BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10279_c0_seq1-m.103 5prime_partial 2-943(+) 314 (+)
         (313 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|409082672|gb|EKM83030.1| hypothetical protein AGABI1DRAFT_536...   234   3e-59   Agaricus bisporus var. burnettii JB137-S8
gi|426200539|gb|EKV50463.1| hypothetical protein AGABI2DRAFT_200...   233   6e-59   Agaricus bisporus var. bisporus H97
gi|393216911|gb|EJD02401.1| PAP2-domain-containing protein [Fomi...   232   1e-58   Fomitiporia mediterranea MF3/22
gi|511000187|gb|EPB81744.1| hypothetical protein HMPREF1544_1153...   230   3e-58   Mucor circinelloides f. circinelloides 1006PhL
gi|384501729|gb|EIE92220.1| hypothetical protein RO3G_17027 [Rhi...   228   2e-57   Rhizopus delemar RA 99-880
gi|395333532|gb|EJF65909.1| acid phosphatase/Vanadium-dependent ...   225   1e-56   Dichomitus squalens LYAD-421 SS1
gi|302692612|ref|XP_003035985.1| hypothetical protein SCHCODRAFT...   221   2e-55   Schizophyllum commune H4-8
gi|170094044|ref|XP_001878243.1| predicted protein [Laccaria bic...   216   6e-54   Laccaria bicolor S238N-H82
gi|471876809|emb|CCO35529.1| putative diacylglycerol pyrophospha...   215   2e-53   Rhizoctonia solani AG-1 IB
gi|390598034|gb|EIN07433.1| PAP2-domain-containing protein [Punc...   213   5e-53   Punctularia strigosozonata HHB-11173 SS5
gi|392558521|gb|EIW51708.1| acid phosphatase/Vanadium-dependent ...   209   9e-52   Trametes versicolor FP-101664 SS1
gi|449547407|gb|EMD38375.1| hypothetical protein CERSUDRAFT_1135...   209   1e-51   Gelatoporia subvermispora B
gi|389748744|gb|EIM89921.1| acid phosphatase/Vanadium-dependent ...   207   3e-51   Stereum hirsutum FP-91666 SS1
gi|392593477|gb|EIW82802.1| PAP2-domain-containing protein [Coni...   203   5e-50   Coniophora puteana RWD-64-598 SS2
gi|358057684|dbj|GAA96449.1| hypothetical protein E5Q_03116 [Mix...   201   2e-49   Mixia osmundae IAM 14324
gi|353237971|emb|CCA69931.1| related to DPP1-diacylglycerol pyro...   200   4e-49   Serendipita indica DSM 11827
gi|511002424|gb|EPB83859.1| hypothetical protein HMPREF1544_0937...   200   5e-49   Mucor circinelloides f. circinelloides 1006PhL
gi|389741682|gb|EIM82870.1| PAP2-domain-containing protein [Ster...   200   5e-49   Stereum hirsutum FP-91666 SS1
gi|501311107|dbj|GAC99833.1| hypothetical protein PHSY_007436 [P...   199   7e-49   Pseudozyma hubeiensis SY62
gi|71020361|ref|XP_760411.1| hypothetical protein UM04264.1 [Ust...   199   7e-49   
gi|343425343|emb|CBQ68879.1| related to DPP1-diacylglycerol pyro...   198   1e-48   Sporisorium reilianum SRZ2
gi|328852334|gb|EGG01481.1| hypothetical protein MELLADRAFT_5008...   197   2e-48   Melampsora larici-populina 98AG31
gi|403415707|emb|CCM02407.1| predicted protein [Fibroporia radic...   194   2e-47   Fibroporia radiculosa
gi|299753976|ref|XP_001833670.2| phosphatidic acid phosphatase t...   191   2e-46   Coprinopsis cinerea okayama7#130
gi|58259405|ref|XP_567115.1| phospholipid metabolism-related pro...   190   5e-46   Cryptococcus neoformans var. neoformans JEC21
gi|321250251|ref|XP_003191744.1| phospholipid metabolism-related...   189   1e-45   Cryptococcus gattii WM276
gi|405118146|gb|AFR92921.1| PAP2 domain-containing protein [Cryp...   188   1e-45   Cryptococcus neoformans var. grubii H99
gi|472586599|gb|EMS24118.1| phosphatidic acid phosphatase type 2...   187   4e-45   Rhodotorula toruloides NP11
gi|505759441|gb|EOR03532.1| hypothetical protein J056_002989 [Wa...   186   5e-45   Wallemia ichthyophaga EXF-994
gi|388855590|emb|CCF50813.1| related to DPP1-diacylglycerol pyro...   184   3e-44   Ustilago hordei
gi|443898366|dbj|GAC75701.1| lipid phosphate phosphatase and rel...   184   3e-44   Moesziomyces antarcticus T-34
gi|406702175|gb|EKD05240.1| phospholipid metabolism-related prot...   184   3e-44   Trichosporon asahii var. asahii CBS 8904
gi|393236172|gb|EJD43722.1| PAP2-domain-containing protein [Auri...   184   4e-44   Auricularia subglabra TFB-10046 SS5
gi|320033145|gb|EFW15094.1| PAP2 domain-containing protein [Cocc...   182   1e-43   Coccidioides posadasii str. Silveira
gi|403176727|ref|XP_003335351.2| hypothetical protein PGTG_17204...   182   1e-43   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|392585424|gb|EIW74763.1| PAP2-domain-containing protein [Coni...   182   1e-43   Coniophora puteana RWD-64-598 SS2
gi|392866891|gb|EAS29927.2| PAP2 domain-containing protein [Cocc...   180   3e-43   
gi|170100609|ref|XP_001881522.1| predicted protein [Laccaria bic...   180   4e-43   Laccaria bicolor S238N-H82
gi|303320775|ref|XP_003070382.1| PAP2 superfamily protein [Cocci...   179   8e-43   Coccidioides posadasii C735 delta SOWgp
gi|401882381|gb|EJT46642.1| phospholipid metabolism-related prot...   179   8e-43   Trichosporon asahii var. asahii CBS 2479
gi|353237970|emb|CCA69930.1| related to DPP1-diacylglycerol pyro...   179   1e-42   Serendipita indica DSM 11827
gi|388579692|gb|EIM20013.1| acid phosphatase/Vanadium-dependent ...   174   2e-41   Wallemia mellicola CBS 633.66
gi|134119096|ref|XP_771783.1| hypothetical protein CNBN2280 [Cry...   174   2e-41   Cryptococcus neoformans var. neoformans B-3501A
gi|58262600|ref|XP_568710.1| phospholipid metabolism-related pro...   174   3e-41   Cryptococcus neoformans var. neoformans JEC21
gi|471874159|emb|CCO36094.1| Phosphatidate phosphatase PPAPDC1A ...   174   3e-41   Rhizoctonia solani AG-1 IB
gi|485917826|gb|EOD44642.1| putative pap2 domain protein [Neofus...   174   3e-41   Neofusicoccum parvum UCRNP2
gi|321265826|ref|XP_003197629.1| phospholipid metabolism-related...   169   9e-40   Cryptococcus gattii WM276
gi|353239149|emb|CCA71071.1| related to DPP1-diacylglycerol pyro...   169   1e-39   Serendipita indica DSM 11827
gi|407916405|gb|EKG09777.1| Phosphatidic acid phosphatase type 2...   169   1e-39   Macrophomina phaseolina MS6
gi|119179105|ref|XP_001241176.1| hypothetical protein CIMG_08339...   167   4e-39   
gi|405123966|gb|AFR98729.1| Ppapdc1 protein [Cryptococcus neofor...   164   3e-38   
gi|242789490|ref|XP_002481370.1| PAP2 domain protein [Talaromyce...   163   5e-38   Talaromyces stipitatus ATCC 10500
gi|328860365|gb|EGG09471.1| hypothetical protein MELLADRAFT_3442...   163   5e-38   Melampsora larici-populina 98AG31
gi|296423609|ref|XP_002841346.1| hypothetical protein [Tuber mel...   162   1e-37   Tuber melanosporum Mel28
gi|121699191|ref|XP_001267939.1| PAP2 domain protein [Aspergillu...   161   2e-37   Aspergillus clavatus NRRL 1
gi|512196496|gb|EPE25332.1| Acid phosphatase/Vanadium-dependent ...   160   3e-37   Glarea lozoyensis ATCC 20868
gi|501752355|emb|CCG83653.1| PAP2 domain protein [Taphrina defor...   160   4e-37   Taphrina deformans PYCC 5710
gi|320039699|gb|EFW21633.1| PAP2 domain-containing protein [Cocc...   160   6e-37   Coccidioides posadasii str. Silveira
gi|392863140|gb|EJB10612.1| PAP2 domain-containing protein, vari...   159   9e-37   
gi|406860901|gb|EKD13958.1| PAP2 domain protein [Marssonina brun...   159   1e-36   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|494834120|gb|EON69846.1| hypothetical protein W97_09109 [Coni...   158   2e-36   Coniosporium apollinis CBS 100218
gi|212534186|ref|XP_002147249.1| PAP2 domain protein [Talaromyce...   157   3e-36   Talaromyces marneffei ATCC 18224
gi|326474141|gb|EGD98150.1| PAP2 domain-containing protein [Tric...   154   2e-35   Trichophyton tonsurans CBS 112818
gi|67523335|ref|XP_659728.1| hypothetical protein AN2124.2 [Aspe...   153   5e-35   Aspergillus nidulans FGSC A4
gi|358367140|dbj|GAA83759.1| PAP2 domain protein [Aspergillus ka...   153   7e-35   Aspergillus kawachii IFO 4308
gi|330947493|ref|XP_003306894.1| hypothetical protein PTT_20194 ...   152   8e-35   Pyrenophora teres f. teres 0-1
gi|317032298|ref|XP_001394521.2| PAP2 domain protein [Aspergillu...   152   1e-34   Aspergillus niger CBS 513.88
gi|358395276|gb|EHK44663.1| Pap2-like protein [Trichoderma atrov...   152   2e-34   Trichoderma atroviride IMI 206040
gi|134079208|emb|CAL00382.1| unnamed protein product [Aspergillu...   151   2e-34   Aspergillus niger
gi|327296185|ref|XP_003232787.1| PAP2 domain-containing protein ...   151   2e-34   Trichophyton rubrum CBS 118892
gi|212540628|ref|XP_002150469.1| PAP2 domain protein [Talaromyce...   151   3e-34   Talaromyces marneffei ATCC 18224
gi|212534188|ref|XP_002147250.1| PAP2 domain protein [Talaromyce...   150   3e-34   Talaromyces marneffei ATCC 18224
gi|451854171|gb|EMD67464.1| hypothetical protein COCSADRAFT_1791...   150   3e-34   Bipolaris sorokiniana ND90Pr
gi|302503135|ref|XP_003013528.1| PAP2 domain protein [Arthroderm...   150   5e-34   Arthroderma benhamiae CBS 112371
gi|296810780|ref|XP_002845728.1| PAP2 domain-containing protein ...   150   5e-34   Arthroderma otae CBS 113480
gi|347831388|emb|CCD47085.1| similar to PAP2 domain-containing p...   150   6e-34   Botrytis cinerea T4
gi|317038184|ref|XP_001401753.2| phosphatidic acid phosphatase [...   150   6e-34   Aspergillus niger CBS 513.88
gi|226292050|gb|EEH47470.1| diacylglycerol pyrophosphate phospha...   149   7e-34   Paracoccidioides brasiliensis Pb18
gi|358366219|dbj|GAA82840.1| PAP2 domain protein [Aspergillus ka...   149   8e-34   Aspergillus kawachii IFO 4308
gi|170100637|ref|XP_001881536.1| predicted protein [Laccaria bic...   149   9e-34   Laccaria bicolor S238N-H82
gi|452000081|gb|EMD92543.1| hypothetical protein COCHEDRAFT_1100...   149   9e-34   Bipolaris maydis C5
gi|295673728|ref|XP_002797410.1| diacylglycerol pyrophosphate ph...   149   1e-33   
gi|242801249|ref|XP_002483723.1| PAP2 domain protein [Talaromyce...   149   1e-33   Talaromyces stipitatus ATCC 10500
gi|350631303|gb|EHA19674.1| hypothetical protein ASPNIDRAFT_5600...   149   1e-33   Aspergillus niger ATCC 1015
gi|392863139|gb|EJB10611.1| PAP2 domain-containing protein [Cocc...   149   1e-33   
gi|451852432|gb|EMD65727.1| hypothetical protein COCSADRAFT_1148...   149   1e-33   Bipolaris sorokiniana ND90Pr
gi|425775486|gb|EKV13754.1| hypothetical protein PDIP_47070 [Pen...   148   1e-33   Penicillium digitatum Pd1
gi|425766320|gb|EKV04936.1| hypothetical protein PDIG_86000 [Pen...   148   1e-33   Penicillium digitatum PHI26
gi|327348655|gb|EGE77512.1| hypothetical protein BDDG_00449 [Aje...   147   3e-33   Blastomyces dermatitidis ATCC 18188
gi|471572212|gb|EMR70745.1| putative pap2 superfamily protein [E...   147   3e-33   Eutypa lata UCREL1
gi|462422633|gb|EMJ26896.1| hypothetical protein PRUPE_ppa008624...   147   3e-33   Prunus persica
gi|238602578|ref|XP_002395717.1| hypothetical protein MPER_04183...   147   4e-33   
gi|396470303|ref|XP_003838611.1| similar to lipid phosphate phos...   147   4e-33   Leptosphaeria maculans JN3
gi|255942779|ref|XP_002562158.1| Pc18g03180 [Penicillium chrysog...   147   5e-33   Penicillium rubens Wisconsin 54-1255
gi|402218896|gb|EJT98971.1| PAP2-domain-containing protein [Dacr...   146   6e-33   Dacryopinax primogenitus
gi|189202966|ref|XP_001937819.1| lipid phosphate phosphatase 1 [...   146   7e-33   Pyrenophora tritici-repentis Pt-1C-BFP
gi|156047531|ref|XP_001589784.1| hypothetical protein SS1G_09506...   146   7e-33   Sclerotinia sclerotiorum 1980 UF-70
gi|402079808|gb|EJT75073.1| hypothetical protein GGTG_08911 [Gae...   146   8e-33   Gaeumannomyces graminis var. tritici R3-111a-1
gi|340915046|gb|EGS18387.1| hypothetical protein CTHT_0064120 [C...   145   1e-32   Chaetomium thermophilum var. thermophilum DSM 1495
gi|46121977|ref|XP_385542.1| hypothetical protein FG05366.1 [Fus...   145   1e-32   
gi|310795928|gb|EFQ31389.1| PAP2 superfamily protein [Glomerella...   145   2e-32   Colletotrichum graminicola M1.001
gi|358389240|gb|EHK26832.1| hypothetical protein TRIVIDRAFT_7290...   145   2e-32   Trichoderma virens Gv29-8
gi|470126109|ref|XP_004299036.1| PREDICTED: putative lipid phosp...   144   2e-32   Fragaria vesca subsp. vesca
gi|470130769|ref|XP_004301275.1| PREDICTED: lipid phosphate phos...   144   3e-32   
gi|408391143|gb|EKJ70525.1| hypothetical protein FPSE_09278 [Fus...   144   3e-32   Fusarium pseudograminearum CS3096
gi|238491364|ref|XP_002376919.1| phosphatidic acid phosphatase, ...   144   4e-32   Aspergillus flavus NRRL3357
gi|255946483|ref|XP_002564009.1| Pc20g15370 [Penicillium chrysog...   143   6e-32   Penicillium rubens Wisconsin 54-1255
gi|477527939|gb|ENH79731.1| pap2 domain protein [Colletotrichum ...   143   6e-32   Colletotrichum orbiculare MAFF 240422
gi|302890273|ref|XP_003044021.1| predicted protein [Nectria haem...   142   1e-31   Nectria haematococca mpVI 77-13-4
gi|317145915|ref|XP_001821158.2| phosphatidic acid phosphatase [...   142   1e-31   Aspergillus oryzae RIB40
gi|451997242|gb|EMD89707.1| hypothetical protein COCHEDRAFT_1177...   142   1e-31   Bipolaris maydis C5
gi|470126107|ref|XP_004299035.1| PREDICTED: lipid phosphate phos...   142   2e-31   
gi|462411842|gb|EMJ16891.1| hypothetical protein PRUPE_ppa008752...   142   2e-31   Prunus persica
gi|462405795|gb|EMJ11259.1| hypothetical protein PRUPE_ppa018484...   142   2e-31   Prunus persica
gi|239611335|gb|EEQ88322.1| PAP2 domain-containing protein [Ajel...   141   2e-31   
gi|115434438|ref|NP_001041977.1| Os01g0139600 [Oryza sativa Japo...   141   2e-31   
gi|225557388|gb|EEH05674.1| PAP2 domain-containing protein [Ajel...   141   3e-31   Histoplasma capsulatum G186AR
gi|330940962|ref|XP_003306009.1| hypothetical protein PTT_19016 ...   140   3e-31   Pyrenophora teres f. teres 0-1
gi|443925824|gb|ELU44586.1| oligosaccharyl transferase subunit O...   140   3e-31   Rhizoctonia solani AG-1 IA
gi|429852094|gb|ELA27245.1| pap2 domain protein [Colletotrichum ...   140   3e-31   Colletotrichum gloeosporioides Nara gc5
gi|508708142|gb|EOY00039.1| Lipid phosphate phosphatase 2 isofor...   140   4e-31   Theobroma cacao [chocolate]
gi|327302378|ref|XP_003235881.1| PAP2 domain-containing protein ...   140   4e-31   Trichophyton rubrum CBS 118892
gi|392576709|gb|EIW69839.1| hypothetical protein TREMEDRAFT_6160...   140   5e-31   Tremella mesenterica DSM 1558
gi|508708139|gb|EOY00036.1| Lipid phosphate phosphatase 2 isofor...   140   5e-31   Theobroma cacao [chocolate]
gi|508708140|gb|EOY00037.1| Lipid phosphate phosphatase 2 isofor...   140   5e-31   Theobroma cacao [chocolate]
gi|477521628|gb|ENH73712.1| Diacylglycerol pyrophosphate phospha...   140   6e-31   Fusarium oxysporum f. sp. cubense race 1
gi|460386404|ref|XP_004238888.1| PREDICTED: lipid phosphate phos...   139   7e-31   Solanum lycopersicum
gi|325096092|gb|EGC49402.1| PAP2 domain-containing protein [Ajel...   139   9e-31   Histoplasma capsulatum H88
gi|224111600|ref|XP_002315916.1| predicted protein [Populus tric...   139   1e-30   Populus trichocarpa [western balsam poplar]
gi|169612053|ref|XP_001799444.1| hypothetical protein SNOG_09142...   139   1e-30   Parastagonospora nodorum SN15
gi|67522429|ref|XP_659275.1| hypothetical protein AN1671.2 [Aspe...   139   1e-30   Aspergillus nidulans FGSC A4
gi|453088448|gb|EMF16488.1| acid phosphatase/Vanadium-dependent ...   139   1e-30   Sphaerulina musiva SO2202
gi|296813831|ref|XP_002847253.1| PAP2 domain-containing protein ...   139   1e-30   Arthroderma otae CBS 113480
gi|508773877|gb|EOY21133.1| Lipid phosphate phosphatase 2 [Theob...   138   2e-30   Theobroma cacao [chocolate]
gi|400598336|gb|EJP66053.1| PAP2 superfamily protein [Beauveria ...   138   2e-30   Beauveria bassiana ARSEF 2860
gi|115439331|ref|NP_001043945.1| Os01g0693300 [Oryza sativa Japo...   138   2e-30   
gi|194694718|gb|ACF81443.1| unknown [Zea mays] >gi|195607996|gb|...   138   2e-30   Zea mays [maize]
gi|154274686|ref|XP_001538194.1| conserved hypothetical protein ...   138   2e-30   Histoplasma capsulatum NAm1
gi|340514373|gb|EGR44636.1| hypothetical protein TRIREDRAFT_6985...   138   2e-30   Trichoderma reesei QM6a
gi|448082153|ref|XP_004195066.1| Piso0_005607 [Millerozyma farin...   137   3e-30   Millerozyma farinosa CBS 7064
gi|482812402|gb|EOA89121.1| hypothetical protein SETTUDRAFT_1595...   137   3e-30   Setosphaeria turcica Et28A
gi|336466569|gb|EGO54734.1| hypothetical protein NEUTE1DRAFT_141...   137   3e-30   Neurospora tetrasperma FGSC 2508
gi|218187478|gb|EEC69905.1| hypothetical protein OsI_00314 [Oryz...   137   3e-30   Oryza sativa Indica Group [Indian rice]
gi|238883401|gb|EEQ47039.1| hypothetical protein CAWG_05594 [Can...   137   3e-30   Candida albicans WO-1
gi|225681234|gb|EEH19518.1| diacylglycerol pyrophosphate phospha...   137   4e-30   
gi|68469030|ref|XP_721302.1| hypothetical protein CaO19.6459 [Ca...   137   4e-30   Candida albicans SC5314
gi|326500976|dbj|BAJ95154.1| predicted protein [Hordeum vulgare ...   137   4e-30   Hordeum vulgare subsp. vulgare [barley]
gi|115478468|ref|NP_001062829.1| Os09g0308900 [Oryza sativa Japo...   137   5e-30   
gi|116787331|gb|ABK24466.1| unknown [Picea sitchensis]                137   5e-30   Picea sitchensis
gi|226507286|ref|NP_001141145.1| lipid phosphate phosphatase 3 i...   136   7e-30   Zea mays [maize]
gi|218201893|gb|EEC84320.1| hypothetical protein OsI_30819 [Oryz...   136   7e-30   Oryza sativa Indica Group [Indian rice]
gi|195653563|gb|ACG46249.1| lipid phosphate phosphatase 3 [Zea m...   136   8e-30   Zea mays [maize]
gi|297844410|ref|XP_002890086.1| ATPAP2 [Arabidopsis lyrata subs...   136   8e-30   Arabidopsis lyrata subsp. lyrata
gi|195624942|gb|ACG34301.1| lipid phosphate phosphatase 3 [Zea m...   136   8e-30   Zea mays [maize]
gi|218201024|gb|EEC83451.1| hypothetical protein OsI_28949 [Oryz...   136   8e-30   Oryza sativa Indica Group [Indian rice]
gi|500257193|gb|EOO00375.1| putative pap2 superfamily protein [T...   136   9e-30   Phaeoacremonium minimum UCRPA7
gi|148910218|gb|ABR18190.1| unknown [Picea sitchensis]                136   9e-30   Picea sitchensis
gi|194693160|gb|ACF80664.1| unknown [Zea mays] >gi|414870668|tpg...   136   9e-30   Zea mays [maize]
gi|242096386|ref|XP_002438683.1| hypothetical protein SORBIDRAFT...   136   9e-30   Sorghum bicolor [broomcorn]
gi|195636994|gb|ACG37965.1| lipid phosphate phosphatase 3 [Zea m...   136   9e-30   Zea mays [maize]
gi|475599288|gb|EMT24205.1| Putative lipid phosphate phosphatase...   135   1e-29   Aegilops tauschii
gi|15218051|ref|NP_172961.1| lipid phosphate phosphatase 2 [Arab...   135   1e-29   Arabidopsis thaliana [mouse-ear cress]
gi|315040614|ref|XP_003169684.1| diacylglycerol pyrophosphate ph...   135   1e-29   Microsporum gypseum CBS 118893
gi|512186343|gb|EPE02139.1| pap2 superfamily protein [Ophiostoma...   135   1e-29   Ophiostoma piceae UAMH 11346
gi|297737764|emb|CBI26965.3| unnamed protein product [Vitis vini...   135   1e-29   Vitis vinifera
gi|425769181|gb|EKV07682.1| hypothetical protein PDIP_72740 [Pen...   135   1e-29   Penicillium digitatum Pd1
gi|378731650|gb|EHY58109.1| PAP2 domain-containing protein [Exop...   135   1e-29   Exophiala dermatitidis NIH/UT8656
gi|389636133|ref|XP_003715719.1| diacylglycerol pyrophosphate ph...   135   1e-29   Magnaporthe oryzae 70-15
gi|357145826|ref|XP_003573780.1| PREDICTED: putative lipid phosp...   135   1e-29   Brachypodium distachyon [annual false brome]
gi|359472919|ref|XP_002282839.2| PREDICTED: putative lipid phosp...   135   1e-29   Vitis vinifera
gi|222640424|gb|EEE68556.1| hypothetical protein OsJ_27038 [Oryz...   135   2e-29   Oryza sativa Japonica Group [Japonica rice]
gi|242091283|ref|XP_002441474.1| hypothetical protein SORBIDRAFT...   135   2e-29   Sorghum bicolor [broomcorn]
gi|115476064|ref|NP_001061628.1| Os08g0359100 [Oryza sativa Japo...   135   2e-29   
gi|356569496|ref|XP_003552936.1| PREDICTED: lipid phosphate phos...   135   2e-29   Glycine max [soybeans]
gi|359472921|ref|XP_003631216.1| PREDICTED: putative lipid phosp...   135   2e-29   
gi|225424095|ref|XP_002282854.1| PREDICTED: lipid phosphate phos...   135   2e-29   Vitis vinifera
gi|115476066|ref|NP_001061629.1| Os08g0359200 [Oryza sativa Japo...   135   2e-29   
gi|119471100|ref|XP_001258128.1| PAP2 domain protein [Neosartory...   134   2e-29   Aspergillus fischeri NRRL 181
gi|258577633|ref|XP_002542998.1| conserved hypothetical protein ...   134   2e-29   Uncinocarpus reesii 1704
gi|410079713|ref|XP_003957437.1| hypothetical protein KAFR_0E014...   134   2e-29   Kazachstania africana CBS 2517
gi|462424643|gb|EMJ28906.1| hypothetical protein PRUPE_ppa008175...   134   3e-29   Prunus persica
gi|241950025|ref|XP_002417735.1| DGPP phosphatase, putative; dia...   134   3e-29   Candida dubliniensis CD36
gi|502129835|ref|XP_004500441.1| PREDICTED: lipid phosphate phos...   134   3e-29   Cicer arietinum [garbanzo]
gi|315051566|ref|XP_003175157.1| PAP2 domain-containing protein ...   134   3e-29   Microsporum gypseum CBS 118893
gi|326491437|dbj|BAJ94196.1| predicted protein [Hordeum vulgare ...   134   4e-29   Hordeum vulgare subsp. vulgare [barley]
gi|226500530|ref|NP_001152212.1| lipid phosphate phosphatase 3 [...   134   4e-29   Zea mays [maize]
gi|190347010|gb|EDK39216.2| hypothetical protein PGUG_03314 [Mey...   134   4e-29   Meyerozyma guilliermondii ATCC 6260
gi|414884960|tpg|DAA60974.1| TPA: lipid phosphate phosphatase 3 ...   134   4e-29   Zea mays [maize]
gi|350397056|ref|XP_003484756.1| PREDICTED: phosphatidate phosph...   134   4e-29   
gi|340725842|ref|XP_003401274.1| PREDICTED: phosphatidate phosph...   134   4e-29   Bombus terrestris [large earth bumblebee]
gi|195611848|gb|ACG27754.1| lipid phosphate phosphatase 3 [Zea m...   133   5e-29   Zea mays [maize]
gi|226528214|ref|NP_001146751.1| uncharacterized protein LOC1002...   133   5e-29   Zea mays [maize]
gi|223943131|gb|ACN25649.1| unknown [Zea mays] >gi|413946370|gb|...   133   6e-29   Zea mays [maize]
gi|116788989|gb|ABK25074.1| unknown [Picea sitchensis]                133   6e-29   Picea sitchensis
gi|328783604|ref|XP_623887.2| PREDICTED: phosphatidate phosphata...   133   7e-29   Apis mellifera [European honey bee]
gi|414870667|tpg|DAA49224.1| TPA: hypothetical protein ZEAMMB73_...   133   7e-29   Zea mays [maize]
gi|171682780|ref|XP_001906333.1| hypothetical protein [Podospora...   133   7e-29   Podospora anserina S mat+
gi|357157977|ref|XP_003577977.1| PREDICTED: lipid phosphate phos...   133   7e-29   Brachypodium distachyon [annual false brome]
gi|449303736|gb|EMC99743.1| hypothetical protein BAUCODRAFT_1193...   133   8e-29   Baudoinia panamericana UAMH 10762
gi|302659979|ref|XP_003021674.1| PAP2 domain protein [Trichophyt...   132   8e-29   Trichophyton verrucosum HKI 0517
gi|357136024|ref|XP_003569606.1| PREDICTED: putative lipid phosp...   132   8e-29   
gi|482572743|gb|EOA36930.1| hypothetical protein CARUB_v10009800...   132   9e-29   Capsella rubella
gi|367029241|ref|XP_003663904.1| hypothetical protein MYCTH_5264...   132   9e-29   Myceliophthora thermophila ATCC 42464
gi|146415927|ref|XP_001483933.1| hypothetical protein PGUG_03314...   132   9e-29   Meyerozyma guilliermondii ATCC 6260
gi|54290302|dbj|BAD61302.1| phosphatidic acid phosphata -like [O...   132   9e-29   Oryza sativa Japonica Group [Japonica rice]
gi|374671175|gb|AEZ56253.1| phosphatidate phosphatase [Jatropha ...   132   1e-28   Jatropha curcas
gi|308044341|ref|NP_001183694.1| uncharacterized protein LOC1005...   132   1e-28   Zea mays [maize]
gi|119500738|ref|XP_001267126.1| PAP2 domain protein [Neosartory...   132   1e-28   Aspergillus fischeri NRRL 181
gi|255574320|ref|XP_002528074.1| phosphatidic acid phosphatase, ...   132   1e-28   Ricinus communis
gi|50305447|ref|XP_452683.1| hypothetical protein [Kluyveromyces...   132   1e-28   Kluyveromyces lactis NRRL Y-1140
gi|449434588|ref|XP_004135078.1| PREDICTED: lipid phosphate phos...   132   1e-28   Cucumis sativus [cucumbers]
gi|168011250|ref|XP_001758316.1| predicted protein [Physcomitrel...   132   2e-28   Physcomitrella patens
gi|449520859|ref|XP_004167450.1| PREDICTED: lipid phosphate phos...   132   2e-28   
gi|346327453|gb|EGX97049.1| PAP2 domain protein [Cordyceps milit...   132   2e-28   Cordyceps militaris CM01
gi|255570669|ref|XP_002526289.1| ER Phosphatidate Phosphatase [R...   132   2e-28   Ricinus communis
gi|473914779|gb|EMS49700.1| Putative lipid phosphate phosphatase...   132   2e-28   Triticum urartu
gi|474367375|gb|EMS63579.1| Putative lipid phosphate phosphatase...   132   2e-28   Triticum urartu
gi|508708143|gb|EOY00040.1| Lipid phosphate phosphatase 2 isofor...   131   2e-28   Theobroma cacao [chocolate]
gi|501751832|emb|CCG84068.1| protein of unknown function [Taphri...   131   2e-28   Taphrina deformans PYCC 5710
gi|357130661|ref|XP_003566966.1| PREDICTED: putative lipid phosp...   131   2e-28   
gi|357508201|ref|XP_003624389.1| Lipid phosphate phosphatase [Me...   131   2e-28   
gi|475502190|gb|EMT04406.1| Putative lipid phosphate phosphatase...   131   2e-28   Aegilops tauschii
gi|336268735|ref|XP_003349130.1| hypothetical protein SMAC_12097...   131   2e-28   Sordaria macrospora k-hell
gi|238878437|gb|EEQ42075.1| hypothetical protein CAWG_00273 [Can...   131   2e-28   Candida albicans WO-1
gi|68486075|ref|XP_713054.1| hypothetical protein CaO19.8747 [Ca...   131   2e-28   Candida albicans SC5314
gi|449441718|ref|XP_004138629.1| PREDICTED: putative lipid phosp...   131   3e-28   Cucumis sativus [cucumbers]
gi|367039689|ref|XP_003650225.1| hypothetical protein THITE_2109...   131   3e-28   Thielavia terrestris NRRL 8126
gi|19112260|ref|NP_595468.1| phosphatidic acid phosphatase (pred...   131   3e-28   Schizosaccharomyces pombe 972h-
gi|365984939|ref|XP_003669302.1| hypothetical protein NDAI_0C039...   131   3e-28   Naumovozyma dairenensis CBS 421
gi|356530711|ref|XP_003533924.1| PREDICTED: lipid phosphate phos...   130   3e-28   Glycine max [soybeans]
gi|359491469|ref|XP_002277246.2| PREDICTED: lipid phosphate phos...   130   3e-28   Vitis vinifera
gi|255718079|ref|XP_002555320.1| KLTH0G06490p [Lachancea thermot...   130   3e-28   Lachancea thermotolerans CBS 6340
gi|388513345|gb|AFK44734.1| unknown [Medicago truncatula]             130   3e-28   Medicago truncatula
gi|116203059|ref|XP_001227341.1| hypothetical protein CHGG_09414...   130   3e-28   Chaetomium globosum CBS 148.51
gi|485928963|gb|EOD52517.1| putative mfs multidrug protein [Neof...   130   4e-28   Neofusicoccum parvum UCRNP2
gi|448086685|ref|XP_004196160.1| Piso0_005607 [Millerozyma farin...   130   4e-28   Millerozyma farinosa CBS 7064
gi|494825341|gb|EON62527.1| hypothetical protein W97_01750 [Coni...   130   5e-28   Coniosporium apollinis CBS 100218
gi|213405583|ref|XP_002173563.1| phosphatidic acid phosphatase t...   130   6e-28   
gi|353249916|ref|NP_001085524.2| phosphatidate phosphatase PPAPD...   130   6e-28   Xenopus laevis [clawed frog]
gi|146414978|ref|XP_001483459.1| hypothetical protein PGUG_04188...   130   6e-28   Meyerozyma guilliermondii ATCC 6260
gi|317145537|ref|XP_001820873.2| PAP2 domain protein [Aspergillu...   130   6e-28   Aspergillus oryzae RIB40
gi|168052537|ref|XP_001778706.1| predicted protein [Physcomitrel...   129   7e-28   Physcomitrella patens
gi|384096918|gb|AFH66947.1| prenyl diphosphate phosphatase [Crot...   129   8e-28   Croton stellatopilosus
gi|502120646|ref|XP_004497034.1| PREDICTED: lipid phosphate phos...   129   9e-28   Cicer arietinum [garbanzo]
gi|325088142|gb|EGC41452.1| PAP2 domain-containing protein [Ajel...   129   9e-28   Histoplasma capsulatum H88
gi|357480765|ref|XP_003610668.1| Lipid phosphate phosphatase [Me...   129   9e-28   Medicago truncatula
gi|296087241|emb|CBI33615.3| unnamed protein product [Vitis vini...   129   1e-27   Vitis vinifera
gi|363750550|ref|XP_003645492.1| hypothetical protein Ecym_3174 ...   129   1e-27   Eremothecium cymbalariae DBVPG#7215
gi|502120649|ref|XP_004497035.1| PREDICTED: putative lipid phosp...   129   1e-27   
gi|70992087|ref|XP_750892.1| PAP2 domain protein [Aspergillus fu...   129   1e-27   Aspergillus fumigatus Af293
gi|21554001|gb|AAM63082.1| putative phosphatidic acid phosphatas...   129   1e-27   Arabidopsis thaliana [mouse-ear cress]
gi|383866165|ref|XP_003708541.1| PREDICTED: phosphatidate phosph...   129   1e-27   
gi|359488161|ref|XP_002281072.2| PREDICTED: putative lipid phosp...   129   1e-27   
gi|460386408|ref|XP_004238890.1| PREDICTED: putative lipid phosp...   129   1e-27   Solanum lycopersicum
gi|42570631|ref|NP_973389.1| lipid phosphate phosphatase 1 [Arab...   129   1e-27   Arabidopsis thaliana [mouse-ear cress]
gi|225559083|gb|EEH07366.1| PAP2 domain-containing protein [Ajel...   129   1e-27   Histoplasma capsulatum G186AR
gi|15724220|gb|AAL06503.1|AF412050_1 At2g01180/F10A8.6 [Arabidop...   129   1e-27   Arabidopsis thaliana [mouse-ear cress]
gi|460383053|ref|XP_004237248.1| PREDICTED: putative lipid phosp...   128   2e-27   
gi|190345629|gb|EDK37549.2| hypothetical protein PGUG_01647 [Mey...   128   2e-27   Meyerozyma guilliermondii ATCC 6260
gi|18379166|ref|NP_565255.1| lipid phosphate phosphatase 1 [Arab...   128   2e-27   Arabidopsis thaliana [mouse-ear cress]
gi|297817704|ref|XP_002876735.1| ATPAP1 [Arabidopsis lyrata subs...   128   2e-27   Arabidopsis lyrata subsp. lyrata
gi|189230308|ref|NP_001121478.1| phosphatidic acid phosphatase t...   128   2e-27   Xenopus tropicalis [western clawed frog]
gi|218188805|gb|EEC71232.1| hypothetical protein OsI_03180 [Oryz...   128   2e-27   Oryza sativa Indica Group [Indian rice]
gi|399169504|emb|CCE29752.1| probable DPP1-diacylglycerol pyroph...   128   2e-27   Claviceps purpurea 20.1
gi|474400309|gb|EMS65998.1| Putative lipid phosphate phosphatase...   128   2e-27   Triticum urartu
gi|190347755|gb|EDK40090.2| hypothetical protein PGUG_04188 [Mey...   128   2e-27   Meyerozyma guilliermondii ATCC 6260
gi|482566703|gb|EOA30892.1| hypothetical protein CARUB_v10014038...   128   2e-27   Capsella rubella
gi|381141440|gb|AFF57761.1| lipid phosphate phosphatase [Nicotia...   128   2e-27   Nicotiana tabacum [American tobacco]
gi|356499612|ref|XP_003518632.1| PREDICTED: putative lipid phosp...   128   2e-27   Glycine max [soybeans]
gi|482559073|gb|EOA23264.1| hypothetical protein CARUB_v10017628...   128   2e-27   Capsella rubella
gi|358248122|ref|NP_001239819.1| uncharacterized protein LOC1008...   128   2e-27   Glycine max [soybeans]
gi|356499614|ref|XP_003518633.1| PREDICTED: putative lipid phosp...   127   3e-27   Glycine max [soybeans]
gi|168058184|ref|XP_001781090.1| predicted protein [Physcomitrel...   127   3e-27   Physcomitrella patens
gi|459368631|gb|EMG47288.1| hypothetical protein G210_2402 [Cand...   127   3e-27   Candida maltosa Xu316
gi|224069557|ref|XP_002302998.1| predicted protein [Populus tric...   127   3e-27   
gi|223944447|gb|ACN26307.1| unknown [Zea mays] >gi|413947357|gb|...   127   3e-27   Zea mays [maize]
gi|475510448|gb|EMT05281.1| Putative lipid phosphate phosphatase...   127   3e-27   Aegilops tauschii
gi|326525375|dbj|BAK07957.1| predicted protein [Hordeum vulgare ...   127   3e-27   Hordeum vulgare subsp. vulgare [barley]
gi|291244903|ref|XP_002742339.1| PREDICTED: phosphatidic acid ph...   127   3e-27   Saccoglossus kowalevskii
gi|241957445|ref|XP_002421442.1| diacylglycerol pyrophosphate (D...   127   3e-27   
gi|414589313|tpg|DAA39884.1| TPA: hypothetical protein ZEAMMB73_...   127   3e-27   
gi|449434594|ref|XP_004135081.1| PREDICTED: putative lipid phosp...   127   4e-27   
gi|482567666|gb|EOA31855.1| hypothetical protein CARUB_v10015082...   127   4e-27   
gi|474077511|gb|EMS54602.1| Putative lipid phosphate phosphatase...   127   4e-27   
gi|332031707|gb|EGI71133.1| Phosphatidic acid phosphatase type 2...   127   4e-27   
gi|51091485|dbj|BAD36224.1| putative phosphatidic acid phosphata...   127   5e-27   
gi|225424091|ref|XP_002282847.1| PREDICTED: putative lipid phosp...   127   5e-27   
gi|255570667|ref|XP_002526288.1| phosphatidic acid phosphatase, ...   127   5e-27   
gi|297737766|emb|CBI26967.3| unnamed protein product [Vitis vini...   127   5e-27   
gi|357133367|ref|XP_003568296.1| PREDICTED: putative lipid phosp...   126   6e-27   
gi|126137587|ref|XP_001385317.1| diacylglycerol pyrophosphate ph...   126   6e-27   
gi|115439037|ref|NP_001043798.1| Os01g0666000 [Oryza sativa Japo...   126   7e-27   
gi|363807094|ref|NP_001242078.1| uncharacterized protein LOC1007...   126   7e-27   
gi|354543193|emb|CCE39911.1| hypothetical protein CPAR2_603300 [...   126   7e-27   
gi|449520861|ref|XP_004167451.1| PREDICTED: putative lipid phosp...   126   8e-27   
gi|9621903|gb|AAF89579.1|AF165891_1 phosphatidic acid phosphatas...   126   9e-27   
gi|448510604|ref|XP_003866383.1| Dpp2 protein [Candida orthopsil...   126   9e-27   
gi|297734255|emb|CBI15502.3| unnamed protein product [Vitis vini...   126   1e-26   
gi|348527168|ref|XP_003451091.1| PREDICTED: phosphatidate phosph...   126   1e-26   
gi|502106518|ref|XP_004492968.1| PREDICTED: putative lipid phosp...   125   1e-26   
gi|508712206|gb|EOY04103.1| Lipid phosphate phosphatase 3 isofor...   125   1e-26   
gi|294658716|ref|XP_461050.2| DEHA2F15884p [Debaryomyces hanseni...   125   1e-26   
gi|255567804|ref|XP_002524880.1| phosphatidic acid phosphatase, ...   125   1e-26   
gi|502106527|ref|XP_004492971.1| PREDICTED: putative lipid phosp...   125   1e-26   
gi|146420035|ref|XP_001485976.1| hypothetical protein PGUG_01647...   125   1e-26   
gi|502106524|ref|XP_004492970.1| PREDICTED: putative lipid phosp...   125   1e-26   
gi|197245532|gb|AAI68452.1| LOC100158576 protein [Xenopus (Silur...   125   1e-26   
gi|118481125|gb|ABK92516.1| unknown [Populus trichocarpa]             125   1e-26   
gi|396494595|ref|XP_003844342.1| similar to PAP2 domain-containi...   125   1e-26   
gi|508712205|gb|EOY04102.1| Lipid phosphate phosphatase 3 isofor...   125   1e-26   
gi|345571514|gb|EGX54328.1| hypothetical protein AOL_s00004g361 ...   125   1e-26   
gi|344229663|gb|EGV61548.1| PAP2-domain-containing protein [Cand...   125   1e-26   
gi|452846543|gb|EME48475.1| hypothetical protein DOTSEDRAFT_1415...   125   1e-26   
gi|508712203|gb|EOY04100.1| Lipid phosphate phosphatase 3 isofor...   125   1e-26   
gi|508712199|gb|EOY04096.1| Lipid phosphate phosphatase 3 isofor...   125   1e-26   
gi|380490900|emb|CCF35696.1| PAP2 superfamily protein [Colletotr...   125   1e-26   
gi|508712201|gb|EOY04098.1| Lipid phosphate phosphatase 3 isofor...   125   2e-26   
gi|508712204|gb|EOY04101.1| Lipid phosphate phosphatase 3 isofor...   125   2e-26   
gi|498969169|ref|XP_004547097.1| PREDICTED: phosphatidate phosph...   125   2e-26   
gi|344302135|gb|EGW32440.1| vacuolar diacylglycerol pyrophosphat...   125   2e-26   
gi|224111602|ref|XP_002315917.1| predicted protein [Populus tric...   125   2e-26   
gi|482804446|gb|EOA81558.1| hypothetical protein SETTUDRAFT_1659...   125   2e-26   
gi|508712202|gb|EOY04099.1| Lipid phosphate phosphatase 3 isofor...   125   2e-26   
gi|414870670|tpg|DAA49227.1| TPA: hypothetical protein ZEAMMB73_...   124   2e-26   
gi|414884963|tpg|DAA60977.1| TPA: hypothetical protein ZEAMMB73_...   124   3e-26   
gi|307203815|gb|EFN82751.1| Phosphatidic acid phosphatase type 2...   124   3e-26   
gi|507620422|ref|XP_004696565.1| PREDICTED: phosphatidate phosph...   124   3e-26   
gi|225679856|gb|EEH18140.1| conserved hypothetical protein [Para...   124   3e-26   
gi|242096360|ref|XP_002438670.1| hypothetical protein SORBIDRAFT...   124   3e-26   
gi|145331738|ref|NP_001078096.1| lipid phosphate phosphatase 3 [...   124   3e-26   
gi|327356980|gb|EGE85837.1| PAP2 domain-containing protein [Ajel...   124   3e-26   
gi|242058259|ref|XP_002458275.1| hypothetical protein SORBIDRAFT...   124   3e-26   
gi|344281375|ref|XP_003412455.1| PREDICTED: phosphatidate phosph...   124   3e-26   
gi|363807748|ref|NP_001242173.1| uncharacterized protein LOC1008...   124   4e-26   
gi|321460104|gb|EFX71150.1| hypothetical protein DAPPUDRAFT_2169...   124   4e-26   
gi|513220669|ref|XP_001234075.3| PREDICTED: phosphatidate phosph...   124   4e-26   
gi|308198170|ref|XP_001386887.2| vacuolar diacylglycerol pyropho...   124   4e-26   
gi|18396250|ref|NP_566177.1| lipid phosphate phosphatase 3 [Arab...   124   4e-26   
gi|296416523|ref|XP_002837927.1| hypothetical protein [Tuber mel...   124   5e-26   
gi|326932765|ref|XP_003212483.1| PREDICTED: phosphatidate phosph...   124   5e-26   
gi|344299751|gb|EGW30104.1| diacylglycerol pyrophosphate phospha...   123   5e-26   
gi|440637273|gb|ELR07192.1| hypothetical protein GMDG_02419 [Geo...   123   5e-26   
gi|145331736|ref|NP_001078095.1| lipid phosphate phosphatase 3 [...   123   6e-26   
gi|512879511|ref|XP_002937854.2| PREDICTED: phosphatidate phosph...   123   6e-26   
gi|242008597|ref|XP_002425089.1| Lipid phosphate phosphatase, pu...   123   6e-26   
gi|357458111|ref|XP_003599336.1| Lipid phosphate phosphatase [Me...   123   6e-26   
gi|322798116|gb|EFZ19955.1| hypothetical protein SINV_14927 [Sol...   123   8e-26   
gi|502120655|ref|XP_004497037.1| PREDICTED: putative lipid phosp...   123   8e-26   
gi|448534223|ref|XP_003870778.1| hypothetical protein CORT_0F042...   123   8e-26   
gi|50345080|ref|NP_001002211.1| phosphatidate phosphatase PPAPDC...   123   8e-26   
gi|297830476|ref|XP_002883120.1| hypothetical protein ARALYDRAFT...   122   9e-26   
gi|366994652|ref|XP_003677090.1| hypothetical protein NCAS_0F025...   122   9e-26   
gi|224099413|ref|XP_002311475.1| predicted protein [Populus tric...   122   9e-26   
gi|222632466|gb|EEE64598.1| hypothetical protein OsJ_19450 [Oryz...   122   9e-26   
gi|224077206|ref|XP_002305178.1| predicted protein [Populus tric...   122   1e-25   
gi|508708146|gb|EOY00043.1| Phosphatidic acid phosphatase 1 isof...   122   1e-25   
gi|357132672|ref|XP_003567953.1| PREDICTED: lipid phosphate phos...   122   1e-25   
gi|255727592|ref|XP_002548722.1| hypothetical protein CTRG_03019...   122   1e-25   
gi|508708148|gb|EOY00045.1| Phosphatidic acid phosphatase 1 isof...   122   1e-25   
gi|508708147|gb|EOY00044.1| Phosphatidic acid phosphatase 1 isof...   122   1e-25   
gi|475576858|gb|EMT17665.1| Putative lipid phosphate phosphatase...   122   1e-25   
gi|115465277|ref|NP_001056238.1| Os05g0549900 [Oryza sativa Japo...   122   1e-25   
gi|149234966|ref|XP_001523362.1| hypothetical protein LELG_05588...   122   1e-25   
gi|125553213|gb|EAY98922.1| hypothetical protein OsI_20877 [Oryz...   122   2e-25   
gi|505796250|ref|XP_004606988.1| PREDICTED: phosphatidate phosph...   122   2e-25   
gi|156538469|ref|XP_001606612.1| PREDICTED: phosphatidate phosph...   121   2e-25   
gi|328352901|emb|CCA39299.1| putative membrane protein [Komagata...   121   2e-25   
gi|448098408|ref|XP_004198920.1| Piso0_002315 [Millerozyma farin...   121   2e-25   
gi|84663863|gb|ABC60344.1| putative phosphaticid acid phosphatas...   121   2e-25   
gi|448102309|ref|XP_004199771.1| Piso0_002315 [Millerozyma farin...   121   3e-25   
gi|9279656|dbj|BAB01172.1| phosphatidic acid phosphatase-like pr...   121   3e-25   
gi|50288839|ref|XP_446849.1| hypothetical protein [Candida glabr...   121   3e-25   
gi|353234524|emb|CCA66548.1| related to DPP1-diacylglycerol pyro...   121   3e-25   
gi|475624609|gb|EMT32686.1| Putative lipid phosphate phosphatase...   120   3e-25   
gi|354472089|ref|XP_003498273.1| PREDICTED: phosphatidate phosph...   120   4e-25   
gi|511976517|ref|XP_004806190.1| PREDICTED: phosphatidate phosph...   120   4e-25   
gi|478509288|ref|XP_004428922.1| PREDICTED: phosphatidate phosph...   120   4e-25   
gi|356534342|ref|XP_003535715.1| PREDICTED: lipid phosphate phos...   120   4e-25   
gi|21593222|gb|AAM65171.1| diacylglycerol pyrophosphate phosphat...   120   5e-25   
gi|18401811|ref|NP_566602.1| phosphatidic acid phosphatase (PAP2...   120   5e-25   
gi|460373037|ref|XP_004232329.1| PREDICTED: putative lipid phosp...   120   5e-25   
gi|511876590|ref|XP_004758278.1| PREDICTED: phosphatidate phosph...   120   5e-25   
gi|322694125|gb|EFY85963.1| PAP2 domain protein [Metarhizium acr...   120   6e-25   
gi|471401703|ref|XP_004383460.1| PREDICTED: phosphatidate phosph...   120   6e-25   
gi|312374025|gb|EFR21678.1| hypothetical protein AND_16614 [Anop...   120   6e-25   
gi|432873462|ref|XP_004072228.1| PREDICTED: phosphatidate phosph...   120   6e-25   
gi|460386406|ref|XP_004238889.1| PREDICTED: putative lipid phosp...   120   7e-25   
gi|358248084|ref|NP_001239809.1| uncharacterized protein LOC1007...   120   7e-25   
gi|474114400|gb|EMS55807.1| Putative lipid phosphate phosphatase...   119   7e-25   
gi|354544380|emb|CCE41103.1| hypothetical protein CPAR2_300920 [...   119   7e-25   
gi|121707289|ref|XP_001271789.1| PAP2 superfamily protein [Asper...   119   7e-25   
gi|502120643|ref|XP_004497033.1| PREDICTED: lipid phosphate phos...   119   8e-25   
gi|297299247|ref|XP_001092746.2| PREDICTED: phosphatidate phosph...   119   1e-24   
gi|10673973|gb|AAF89745.3|AF171230_1 phosphatidic acid phosphata...   119   1e-24   
gi|294657620|ref|XP_459907.2| DEHA2E13838p [Debaryomyces hanseni...   119   1e-24   
gi|508712200|gb|EOY04097.1| Lipid phosphate phosphatase 3 isofor...   119   1e-24   
gi|398411753|ref|XP_003857213.1| hypothetical protein MYCGRDRAFT...   119   1e-24   
gi|213515178|ref|NP_001133319.1| Phosphatidic acid phosphatase t...   119   1e-24   
gi|308321322|gb|ADO27813.1| phosphatidate phosphatase ppapdc1b [...   119   1e-24   
gi|170100627|ref|XP_001881531.1| predicted protein [Laccaria bic...   119   1e-24   
gi|124487352|ref|NP_082276.1| phosphatidate phosphatase PPAPDC1B...   119   2e-24   
gi|512952947|ref|XP_004838871.1| PREDICTED: phosphatidate phosph...   118   2e-24   
gi|254570593|ref|XP_002492406.1| Diacylglycerol pyrophosphate (D...   118   2e-24   
gi|452988569|gb|EME88324.1| hypothetical protein MYCFIDRAFT_2675...   118   2e-24   
gi|414881087|tpg|DAA58218.1| TPA: hypothetical protein ZEAMMB73_...   118   2e-24   
gi|466002228|gb|EMP41723.1| Phosphatidate phosphatase PPAPDC1B [...   118   2e-24   
gi|301763729|ref|XP_002917286.1| PREDICTED: phosphatidate phosph...   118   2e-24   
gi|148700882|gb|EDL32829.1| mCG14513, isoform CRA_f [Mus musculus]    118   2e-24   
gi|296222017|ref|XP_002757006.1| PREDICTED: phosphatidate phosph...   118   2e-24   
gi|302798525|ref|XP_002981022.1| hypothetical protein SELMODRAFT...   118   2e-24   
gi|147905181|ref|NP_001088710.1| phosphatidic acid phosphatase t...   118   2e-24   
gi|380024609|ref|XP_003696086.1| PREDICTED: LOW QUALITY PROTEIN:...   118   2e-24   
gi|156847289|ref|XP_001646529.1| hypothetical protein Kpol_1055p...   118   3e-24   
gi|448537475|ref|XP_003871335.1| Dpp3 protein [Candida orthopsil...   118   3e-24   
gi|302802810|ref|XP_002983159.1| hypothetical protein SELMODRAFT...   118   3e-24   
gi|156523237|ref|NP_001096029.1| phosphatidate phosphatase PPAPD...   118   3e-24   
gi|367014571|ref|XP_003681785.1| hypothetical protein TDEL_0E033...   117   3e-24   
gi|126304089|ref|XP_001381873.1| PREDICTED: phosphatidate phosph...   117   3e-24   
gi|297682717|ref|XP_002819058.1| PREDICTED: phosphatidate phosph...   117   3e-24   
gi|513029863|gb|AGO09907.1| AaceriAAL084Wp [Saccharomycetaceae s...   117   3e-24   
gi|332240915|ref|XP_003269633.1| PREDICTED: phosphatidate phosph...   117   3e-24   
gi|402878023|ref|XP_003902706.1| PREDICTED: phosphatidate phosph...   117   3e-24   
gi|115399082|ref|XP_001215130.1| conserved hypothetical protein ...   117   3e-24   
gi|73979309|ref|XP_532804.2| PREDICTED: phosphatidate phosphatas...   117   4e-24   
gi|83768734|dbj|BAE58871.1| unnamed protein product [Aspergillus...   117   4e-24   
gi|116283686|gb|AAH23111.1| Ppapdc1b protein [Mus musculus] >gi|...   117   4e-24   
gi|38328199|gb|AAH62173.1| Ppapdc1b protein [Mus musculus]            117   5e-24   
gi|303311599|ref|XP_003065811.1| PAP2 superfamily protein [Cocci...   117   5e-24   
gi|198442855|ref|NP_001102881.2| phosphatidate phosphatase PPAPD...   117   5e-24   
gi|147787086|emb|CAN75772.1| hypothetical protein VITISV_010662 ...   117   5e-24   
gi|194226427|ref|XP_001491935.2| PREDICTED: phosphatidate phosph...   117   5e-24   
gi|488557962|ref|XP_004469419.1| PREDICTED: LOW QUALITY PROTEIN:...   117   5e-24   
gi|45184740|ref|NP_982458.1| AAL084Wp [Ashbya gossypii ATCC 1089...   117   5e-24   
gi|146323769|ref|XP_751928.2| PAP2 domain protein [Aspergillus f...   117   5e-24   
gi|410900532|ref|XP_003963750.1| PREDICTED: phosphatidate phosph...   117   6e-24   
gi|291404917|ref|XP_002718788.1| PREDICTED: phosphatidic acid ph...   117   6e-24   
gi|507551090|ref|XP_004659348.1| PREDICTED: phosphatidate phosph...   117   6e-24   
gi|395827964|ref|XP_003787158.1| PREDICTED: phosphatidate phosph...   116   7e-24   
gi|149057821|gb|EDM09064.1| rCG42960, isoform CRA_c [Rattus norv...   116   7e-24   
gi|119194029|ref|XP_001247618.1| hypothetical protein CIMG_01389...   116   7e-24   
gi|124377995|ref|NP_001074432.1| phosphatidate phosphatase PPAPD...   116   7e-24   
gi|444315329|ref|XP_004178322.1| hypothetical protein TBLA_0A102...   116   7e-24   
gi|478507815|ref|XP_004428193.1| PREDICTED: phosphatidate phosph...   116   7e-24   
gi|296221365|ref|XP_002756710.1| PREDICTED: phosphatidate phosph...   116   7e-24   
gi|330864696|ref|NP_001193479.1| phosphatidate phosphatase PPAPD...   116   8e-24   
gi|472369113|ref|XP_004404077.1| PREDICTED: phosphatidate phosph...   116   8e-24   
gi|471368869|ref|XP_004374957.1| PREDICTED: phosphatidate phosph...   116   8e-24   
gi|157136059|ref|XP_001656750.1| phosphatidic acid phosphatase [...   116   8e-24   
gi|475473509|gb|EMT02499.1| Lipid phosphate phosphatase 2 [Aegil...   116   8e-24   
gi|73611920|ref|NP_001025230.1| phosphatidate phosphatase PPAPDC...   116   8e-24   
gi|300798497|ref|NP_001178560.1| phosphatidate phosphatase PPAPD...   116   8e-24   
gi|367001028|ref|XP_003685249.1| hypothetical protein TPHA_0D017...   116   8e-24   
gi|355783150|gb|EHH65071.1| hypothetical protein EGM_18414, part...   116   8e-24   
gi|507622484|ref|XP_004625672.1| PREDICTED: phosphatidate phosph...   116   8e-24   
gi|194042150|ref|XP_001924214.1| PREDICTED: phosphatidate phosph...   116   8e-24   
gi|504134629|ref|XP_004579830.1| PREDICTED: phosphatidate phosph...   116   8e-24   
gi|159125157|gb|EDP50274.1| PAP2 domain protein [Aspergillus fum...   116   8e-24   
gi|403294388|ref|XP_003938172.1| PREDICTED: phosphatidate phosph...   116   8e-24   
gi|410956394|ref|XP_003984827.1| PREDICTED: phosphatidate phosph...   116   9e-24   
gi|21542541|gb|AAH33025.1| PPAPDC1B protein [Homo sapiens] >gi|1...   116   9e-24   
gi|507576055|ref|XP_004671568.1| PREDICTED: phosphatidate phosph...   116   9e-24   
gi|472349568|ref|XP_004394484.1| PREDICTED: phosphatidate phosph...   116   9e-24   
gi|355779635|gb|EHH64111.1| hypothetical protein EGM_17242 [Maca...   116   9e-24   
gi|260939868|ref|XP_002614234.1| hypothetical protein CLUG_05720...   116   9e-24   
gi|465985545|ref|XP_004265811.1| PREDICTED: phosphatidate phosph...   116   9e-24   
gi|507940028|ref|XP_004680445.1| PREDICTED: phosphatidate phosph...   116   1e-23   
gi|167999556|ref|XP_001752483.1| predicted protein [Physcomitrel...   115   1e-23   
gi|241956200|ref|XP_002420820.1| diacylglycerol pyrophosphate (D...   115   1e-23   
gi|347966839|ref|XP_321121.5| AGAP001941-PA [Anopheles gambiae s...   115   1e-23   
gi|507668779|ref|XP_004637308.1| PREDICTED: phosphatidate phosph...   115   1e-23   
gi|403294390|ref|XP_003938173.1| PREDICTED: phosphatidate phosph...   115   1e-23   
gi|242054083|ref|XP_002456187.1| hypothetical protein SORBIDRAFT...   115   1e-23   
gi|148685717|gb|EDL17664.1| mCG52078, isoform CRA_b [Mus musculus]    115   2e-23   
gi|82184575|sp|Q6GQ62.1|PPC1B_XENLA RecName: Full=Phosphatidate ...   115   2e-23   
gi|158257668|dbj|BAF84807.1| unnamed protein product [Homo sapiens]   115   2e-23   
gi|432099959|gb|ELK28853.1| Phosphatidate phosphatase PPAPDC1B [...   115   2e-23   
gi|195453453|ref|XP_002073795.1| GK14299 [Drosophila willistoni]...   115   2e-23   
gi|195109666|ref|XP_001999404.1| GI24490 [Drosophila mojavensis]...   115   2e-23   
gi|512839994|ref|XP_004884347.1| PREDICTED: phosphatidate phosph...   115   2e-23   
gi|378725741|gb|EHY52200.1| PAP2 domain-containing protein [Exop...   115   2e-23   
gi|68487344|ref|XP_712443.1| hypothetical protein CaO19.8772 [Ca...   115   2e-23   
gi|295668354|ref|XP_002794726.1| PAP2 domain-containing protein ...   115   2e-23   
gi|226291617|gb|EEH47045.1| PAP2 domain-containing protein [Para...   114   3e-23   
gi|255728519|ref|XP_002549185.1| hypothetical protein CTRG_03482...   114   3e-23   
gi|513192209|ref|XP_426544.3| PREDICTED: phosphatidate phosphata...   114   3e-23   
gi|168005660|ref|XP_001755528.1| predicted protein [Physcomitrel...   114   3e-23   
gi|483497667|gb|EOA93918.1| Phosphatidic acid phosphatase type 2...   114   3e-23   
gi|149247202|ref|XP_001528026.1| hypothetical protein LELG_00546...   114   3e-23   
gi|296472576|tpg|DAA14691.1| TPA: phosphatidic acid phosphatase ...   114   3e-23   
gi|224053094|ref|XP_002190278.1| PREDICTED: phosphatidate phosph...   114   3e-23   
gi|432907400|ref|XP_004077625.1| PREDICTED: phosphatidate phosph...   114   4e-23   
gi|512986946|ref|XP_004855413.1| PREDICTED: phosphatidate phosph...   114   5e-23   
gi|390362208|ref|XP_787511.3| PREDICTED: phosphatidate phosphata...   113   5e-23   
gi|297828720|ref|XP_002882242.1| hypothetical protein ARALYDRAFT...   113   6e-23   
gi|164657937|ref|XP_001730094.1| hypothetical protein MGL_2476 [...   113   6e-23   
gi|499017874|ref|XP_004559735.1| PREDICTED: phosphatidate phosph...   113   6e-23   
gi|195062936|ref|XP_001996281.1| GH22403 [Drosophila grimshawi] ...   113   6e-23   
gi|47226563|emb|CAG08579.1| unnamed protein product [Tetraodon n...   113   7e-23   
gi|512878033|ref|XP_004894337.1| PREDICTED: phosphatidate phosph...   113   7e-23   
gi|115397809|ref|XP_001214496.1| conserved hypothetical protein ...   113   7e-23   


>gi|409082672|gb|EKM83030.1| hypothetical protein AGABI1DRAFT_53693 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 387

 Score =  234 bits (596), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 125/301 (41%), Positives = 174/301 (57%), Gaps = 18/301 (5%)

Query: 2   KKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVP 61
           + MS   + ++L +Y  DW+L  I  GIFFS+D++E Y R+F+LED +++ P+A  ERVP
Sbjct: 16  RPMSPLRRRKLLLSYVPDWLLTIILAGIFFSLDKVEGYRRVFALEDTSLRHPYAVHERVP 75

Query: 62  MWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRP 121
                               +   +S  D H++S            VT+  K TVGRPRP
Sbjct: 76  NIALYFICFVAPFLLQPVVNVLTIRSWWDLHNSSLGLILSLALTGSVTQFSKITVGRPRP 135

Query: 122 DFIDRCQPS-AAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLA 178
           D +DRCQP   A DP  GLS+  ICT+ D  +L+DGF+SF SGHSS SFAG+GFLS YLA
Sbjct: 136 DIVDRCQPPVGATDPEFGLSSWQICTQPDNGILRDGFRSFPSGHSSMSFAGLGFLSFYLA 195

Query: 179 GKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQ 238
           GKLH+FD++G+T K +              SRT DYRHHWHDV  GSL+G +++YF+Y Q
Sbjct: 196 GKLHLFDKRGHTGKAWLSLAPFCCAALVAISRTMDYRHHWHDVLVGSLLGTVMAYFSYRQ 255

Query: 239 YYPDLHSKISDKPFTIRLKK----VVPEYK-----AEFSFMDGSEV------EITVVKND 283
           YYP L S++S +PF+ R+K+    ++P +      + F F+           + T   ND
Sbjct: 256 YYPPLESELSHRPFSPRIKRDDDELIPTHNHHPSGSNFPFVQPPTTSTQGNGQYTATNND 315

Query: 284 E 284
           E
Sbjct: 316 E 316



>gi|426200539|gb|EKV50463.1| hypothetical protein AGABI2DRAFT_200181 [Agaricus bisporus var.
           bisporus H97]
          Length = 387

 Score =  233 bits (593), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 124/301 (41%), Positives = 174/301 (57%), Gaps = 18/301 (5%)

Query: 2   KKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVP 61
           + MS   + ++L +Y  DW+L  +  GIFFS+D++E Y R+F+LED +++ P+A  ERVP
Sbjct: 16  RPMSPIRRRKLLLSYVPDWLLTIVLAGIFFSLDKVEGYRRVFALEDTSLRHPYAVHERVP 75

Query: 62  MWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRP 121
                               +   +S  D H++S            VT+  K TVGRPRP
Sbjct: 76  NIALYFICFVAPFLLQPVVNVFTIRSWWDLHNSSLGLILSLALTGSVTQFSKITVGRPRP 135

Query: 122 DFIDRCQPS-AAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLA 178
           D +DRCQP   A DP  GLS+  ICT+ D  +L+DGF+SF SGHSS SFAG+GFLS YLA
Sbjct: 136 DIVDRCQPPIGATDPEFGLSSWEICTQPDNGILRDGFRSFPSGHSSMSFAGLGFLSFYLA 195

Query: 179 GKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQ 238
           GKLH+FD++G+T K +              SRT DYRHHWHDV  GSL+G +++YF+Y Q
Sbjct: 196 GKLHLFDKRGHTGKAWLSLAPFCCAALVAISRTMDYRHHWHDVLVGSLLGTVMAYFSYRQ 255

Query: 239 YYPDLHSKISDKPFTIRLKK----VVPEYK-----AEFSFMDGSEV------EITVVKND 283
           YYP L S++S +PF+ R+K+    ++P +      + F F+           + T   ND
Sbjct: 256 YYPPLESELSHRPFSPRIKREDDELIPTHNHHPSGSNFPFVQAPTTSTQGNGQYTATNND 315

Query: 284 E 284
           E
Sbjct: 316 E 316



>gi|393216911|gb|EJD02401.1| PAP2-domain-containing protein [Fomitiporia mediterranea MF3/22]
          Length = 449

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 165/280 (58%), Gaps = 3/280 (1%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           + KMS   ++ +L++Y  DW+LC +   +FFS+D++  + R FS+ED T++FPFA  ERV
Sbjct: 57  RSKMSRKRRLALLRSYLPDWILCIVLAAVFFSLDKVPGFRREFSIEDPTLRFPFAVHERV 116

Query: 61  PMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPR 120
           P                    +   +S+ D+H+ +            +T+  K TVGRPR
Sbjct: 117 PPIALYFIAIVAPFVIQIIVNVITIRSLWDFHNGTLGLLLGLTLTGAITQFTKITVGRPR 176

Query: 121 PDFIDRCQP-SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYL 177
           PD I RCQP S   +P  GL +S ICT+TD  +L+DG++SF SGHSS SFAG+GFLS YL
Sbjct: 177 PDVISRCQPPSGIVNPEYGLVSSAICTQTDVGILRDGWRSFPSGHSSLSFAGLGFLSFYL 236

Query: 178 AGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           AGKLH+FD+ G+T K +              SRT DYRHHW DV  GS++G ++S+FAY 
Sbjct: 237 AGKLHLFDENGHTTKAWISLTPLSGAALVAISRTMDYRHHWQDVLVGSILGLVMSFFAYR 296

Query: 238 QYYPDLHSKISDKPFTIRLKKVVPEYKAEFSFMDGSEVEI 277
           QYYP L S  + KPF+ R+K+     + E +  D S   I
Sbjct: 297 QYYPPLGSPRAHKPFSPRIKRERTADENESTPSDESNAPI 336



>gi|511000187|gb|EPB81744.1| hypothetical protein HMPREF1544_11530 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 359

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 154/256 (60%), Gaps = 9/256 (3%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           K ++  +Y  DWVL  I    FF++DQ+ P+HR+FSLEDKTI FP+AEKE VP+W+    
Sbjct: 10  KKRLAVSYLWDWVLVIIMTAAFFAIDQITPFHRMFSLEDKTIMFPYAEKESVPVWMLLII 69

Query: 69  XXXXXXXXXXXXALA---IKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFID 125
                       +L+    ++S+HD+H               +T+V K T GRPRPD + 
Sbjct: 70  CFLAPIIVIAGISLSGYGYRRSLHDFHSGVLGLCLGLAMTIMLTDVIKVTAGRPRPDMLS 129

Query: 126 RCQPSA-AFDPGLGLSNSTICTRTDL----LKDGFKSFLSGHSSTSFAGMGFLSLYLAGK 180
           RCQP A A DP  GL++  ICT TD+    + DGFKSF SGHSS SFAG+G+L+ Y+AGK
Sbjct: 130 RCQPPADAVDPRFGLTSVDICT-TDIYSHTMIDGFKSFPSGHSSFSFAGLGYLAFYIAGK 188

Query: 181 LHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYY 240
           + +FD+KG+TYKGF              SRTEDYRHHW DV  G+L+G   +YFAY QYY
Sbjct: 189 VKMFDEKGHTYKGFLFAFPIIGALLVAISRTEDYRHHWQDVTIGALLGTFCAYFAYRQYY 248

Query: 241 PDLHSKISDKPFTIRL 256
           P L       PF  R+
Sbjct: 249 PGLSQDSCRDPFLTRV 264



>gi|384501729|gb|EIE92220.1| hypothetical protein RO3G_17027 [Rhizopus delemar RA 99-880]
          Length = 321

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/253 (44%), Positives = 150/253 (59%), Gaps = 7/253 (2%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMW---LCAX 67
           +I  +Y LDW+L  I   +FF++DQ+ P+HR FS++DKTI FP+ E ERVP+W   +   
Sbjct: 9   RITLSYGLDWLLVIIMTAVFFAIDQVTPFHRQFSIDDKTISFPYTENERVPVWSLIIICL 68

Query: 68  XXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC 127
                         +  K++ +D+H               +T+V K T GRPRPD + RC
Sbjct: 69  IAPIVVIAIISLSGIGYKRNWYDFHAGVLGLCLGLSMTIMLTDVIKVTAGRPRPDMLSRC 128

Query: 128 QPSA-AFDPGLGLSNSTICT---RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           +P     DP LGLS+  +CT    +D++ DGFKSF SGHSS SFAG+G+LS Y+AGKL +
Sbjct: 129 KPPLDTQDPVLGLSSIDVCTTDIHSDIMIDGFKSFPSGHSSFSFAGLGYLSFYIAGKLRL 188

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           FDQ G+TYKGF              SRT+DYRHHW DVF GS++G + +YFAY QYYP L
Sbjct: 189 FDQMGHTYKGFCCIFPFIGAALVAISRTDDYRHHWQDVFIGSILGIVCAYFAYRQYYPSL 248

Query: 244 HSKISDKPFTIRL 256
                  PF  RL
Sbjct: 249 GHDSCHDPFMTRL 261



>gi|395333532|gb|EJF65909.1| acid phosphatase/Vanadium-dependent haloperoxidase [Dichomitus
           squalens LYAD-421 SS1]
          Length = 379

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/260 (43%), Positives = 152/260 (58%), Gaps = 3/260 (1%)

Query: 2   KKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVP 61
           K+     + ++  +YA DWVLC      FF++D++  + R FSL D ++   FA  ERVP
Sbjct: 53  KRFGRAYRTRVFLSYAPDWVLCIGLSAAFFALDKVPGFKREFSLTDTSLLHTFAVHERVP 112

Query: 62  MWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRP 121
            WL                 L + +S+ DWH +             +T+  K TVGRPRP
Sbjct: 113 DWLLYVIFAAAPLTLMPIINLILLRSLWDWHSSWLGWLLSCSITGAITQFSKITVGRPRP 172

Query: 122 DFIDRCQP-SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLA 178
           D IDRCQP S A DP LGLS   ICT+TD  +L+DG++SF SGHSS SFAG+GFLS YLA
Sbjct: 173 DLIDRCQPISGAVDPPLGLSTVAICTQTDVGILRDGWRSFPSGHSSLSFAGLGFLSFYLA 232

Query: 179 GKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQ 238
           GKLH+FD++G+T K +              SRT DYRHHW DV  GS +G +++YF Y Q
Sbjct: 233 GKLHLFDERGHTVKAWISLVPLSGAALVAISRTMDYRHHWQDVLTGSTLGIVVAYFGYRQ 292

Query: 239 YYPDLHSKISDKPFTIRLKK 258
           YYP L S+I   P++ R+ +
Sbjct: 293 YYPPLSSQICHLPYSPRVHR 312



>gi|302692612|ref|XP_003035985.1| hypothetical protein SCHCODRAFT_105635 [Schizophyllum commune H4-8]
 gi|300109681|gb|EFJ01083.1| hypothetical protein SCHCODRAFT_105635, partial [Schizophyllum
           commune H4-8]
          Length = 441

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/261 (41%), Positives = 158/261 (60%), Gaps = 3/261 (1%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           +  ++   + +++ +Y  DW+L  +   IFF++D++E + R+FSLED +++ P+A  ER+
Sbjct: 20  RPPVTAARRRKLILSYLPDWILTIVLAAIFFALDEIEGFKRVFSLEDTSLRHPYAVHERI 79

Query: 61  PMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPR 120
           P                    +   +S  D H +             VT+  K TVGRPR
Sbjct: 80  PNKELMVIAILAPIVLLPLVNVLTIRSWWDLHASWLGVVLGLSLTGAVTQFAKVTVGRPR 139

Query: 121 PDFIDRCQP-SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYL 177
           PD IDRCQP   + DP  GLSN TICT+TD  +L+DGF+SF SGHSS SFAG+GFL+ YL
Sbjct: 140 PDVIDRCQPRPGSADPVYGLSNYTICTQTDHYVLRDGFRSFPSGHSSLSFAGLGFLAFYL 199

Query: 178 AGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           AGKLH+FD++G+T K +              SRT DYRHHW DV  GS++G +++YFAY 
Sbjct: 200 AGKLHLFDRRGHTGKAWLALTPFAGATLVAISRTMDYRHHWQDVLTGSILGTVMTYFAYR 259

Query: 238 QYYPDLHSKISDKPFTIRLKK 258
           QYYP LH  ++ +P++ R+++
Sbjct: 260 QYYPPLHDPLAHRPYSPRIRR 280



>gi|170094044|ref|XP_001878243.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164646697|gb|EDR10942.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 366

 Score =  216 bits (550), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 113/257 (43%), Positives = 154/257 (59%), Gaps = 4/257 (1%)

Query: 4   MSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMW 63
           MS   + +++ +YA DW    + + +FFS+D++  Y R+FSLED +++ P+A  ERVP  
Sbjct: 16  MSPTRRRKLVFSYAPDW-YAMMTIALFFSLDKVNGYRRVFSLEDTSLRHPYAVHERVPNI 74

Query: 64  LCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDF 123
                                 +S  D+H+ S            VT+  K TVGRPRPD 
Sbjct: 75  ALYLICFVSPLLIQPVINFFTVRSWWDFHNGSLGLVLGLALTGSVTQFVKITVGRPRPDV 134

Query: 124 IDRCQP-SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGK 180
           IDRCQP + + DP  GLSN TICT+    +L+DGF+SF SGHSS SFAG+GFLS YLAGK
Sbjct: 135 IDRCQPPTGSVDPTFGLSNWTICTQASEAILRDGFRSFPSGHSSMSFAGLGFLSFYLAGK 194

Query: 181 LHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYY 240
           LH+FD +G+T K +              SRT DYRHHW DV  GS++G +L+YF+Y QYY
Sbjct: 195 LHLFDSRGHTGKAWLALSPFAGASLVAISRTMDYRHHWQDVLVGSILGTVLAYFSYRQYY 254

Query: 241 PDLHSKISDKPFTIRLK 257
           P L S +S +P++ R+K
Sbjct: 255 PSLESDLSHRPYSPRIK 271



>gi|471876809|emb|CCO35529.1| putative diacylglycerol pyrophosphate phosphatase 1 Short=DGPP
           phosphatase [Rhizoctonia solani AG-1 IB]
          Length = 380

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/254 (43%), Positives = 147/254 (57%), Gaps = 4/254 (1%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
            +Q+L +Y  DW++       FF++D+++ + R FSL D TIQ  +   ERVP W+    
Sbjct: 16  NMQLLFSYLPDWIVTCGLAAAFFALDKIDGFRREFSLTDTTIQHTYTVHERVPNWMLIAI 75

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        +   +S  DWH++             VT+V K TVGRPRPD I RC+
Sbjct: 76  CFGVPVVIMPIVNMLTVRSWWDWHNSMLGLVLGLATTGAVTQVVKVTVGRPRPDAIARCK 135

Query: 129 PSA-AFDPGL-GLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF 184
           P A A D  + GL  + ICT TD  ++KDG++SF SGHSS SFAG+GFLS YLAGKLH+F
Sbjct: 136 PKADAHDSAVFGLVTTIICTETDIHMMKDGWRSFFSGHSSLSFAGLGFLSFYLAGKLHLF 195

Query: 185 DQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLH 244
           D++G+T K +              SRT DYRHHW DV  GS VG + SYFAY QYYP L 
Sbjct: 196 DERGHTGKAWIALTPLTGALLIAISRTMDYRHHWQDVLVGSTVGLIFSYFAYRQYYPTLE 255

Query: 245 SKISDKPFTIRLKK 258
           S  S KP++ R+ +
Sbjct: 256 SPFSHKPYSPRIPR 269



>gi|390598034|gb|EIN07433.1| PAP2-domain-containing protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 377

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 108/261 (41%), Positives = 152/261 (58%), Gaps = 3/261 (1%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           K  M    ++++L++YA DW++  +    FF++D +  + R FSLED +++ P+A  ERV
Sbjct: 35  KPPMDAKQRMRLLRSYAPDWIITIVLAAAFFALDWVPGFKREFSLEDTSLRHPYAVHERV 94

Query: 61  PMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPR 120
           P W                      +S  D+H++             +T+  K TVGRPR
Sbjct: 95  PDWALYIIAFFAPLILQIGINFLSIRSWWDFHNSFLGLLLGLALAGSITQFAKVTVGRPR 154

Query: 121 PDFIDRCQPSAAF-DPGLGLSNSTICTRTDL--LKDGFKSFLSGHSSTSFAGMGFLSLYL 177
           PD I RC P+A   DP  GLS   ICT+TD+  LKDGF+SF SGHSS SFAG+GFLS YL
Sbjct: 155 PDVISRCIPAAGSQDPRFGLSTFKICTQTDIAILKDGFRSFPSGHSSLSFAGLGFLSFYL 214

Query: 178 AGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           AGKLH+FD++G+  K +              SRT DYRHHW DV  GS +G  ++YF+Y 
Sbjct: 215 AGKLHLFDRRGHAGKAWLSLTPLSGATLVAISRTMDYRHHWQDVLVGSALGLAMAYFSYR 274

Query: 238 QYYPDLHSKISDKPFTIRLKK 258
           QYYP L S +S +P++ R+++
Sbjct: 275 QYYPSLTSALSHRPYSPRIRR 295



>gi|392558521|gb|EIW51708.1| acid phosphatase/Vanadium-dependent haloperoxidase [Trametes
           versicolor FP-101664 SS1]
          Length = 338

 Score =  209 bits (532), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 159/280 (56%), Gaps = 11/280 (3%)

Query: 4   MSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMW 63
           M    + +++ +YA DW++C +    F++++ +E + R FSL D ++Q  FA  ERVP  
Sbjct: 4   MGRSVRSRLVLSYAPDWLVCIVLAAAFYALEYIEGFKREFSLTDTSLQHTFAVHERVPAL 63

Query: 64  LCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDF 123
                             +   +S  D H +             +T+  K TVGRPRPD 
Sbjct: 64  ALYMIAGVAPLVLQPLINVLTIRSWWDLHTSWLGLLLSLTITGSITQFVKITVGRPRPDL 123

Query: 124 IDRCQPSA-AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGK 180
           I RC P A + DP LGLS   ICT+TD  +L+DG++SF SGHSS +FAG+GFLS YLAGK
Sbjct: 124 IARCIPIAGSVDPPLGLSTVAICTQTDKHMLQDGWRSFPSGHSSLTFAGLGFLSFYLAGK 183

Query: 181 LHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYY 240
           LH+FD +G+T K +              SRT DYRHHW DV  GSL+G + +YF+Y Q+Y
Sbjct: 184 LHLFDMRGHTVKAWLALAPLAGAAMVAISRTMDYRHHWQDVLTGSLLGLVTAYFSYRQFY 243

Query: 241 PDLHSKISDKPFTIRLKK---VVPEYKAEFSFMDGSEVEI 277
           P L S+IS KP++ R+K+   ++P +       D SE E+
Sbjct: 244 PPLWSEISHKPYSPRIKRGSHLLPTHT-----RDPSEAEV 278



>gi|449547407|gb|EMD38375.1| hypothetical protein CERSUDRAFT_113537 [Ceriporiopsis subvermispora
           B]
          Length = 339

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 165/296 (55%), Gaps = 11/296 (3%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           + +M    + +++ +YA DW++      +F ++  L  + R FSL+D T+ +PFAE ERV
Sbjct: 12  RAQMDSGRRRRLIFSYAPDWIVTIALSALFLALGNLPGFKREFSLDDTTLHYPFAEHERV 71

Query: 61  PMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPR 120
           P                    L   +S  D H +             +T+  K T GRPR
Sbjct: 72  PPVALYMICLVSPLILQAILNLLTVRSWWDLHTSYLGLILGLGITGTITQFIKLTAGRPR 131

Query: 121 PDFIDRCQP-SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYL 177
           PD I RC P + A DP LGLS+  ICT+TD  ++ DG++SF SGHSS SFAGMGFLSLY+
Sbjct: 132 PDLIARCIPMTGAMDPPLGLSSVAICTQTDTHIIDDGWRSFPSGHSSLSFAGMGFLSLYV 191

Query: 178 AGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           AGKLH+FD+KGY  K +              SRT D RHHW DV  GS +G ++++F+Y 
Sbjct: 192 AGKLHLFDRKGYAIKAWITLVPLSSAALVAVSRTMDNRHHWQDVLVGSALGMVVAWFSYR 251

Query: 238 QYYPDLHSKISDKPFTIRLKK---VVPEYKAEFSFMDGSEVEITVVKNDEQLLLKD 290
           QYYP L S+   +P++ R+K+   ++P +   +S     E E ++ +ND++   +D
Sbjct: 252 QYYPALSSEWPHRPYSPRIKRDEHMLPTFN-RYSV----EAEQSIPENDDRSRYRD 302



>gi|389748744|gb|EIM89921.1| acid phosphatase/Vanadium-dependent haloperoxidase, partial
           [Stereum hirsutum FP-91666 SS1]
          Length = 335

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 151/266 (56%), Gaps = 3/266 (1%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           K +M    + +I  +YA DW +  I   IFFS+D++  Y R FS+ D +++  FAE ERV
Sbjct: 22  KPRMDPKRRWRIFLSYAPDWAVTIILAAIFFSLDKVHGYKREFSVADTSLRHTFAEHERV 81

Query: 61  PMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPR 120
           P                    L   +S  D H ++            +T+  K TVGRPR
Sbjct: 82  PDIALYFIAIVAPIVLMWFINLISIRSWWDAHISTLGAILALCLAGVITQFTKITVGRPR 141

Query: 121 PDFIDRCQPS-AAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYL 177
           PD I RC PS    DP  GLS   IC ++D  +L+DGF+SF SGHSS SFAG+GFLS YL
Sbjct: 142 PDLISRCNPSNGTADPTYGLSTYLICNQSDSHILEDGFRSFPSGHSSLSFAGLGFLSWYL 201

Query: 178 AGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           AGK+H+FD +G+  K +              SRT DYRHHWHDV  GS++G + SYF+Y 
Sbjct: 202 AGKMHLFDSRGHAPKAWLALGPLAAAALVAISRTMDYRHHWHDVLVGSILGLVTSYFSYR 261

Query: 238 QYYPDLHSKISDKPFTIRLKKVVPEY 263
           Q+YP L S+ S +PF+ R+K+ V E+
Sbjct: 262 QFYPSLSSERSHRPFSPRVKREVEEH 287



>gi|392593477|gb|EIW82802.1| PAP2-domain-containing protein [Coniophora puteana RWD-64-598 SS2]
          Length = 339

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 145/251 (57%), Gaps = 3/251 (1%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           +++IL++YA DW+L      +FFS++ +  Y R FS+EDKTI FPFA  ERVP       
Sbjct: 8   RLKILRSYAPDWILTIALAVVFFSLNVVHGYRREFSVEDKTISFPFAVHERVPNIALYFI 67

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        L   +S  D+H+++            VT+  K TVGRPRPD + RC 
Sbjct: 68  AIVSPIVIQATVNLLTVRSFWDFHNSTLGLILGLVITGAVTQFTKITVGRPRPDLLSRCM 127

Query: 129 P-SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P +   DP  GL +  +CT T+  ++ DG++SF SGH+S SFAG+GFLS YLAGKLH+FD
Sbjct: 128 PITGTADPTYGLVSDAVCTNTNEKIMIDGWRSFPSGHASLSFAGLGFLSFYLAGKLHLFD 187

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
            +G+  K +              SRT D RHHW DV  GSL+G ++SYF+Y QY+P L +
Sbjct: 188 TRGHAPKAWIAITPLFGAALVAISRTMDSRHHWQDVTVGSLLGLIVSYFSYRQYFPHLAA 247

Query: 246 KISDKPFTIRL 256
             S +P + R+
Sbjct: 248 PTSHRPHSPRV 258



>gi|358057684|dbj|GAA96449.1| hypothetical protein E5Q_03116 [Mixia osmundae IAM 14324]
          Length = 316

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 148/260 (56%), Gaps = 4/260 (1%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           + +M    +  ++ +Y  DW+L  +   +F+ +D    Y R F L D +IQ  +A  ERV
Sbjct: 17  RHQMDADRRKALILSYLPDWLLTIVLWIVFYLIDNAHGYFREFDLTDGSIQHTYAVHERV 76

Query: 61  PMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPR 120
           P+W  A              +L +  S  D+H+A             VT+  K TVGRPR
Sbjct: 77  PVWALAIIGAIAPLVIMAAISLGLIGSFWDFHNAVLGLVLSLALSTTVTDTIKITVGRPR 136

Query: 121 PDFIDRCQP--SAAFDPGLGLSNSTICTRTDL--LKDGFKSFLSGHSSTSFAGMGFLSLY 176
           PD IDRCQP   AA     GL+ S ICT+TD   L+DGF+SF SGHSS +FAG+GFL+LY
Sbjct: 137 PDLIDRCQPMAGAANASPYGLATSAICTQTDFHTLRDGFRSFPSGHSSFAFAGLGFLALY 196

Query: 177 LAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAY 236
           L GKLH+ D++G+T K +              SRT DYRHH  DV AG+++G++ ++ +Y
Sbjct: 197 LGGKLHISDRQGFTAKTWICVVPLLAAALVAVSRTMDYRHHSTDVIAGAILGYITAWVSY 256

Query: 237 HQYYPDLHSKISDKPFTIRL 256
            QYYP ++S+   KP++ RL
Sbjct: 257 RQYYPAIYSQDCHKPYSPRL 276



>gi|353237971|emb|CCA69931.1| related to DPP1-diacylglycerol pyrophosphate phosphatase
           [Piriformospora indica DSM 11827]
          Length = 313

 Score =  200 bits (509), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 146/262 (55%), Gaps = 4/262 (1%)

Query: 2   KKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVP 61
           K+     + ++L +Y  DW L      +F +++ +  + R FSL+D++IQ+PF  KERVP
Sbjct: 15  KRNVRVRRWKLLASYFGDWFLTVALAALFLALENVHGFRRRFSLQDESIQYPFTVKERVP 74

Query: 62  MWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRP 121
            WL                 L   + + D H++             +T++FK T GRPRP
Sbjct: 75  NWLLGVICLGIPGVLMPIVNLLTVRMLWDLHNSWLGLVLSLAISGSITQIFKITAGRPRP 134

Query: 122 DFIDRCQP--SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYL 177
           D I RC P   A   P  GL + +ICT+T+  ++ DG++SF SGHS  SFAG+GFLSLYL
Sbjct: 135 DLIARCAPVQGAQNPPVYGLVDDSICTQTEYAIMIDGWRSFSSGHSCLSFAGLGFLSLYL 194

Query: 178 AGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           AGKLH+FD +G T K +              +RT DYRHHW DV  G+++G   +YFAY 
Sbjct: 195 AGKLHLFDSRGQTSKAWISIFPLFGAALVATTRTMDYRHHWQDVLVGAVIGITTAYFAYR 254

Query: 238 QYYPDLHSKISDKPFTIRLKKV 259
           QYYP L S +S +PF+ R   +
Sbjct: 255 QYYPTLESPLSHRPFSPRYAPI 276



>gi|511002424|gb|EPB83859.1| hypothetical protein HMPREF1544_09371 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 319

 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 143/251 (56%), Gaps = 4/251 (1%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           K ++  +Y  DWVL  I + IFF +D + P+HR FS+ D ++   +   E VP+WL    
Sbjct: 11  KKRLFVSYGKDWVLVIIMIIIFFGIDLITPFHREFSINDTSLMHKYTVDESVPVWLLVVI 70

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                       +L I++S  D+H               +T+V K TVGRPRPD +DRCQ
Sbjct: 71  AIVAPVLIIAVVSLGIRRSWLDFHSGLLGLAVALSLTIMMTDVIKITVGRPRPDMLDRCQ 130

Query: 129 PSAAF-DPGLGLSNSTICTR---TDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF 184
           P     +P L L N TICT    T   KDGFKSF SGH+S SFAG+G+++ YLAGK+H+F
Sbjct: 131 PPPGIQNPPLLLLNYTICTADHDTYEFKDGFKSFPSGHASFSFAGLGYVAFYLAGKMHLF 190

Query: 185 DQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLH 244
           D+ G+TYK F              SR  DYRHHW DVF G ++G + +YFAY QYYP L 
Sbjct: 191 DEGGHTYKSFVFCIPFLGALLIAISRLHDYRHHWTDVFIGGIIGTVFAYFAYRQYYPSLA 250

Query: 245 SKISDKPFTIR 255
           ++ S KPF  R
Sbjct: 251 AEYSQKPFPPR 261



>gi|389741682|gb|EIM82870.1| PAP2-domain-containing protein [Stereum hirsutum FP-91666 SS1]
          Length = 332

 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 148/262 (56%), Gaps = 8/262 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXX 70
           ++L +YA DW++  + L +FFS++ +  + R+FS+ D+++  PF E ERVP         
Sbjct: 32  RLLVSYAPDWIITIVILVVFFSLNNIHGFKRVFSINDESLHHPFTEHERVPPEALFVIAL 91

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP- 129
                          +S  D H+++            +T+  K TVGRPRPD I RC P 
Sbjct: 92  IAPIVLQWILNFITIRSWWDAHNSTLGVFLSFSLAGVITQFTKITVGRPRPDLIARCNPD 151

Query: 130 SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
               +P LGL +  +C + +  +L+DGF+SF SGHSS SFAG+GFL+LYLAGKLH+FD +
Sbjct: 152 PTTVNPPLGLVSVDVCHQENALMLEDGFRSFPSGHSSMSFAGLGFLTLYLAGKLHLFDAR 211

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKI 247
           G+  K +              SRT DYRHHWHD+  GS +G   +YF+Y QYYP L S+ 
Sbjct: 212 GHAPKAWLALTPLAGAALVAISRTMDYRHHWHDIVVGSALGLATAYFSYRQYYPSLASEF 271

Query: 248 SDKPFTIRLKK-----VVPEYK 264
           S +P+  R+K      ++P++ 
Sbjct: 272 SHRPYGPRVKNEEDDPILPQFN 293



>gi|501311107|dbj|GAC99833.1| hypothetical protein PHSY_007436 [Pseudozyma hubeiensis SY62]
          Length = 363

 Score =  199 bits (507), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 103/271 (38%), Positives = 147/271 (54%), Gaps = 5/271 (1%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           K+Q+L++Y  DW++  +  G+   ++ +  + R FSL D +IQ  +A  ERVP WL    
Sbjct: 44  KLQLLRSYLPDWIITILLAGLLAIINNVHGFRREFSLTDTSIQHTYAVHERVPTWLLGVL 103

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                       +LA+ +S+ D H+              +T + K TVGRPRPD IDRCQ
Sbjct: 104 AILVPAIIIAVFSLAVSRSVWDLHNGLLGFVLANALTVTITTLVKVTVGRPRPDLIDRCQ 163

Query: 129 PSAAFDPGL--GLSNSTICT---RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           P+A     +  GL    ICT       L+DGF+SF SGH+STSFAG  +LSLYLAGKLH+
Sbjct: 164 PAAGSSNAVPYGLVTDIICTVGVNDKTLRDGFRSFPSGHASTSFAGFTYLSLYLAGKLHL 223

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           FD++G+    +              SRT DYRHH  DV AG+L+G +++Y++Y  YYP L
Sbjct: 224 FDRRGHAVTAWLCGTPLMAATLIAVSRTMDYRHHATDVIAGALLGLVVAYWSYKLYYPAL 283

Query: 244 HSKISDKPFTIRLKKVVPEYKAEFSFMDGSE 274
               S KP++ R+        +E  + D  E
Sbjct: 284 GHSQSHKPYSPRIPAEHLSGASEHRYADQEE 314



>gi|71020361|ref|XP_760411.1| hypothetical protein UM04264.1 [Ustilago maydis 521]
 gi|46100080|gb|EAK85313.1| hypothetical protein UM04264.1 [Ustilago maydis 521]
          Length = 583

 Score =  199 bits (507), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 142/253 (56%), Gaps = 5/253 (1%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           K+Q+L++Y  DW++  +  G+   ++ +  + R FSL D +IQ  +A  ERVP+WL    
Sbjct: 45  KLQLLRSYLPDWIITILLAGLLAIINNVHGFRREFSLTDTSIQHTYAVHERVPVWLLGIL 104

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                       +L I +S+ D H+              +T + K TVGRPRPD IDRCQ
Sbjct: 105 AVLIPVIIIAVFSLVISRSVWDLHNGLLGFVLANALTVTITTIVKVTVGRPRPDLIDRCQ 164

Query: 129 PSAAFDPGL--GLSNSTICT---RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           P+      +  GL    ICT       L+DGF+SF SGHSSTSFAG+ +LSLYLAGKLH+
Sbjct: 165 PAPGSANAIPYGLVTDIICTVGVNDKTLRDGFRSFPSGHSSTSFAGLTYLSLYLAGKLHL 224

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           FD +G+    +              SRT DYRHH  DV AGSL+G +++Y++Y  YYP L
Sbjct: 225 FDGRGHAVTAWLCGTPLMAATLIAVSRTMDYRHHATDVIAGSLLGLIIAYWSYKLYYPPL 284

Query: 244 HSKISDKPFTIRL 256
             + S KP++ R+
Sbjct: 285 AHRQSHKPYSPRI 297



>gi|343425343|emb|CBQ68879.1| related to DPP1-diacylglycerol pyrophosphate phosphatase
           [Sporisorium reilianum SRZ2]
          Length = 364

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 154/282 (54%), Gaps = 6/282 (2%)

Query: 2   KKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVP 61
           + ++   K+Q+L++Y  DW++  +  G+   ++ +  + R FSL D ++   +A +ERVP
Sbjct: 39  EPINRRRKLQLLRSYLPDWIITIVLAGLLAIINNVHGFRREFSLTDTSLH-TYAVRERVP 97

Query: 62  MWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRP 121
            WL                +L + +S+ D H+              VT + K  VGRPRP
Sbjct: 98  TWLLGVLAVLIPALIIVAFSLGVSRSVWDLHNGLLGFVLANALTVTVTTLLKVCVGRPRP 157

Query: 122 DFIDRCQPSAAFDPGL--GLSNSTICT---RTDLLKDGFKSFLSGHSSTSFAGMGFLSLY 176
           D IDRCQP A    G+  GL    ICT    +  L+DGF+SF SGH+STSFAG+ +LSLY
Sbjct: 158 DVIDRCQPRAGSANGVPYGLVTDMICTVGVNSKTLRDGFRSFPSGHASTSFAGLTYLSLY 217

Query: 177 LAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAY 236
           LAGKLH+FD++G+    +              SRT DYRHH  DV AG+L+G +++Y++Y
Sbjct: 218 LAGKLHLFDRRGHAVSAWLCGIPLMAATLIAVSRTMDYRHHATDVIAGALLGLVIAYWSY 277

Query: 237 HQYYPDLHSKISDKPFTIRLKKVVPEYKAEFSFMDGSEVEIT 278
             YYP L  ++S KP++ R+         E ++ D  + E T
Sbjct: 278 KLYYPALSHRLSHKPYSPRIPAEHMAGAGEGAYTDVEDEEAT 319



>gi|328852334|gb|EGG01481.1| hypothetical protein MELLADRAFT_50083 [Melampsora larici-populina
           98AG31]
          Length = 353

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 102/260 (39%), Positives = 151/260 (58%), Gaps = 6/260 (2%)

Query: 2   KKMSEFSKIQILKAYALDWVLCF-IFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           ++ ++  ++ +L++Y  DW++   + +G++F+ D +  +HR F L D +I+   AE ERV
Sbjct: 37  RQTTKERRLNLLRSYLPDWIIIIALCVGLYFTGD-VNGFHRQFDLNDTSIRHTHAETERV 95

Query: 61  PMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPR 120
           P+   A              +  + +S  D H+               T   KNTVGRPR
Sbjct: 96  PILHLAIYSILIPIVLIITCSQGLLRSFWDSHNGLLGLAFSLSLNWAFTTAIKNTVGRPR 155

Query: 121 PDFIDRCQP-SAAFDPGLGLSNSTICTRT---DLLKDGFKSFLSGHSSTSFAGMGFLSLY 176
           PDFIDRCQP S   +  +GLS+ +ICT +    LL DGF+SF SGH+ST++ G+G+LSLY
Sbjct: 156 PDFIDRCQPRSDVMNASIGLSDESICTTSLDSRLLMDGFRSFPSGHASTAWCGLGYLSLY 215

Query: 177 LAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAY 236
           LAGK H+FD+KG+T K +              SRT DYRHHW DV  G L+G L+++F Y
Sbjct: 216 LAGKFHLFDRKGHTLKAWLALSPLLGAALISISRTMDYRHHWQDVLVGGLLGMLIAWFGY 275

Query: 237 HQYYPDLHSKISDKPFTIRL 256
             YYP L ++ + KP++ RL
Sbjct: 276 RMYYPSLFTEEAHKPYSPRL 295



>gi|403415707|emb|CCM02407.1| predicted protein [Fibroporia radiculosa]
          Length = 312

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 145/253 (57%), Gaps = 3/253 (1%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXX 70
           Q++ +YA DW +  I   +  +VD++  + R FSL+D ++  P+A  ERVP         
Sbjct: 9   QLIHSYAPDWAVTAILGILVIAVDEVNGFKRDFSLQDSSLYHPYAVHERVPPVALYMLCG 68

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS 130
                          +S  D H+++            +TE  K TVGRPRPD I RC P 
Sbjct: 69  FAPFAFQCVINYLTLRSWWDAHNSTLGLVLSLALTGAITEFVKLTVGRPRPDLIARCIPQ 128

Query: 131 A-AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
           A A DP  GLS   ICT+TD  L++DG+KSF SGH+S SFAG+GFLS YL+GK+H+FD++
Sbjct: 129 AGAVDPPYGLSTYAICTQTDSYLMRDGWKSFPSGHASLSFAGLGFLSFYLSGKIHLFDRR 188

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKI 247
           G   K +              SRT DYRHH  DV AG+L+G   +YFAY QYYP L S++
Sbjct: 189 GCAPKVWAALTPLSVAALVAISRTMDYRHHATDVIAGALLGIAGAYFAYRQYYPSLASEL 248

Query: 248 SDKPFTIRLKKVV 260
           S +P++ R+K+ V
Sbjct: 249 SHRPYSPRVKREV 261



>gi|299753976|ref|XP_001833670.2| phosphatidic acid phosphatase type 2 domain-containing protein 1A
           [Coprinopsis cinerea okayama7#130]
 gi|298410550|gb|EAU88215.2| phosphatidic acid phosphatase type 2 domain-containing protein 1A
           [Coprinopsis cinerea okayama7#130]
          Length = 449

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/259 (40%), Positives = 146/259 (56%), Gaps = 3/259 (1%)

Query: 2   KKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVP 61
           KKM+   + ++L +YA DW +  +    F+++D++  Y R FSL+D ++++P A  ERVP
Sbjct: 21  KKMTPARRRKLLLSYAPDWAITLLLAAAFYALDKVTGYRRQFSLDDSSLRYPHALHERVP 80

Query: 62  MWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRP 121
                                   +S  D H++S             T+  K TVGRPRP
Sbjct: 81  NGPLYFIVFGIPIILMPLINFFTVRSWWDLHNSSLGLVLGLALTGATTQFIKITVGRPRP 140

Query: 122 DFIDRC-QPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLA 178
           D IDRC  P  A +   GL + T CT+ D  LL +GF+SF SGHSS SFAG+GFL+ YLA
Sbjct: 141 DIIDRCIPPPGATNSEFGLFDWTQCTQADDSLLNEGFRSFPSGHSSMSFAGLGFLAFYLA 200

Query: 179 GKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQ 238
           GKLH+FD +G+  K +              SRT DYRHHW DV  GS +G + SYFAY Q
Sbjct: 201 GKLHLFDTRGHAGKAWAALFPFCGAAMVAISRTMDYRHHWQDVIVGSAMGIIFSYFAYRQ 260

Query: 239 YYPDLHSKISDKPFTIRLK 257
           YYP L S+++ +P++ R+K
Sbjct: 261 YYPPLDSEVAHRPYSPRIK 279



>gi|58259405|ref|XP_567115.1| phospholipid metabolism-related protein [Cryptococcus neoformans
           var. neoformans JEC21]
 gi|134107487|ref|XP_777628.1| hypothetical protein CNBA7490 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50260322|gb|EAL22981.1| hypothetical protein CNBA7490 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57223252|gb|AAW41296.1| phospholipid metabolism-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 354

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 133/248 (53%), Gaps = 4/248 (1%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           I  +YA DW++ F+   +   +D+   + R FSL D +IQ  FAE ERVP  L       
Sbjct: 59  ICASYAPDWIIVFVLWAVLVILDRSGGHKREFSLNDVSIQHSFAEHERVPPVLLVLFSIV 118

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP-S 130
                    +  I ++  D H++             VT++ K +VGRPRPD I RC P  
Sbjct: 119 VPLLVLVPLSSLIARNAWDTHNSVLGLLMSYTMTGVVTQIIKMSVGRPRPDLIARCMPIE 178

Query: 131 AAFD-PGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
            A D P  GL+N +ICT TD  +L DGFKSF SGHSS SFAG+GFLSLYLAGK+H++D  
Sbjct: 179 GAMDHPVFGLTNVSICTNTDAFILDDGFKSFPSGHSSMSFAGLGFLSLYLAGKMHLWDNG 238

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKI 247
           G+  + +              SRTED RHHW DV  GS++G  +++ AY  YYP L    
Sbjct: 239 GHRTRAWAALSPLLGATMVAISRTEDNRHHWQDVLIGSILGLFIAWVAYRTYYPPLSHNQ 298

Query: 248 SDKPFTIR 255
              P   R
Sbjct: 299 CHLPLAPR 306



>gi|321250251|ref|XP_003191744.1| phospholipid metabolism-related protein [Cryptococcus gattii WM276]
 gi|317458211|gb|ADV19957.1| Phospholipid metabolism-related protein, putative [Cryptococcus
           gattii WM276]
          Length = 344

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 133/248 (53%), Gaps = 4/248 (1%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           I  +YA DW++  +  G+   +D+   + R FSL D +IQ  FAE ERVP  L       
Sbjct: 59  ICASYAPDWIIVIVLWGVLIVLDRSGGHKREFSLNDISIQHSFAEHERVPPVLLILFSIV 118

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP-- 129
                    +  + ++  D H++             VT++ K +VGRPRPD I RC P  
Sbjct: 119 VPLLVLVPLSSLVARNAWDTHNSVLGLLMSYTMTGVVTQIIKMSVGRPRPDLIARCMPVE 178

Query: 130 SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
           SA   P  GLSN +ICT T+  +L DGFKSF SGHSS SFAG+GFLSLYLAGK+H++D  
Sbjct: 179 SATDHPVFGLSNVSICTNTNAFILDDGFKSFPSGHSSMSFAGLGFLSLYLAGKMHLWDNG 238

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKI 247
           G+  + +              SRTED RHHW DV  GS++G  +++ AY  YYP L    
Sbjct: 239 GHRTRAWAALSPLLGAAMVAISRTEDNRHHWQDVLVGSILGLFIAWVAYRTYYPPLSHNQ 298

Query: 248 SDKPFTIR 255
              P   R
Sbjct: 299 CHLPLAPR 306



>gi|405118146|gb|AFR92921.1| PAP2 domain-containing protein [Cryptococcus neoformans var. grubii
           H99]
          Length = 354

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 133/248 (53%), Gaps = 4/248 (1%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           I  +YA DW++ F+   +   +D+   + R FSL D +IQ  FAE ERVP  L       
Sbjct: 59  ICASYAPDWIIVFVLWAVLVILDRSGGHKREFSLNDISIQHSFAEHERVPPVLLVFFSIV 118

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP-S 130
                    +  I ++  D H++             VT++ K +VGRPRPD I RC P  
Sbjct: 119 VPLLVLVPLSSLIARNAWDTHNSVLGLLMSYTMTGVVTQIIKMSVGRPRPDLIARCMPVE 178

Query: 131 AAFD-PGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
            A D P  GLSN +ICT T+  +L DGFKSF SGHSS SFAG+GFLSLYLAGK+H++D  
Sbjct: 179 GAMDHPVFGLSNVSICTNTNAFILDDGFKSFPSGHSSMSFAGLGFLSLYLAGKMHLWDNG 238

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKI 247
           G+  + +              SRTED RHHW DV  GS++G  +++ AY  YYP L    
Sbjct: 239 GHRTRAWAALSPLLGAAMVAISRTEDNRHHWQDVLVGSILGLFIAWVAYRTYYPPLSHSQ 298

Query: 248 SDKPFTIR 255
              P   R
Sbjct: 299 CHLPLAPR 306



>gi|472586599|gb|EMS24118.1| phosphatidic acid phosphatase type 2/haloperoxidase family protein
           [Rhodosporidium toruloides NP11]
          Length = 355

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 139/263 (52%), Gaps = 4/263 (1%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           K+ + +  ++++L +Y  DW+L  I + I         Y R FSL D +IQ  FA KER+
Sbjct: 15  KQPVDKSRRLKLLASYLPDWILTIILVAIIGYFTDYAGYKREFSLTDTSIQHTFATKERI 74

Query: 61  PMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPR 120
               C               AL  ++S  D H+               T+V K TVGRPR
Sbjct: 75  SFGECVVYAGVIPAVIIILVALIWRRSFWDMHNGLLGLLLSVSLTTVFTQVVKVTVGRPR 134

Query: 121 PDFIDRCQP--SAAFDPGLGLSNSTICT--RTDLLKDGFKSFLSGHSSTSFAGMGFLSLY 176
           PD IDRCQP   A+  P  GL+   +CT     ++ DGFKSF SGHSS ++AG+G+ +LY
Sbjct: 135 PDLIDRCQPVGGASNHPVYGLATVALCTVQTGHIIDDGFKSFPSGHSSFAWAGLGYFALY 194

Query: 177 LAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAY 236
           LAGK+H+FDQ+G+T K +              SRT DYRHH  DV AG ++G L++   Y
Sbjct: 195 LAGKMHLFDQRGHTIKSWIAITPPIGATLIAVSRTMDYRHHATDVIAGGILGALIAIMTY 254

Query: 237 HQYYPDLHSKISDKPFTIRLKKV 259
           H YYP L S     PF+ R+  +
Sbjct: 255 HLYYPSLFSPQCHLPFSPRIPAI 277



>gi|505759441|gb|EOR03532.1| hypothetical protein J056_002989 [Wallemia ichthyophaga EXF-994]
          Length = 339

 Score =  186 bits (473), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 152/299 (50%), Gaps = 6/299 (2%)

Query: 15  AYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXX 74
           +YA+DWV+C   LG+ + ++ +  Y R F L D +I+    E ERVP+WL          
Sbjct: 44  SYAMDWVICAALLGLLYIINNVHGYWREFDLNDASIRHSHTEDERVPLWLLGILIGLVPI 103

Query: 75  XXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP-SAAF 133
                 +    +S  D HHA              T   K  VGRPRPD I RCQP S A 
Sbjct: 104 VAKILLSTQWYRSYTDLHHALLGFLLTAGLTLSTTTAVKVLVGRPRPDLIARCQPRSGAS 163

Query: 134 DPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY 191
           +  +GL+ + +CT+TD  LL+DGF+SF SGHSSTSFA +G+LS YLAGK+ VFD KG+T 
Sbjct: 164 NADVGLATADVCTQTDFELLQDGFRSFPSGHSSTSFALLGYLSFYLAGKMQVFDTKGHTV 223

Query: 192 KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
           K +              SRT DYRHH  D+ AG ++G   +Y  Y QYYP L + +  KP
Sbjct: 224 KSWICWAPWIGAVLIAVSRTMDYRHHATDIIAGGVIGTFFAYVCYRQYYPHLGNAMCHKP 283

Query: 252 FTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQLLLKDSRALLADSSSNNTEGGSADI 310
              R  +    Y+      DG +   +V +   Q+   +   L+   +      G+ ++
Sbjct: 284 HNTRYVERKDAYRLPRYQGDGVD---SVSEEGMQMGTLNGGGLVGQENRRTGTTGTRNV 339



>gi|388855590|emb|CCF50813.1| related to DPP1-diacylglycerol pyrophosphate phosphatase [Ustilago
           hordei]
          Length = 377

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 132/248 (53%), Gaps = 7/248 (2%)

Query: 15  AYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXX 74
           +Y  DW++  +  G+   ++ +  + R FSL D +IQ  +A   R+P WL          
Sbjct: 50  SYLPDWIITVLLAGLLAIINNVHGFRREFSLTDTSIQHTYATSARIPTWLLVVLAVIIPA 109

Query: 75  XXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP---SA 131
                 +L I +S+ D H+              +T + K TVGRPRPD IDRCQP   S 
Sbjct: 110 LIVAGFSLGISRSVWDLHNGLLGFVLANALTVTITTIIKVTVGRPRPDLIDRCQPIPESV 169

Query: 132 AFDPGLGLSNSTICT---RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
              P  GL    ICT       L+DGF+SF SGH+STSFAG+ +LSLYLAGKLH+FD++G
Sbjct: 170 NRTP-YGLVTDAICTVAADNHTLRDGFRSFPSGHASTSFAGLTYLSLYLAGKLHLFDKRG 228

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKIS 248
           +    +              SRT DYRHH  DV AG L+G  ++Y++Y  YYP L    S
Sbjct: 229 HAVTAWLCGTPLMAATLVAVSRTMDYRHHATDVIAGGLLGLTVAYWSYKLYYPPLGHAQS 288

Query: 249 DKPFTIRL 256
            KP++ R+
Sbjct: 289 HKPYSPRI 296



>gi|443898366|dbj|GAC75701.1| lipid phosphate phosphatase and related enzymes of the PAP2 family
           [Pseudozyma antarctica T-34]
          Length = 356

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 99/262 (37%), Positives = 140/262 (53%), Gaps = 7/262 (2%)

Query: 19  DWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXX 78
           DW++  +  G+   ++ +  + R FSL D +IQ  +A  ERVP WL              
Sbjct: 42  DWIITILLAGLLAIINDVHGFRREFSLTDTSIQHTYAVHERVPTWLLGVLAVLIPALIIV 101

Query: 79  XXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA---FDP 135
             +L I +S+ D H+              +T + K TVGRPRPD IDRCQP A     +P
Sbjct: 102 GFSLGISRSVWDLHNGLLGFVLANALTLTITTIVKCTVGRPRPDLIDRCQPLAGSHNAEP 161

Query: 136 GLGLSNSTICT---RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYK 192
             GL    IC+       L+DGF+SF SGH+STSFAG  +L+LYLAGKLH+FD++G+   
Sbjct: 162 -YGLVTDAICSVGVDNKTLRDGFRSFPSGHASTSFAGFTYLALYLAGKLHLFDRRGHAVT 220

Query: 193 GFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
            +              SRT DYRHH  DV AGSL+G +++Y++Y  YYP L    S KP+
Sbjct: 221 AWLCGTPLMAAALIAISRTMDYRHHATDVIAGSLLGLVVAYWSYKLYYPPLGHAQSHKPY 280

Query: 253 TIRLKKVVPEYKAEFSFMDGSE 274
           + R+        +E ++ + SE
Sbjct: 281 SPRIPNEHLAGASEDAYTEHSE 302



>gi|406702175|gb|EKD05240.1| phospholipid metabolism-related protein [Trichosporon asahii var.
           asahii CBS 8904]
          Length = 334

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/252 (36%), Positives = 141/252 (55%), Gaps = 3/252 (1%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           K ++  +Y  DW++C    GIF+ +D+++ Y RLF + D ++  P+AE ERVP+W+ A  
Sbjct: 17  KWRVFWSYLPDWIICIFLWGIFYLIDKIDGYRRLFDITDTSLAHPYAEHERVPVWMLAVL 76

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                       + AI++S  D H+               T+  K TVGRPRPD   RC 
Sbjct: 77  FGVVPAIIMVIIS-AIQRSFWDAHNTILGFILSLGLCVSFTDFVKITVGRPRPDLFSRCA 135

Query: 129 PSAAF--DPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
           P A +  +P  GL++  +CT T+ L++GF+SF SGHSS ++ GM +L+L+L+ K+   ++
Sbjct: 136 PPADYTANPVHGLTSWKVCTETEHLQEGFRSFPSGHSSFAWTGMWYLTLFLSAKMRALNR 195

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSK 246
           KGYT K +              SRT DYRHH  DV AG +VG L +++ Y QY+P + + 
Sbjct: 196 KGYTIKSWILLAPITGATLVSVSRTMDYRHHATDVIAGGIVGVLAAWWGYRQYFPPIAAP 255

Query: 247 ISDKPFTIRLKK 258
            S K +  R+K 
Sbjct: 256 KSWKTYDPRIKN 267



>gi|393236172|gb|EJD43722.1| PAP2-domain-containing protein [Auricularia delicata TFB-10046 SS5]
          Length = 377

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 155/303 (51%), Gaps = 10/303 (3%)

Query: 3   KMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPM 62
           K  ++S   +++ YA+DWV+  +   +F+ + +++ + R FSL D +IQ+P+   ERVP 
Sbjct: 41  KRRKYSVWFLVQTYAVDWVVSIVLAALFWYLGRIKGFRRRFSLTDTSIQYPYTVHERVPN 100

Query: 63  WLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPD 122
           +  A              +L  ++++ D H               VT + K  VGRPRPD
Sbjct: 101 FALALICGVAPALLVPVVSLVTERTIADLHSGWLGLLVSLAITGSVTNITKVVVGRPRPD 160

Query: 123 FIDRCQPSAAFD--PGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLA 178
            I RCQP       P  GL    ICT+ +  ++ DG++SF SGHSS SFAG+ +LS YLA
Sbjct: 161 LISRCQPIPGVTNAPVFGLVGDVICTQLNEKIMNDGWRSFPSGHSSLSFAGLSYLSFYLA 220

Query: 179 GKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQ 238
           GKLH+FD+ G   K +              SRT DYRHH  DV +GSL+G  ++YF+Y Q
Sbjct: 221 GKLHLFDKIGSGLKAWFTIVPLMGAALVAISRTMDYRHHATDVLSGSLLGLTVAYFSYRQ 280

Query: 239 YYPDLHSKISDKPFTIR-----LKKVVPEYKAEFSFMDGSEVEITVVKNDEQLLLKDSRA 293
           Y+P L+  +S + ++ R     + + VP   A        E E      D+ +  +D  A
Sbjct: 281 YFPPLNDPMSHRCYSPRRRGSMMNRDVPNGPAAPRDHTAGE-EARADDGDDGVAFRDEEA 339

Query: 294 LLA 296
            L 
Sbjct: 340 ALG 342



>gi|320033145|gb|EFW15094.1| PAP2 domain-containing protein [Coccidioides posadasii str.
           Silveira]
          Length = 432

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 141/264 (53%), Gaps = 29/264 (10%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +++ +Y LD+V+    +  FF +D++EP+H+ FSL + T+Q+PFAE ER+PM+L    
Sbjct: 17  RARVIISYILDYVILVALVIGFFILDKVEPHHQHFSLRNYTLQYPFAEHERIPMYLALAI 76

Query: 69  XXXXXXXXXXXXALAI-------------------------KKSMHDWHHASXXXXXXXX 103
                        + I                         K  + + +           
Sbjct: 77  TGGVPIVVIAVYTIVIDGLFSHHKPTNPATGRRKVMGRYRLKDRLWELNCGILGLFLSQA 136

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAFD--PGLGLSNSTICTRTD--LLKDGFKSFL 159
               +T   KN  G+PRPDFIDRC+P    +  P  GLSNSTICT+TD  ++KDGF+SF 
Sbjct: 137 AAFVITSALKNAAGKPRPDFIDRCRPRPGSEDAPVFGLSNSTICTQTDNAIMKDGFRSFP 196

Query: 160 SGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWH 219
           SGHSS++FAG+ +LSLYLAGKLHV D +G  +K F              SR  D RHH  
Sbjct: 197 SGHSSSAFAGLFYLSLYLAGKLHVLDSRGEVWKTFVVLMPTLGAGLVSVSRIMDARHHPF 256

Query: 220 DVFAGSLVGFLLSYFAYHQYYPDL 243
           DV +GSL+G L ++ +Y QY+P +
Sbjct: 257 DVISGSLLGILCAWMSYRQYFPSI 280



>gi|403176727|ref|XP_003335351.2| hypothetical protein PGTG_17204 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375172371|gb|EFP90932.2| hypothetical protein PGTG_17204 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 381

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 146/266 (54%), Gaps = 9/266 (3%)

Query: 2   KKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVP 61
           ++     +I++L +Y  DWV+  +   IF  +D+L  +HR F L D TIQF  A  ER+P
Sbjct: 40  RRTENERRIELLWSYLADWVVVILMAVIFGLLDRLHGHHREFDLNDPTIQFSHAVHERIP 99

Query: 62  MWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRP 121
           +                  +  + +S  D H               VT   K TVGRPRP
Sbjct: 100 VPFLGVLAVVIPAVLIIICSQLLLRSSWDTHIGLLGLALSLSLSLVVTTTVKITVGRPRP 159

Query: 122 DFIDRCQPS-----AAFDPGLGLSNSTICTR---TDLLKDGFKSFLSGHSSTSFAGMGFL 173
           D + RCQPS     A F P  GLSNS++CT    +   +DGF+SF SGHSST++AG+GFL
Sbjct: 160 DMLSRCQPSPTATNAGF-PSYGLSNSSVCTAPVDSREFQDGFRSFPSGHSSTAWAGLGFL 218

Query: 174 SLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSY 233
           SLYLAGKLH+FD++G++ K +              SRT D RHHW DV  GS +G L ++
Sbjct: 219 SLYLAGKLHLFDRRGHSLKVWISIAPLLGAALIAISRTMDNRHHWQDVLIGSALGALTAW 278

Query: 234 FAYHQYYPDLHSKISDKPFTIRLKKV 259
           F Y  YYPDL S+ S +P++ R+  +
Sbjct: 279 FGYRFYYPDLSSQNSHRPYSPRIPSL 304



>gi|392585424|gb|EIW74763.1| PAP2-domain-containing protein [Coniophora puteana RWD-64-598 SS2]
          Length = 344

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 141/253 (55%), Gaps = 6/253 (2%)

Query: 11  QILKAYALDWVLCFIFLGIFFSV-DQLEPYHRLFSLEDKTIQFPFAEKERVPM-WLCAXX 68
           + L  YA DW+   +   ++  V  Q+  + R FSL+D T+ +P+AE +RV +  L A  
Sbjct: 20  KFLATYAPDWITAAVLWAVYVVVWTQVNGFRRQFSLDDTTLHYPYAEHQRVSVPALFAIC 79

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        L ++ S  D HH +            +T++ K  VGRPRPD + RC 
Sbjct: 80  TLLPLACQFVVNRLTVR-SWVDVHHGALGLLLGLSLTGSLTQLVKVGVGRPRPDLLSRCH 138

Query: 129 PS-AAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P+  A DP  GLS   IC + D  LL+DGF+SF SGHSS +FAG+GFL+ YLAGK+H+FD
Sbjct: 139 PAPTAHDPAFGLSTWHICAQPDASLLEDGFRSFPSGHSSMAFAGLGFLACYLAGKMHLFD 198

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
           ++G+  K +              SRT DYRHHW DV  GS++G  ++Y AY QY+P L  
Sbjct: 199 ERGHASKAWTALFPLLGALLVAISRTMDYRHHWEDVTVGSVLGLAVAYLAYRQYFPHLAD 258

Query: 246 KISDKPFTIRLKK 258
           + +  P T RL++
Sbjct: 259 RAAHLPLTGRLER 271



>gi|392866891|gb|EAS29927.2| PAP2 domain-containing protein [Coccidioides immitis RS]
          Length = 432

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 108/333 (32%), Positives = 164/333 (49%), Gaps = 37/333 (11%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +++ +Y LD+V+    +  FF +D++EP+H+ FSL + T+Q+PFAE E +PM+L    
Sbjct: 17  RARVIISYILDYVILVALVIGFFILDKVEPHHQHFSLRNYTLQYPFAEHESIPMYLALAI 76

Query: 69  XXXXXXXXXXXXALAI-------------------------KKSMHDWHHASXXXXXXXX 103
                        + I                         K  + + +           
Sbjct: 77  TGGVPIVVIAVYTIVIDGLFSHHKPTNPATGRRKVMGKYRLKDRLWELNCGILGLFLSQA 136

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAFD--PGLGLSNSTICTRTD--LLKDGFKSFL 159
               +T   KN  G+PRPDFIDRC+P    +  P  GLSNSTICT+TD  ++KDGF+SF 
Sbjct: 137 AAFVITSALKNAAGKPRPDFIDRCRPRPGSEDAPVFGLSNSTICTQTDNAIMKDGFRSFP 196

Query: 160 SGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWH 219
           SGHSS++FAG+ +LSLYLAGKLHV D +G  +K F              SR  D RHH  
Sbjct: 197 SGHSSSAFAGLFYLSLYLAGKLHVLDSRGEVWKTFVVLMPTLGAGLVSVSRIMDARHHPF 256

Query: 220 DVFAGSLVGFLLSYFAYHQYYPDL-HSKISDKPFTIRLKKVVPE-------YKAEFSFMD 271
           DV +GSL+G L ++ +Y QY+P +  +    +   IR    +P+        + E    D
Sbjct: 257 DVISGSLLGILCAWMSYRQYFPSITEAWKKGRAHPIRTWGTIPQPPELVERRRFELDDDD 316

Query: 272 GSEVEITVVKNDEQLLLKDSRALLADSSSNNTE 304
             E +    +++E   +  +R  ++ S    TE
Sbjct: 317 DDEAKPMAPRDEEYQGVTSARPPMSPSQRRETE 349



>gi|170100609|ref|XP_001881522.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164643481|gb|EDR07733.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 343

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 149/277 (53%), Gaps = 34/277 (12%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKER- 59
           ++ MS   + ++L +YA DW         FF++D++  Y R+FSLED +  +P++   + 
Sbjct: 4   RRPMSALRRKRLLFSYAPDW-------AAFFALDKVHGYRRVFSLEDTSYVYPYSLLPQR 56

Query: 60  --------VPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEV 111
                   V +++                 L   +S  D H+              VT+ 
Sbjct: 57  HSQLLLQDVALYMICFVAPLVIQPLIN---LLTIRSWWDLHNV----ILGLALTGAVTQF 109

Query: 112 FKNTVGRPRPD--------FIDRC-QPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLS 160
            K TVGRPRP          I RC  P  A DP  GLS   ICT TD  +++DGF+SF S
Sbjct: 110 TKITVGRPRPGTSISSFPYIIARCLPPQNATDPIFGLSTDAICTNTDVAIMRDGFRSFPS 169

Query: 161 GHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHD 220
           GHSS SFAG+GFLS YLAGKLH+FD++G+  K +              SRT DYRHHWHD
Sbjct: 170 GHSSLSFAGLGFLSFYLAGKLHLFDKRGHAGKAWLSLTPFAGAALVAISRTMDYRHHWHD 229

Query: 221 VFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFTIRLK 257
           V  GS++G +L+YF+Y QYYP L S++S +P++ R+K
Sbjct: 230 VLVGSILGTVLAYFSYRQYYPSLSSELSHRPYSPRIK 266



>gi|303320775|ref|XP_003070382.1| PAP2 superfamily protein [Coccidioides posadasii C735 delta SOWgp]
 gi|240110078|gb|EER28237.1| PAP2 superfamily protein [Coccidioides posadasii C735 delta SOWgp]
          Length = 432

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 140/264 (53%), Gaps = 29/264 (10%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +++ +Y LD+V+    +  FF +D++EP+H+ FSL + T+Q+PFAE E +PM+L    
Sbjct: 17  RARVIISYILDYVILVALVIGFFILDKVEPHHQHFSLRNYTLQYPFAEHESIPMYLALAI 76

Query: 69  XXXXXXXXXXXXALAI-------------------------KKSMHDWHHASXXXXXXXX 103
                        + I                         K  + + +           
Sbjct: 77  TGGVPIVVIAVYTIVIDGLFSHHKPTNPATGRRKVMGRYRLKDRLWELNCGILGLFLSQA 136

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAFD--PGLGLSNSTICTRTD--LLKDGFKSFL 159
               +T   KN  G+PRPDFIDRC+P    +  P  GLSNSTICT+TD  ++KDGF+SF 
Sbjct: 137 AAFVITSALKNAAGKPRPDFIDRCRPRPGSEDAPVFGLSNSTICTQTDNAIMKDGFRSFP 196

Query: 160 SGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWH 219
           SGHSS++FAG+ +LSLYLAGKLHV D +G  +K F              SR  D RHH  
Sbjct: 197 SGHSSSAFAGLFYLSLYLAGKLHVLDSRGEVWKTFVVLMPTLGAGLVSVSRIMDARHHPF 256

Query: 220 DVFAGSLVGFLLSYFAYHQYYPDL 243
           DV +GSL+G L ++ +Y QY+P +
Sbjct: 257 DVISGSLLGILCAWMSYRQYFPSI 280



>gi|401882381|gb|EJT46642.1| phospholipid metabolism-related protein [Trichosporon asahii var.
           asahii CBS 2479]
          Length = 352

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 88/235 (37%), Positives = 133/235 (56%), Gaps = 3/235 (1%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           K ++  +Y  DW++C    GIF+ +D+++ Y RLF + D ++  P+AE ERVP+W+ A  
Sbjct: 17  KWRVFWSYLPDWIICIFLWGIFYLIDKIDGYRRLFDITDTSLAHPYAEHERVPVWMLAVL 76

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                       + AI++S  D H+               T+  K TVGRPRPD   RC 
Sbjct: 77  FGVVPAIIMVIIS-AIQRSFWDAHNTILGFILSLGLCVSFTDFVKITVGRPRPDLFSRCA 135

Query: 129 PSAAF--DPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
           P A +  +P  GL++  +CT T+ L++GF+SF SGHSS ++ GM +L+L+L+ K+   ++
Sbjct: 136 PPADYTANPVHGLTSWKVCTETEHLQEGFRSFPSGHSSFAWTGMWYLTLFLSAKMRALNR 195

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           KGYT K +              SRT DYRHH  DV AG +VG L +++ Y QY+P
Sbjct: 196 KGYTIKSWILLAPITGATLVSVSRTMDYRHHATDVIAGGIVGVLAAWWGYRQYFP 250



>gi|353237970|emb|CCA69930.1| related to DPP1-diacylglycerol pyrophosphate phosphatase
           [Piriformospora indica DSM 11827]
          Length = 335

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 98/258 (37%), Positives = 145/258 (56%), Gaps = 4/258 (1%)

Query: 13  LKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           L   A+  +L      +FF+++++E + R FSL D++IQ+P+   ERVP WL        
Sbjct: 3   LTRPAIPRLLTLALGALFFALNEVEGFRRRFSLHDESIQYPYTLHERVPDWLLGIVCLVV 62

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP-SA 131
                    L   +++ D H++             +T + K T GRPRPD I RCQP S 
Sbjct: 63  PAVTMPLVNLISVRTLWDLHNSELGLILSLALAGSITNILKITAGRPRPDLIARCQPASG 122

Query: 132 AFDPGL-GLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
           + +P + GL +  ICT+T   +++DG++SF SGHSS SFAG+G+L+ YL GKLH+FD++G
Sbjct: 123 SENPAVFGLVDWHICTQTSQSIMRDGWRSFSSGHSSLSFAGLGYLTFYLMGKLHLFDERG 182

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKIS 248
           +T K +              +RT DYRHHW DVF G L+G   +YF+Y QYYP L   +S
Sbjct: 183 HTSKSWISVFPLFGATVVAITRTMDYRHHWQDVFVGMLIGLATAYFSYRQYYPSLEHPLS 242

Query: 249 DKPFTIRLKKVVPEYKAE 266
            +PF  R   +    ++E
Sbjct: 243 HRPFAPRYAPITDAAESE 260



>gi|388579692|gb|EIM20013.1| acid phosphatase/Vanadium-dependent haloperoxidase [Wallemia sebi
           CBS 633.66]
          Length = 339

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 152/282 (53%), Gaps = 5/282 (1%)

Query: 8   SKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAX 67
           SK +++ +Y +DW++C I LG+ + ++ +  Y R F + D TI+  +A +ERVPM L   
Sbjct: 34  SKWKLVASYGMDWIICAILLGLLYLINNVHGYWREFDVNDVTIRHTYATEERVPMTLLGI 93

Query: 68  XXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC 127
                        +    +S  D HH+              T   K   GR RPDFIDRC
Sbjct: 94  IIGLIPLVCLVVLSTQWYRSYTDLHHSILGFLLTISLTISTTTSIKVLAGRMRPDFIDRC 153

Query: 128 QPSA-AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF 184
           QP+A + +  +GLS + ICT+TD  +L+DGF+SF SGHSS+SFA +G+ S YLAGK+ +F
Sbjct: 154 QPTAGSVNADVGLSTAAICTQTDFNILQDGFRSFPSGHSSSSFALLGYFSFYLAGKMQIF 213

Query: 185 DQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLH 244
           D KG+T K +              SRT DYRHH  DV AG+++G   +Y  Y QYYP L 
Sbjct: 214 DTKGHTIKSWICWTPWIGAVLIAVSRTMDYRHHATDVIAGAIIGSFFAYVCYRQYYPHLG 273

Query: 245 SKISDKPFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQL 286
             +S KP   R  +    Y+      +G  +E   V N+ QL
Sbjct: 274 EPLSHKPHNSRYIEANDAYRLPTHQTEGYGLE--RVTNEPQL 313



>gi|134119096|ref|XP_771783.1| hypothetical protein CNBN2280 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50254383|gb|EAL17136.1| hypothetical protein CNBN2280 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 396

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 136/257 (52%), Gaps = 12/257 (4%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +I  +YA DWV+  +          +  Y RLFS+ D ++  P+A+ ERVP+WL A  
Sbjct: 24  RRRIFISYAPDWVITILLW--------INGYRRLFSVTDTSLAHPYADPERVPVWLLAVL 75

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC- 127
                       A  +++S  D H+               T + K TVGRPRPD   RC 
Sbjct: 76  CGIVPAVFIILVAAFVRRSFWDGHNGILGLILGLGLTATFTNIIKITVGRPRPDLFARCI 135

Query: 128 -QPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF 184
             P    +P  GL++ T CT TD   L +GF+SF SGHSS ++ GM +L LYLA K+ + 
Sbjct: 136 LPPDLTSNPVHGLTSWTACTTTDDGRLSEGFRSFPSGHSSFAWCGMWYLILYLAAKMEIN 195

Query: 185 DQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLH 244
           +++G+TYK +              SRT DYRHH  DV AGS++G L  ++AY QYYP L 
Sbjct: 196 NRQGFTYKSWLLLAPLSCATLVAVSRTMDYRHHATDVIAGSVIGLLGGWYAYRQYYPPLS 255

Query: 245 SKISDKPFTIRLKKVVP 261
             ++ KP++ R+ K  P
Sbjct: 256 HPVAYKPYSPRIPKSDP 272



>gi|58262600|ref|XP_568710.1| phospholipid metabolism-related protein [Cryptococcus neoformans
           var. neoformans JEC21]
 gi|57230884|gb|AAW47193.1| phospholipid metabolism-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 396

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 136/257 (52%), Gaps = 12/257 (4%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +I  +YA DWV+  +          +  Y RLFS+ D ++  P+A+ ERVP+WL A  
Sbjct: 24  RRRIFISYAPDWVITILLW--------INGYRRLFSVTDTSLAHPYADPERVPVWLLAVL 75

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC- 127
                       A  +++S  D H+               T + K TVGRPRPD   RC 
Sbjct: 76  CGIVPAVFIILVAAFVRRSFWDGHNGILGLILGLGLTATFTNIIKITVGRPRPDLFARCI 135

Query: 128 -QPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF 184
             P    +P  GL++ T CT TD   L +GF+SF SGHSS ++ GM +L LYLA K+ + 
Sbjct: 136 LPPDLTSNPVHGLTSWTACTTTDDGRLSEGFRSFPSGHSSFAWCGMWYLILYLAAKMEIN 195

Query: 185 DQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLH 244
           +++G+TYK +              SRT DYRHH  DV AGS++G L  ++AY QYYP L 
Sbjct: 196 NRQGFTYKSWLLLAPLSCATLVAVSRTMDYRHHATDVIAGSVIGLLGGWYAYRQYYPPLS 255

Query: 245 SKISDKPFTIRLKKVVP 261
             ++ KP++ R+ K  P
Sbjct: 256 HPVAYKPYSPRIPKSDP 272



>gi|471874159|emb|CCO36094.1| Phosphatidate phosphatase PPAPDC1A [Rhizoctonia solani AG-1 IB]
          Length = 320

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 110/173 (63%), Gaps = 4/173 (2%)

Query: 90  DWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA-AFDPGL-GLSNSTICTR 147
           DWH++             VT+V K TVGRPRPD I RC+P A A D  + GL  + ICT 
Sbjct: 37  DWHNSMLGLVLGLATTGAVTQVVKVTVGRPRPDAIARCKPKADAHDSAVFGLVTTIICTE 96

Query: 148 TD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXX 205
           TD  ++KDG++SF SGHSS SFAG+GFLS YLAGKLH+FD++G+T K +           
Sbjct: 97  TDIHMMKDGWRSFFSGHSSLSFAGLGFLSFYLAGKLHLFDERGHTGKAWIALTPLTGALL 156

Query: 206 XXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFTIRLKK 258
              SRT DYRHHW DV  GS VG + SYFAY QYYP L S  S KP++ R+ +
Sbjct: 157 IAISRTMDYRHHWQDVLVGSTVGLIFSYFAYRQYYPTLESPFSHKPYSPRIPR 209



>gi|485917826|gb|EOD44642.1| putative pap2 domain protein [Neofusicoccum parvum UCRNP2]
          Length = 512

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 114/329 (34%), Positives = 168/329 (51%), Gaps = 33/329 (10%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMW-LCAXXX- 69
           ++ +Y  D+V+  + +  F+++D +EP+H+ FSL + T+Q+ +AEKER+P++ LC     
Sbjct: 20  VILSYIFDYVIIVVLIIAFYALDSVEPHHQEFSLRNYTLQYQYAEKERIPVFDLCIIAVL 79

Query: 70  -------------------XXXXXXXXXXXALAIKKSMHD--W--HHASXXXXXXXXXXX 106
                                          LA K  M D  W  +              
Sbjct: 80  APAIIIAIYTLVIDGIFSHNKTQQMPSGRRKLAGKYRMKDRLWELNCGVLGLMLSVGAAF 139

Query: 107 XVTEVFKNTVGRPRPDFIDRCQPSAAFDP-GLGLSNSTICTRTD--LLKDGFKSFLSGHS 163
            +T   KN VG+PRPD IDRC+P    DP   GLSN +ICT+TD  +LKDGF+SF SGHS
Sbjct: 140 TITGSLKNAVGKPRPDLIDRCKPDVFEDPTPFGLSNHSICTQTDNKILKDGFRSFPSGHS 199

Query: 164 STSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFA 223
           ST+F G+ +LS+YLAGKLHV D KG  +K F              SR  D RHH  DV +
Sbjct: 200 STAFGGLYYLSIYLAGKLHVLDSKGEVWKSFIVMVPTLGAALVAASRIMDARHHPFDVLS 259

Query: 224 GSLVGFLLSYFAYHQYYPDL-HSKISDKPFTIRLKKVVPEYKAEFSFMD--GSEV--EIT 278
           GSL+G L ++ +Y QY+P +  +    + F IR     PE   E   ++  G E   E +
Sbjct: 260 GSLLGILTAWGSYRQYFPPVTETWRKGRAFPIRSWGKDPEIPPEAYPINHEGREPLREGS 319

Query: 279 VVKNDEQLLLKDSRALLADSSSNNTEGGS 307
           +   DE+  ++ +    A S+++  E G+
Sbjct: 320 LKTIDEEQPMRGAEDAGAPSTADVGEPGA 348



>gi|321265826|ref|XP_003197629.1| phospholipid metabolism-related protein [Cryptococcus gattii WM276]
 gi|317464109|gb|ADV25842.1| Phospholipid metabolism-related protein, putative [Cryptococcus
           gattii WM276]
          Length = 393

 Score =  169 bits (428), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 150/290 (51%), Gaps = 15/290 (5%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +I  +YA DW++  +          +  Y RLFS+ D ++  P+A  ER+P+WL A  
Sbjct: 24  RWRIFISYAPDWIITILLW--------INGYRRLFSVTDTSLAHPYANPERIPVWLLAVL 75

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                       A  +++S  D H+               T++ K TVGRPRPD   RC 
Sbjct: 76  CGIVPAILIILAAF-VRRSFWDAHNGILGLILGLGLTATFTDIIKITVGRPRPDLFARCI 134

Query: 129 PSAAF--DPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF 184
             A    +P  GL++ T+CT TD  +L +GF+SF SGHSS ++ GM +L L+LA K+ + 
Sbjct: 135 LPADLTSNPVHGLTSWTVCTTTDDGMLNEGFRSFPSGHSSFAWCGMWYLILFLAAKMGIN 194

Query: 185 DQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLH 244
           +++G+TYK +              SRT DYRHH  DV AG+++G L  ++AY QYYP + 
Sbjct: 195 NRQGFTYKSWLLLAPLSCATLVAISRTMDYRHHATDVIAGAVIGLLGGWYAYRQYYPPIS 254

Query: 245 SKISDKPFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDE--QLLLKDSR 292
             ++ KP++ R+ K  P      S    S     +++ D+  QL  ++ R
Sbjct: 255 DLLAYKPYSPRIPKSDPPPIPLHSHSRSSPSTEMMLRQDQESQLQYRNGR 304



>gi|353239149|emb|CCA71071.1| related to DPP1-diacylglycerol pyrophosphate phosphatase
           [Piriformospora indica DSM 11827]
          Length = 307

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/153 (52%), Positives = 103/153 (67%), Gaps = 4/153 (2%)

Query: 108 VTEVFKNTVGRPRPDFIDRCQP--SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHS 163
           V++V K  VGRPRPD I RC+P   +A  P  GL  S ICT+TD  +++DGF+SF S HS
Sbjct: 45  VSQVTKVMVGRPRPDLIARCKPLQGSANAPIFGLVTSKICTQTDRFIMRDGFRSFPSAHS 104

Query: 164 STSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFA 223
           S SFAG+GFLS YLAGKLH+FD+KGYT K +              SRT DYRHHW DV  
Sbjct: 105 SLSFAGLGFLSFYLAGKLHLFDEKGYTGKSWVSLTPLVGAALIAISRTMDYRHHWQDVLT 164

Query: 224 GSLVGFLLSYFAYHQYYPDLHSKISDKPFTIRL 256
           GS VG + ++F+Y QYYP L S +S +P++ R+
Sbjct: 165 GSTVGIIFAFFSYRQYYPRLSSPLSHRPYSPRI 197



>gi|407916405|gb|EKG09777.1| Phosphatidic acid phosphatase type 2/haloperoxidase [Macrophomina
           phaseolina MS6]
          Length = 509

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 141/271 (52%), Gaps = 32/271 (11%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           KK++S+     ++ +Y  D+++  I +  F+++D +EP+H+ FSLE+ T+ + +A KER+
Sbjct: 13  KKRLSK----TVILSYIFDYLIIVILIITFYALDSVEPHHQEFSLENYTLHYKYAVKERI 68

Query: 61  PMWLCAXXXXXXXXXXXXXXALAI-------------------------KKSMHDWHHAS 95
           P++                  L I                         K  + + +   
Sbjct: 69  PVFDLCIIAVLAPAIIIAFYTLVIDGIFSHNKTQAVSSGRRKLLGKYRMKDRLWELNCGV 128

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPG-LGLSNSTICTRTD--LLK 152
                       +T   KN VG+PRPD IDRCQP    DP  L L+N +ICT+TD  +LK
Sbjct: 129 LGLMLSVGAAFTITGSLKNAVGKPRPDLIDRCQPKIDHDPTPLTLANHSICTQTDNAILK 188

Query: 153 DGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTE 212
           DGF+SF SGHSST+F G+ +LS+YLAGKLHV D KG  +K F              SR  
Sbjct: 189 DGFRSFPSGHSSTAFGGLYYLSIYLAGKLHVLDSKGEVWKSFIVMVPTLGAALVAASRIM 248

Query: 213 DYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           D RHH  DV +GSL+G L ++ +Y QY+P +
Sbjct: 249 DARHHPFDVLSGSLLGILTAWGSYRQYFPPV 279



>gi|119179105|ref|XP_001241176.1| hypothetical protein CIMG_08339 [Coccidioides immitis RS]
          Length = 428

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 104/333 (31%), Positives = 159/333 (47%), Gaps = 41/333 (12%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +++ +Y LD+V+    +  FF +D++EP+H+ FSL + T+Q+PFAE E +PM+L    
Sbjct: 17  RARVIISYILDYVILVALVIGFFILDKVEPHHQHFSLRNYTLQYPFAEHESIPMYLALAI 76

Query: 69  XXXXXXXXXXXXALAI-------------------------KKSMHDWHHASXXXXXXXX 103
                        + I                         K  + + +           
Sbjct: 77  TGGVPIVVIAVYTIVIDGLFSHHKPTNPATGRRKVMGKYRLKDRLWELNCGILGLFLSQA 136

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAFD--PGLGLSNSTICTRTD--LLKDGFKSFL 159
               +T   KN  G+PRPDFIDRC+P    +  P  GLSNSTICT+TD  ++KDGF+SF 
Sbjct: 137 AAFVITSALKNAAGKPRPDFIDRCRPRPGSEDAPVFGLSNSTICTQTDNAIMKDGFRSF- 195

Query: 160 SGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWH 219
               S +FAG+ +LSLYLAGKLHV D +G  +K F              SR  D RHH  
Sbjct: 196 ---PSAAFAGLFYLSLYLAGKLHVLDSRGEVWKTFVVLMPTLGAGLVSVSRIMDARHHPF 252

Query: 220 DVFAGSLVGFLLSYFAYHQYYPDL-HSKISDKPFTIRLKKVVPE-------YKAEFSFMD 271
           DV +GSL+G L ++ +Y QY+P +  +    +   IR    +P+        + E    D
Sbjct: 253 DVISGSLLGILCAWMSYRQYFPSITEAWKKGRAHPIRTWGTIPQPPELVERRRFELDDDD 312

Query: 272 GSEVEITVVKNDEQLLLKDSRALLADSSSNNTE 304
             E +    +++E   +  +R  ++ S    TE
Sbjct: 313 DDEAKPMAPRDEEYQGVTSARPPMSPSQRRETE 345



>gi|405123966|gb|AFR98729.1| Ppapdc1 protein [Cryptococcus neoformans var. grubii H99]
          Length = 382

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 85/226 (37%), Positives = 125/226 (55%), Gaps = 4/226 (1%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +I  +YA DWV+  +  G+F+ +D++  Y RLFS+ D ++  P+A+ ERVP+WL A  
Sbjct: 24  RRRIFISYAPDWVVTILLWGLFYLLDKINGYRRLFSVTDTSLAHPYADPERVPVWLLAVL 83

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC- 127
                       A  +++S  D H+               T + K TVGRPRPD   RC 
Sbjct: 84  CGIVPAVFIILVAAFVRRSFWDGHNGILGLILGLGLTATFTNIVKITVGRPRPDLFARCI 143

Query: 128 -QPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF 184
             P    +P  GL++ T+CT TD   L +GF+SF SGHSS ++ GM +L LYLA K+ + 
Sbjct: 144 LPPDLTSNPVHGLTSWTVCTTTDDGRLNEGFRSFPSGHSSFAWCGMWYLILYLAAKMEIN 203

Query: 185 DQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFL 230
           +++G+TYK +              SRT DYRHH  DV AG+++G L
Sbjct: 204 NRQGFTYKSWLLLAPLSCATLVAVSRTMDYRHHATDVIAGAVIGLL 249



>gi|242789490|ref|XP_002481370.1| PAP2 domain protein [Talaromyces stipitatus ATCC 10500]
 gi|218717958|gb|EED17378.1| PAP2 domain protein [Talaromyces stipitatus ATCC 10500]
          Length = 311

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 132/250 (52%), Gaps = 4/250 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           + YA D+V L F+  G       + P+HR+F L++  IQFPFA+ ERVPM          
Sbjct: 29  RTYAADYVALGFVAAGFILIQLFVTPFHRMFYLDNMAIQFPFAKSERVPMPWSIVYSAVF 88

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   AL  + S H  H +             +T++ KN VGRPRPD IDRC+P   
Sbjct: 89  PTLVLLLWALITRPSAHKLHVSFLGLVVSLAVTPFLTDIIKNAVGRPRPDLIDRCKPEPG 148

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L   ++C + +  +L++G++SF SGHSS +FAG+GFLSL+LAG+LHVF  +   
Sbjct: 149 -TPEHKLVTFSVCMQANEHILQEGWRSFPSGHSSFAFAGLGFLSLFLAGQLHVFRPRADL 207

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR EDYRH   DV AG+++G  ++YF Y +YYP L  K    
Sbjct: 208 GRCLFTFIPTLGALMIAISRCEDYRHDVWDVTAGAILGSSVAYFTYRRYYPSLRDKRCHV 267

Query: 251 PFTIRLKKVV 260
           P+ + + K V
Sbjct: 268 PYDLAVVKGV 277



>gi|328860365|gb|EGG09471.1| hypothetical protein MELLADRAFT_34423 [Melampsora larici-populina
           98AG31]
          Length = 288

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 124/242 (51%), Gaps = 4/242 (1%)

Query: 18  LDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXX 77
           LDWV+ F+     F  D+++ + R F + D +I   F E ERVP+   A           
Sbjct: 25  LDWVITFLLWSAAFICDKIDGFRRQFDIHDSSIAHTFTEHERVPVGQLALLSVFLPAISM 84

Query: 78  XXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGL 137
                    S+ D HH              VT+V K  +GRPRPD +DRC+P      G 
Sbjct: 85  VILNRLQHHSIRDIHHGLLGLLLGLSLTTVVTQVTKICIGRPRPDLLDRCKPQLPLPMGT 144

Query: 138 GLSNSTIC---TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ-KGYTYKG 193
             +NS+IC   T++  L DGF+SF SGHSST++AG+GFLSLY + KL  F++ +      
Sbjct: 145 IWTNSSICSTHTKSYRLIDGFRSFPSGHSSTAWAGLGFLSLYTSAKLKTFEKPERRVVNP 204

Query: 194 FXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFT 253
                          SRT DYRHHW DV  G L+G L+++F+Y  YYP + S+ S +PF 
Sbjct: 205 IFSLLPLILASWISISRTMDYRHHWEDVVIGGLLGMLMAWFSYRMYYPSITSQDSHEPFH 264

Query: 254 IR 255
            R
Sbjct: 265 FR 266



>gi|296423609|ref|XP_002841346.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295637583|emb|CAZ85537.1| unnamed protein product [Tuber melanosporum]
          Length = 488

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/261 (34%), Positives = 133/261 (50%), Gaps = 28/261 (10%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVP-MWLCAXX- 68
           +++ +Y  D+V+  +F+ IF ++D  EPYH+ FSL ++++Q+PFAEKER+P +W      
Sbjct: 15  RVVLSYIFDYVVIIVFILIFSALDLAEPYHQHFSLNNESLQYPFAEKERIPAVWAGVLSC 74

Query: 69  -----------------------XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXX 105
                                              A  +   + + +             
Sbjct: 75  LFPLVFIIFWTMLIDGLYSHHKPPNSRRRLLGNNGAWTLSDRLWEMNCGILGLGLSVAAA 134

Query: 106 XXVTEVFKNTVGRPRPDFIDRCQP--SAAFDPGLGLSNSTICTRTD-LLKDGFKSFLSGH 162
             +T   KNT G+PRPD + RC+P   A   P  GL++  ICT    +LKDGFKS+ SGH
Sbjct: 135 IVMTGALKNTTGKPRPDMLARCKPKEGAQNAPVYGLASYDICTGDKHILKDGFKSWPSGH 194

Query: 163 SSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVF 222
           SS +FAG+G+LSL+LAGKLHVFD +G  +K                SR  D RHH  DV 
Sbjct: 195 SSIAFAGLGYLSLFLAGKLHVFDTRGEVWKTMLVLIPLLAASLVAVSRIMDARHHPFDVI 254

Query: 223 AGSLVGFLLSYFAYHQYYPDL 243
            G ++GF ++Y +Y QY+P L
Sbjct: 255 TGGMMGFFVAYVSYRQYFPPL 275



>gi|121699191|ref|XP_001267939.1| PAP2 domain protein [Aspergillus clavatus NRRL 1]
 gi|119396081|gb|EAW06513.1| PAP2 domain protein [Aspergillus clavatus NRRL 1]
          Length = 309

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/238 (34%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 17  ALDWVLCFIFLGIFFSVDQ-LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXX 75
           A+D+V      GI+  +   ++P+HR+FSL++++IQ+PFA  ERVP+             
Sbjct: 29  AVDYVALACLAGIWVMIQLFVDPFHRMFSLDNRSIQYPFAVVERVPVLWSIIYAGLIPLL 88

Query: 76  XXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDP 135
                A   +   +                  +T++ KN VGRPRPD + RC P     P
Sbjct: 89  VIICWAAVFRPKPYQVQLTVLGLLVALMLTSLITDIIKNAVGRPRPDLVSRCVPKKG-TP 147

Query: 136 GLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKG 193
           G  L   T+CT+T+  +L++G++SF SGHSS SFAG+G+LS++ +G++HVF  +   ++ 
Sbjct: 148 GNALVAWTVCTQTNNHILQEGWRSFPSGHSSFSFAGLGYLSMFFSGQMHVFRPRADLWRC 207

Query: 194 FXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
                          SR EDYRH  +DV  GSL+G ++++F+Y +YYP L S   D P
Sbjct: 208 ILALIPMLGALMIAISRLEDYRHDVYDVTCGSLLGLVVAHFSYRRYYPALRSAACDTP 265



>gi|512196496|gb|EPE25332.1| Acid phosphatase/Vanadium-dependent haloperoxidase [Glarea
           lozoyensis ATCC 20868]
          Length = 308

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/246 (37%), Positives = 130/246 (52%), Gaps = 6/246 (2%)

Query: 14  KAYALDWVLCFIFLGIFFSVD-QLEPYHRLFSLEDKTIQFPFAEKERV-PMWLCAXXXXX 71
           K YA D+V   I +  +  ++  +EP+HRLF   +  IQ+P AEKERV P W        
Sbjct: 28  KTYAPDYVGLIILVSAYMLLEFIVEPFHRLFFTNNINIQYPHAEKERVTPGWNIVYAGGI 87

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                    AL  +  +H  H               +T+V KN VGRPRPD I RC+P+A
Sbjct: 88  PLIILIFTLALT-RAGLHKSHVTILGLFISLILTSFITDVIKNAVGRPRPDLISRCKPAA 146

Query: 132 AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
              P   L + T+CT T+   L DG++SF SGHSS +FAG+G+LSL+  G++HV   +  
Sbjct: 147 G-TPKDVLVDITVCTETNHHTLHDGWRSFPSGHSSFAFAGLGYLSLFFFGQMHVLRPRTD 205

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISD 249
             +                SR EDYRH  +DV  GS++GF ++YF+Y +Y+P L S   D
Sbjct: 206 LGRAMLAIAPLLVAALIAISRCEDYRHDVYDVTCGSILGFSIAYFSYRRYFPRLRSAKCD 265

Query: 250 KPFTIR 255
           +PF  R
Sbjct: 266 EPFPSR 271



>gi|501752355|emb|CCG83653.1| PAP2 domain protein [Taphrina deformans PYCC 5710]
          Length = 247

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 123/226 (54%), Gaps = 4/226 (1%)

Query: 13  LKAYALDWVLCFIFLGIFFSVDQ-LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           L ++  +WV     L +F  ++  ++P+HRLFSL D +IQFP A+ E++P+W+       
Sbjct: 5   LNSHVFEWVTVIGALTLFLVLEHAIDPFHRLFSLADLSIQFPHAKHEQIPVWMLFLISYG 64

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                       +K+  +  H +              T + KN VGRPRPD +DRCQP+ 
Sbjct: 65  IPAIIICVVCTVLKRRTNTLHLSLLALSASTALTVFATALIKNGVGRPRPDLLDRCQPAT 124

Query: 132 AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
              P  GL + ++CT  D   L +GF+SF SGHSS +FAG+GFL+ +LAG+L +F     
Sbjct: 125 G-TPLQGLVDISVCTTKDAHFLNEGFRSFPSGHSSYAFAGLGFLAFWLAGQLMLFKAPPR 183

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFA 235
           ++K F              +RTEDYRHHW DV  G ++GF ++YF 
Sbjct: 184 SWKSFCCFTPIVGAAMIAVTRTEDYRHHWQDVTVGGVMGFTIAYFV 229



>gi|320039699|gb|EFW21633.1| PAP2 domain-containing protein [Coccidioides posadasii str.
           Silveira]
          Length = 312

 Score =  160 bits (404), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 124/243 (51%), Gaps = 4/243 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D++ L  I  G F     +EP+HR+FSLE+ +IQFPFA  ERVP+          
Sbjct: 33  RSYAADYISLAIITAGWFIIQIFVEPFHRMFSLENGSIQFPFAVVERVPVVWAVIYAGIL 92

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   A   +   H  H               +T+V KN VGRPRPD I RC+P   
Sbjct: 93  PLMIIGIWAAVTRSGSHFTHVTILGFLATLILTSFLTDVVKNAVGRPRPDLISRCKPEKG 152

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L +  +C  TD  +L +G++SF SGHSS +F G+G+LSL+ AG+LHVF  +   
Sbjct: 153 -TPAHTLVSFNVCLETDHHILHEGWRSFPSGHSSFAFGGLGYLSLFFAGQLHVFRPRSGL 211

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR  DYRH  +DV  GSL+G   +YF Y +YYP L S   D 
Sbjct: 212 ARFLFSAAPLLGALMIAMSRLADYRHDVYDVTVGSLLGLFTAYFTYRRYYPSLKSIDCDT 271

Query: 251 PFT 253
           P++
Sbjct: 272 PYS 274



>gi|392863140|gb|EJB10612.1| PAP2 domain-containing protein, variant 1 [Coccidioides immitis RS]
          Length = 312

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 124/243 (51%), Gaps = 4/243 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D++ L  I  G F     +EP+HR+FSLE+ +IQFPFA  ERVP+          
Sbjct: 33  RSYAADYISLAIITAGWFIIQIFVEPFHRMFSLENGSIQFPFAVVERVPVVWAVIYAGIL 92

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   A   +   H  H               +T+V KN VGRPRPD I RC+P   
Sbjct: 93  PLMIIGIWAAVTRSGSHFTHVTILGFLATLILTSFLTDVVKNAVGRPRPDLISRCKPEKG 152

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L +  +C  TD  +L +G++SF SGHSS +F G+G+LSL+ AG+LHVF  +   
Sbjct: 153 -TPAHTLVSFNVCLETDHHILHEGWRSFPSGHSSFAFGGLGYLSLFFAGQLHVFRPRSGL 211

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR  DYRH  +DV  GSL+G   +YF Y +YYP L S   D 
Sbjct: 212 ARFLFSGAPLLGALMIAMSRLADYRHDVYDVTVGSLLGLFTAYFTYRRYYPSLKSIDCDT 271

Query: 251 PFT 253
           P++
Sbjct: 272 PYS 274



>gi|406860901|gb|EKD13958.1| PAP2 domain protein [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 305

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 96/275 (34%), Positives = 136/275 (49%), Gaps = 18/275 (6%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           K YA D++ L  +F      V  ++P+HR+F + +  IQ+P A  ERVP+          
Sbjct: 30  KTYAPDYLGLALLFTSYLLLVFLVQPFHRMFFINNINIQYPHALVERVPVKWGIVYGAIV 89

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                     A +  +H +H               +T+  KN VGRPRPD I RC+P+  
Sbjct: 90  PLFVLVVWLSASRAGVHKFHVTILGLLISIFLTLFITDSIKNAVGRPRPDLIARCKPAPG 149

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L    +CT TD   L DG++SF SGHSS +F+G+GFL+L+ AG++HVF  +   
Sbjct: 150 -TPDNVLVTVDVCTETDSHTLHDGWRSFPSGHSSFAFSGLGFLALFFAGQMHVFRPRTDL 208

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            K                SR EDYRH  +DV  GS++G  ++YF+Y +YYP LHS   D+
Sbjct: 209 SKALLAIAPLLGAALIAISRCEDYRHDVYDVTCGSVLGMTIAYFSYRRYYPRLHSAKCDE 268

Query: 251 PFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQ 285
           PF  R          E SF +G       +K DE+
Sbjct: 269 PFQSR----------ESSFNEG----FAKIKTDEE 289



>gi|494834120|gb|EON69846.1| hypothetical protein W97_09109 [Coniosporium apollinis CBS 100218]
          Length = 314

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/242 (36%), Positives = 127/242 (52%), Gaps = 4/242 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V L  I          ++P+HR+FSL++  IQ+P AE ERVP+          
Sbjct: 30  RSYASDYVGLAMIAAAYALLRLFMDPFHRMFSLDNLAIQYPHAEVERVPVPFLFVYAGAI 89

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   AL ++ ++H  H               +T+V KN+VGRPRPD I RC+P   
Sbjct: 90  PLALIIIWALVLRPTIHKAHVTVLGFIISLILTSFLTDVVKNSVGRPRPDLIARCKPEPG 149

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L    ICT TD   L DG++SF SGHSS +F+G+G+ +L+LAG+L VF  +   
Sbjct: 150 -TPAHALVTFEICTETDHHALHDGWRSFPSGHSSFAFSGLGYFALFLAGQLFVFRPRTDL 208

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR EDYRH  +DV AGS +GF ++ F Y +YYP L  ++ D 
Sbjct: 209 ARALLAFAPMLGAALIAISRCEDYRHDVYDVTAGSFLGFGIALFTYRRYYPPLRHRLCDT 268

Query: 251 PF 252
           P+
Sbjct: 269 PY 270



>gi|212534186|ref|XP_002147249.1| PAP2 domain protein [Talaromyces marneffei ATCC 18224]
 gi|210069648|gb|EEA23738.1| PAP2 domain protein [Talaromyces marneffei ATCC 18224]
          Length = 312

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 144/290 (49%), Gaps = 19/290 (6%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           + YA D+V L  + +G       + P+HR+F L++  IQFPFA+ ERVPM          
Sbjct: 29  RTYAADYVALGVVAIGFILIQLFVTPFHRMFYLDNMAIQFPFAQSERVPMRWSIVYSAVL 88

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   AL  + S H  H +             +T++ KN VGRPRPD IDRC+P A 
Sbjct: 89  PLLVLLLWALITRPSTHKLHVSFLGLAVSLITTPFLTDIIKNAVGRPRPDLIDRCKPEAG 148

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L   ++C +++  +L++G++SF SGHSS +FAG+GFLSL+LAG+LHVF  +   
Sbjct: 149 -TPEHKLVTFSVCMQSNEHILQEGWRSFPSGHSSFAFAGLGFLSLFLAGQLHVFRPRADL 207

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR EDYRH   DV AG+++G  ++YF Y +YYP L       
Sbjct: 208 GRCLFAFFPILGAIMIAISRCEDYRHDVWDVTAGAILGSSVAYFTYRRYYPSLRDIRCHV 267

Query: 251 PFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQLLLKDSRALLADSSS 300
           P+ +                D        + +DE+ LL  + AL +D  S
Sbjct: 268 PYDL---------------ADAKGEGFAKLADDEERLLHVNGALGSDQES 302



>gi|326474141|gb|EGD98150.1| PAP2 domain-containing protein [Trichophyton tonsurans CBS 112818]
          Length = 426

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/262 (33%), Positives = 128/262 (48%), Gaps = 31/262 (11%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +I+ +Y  D+V+    +  FF +D++EP+H+ F+L++ T+ +P+A  ERVP+ L    
Sbjct: 17  RARIVLSYISDYVILIALIIGFFILDRVEPFHQPFALQNYTLHYPYAVNERVPIPLALAI 76

Query: 69  XXXXXXXXXXXXALAI-------------------------KKSMHDWHHASXXXXXXXX 103
                        + +                         K  + + +           
Sbjct: 77  SGGFPVLVIVVYTIVLDGLFSHSKPVNIATGKRRLMGKYRLKDRLWELNCGILGLVLAQG 136

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSG 161
               +T   KN  G+PRPD IDRC+P     P  GLSN TICT+TD  +LKDGF+SF   
Sbjct: 137 AAFVITGALKNACGKPRPDLIDRCKPRTFEQPEFGLSNYTICTQTDHEILKDGFRSF--- 193

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
             S SFAG+ +LSLYLAGKLHV D +G  +K F              +R  D RHH  DV
Sbjct: 194 -PSASFAGLFYLSLYLAGKLHVMDSRGEVWKAFIVMVPTLSAGLVAVTRIMDARHHPFDV 252

Query: 222 FAGSLVGFLLSYFAYHQYYPDL 243
            +GSL+G    + AY QY+P L
Sbjct: 253 ISGSLLGVGCGWVAYRQYFPSL 274



>gi|67523335|ref|XP_659728.1| hypothetical protein AN2124.2 [Aspergillus nidulans FGSC A4]
 gi|40745800|gb|EAA64956.1| hypothetical protein AN2124.2 [Aspergillus nidulans FGSC A4]
 gi|259487499|tpe|CBF86224.1| TPA: PAP2 domain protein (AFU_orthologue; AFUA_6G10030)
           [Aspergillus nidulans FGSC A4]
          Length = 314

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 126/233 (54%), Gaps = 8/233 (3%)

Query: 23  CFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXAL 82
           C+IF+ IF +     P+HR+F+L+++ +Q+PFA  ERVP+                  A 
Sbjct: 43  CWIFIQIFVT-----PFHRMFALDNQALQYPFATVERVPVLWSIFYAGVIPLLILLVWAA 97

Query: 83  AIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNS 142
             + S +                  +T++ KN VGRPRPD I RC P     P   L   
Sbjct: 98  VFRPSPYKVQVTILGFLTAIMLTSLLTDIIKNAVGRPRPDLISRCMPRKG-TPESTLVYW 156

Query: 143 TICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXX 200
           T+CT+T+  +L++G++SF SGHSS SFAG+G+LSL+ +G++HVF  +    +        
Sbjct: 157 TVCTQTNEHILQEGWRSFPSGHSSFSFAGLGYLSLFFSGQMHVFRPRTDLCRCLLVLIPI 216

Query: 201 XXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFT 253
                   SR +DYRH  +DV +G+++G +++YF Y +Y+P L S   D P++
Sbjct: 217 VCALMVAISRLDDYRHDVYDVTSGTILGSVVAYFCYRRYFPPLRSFRCDTPYS 269



>gi|358367140|dbj|GAA83759.1| PAP2 domain protein [Aspergillus kawachii IFO 4308]
          Length = 294

 Score =  153 bits (386), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 130/244 (53%), Gaps = 9/244 (3%)

Query: 12  ILKAYALDWVLC-FIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXX 70
           ++ A AL  ++  +I + IF +     P+HR+FSL++K+IQ+PFA  ERVP+        
Sbjct: 11  VVDAVALACIVAAWILIQIFAT-----PFHRMFSLDNKSIQYPFAVVERVPVVWSIIYAG 65

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS 130
                     A   +   H                  +T++ KN  GRPRPD I RC P 
Sbjct: 66  VIPFLLLLAWAAVFRPYPHKVQVTLLGFLIALMLTSLITDIIKNAAGRPRPDLISRCLPR 125

Query: 131 AAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
                 L L + T+CT+T+  +L++G++SF SGHSS SF G+G++SL+L+G++HVF  + 
Sbjct: 126 KGTPKDL-LVSWTVCTQTNEHILQEGWRSFPSGHSSFSFGGLGYMSLFLSGQMHVFRPRT 184

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKIS 248
              +                SR +DYRH  +DV  GSL+G +++YF+Y +YYP L S   
Sbjct: 185 DLCRCLVAFAPLLCALLVAISRLDDYRHDVYDVTCGSLLGLMVAYFSYRRYYPALRSVTC 244

Query: 249 DKPF 252
           D P+
Sbjct: 245 DCPY 248



>gi|330947493|ref|XP_003306894.1| hypothetical protein PTT_20194 [Pyrenophora teres f. teres 0-1]
 gi|311315320|gb|EFQ84991.1| hypothetical protein PTT_20194 [Pyrenophora teres f. teres 0-1]
          Length = 513

 Score =  152 bits (385), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 133/271 (49%), Gaps = 34/271 (12%)

Query: 7   FSKIQILKA----YALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPM 62
           FSK ++ K+    Y  D+++ F  L IF  VD++ P+H+ F+LE+ T+ +PFA KERVP+
Sbjct: 17  FSKQRLPKSVIFSYIGDYLIIFALLIIFTVVDKIPPFHQHFALENYTLHYPFATKERVPV 76

Query: 63  -WLC-------------------------AXXXXXXXXXXXXXXALAIKKSMHDWHHASX 96
            WLC                         A                  K  + + +    
Sbjct: 77  FWLCVYVILAPAVIIGIYTMVIDGLFSHQAAMPAGRAGIKRLSGRYRFKDRLWELNCGIL 136

Query: 97  XXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ--PSAAFDPGLGLSNSTICTRTD--LLK 152
                      +T   KN +G+PRPDFI RC    +        L    ICT+T+  +L+
Sbjct: 137 GLGLSIGAAYTITGALKNAIGKPRPDFISRCMIDETKINTAKYALQTIDICTQTNNYILQ 196

Query: 153 DGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTE 212
           DGFKSF SGHSS SFAG+ +LS+YLAGKLHV D KG  ++                +R  
Sbjct: 197 DGFKSFPSGHSSVSFAGLFYLSIYLAGKLHVMDAKGEVWRTLIVLVPALGAALITGTRIM 256

Query: 213 DYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           D RHH  DV +G+L+G L+S+ +Y QY+P +
Sbjct: 257 DARHHPFDVISGALIGILVSWASYRQYFPPV 287



>gi|317032298|ref|XP_001394521.2| PAP2 domain protein [Aspergillus niger CBS 513.88]
          Length = 317

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 130/244 (53%), Gaps = 9/244 (3%)

Query: 12  ILKAYALDWVL-CFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXX 70
           ++ A AL  ++  +I + IF +     P+HR+FSL++K+IQ+PFA  ERVP+        
Sbjct: 34  VVDAVALACIVGAWILIQIFAT-----PFHRMFSLDNKSIQYPFAVVERVPVVWSIVYAG 88

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS 130
                     A   +   H                  +T++ KN  GRPRPDFI RC P 
Sbjct: 89  VIPFLVLLAWAAVFRPYPHKVQVTLLGFLIALMLTSLITDIIKNAAGRPRPDFISRCLPR 148

Query: 131 AAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
                 L L + T+CT+T+  +L++G++SF SGHSS SF G+G++SL+L+G++HVF  + 
Sbjct: 149 KGTPKDL-LVSWTVCTQTNEHILQEGWRSFPSGHSSFSFGGLGYMSLFLSGQMHVFRPRT 207

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKIS 248
              +                SR +DYRH  +DV  GSL+G  ++YF+Y +YYP L S   
Sbjct: 208 DLCRCLVAFVPLLGALLIAISRLDDYRHDVYDVTCGSLLGLTVAYFSYRRYYPALRSIKC 267

Query: 249 DKPF 252
           D P+
Sbjct: 268 DCPY 271



>gi|358395276|gb|EHK44663.1| Pap2-like protein [Trichoderma atroviride IMI 206040]
          Length = 300

 Score =  152 bits (383), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 129/246 (52%), Gaps = 11/246 (4%)

Query: 14  KAYALDWVLCFIFL-GIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           K +A D+V   + L G    V+ + P+HR+F   D  I +P AE ERV + L        
Sbjct: 24  KTHAPDYVGFIVLLAGWMLIVNLVNPFHRMFFTNDLRISYPHAEHERVTVPLNFLYALFI 83

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                    +  + S H                  +T+V KN VGRPRPD + RCQPSA 
Sbjct: 84  PLGVLIAYNIITRASTHKHEATYLSFAISIVLSSFITDVVKNAVGRPRPDLLARCQPSAD 143

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
            +P + L N  +CT  D   L+DG++SF SGHSS SFAG+GFLSL+LAG+LHVF+   YT
Sbjct: 144 TEPNV-LVNIDVCTAPDGHTLQDGWRSFPSGHSSFSFAGLGFLSLFLAGQLHVFNY--YT 200

Query: 191 -----YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
                 +                SRTEDYRH  +DV  GS +G  ++Y++Y +++P L S
Sbjct: 201 GGRDLSRALVCLAPLLGAALIAISRTEDYRHDVYDVCVGSALGMTVAYWSYRRHWPHLTS 260

Query: 246 KISDKP 251
            + ++P
Sbjct: 261 PVCEEP 266



>gi|134079208|emb|CAL00382.1| unnamed protein product [Aspergillus niger]
          Length = 292

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 117/217 (53%), Gaps = 3/217 (1%)

Query: 38  PYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXX 97
           P+HR+FSL++K+IQ+PFA  ERVP+                  A   +   H        
Sbjct: 31  PFHRMFSLDNKSIQYPFAVVERVPVVWSIVYAGVIPFLVLLAWAAVFRPYPHKVQVTLLG 90

Query: 98  XXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGF 155
                     +T++ KN  GRPRPDFI RC P       L L + T+CT+T+  +L++G+
Sbjct: 91  FLIALMLTSLITDIIKNAAGRPRPDFISRCLPRKGTPKDL-LVSWTVCTQTNEHILQEGW 149

Query: 156 KSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYR 215
           +SF SGHSS SF G+G++SL+L+G++HVF  +    +                SR +DYR
Sbjct: 150 RSFPSGHSSFSFGGLGYMSLFLSGQMHVFRPRTDLCRCLVAFVPLLGALLIAISRLDDYR 209

Query: 216 HHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
           H  +DV  GSL+G  ++YF+Y +YYP L S   D P+
Sbjct: 210 HDVYDVTCGSLLGLTVAYFSYRRYYPALRSIKCDCPY 246



>gi|327296185|ref|XP_003232787.1| PAP2 domain-containing protein [Trichophyton rubrum CBS 118892]
 gi|326465098|gb|EGD90551.1| PAP2 domain-containing protein [Trichophyton rubrum CBS 118892]
          Length = 430

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/262 (35%), Positives = 133/262 (50%), Gaps = 27/262 (10%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +I+ +Y  D+V+    +  FF +D++EP+H+ F+L++ T+ +P+A  ERVP+ L    
Sbjct: 17  RARIVLSYISDYVILIALIIGFFILDRVEPFHQPFALQNYTLHYPYAVNERVPIPLALAI 76

Query: 69  XXXXXXXXXXXXALAI-------------------------KKSMHDWHHASXXXXXXXX 103
                        + +                         K  + + +           
Sbjct: 77  SGGFPVLVIVVYTIVLDGLFSHSKPVNIATGKRKLMGKYRLKDRLWELNCGILGLVLAQG 136

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSG 161
               +T   KN  G+PRPD IDRC+P     P  GLSN TICT+TD  +LKDGF+SF SG
Sbjct: 137 AAFVITGALKNACGKPRPDLIDRCKPRTFEQPEFGLSNYTICTQTDHEILKDGFRSFPSG 196

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
           HSS+SFAG+ +LSLYLAGKLHV D +G  +K F              SR  D RHH  DV
Sbjct: 197 HSSSSFAGLFYLSLYLAGKLHVMDSRGEVWKAFIVMVPTLSAGLVAVSRIMDARHHPFDV 256

Query: 222 FAGSLVGFLLSYFAYHQYYPDL 243
            +GSL+G    + AY QY+P L
Sbjct: 257 ISGSLLGVGCGWVAYRQYFPSL 278



>gi|212540628|ref|XP_002150469.1| PAP2 domain protein [Talaromyces marneffei ATCC 18224]
 gi|210067768|gb|EEA21860.1| PAP2 domain protein [Talaromyces marneffei ATCC 18224]
          Length = 424

 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 106/330 (32%), Positives = 152/330 (46%), Gaps = 47/330 (14%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXX 70
           +++ +Y  D+V    F   F+ +DQ+EPYH+ FSLE+K++Q+PFA KER+ +        
Sbjct: 18  RVIISYIFDYVFIIGFAAGFWVLDQIEPYHQHFSLENKSLQYPFAVKERITIQEALLISI 77

Query: 71  XXXXXXXXXXALAI--------------------------KKSMHDWHHASXXXXXXXXX 104
                      L I                          K  + + +            
Sbjct: 78  ASPLVVIILYTLVIDGLFSHHKSSSPDGSGRRKLTGPYRLKDRLWELNCGILGLFLSQGL 137

Query: 105 XXXVTEVFKNTVGRPRPDFIDRCQPSAAFD--PGLGLSNSTICTRTD-LLKDGFKSFLSG 161
               T++ KN  G+PRPD IDRCQP+      P  GLSNSTICT    L+KDGF+S+ SG
Sbjct: 138 AFVTTQILKNACGKPRPDLIDRCQPAPGSHDLPVFGLSNSTICTGDPVLIKDGFRSWPSG 197

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
           HSS+SFAG+ +LSLYL GK+H+ D +G  +K                +R  D RHH  DV
Sbjct: 198 HSSSSFAGLFYLSLYLGGKMHIMDNRGEVWKTIIVMVPILAATLIAVTRIMDARHHPFDV 257

Query: 222 FAGSLVGFLLSYFAYHQYYPDLHSKISD-KPFTIRLKKVVPEYKAEFSFMDGSEVEITVV 280
             GSL+G   ++ +Y QY+P L       + + IR     P   A  S            
Sbjct: 258 ITGSLLGVFTAWASYRQYFPSLSEPWKKGRAYPIRSWGTEPRLPAGMS------------ 305

Query: 281 KNDEQLLLKDSRALLADSSSNNTEGGSADI 310
           +ND+ + L+D R          T+G  AD+
Sbjct: 306 ENDDTIPLRDGRG-----EQIYTQGRQADV 330



>gi|212534188|ref|XP_002147250.1| PAP2 domain protein [Talaromyces marneffei ATCC 18224]
 gi|210069649|gb|EEA23739.1| PAP2 domain protein [Talaromyces marneffei ATCC 18224]
          Length = 328

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/306 (31%), Positives = 146/306 (47%), Gaps = 35/306 (11%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           + YA D+V L  + +G       + P+HR+F L++  IQFPFA+ ERVPM + +      
Sbjct: 29  RTYAADYVALGVVAIGFILIQLFVTPFHRMFYLDNMAIQFPFAQSERVPMRMSSFTLSNL 88

Query: 73  XXXXXXXXALA----------------IKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTV 116
                   ++                  + S H  H +             +T++ KN V
Sbjct: 89  FLIWRTGWSIVYSAVLPLLVLLLWALITRPSTHKLHVSFLGLAVSLITTPFLTDIIKNAV 148

Query: 117 GRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLS 174
           GRPRPD IDRC+P A   P   L   ++C +++  +L++G++SF SGHSS +FAG+GFLS
Sbjct: 149 GRPRPDLIDRCKPEAG-TPEHKLVTFSVCMQSNEHILQEGWRSFPSGHSSFAFAGLGFLS 207

Query: 175 LYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYF 234
           L+LAG+LHVF  +    +                SR EDYRH   DV AG+++G  ++YF
Sbjct: 208 LFLAGQLHVFRPRADLGRCLFAFFPILGAIMIAISRCEDYRHDVWDVTAGAILGSSVAYF 267

Query: 235 AYHQYYPDLHSKISDKPFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQLLLKDSRAL 294
            Y +YYP L       P+ +                D        + +DE+ LL  + AL
Sbjct: 268 TYRRYYPSLRDIRCHVPYDL---------------ADAKGEGFAKLADDEERLLHVNGAL 312

Query: 295 LADSSS 300
            +D  S
Sbjct: 313 GSDQES 318



>gi|451854171|gb|EMD67464.1| hypothetical protein COCSADRAFT_179122 [Bipolaris sorokiniana
           ND90Pr]
          Length = 318

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 86/242 (35%), Positives = 125/242 (51%), Gaps = 4/242 (1%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQL-EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V   I L  +  +  L EP+HR+F L++  I +P AE ERV +          
Sbjct: 29  RSYASDYVGIAILLCGYIPIQFLTEPFHRMFFLDNLAIGYPHAEIERVSVGWLLIFSAAV 88

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   AL  +   H  H               +T+V KN VGRPRPD I RC+P+  
Sbjct: 89  PLGLLVVWALLFRPGSHKAHVTILGLIISLILTSFITDVIKNAVGRPRPDLIARCKPAPG 148

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L    +CT TD  +L DG++SF SGHSS +F+G+G+LSL+LAG+ HV+  +   
Sbjct: 149 -TPAHQLVTYKVCTETDHHILHDGWRSFPSGHSSFAFSGLGYLSLFLAGQCHVYRPRADL 207

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR EDYRH  +DV  GSL+G  ++++ Y +YYP L +++   
Sbjct: 208 ARVLFALAPLLGAALIAISRCEDYRHDVYDVTVGSLLGLAIAHYTYRRYYPALRNRLCAT 267

Query: 251 PF 252
           PF
Sbjct: 268 PF 269



>gi|302503135|ref|XP_003013528.1| PAP2 domain protein [Arthroderma benhamiae CBS 112371]
 gi|291177092|gb|EFE32888.1| PAP2 domain protein [Arthroderma benhamiae CBS 112371]
          Length = 418

 Score =  150 bits (379), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 90/253 (35%), Positives = 121/253 (47%), Gaps = 36/253 (14%)

Query: 23  CFIFLGI-----FFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXX 77
           CF F G      FF +D++EP+H+ F+L++ T+ +P+A  ERVP+ L             
Sbjct: 17  CFFFAGSALIVGFFILDRVEPFHQPFALQNYTLHYPYAVHERVPIPLALAISGGFPVLVI 76

Query: 78  XXXALAI-------------------------KKSMHDWHHASXXXXXXXXXXXXVTEVF 112
               + +                         K  + + +               +T   
Sbjct: 77  VVYTIVLDGLFSHSKPVNIATGKRKLMGKYRLKDRLWELNCGILGLVLAQGAAFVITGAL 136

Query: 113 KNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGM 170
           KN  G+PRPD IDRC+P     P  GLSN TICT+TD  +LKDGF+SF     S SFAG+
Sbjct: 137 KNACGKPRPDLIDRCKPRTFEQPEFGLSNYTICTQTDHEILKDGFRSF----PSASFAGL 192

Query: 171 GFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFL 230
            +LSLYLAGKLHV D +G  +K F              SR  D RHH  DV +GSL+G  
Sbjct: 193 FYLSLYLAGKLHVMDSRGEVWKAFIVMVPTLSAGLVAVSRIMDARHHPFDVISGSLLGVG 252

Query: 231 LSYFAYHQYYPDL 243
             + AY QY+P L
Sbjct: 253 CGWVAYRQYFPSL 265



>gi|296810780|ref|XP_002845728.1| PAP2 domain-containing protein [Arthroderma otae CBS 113480]
 gi|238843116|gb|EEQ32778.1| PAP2 domain-containing protein [Arthroderma otae CBS 113480]
          Length = 427

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 134/262 (51%), Gaps = 27/262 (10%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +I+ +Y  D+V+    +  FF +D++EP+H+ F+L++ T+ +P+A  ERVP+ L    
Sbjct: 17  RARIILSYISDYVILIALIIGFFILDRVEPFHQPFALQNYTLHYPYAVHERVPIPLALAI 76

Query: 69  XXXXXXXXXXXXALAI-------------------------KKSMHDWHHASXXXXXXXX 103
                        + +                         K  + + +           
Sbjct: 77  SGGFPILVIVVYTIVLDGLFSHSKPVNIATGKRKLMGKYRFKDRLWELNCGVLGLALAQG 136

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSG 161
               +T   KN  G+PRPD IDRC+P +   P  GLSN TICT+T+  +LKDGF+SF SG
Sbjct: 137 AAFVITGALKNACGKPRPDLIDRCKPKSFEQPEFGLSNYTICTQTNHEILKDGFRSFPSG 196

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
           HSS+SFAG+ +LSLYLAGKLHV D +G  +K F              SR  D RHH  DV
Sbjct: 197 HSSSSFAGLFYLSLYLAGKLHVMDSRGEVWKAFIVMVPTLSAGLVAVSRIMDARHHPFDV 256

Query: 222 FAGSLVGFLLSYFAYHQYYPDL 243
            +GSL+G    + AY QY+P L
Sbjct: 257 ISGSLLGVGCGWVAYRQYFPSL 278



>gi|347831388|emb|CCD47085.1| similar to PAP2 domain-containing protein [Botryotinia fuckeliana
           T4]
 gi|472239056|gb|EMR83887.1| putative pap2 domain protein [Botryotinia fuckeliana BcDW1]
          Length = 305

 Score =  150 bits (378), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 147/296 (49%), Gaps = 22/296 (7%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQL-EPYHRLFSLEDKTIQFPFAEKERVPM-WLCAXXXXX 71
           K+YA D+V   + L  +  ++ L EP+HR+F + +  IQ+P A  ERVP+ W        
Sbjct: 27  KSYAPDYVGFVLLLTAYVLIEFLQEPFHRMFFINNINIQYPHALVERVPVGWNLIYAGVI 86

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                     ++ + ++H  H               +T+V KN VGRPRPD I RC+P+ 
Sbjct: 87  PCITLAIWLGIS-RANLHKCHVTILGFFIGLVLTSFITDVIKNAVGRPRPDLISRCKPTP 145

Query: 132 AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
              P   L    +CT TD   L DG++SF SGHSS +FAG+G+L+ + AG+ HVF  +  
Sbjct: 146 E-TPENKLVTIHVCTETDHHTLHDGWRSFPSGHSSFAFAGLGYLAFFFAGQTHVFRPRTD 204

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISD 249
             +                SR EDYRH  +DV  GS++G  L+YF+Y +Y+P LHS    
Sbjct: 205 LGRVLLALAPLLGAAMIAISRCEDYRHDVYDVTCGSILGISLAYFSYRRYFPRLHSSKCH 264

Query: 250 KPFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQLLLKDSRALLADSSSNNTEG 305
           +P+        P  +A F+   G       +KNDE+  +  +R    D S N ++ 
Sbjct: 265 EPY--------PSREAAFNQGFGK------IKNDEETEVGRAREF--DVSDNESDA 304



>gi|317038184|ref|XP_001401753.2| phosphatidic acid phosphatase [Aspergillus niger CBS 513.88]
 gi|350632262|gb|EHA20630.1| hypothetical protein ASPNIDRAFT_213045 [Aspergillus niger ATCC
           1015]
          Length = 441

 Score =  150 bits (378), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 151/311 (48%), Gaps = 28/311 (9%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMW--LCA 66
           K +++ +Y  D+V+    +G F+ +D +EPYH+ FSL + +IQ+P+A  ER+ +   LC 
Sbjct: 16  KQRVILSYIFDYVILIACIGGFYVLDSIEPYHQHFSLRNISIQYPYAVHERITIQEALCI 75

Query: 67  XXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXX-----------------------XXX 103
                          +    S H   H                                 
Sbjct: 76  SGLAPLVIIIVYTLFIDGLFSHHKTQHPVSGKRKFTGPYRWKDRLWELNCGILGLLLSQG 135

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGL-GLSNSTICT-RTDLLKDGFKSFLSG 161
               +T+V KN  G+PRPDFIDRCQP A     + GLSNSTICT    L+KDGF+S+ SG
Sbjct: 136 LAFVITQVLKNACGKPRPDFIDRCQPRAGSQDAIPGLSNSTICTGEHALIKDGFRSWPSG 195

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
           HSS+SFAG+ +L+L+L+GKLH+ D +G  +K                SR  D RHH  DV
Sbjct: 196 HSSSSFAGLFYLTLWLSGKLHIMDNRGEAWKTLLVMIPSLAATLVAVSRIMDARHHPFDV 255

Query: 222 FAGSLVGFLLSYFAYHQYYPDLHSKISD-KPFTIRLKKVVPEYKAEFSFMDGSEVEITVV 280
             GSL+G + +  +Y QY+P L+      + + IR     P    E   + G++     +
Sbjct: 256 ITGSLLGIICACISYRQYFPSLNEPWKKGRAYPIRTWGRDPVGPVETVRLVGTDGSTAAL 315

Query: 281 KNDEQLLLKDS 291
           +N E+  L ++
Sbjct: 316 RNPEEERLNEA 326



>gi|226292050|gb|EEH47470.1| diacylglycerol pyrophosphate phosphatase [Paracoccidioides
           brasiliensis Pb18]
          Length = 321

 Score =  149 bits (377), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 124/243 (51%), Gaps = 4/243 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V L  I +G       + P+HR+F+L++ +IQFPF E ERVP+          
Sbjct: 32  RSYAADYVSLIVIVVGWMLIQIFVLPFHRMFTLDNVSIQFPFTEVERVPVLWSIIYSEVF 91

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   A+ I+  +H  H +             +T + KN VGRPRPD + RC P   
Sbjct: 92  PLVVIVLWAVIIRPEVHFAHVSVLGLLVTLALTSFLTNIIKNAVGRPRPDLLSRCSPKKG 151

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L    +C   D   L +G++SF SGHSS +F G+G+L+++L+G+L VF  +   
Sbjct: 152 -TPDHLLVTLDVCGEPDSHKLHEGWRSFPSGHSSIAFGGLGYLAMFLSGQLRVFRPRTGL 210

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            K                SR EDYRH  +DV AGSL+G   +YF Y +YYP L S   + 
Sbjct: 211 AKFLFSLSPLLGALMIAMSRLEDYRHDVYDVTAGSLLGLSAAYFTYRRYYPPLRSVDCEN 270

Query: 251 PFT 253
           P++
Sbjct: 271 PYS 273



>gi|358366219|dbj|GAA82840.1| PAP2 domain protein [Aspergillus kawachii IFO 4308]
          Length = 441

 Score =  149 bits (376), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 151/311 (48%), Gaps = 28/311 (9%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMW--LCA 66
           K +++ +Y  D+V+    +G F+ +D +EPYH+ FSL + +IQ+P+A  ER+ +   LC 
Sbjct: 16  KQRVILSYIFDYVILIACIGGFYVLDSIEPYHQHFSLRNISIQYPYAVHERITIQEALCI 75

Query: 67  XXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXX-----------------------XXX 103
                          +    S H   H                                 
Sbjct: 76  SGLAPLVIIIVYTLFIDGLFSHHKTQHPVSGKRKFTGPYRWKDRLWELNCGILGLLLSQG 135

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGL-GLSNSTICT-RTDLLKDGFKSFLSG 161
               +T+V KN  G+PRPDFIDRCQP A     + GLSNSTICT    L+KDGF+S+ SG
Sbjct: 136 LAFVITQVLKNACGKPRPDFIDRCQPRAGSQDAIPGLSNSTICTGEHALIKDGFRSWPSG 195

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
           HSS+SFAG+ +L+L+L+GKLH+ D +G  +K                SR  D RHH  DV
Sbjct: 196 HSSSSFAGLFYLTLWLSGKLHIMDNRGEAWKTLLVMIPSLAATLVAVSRIMDARHHPFDV 255

Query: 222 FAGSLVGFLLSYFAYHQYYPDLHSKISD-KPFTIRLKKVVPEYKAEFSFMDGSEVEITVV 280
             GSL+G + +  +Y QY+P L+      + + IR     P   AE   +  ++     +
Sbjct: 256 ITGSLLGIICACISYRQYFPSLNEPWKKGRAYPIRTWGRDPVGPAETVRLVAADGSTAAL 315

Query: 281 KNDEQLLLKDS 291
           +N E+  L ++
Sbjct: 316 RNPEEERLNEA 326



>gi|170100637|ref|XP_001881536.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164643495|gb|EDR07747.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 432

 Score =  149 bits (376), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 77/155 (49%), Positives = 99/155 (63%), Gaps = 13/155 (8%)

Query: 115 TVGRPRPDFIDRC-QPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSS------- 164
           TV +P  D I RC  P  A DP  GLS   ICT TD  +++DGF+SF SGHSS       
Sbjct: 203 TVSKPT-DIIARCLPPQNATDPIFGLSTDAICTNTDVAIMRDGFRSFPSGHSSRRRLTQP 261

Query: 165 --TSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVF 222
              SFAG+GFLS YLAGKLH+FD++G+  K +              SRT DYRHHWHDV 
Sbjct: 262 ITVSFAGLGFLSFYLAGKLHLFDKRGHAGKAWLSLTPFAGAALVAISRTMDYRHHWHDVL 321

Query: 223 AGSLVGFLLSYFAYHQYYPDLHSKISDKPFTIRLK 257
            GS++G +L+YF+Y QYYP L S++S +P++ R+K
Sbjct: 322 VGSILGTVLAYFSYRQYYPSLSSELSHRPYSPRIK 356



>gi|452000081|gb|EMD92543.1| hypothetical protein COCHEDRAFT_1100221 [Bipolaris maydis C5]
 gi|477591166|gb|ENI08239.1| hypothetical protein COCC4DRAFT_129832 [Bipolaris maydis ATCC
           48331]
          Length = 316

 Score =  149 bits (376), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 125/242 (51%), Gaps = 4/242 (1%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQL-EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V   + L  +  +  L EP+HR+F L++  I +P AE ERV +          
Sbjct: 29  RSYASDYVGIALLLCGYIPIQFLGEPFHRMFFLDNLAIGYPHAEIERVSVGWLLIFAGAV 88

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   AL  +   H  H               +T+V KN VGRPRPD I RC+P+  
Sbjct: 89  PLGLLVAWALLFRPGSHKAHVTILGLIISLILTSFITDVIKNAVGRPRPDLIARCKPAPG 148

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L    +CT TD  +L DG++SF SGHSS +F+G+G+LSL+LAG+ HV+  +   
Sbjct: 149 -TPAHQLVTYKVCTETDHHILHDGWRSFPSGHSSFAFSGLGYLSLFLAGQCHVYRPRADL 207

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR EDYRH  +DV  GSL+G  ++++ Y +YYP L +++   
Sbjct: 208 ARVLFALAPLLGAALIAISRCEDYRHDVYDVTVGSLLGLAIAHYTYRRYYPALRNRLCAT 267

Query: 251 PF 252
           PF
Sbjct: 268 PF 269



>gi|295673728|ref|XP_002797410.1| diacylglycerol pyrophosphate phosphatase [Paracoccidioides sp.
           'lutzii' Pb01]
 gi|226282782|gb|EEH38348.1| diacylglycerol pyrophosphate phosphatase [Paracoccidioides sp.
           'lutzii' Pb01]
          Length = 321

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 124/243 (51%), Gaps = 4/243 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V L  I +G       + P+HR+F+L++ +IQFPF E ERVP+          
Sbjct: 32  RSYAADYVSLIVIVVGWMLIQIFVLPFHRMFTLDNVSIQFPFTEVERVPVLWSIIYSEVF 91

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   A+ I+  +H  H +             +T + KN VGRPRPD + RC P   
Sbjct: 92  PFVVIVLWAVIIRPEVHFAHVSVLGLLVTLALTSFLTNIIKNAVGRPRPDLLSRCSPKKG 151

Query: 133 FDPGLGLSNSTICTRTDL--LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L    +C   D   L +G++SF SGHSS +F G+G+L+++L+G+L VF  +   
Sbjct: 152 -TPEHLLVTLDVCGEPDSHKLHEGWRSFPSGHSSIAFGGLGYLAMFLSGQLRVFRPRTGL 210

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            K                SR EDYRH  +DV AGSL+G   +YF Y +YYP L S   + 
Sbjct: 211 AKFLFSLSPLLGALMIAMSRLEDYRHDVYDVTAGSLLGLSAAYFTYRRYYPPLRSVDCEN 270

Query: 251 PFT 253
           P++
Sbjct: 271 PYS 273



>gi|242801249|ref|XP_002483723.1| PAP2 domain protein [Talaromyces stipitatus ATCC 10500]
 gi|218717068|gb|EED16489.1| PAP2 domain protein [Talaromyces stipitatus ATCC 10500]
          Length = 424

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 152/314 (48%), Gaps = 36/314 (11%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +I+ +Y LD+V    F   F+++D +EPYH+ FSLE+K++Q+PFA KER+ +      
Sbjct: 16  RARIIISYILDYVFIIGFAVGFWALDAIEPYHQHFSLENKSLQYPFAVKERITIQEALLI 75

Query: 69  XXXXXXXXXXXXALAI-------------------------KKSMHDWHHASXXXXXXXX 103
                       +L I                         K  + + +           
Sbjct: 76  SIVSPLVIIVLYSLLIDGLFSHHKTLVDGSGRRKLTGPYRLKDRLWELNCGILGLLLSQG 135

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQPSAAF--DPGLGLSNSTICT-RTDLLKDGFKSFLS 160
                T++ KN  G+PRPD IDRC+P+      P  GLSNSTICT    L+KDGF+S+ S
Sbjct: 136 LAFVTTQILKNACGKPRPDLIDRCRPAPDSHDQPVFGLSNSTICTGDPALIKDGFRSWPS 195

Query: 161 GHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHD 220
           GHSS+SFAG+ +LSLYL+GK+H+ D++G  +K                SR  D RHH  D
Sbjct: 196 GHSSSSFAGLFYLSLYLSGKMHIMDKRGEVWKAIIVMVPILAATLIAVSRIMDARHHPFD 255

Query: 221 VFAGSLVGFLLSYFAYHQYYPDLHSKISD-KPFTIRLKKVVPEYKAEFSFMDGSEVEITV 279
           V  GSL+G   ++ +Y QY+P L       + + IR     P   A  ++    +     
Sbjct: 256 VITGSLLGVFTAWASYRQYFPSLSEPWKKGRAYPIRSWGSEPRVPAGIAYSGTPD----- 310

Query: 280 VKNDEQLLLKDSRA 293
             ND+ + L+D  A
Sbjct: 311 --NDDTVPLRDGAA 322



>gi|350631303|gb|EHA19674.1| hypothetical protein ASPNIDRAFT_56002 [Aspergillus niger ATCC 1015]
          Length = 317

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 129/244 (52%), Gaps = 9/244 (3%)

Query: 12  ILKAYALDWVL-CFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXX 70
           ++ A AL  ++  +I + IF +     P+HR+FSL++++IQ+PFA  ERVP+        
Sbjct: 34  VVDAVALACIVGAWILIQIFAT-----PFHRMFSLDNRSIQYPFAVVERVPVVWSIIYAG 88

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS 130
                     A   +   H                  +T++ KN  GRPRPD I RC P 
Sbjct: 89  VIPFLVLLAWAAMFRPYPHKVQVTLLGFLIALMLTSLITDIIKNAAGRPRPDLISRCLPR 148

Query: 131 AAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
                 L L + T+CT+T+  +L++G++SF SGHSS SF G+G++SL+L+G++HVF  + 
Sbjct: 149 KGTPKDL-LVSWTVCTQTNEHILQEGWRSFPSGHSSFSFGGLGYMSLFLSGQMHVFRPRT 207

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKIS 248
              +                SR +DYRH  +DV  GSL+G  ++YF+Y +YYP L S   
Sbjct: 208 DLCRCLVAFVPLLGALLIAISRLDDYRHDVYDVTCGSLLGLTVAYFSYRRYYPALRSIKC 267

Query: 249 DKPF 252
           D P+
Sbjct: 268 DCPY 271



>gi|392863139|gb|EJB10611.1| PAP2 domain-containing protein [Coccidioides immitis RS]
          Length = 289

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 124/243 (51%), Gaps = 27/243 (11%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D++ L  I  G F     +EP+HR+FSLE+ +IQFPFA  ERVP+ + A      
Sbjct: 33  RSYAADYISLAIITAGWFIIQIFVEPFHRMFSLENGSIQFPFAVVERVPV-VWAVIYAGI 91

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                     A+ +S                      +V KN VGRPRPD I RC+P   
Sbjct: 92  LPLMIIGIWAAVTRS----------------------DVVKNAVGRPRPDLISRCKPEKG 129

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L +  +C  TD  +L +G++SF SGHSS +F G+G+LSL+ AG+LHVF  +   
Sbjct: 130 -TPAHTLVSFNVCLETDHHILHEGWRSFPSGHSSFAFGGLGYLSLFFAGQLHVFRPRSGL 188

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR  DYRH  +DV  GSL+G   +YF Y +YYP L S   D 
Sbjct: 189 ARFLFSGAPLLGALMIAMSRLADYRHDVYDVTVGSLLGLFTAYFTYRRYYPSLKSIDCDT 248

Query: 251 PFT 253
           P++
Sbjct: 249 PYS 251



>gi|451852432|gb|EMD65727.1| hypothetical protein COCSADRAFT_114850 [Bipolaris sorokiniana
           ND90Pr]
          Length = 513

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 89/273 (32%), Positives = 134/273 (49%), Gaps = 34/273 (12%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           KK++S+    +++ +Y  D+++  + +  F  VD++ P+H+ FSL++ T+ +PFA KERV
Sbjct: 17  KKRLSK----KVIFSYIGDYLIIIVLMLTFAIVDKIPPFHQPFSLDNYTLHYPFATKERV 72

Query: 61  P-MWLC-------------------------AXXXXXXXXXXXXXXALAIKKSMHDWHHA 94
           P +WLC                         A                  K  + + +  
Sbjct: 73  PVIWLCVYVVLAPAVIIGIYTMVIDGLFSHQAAMPANRTGLKRLSGRYRFKDRLWELNCG 132

Query: 95  SXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA--FDPGLGLSNSTICTRTD--L 150
                        +T   KN +G+PRPD I RC    A        L    ICT+ D  +
Sbjct: 133 ILGLGLSIGAAFTITGALKNAIGKPRPDLISRCLIDQAKINTERYALQTIDICTQKDNYI 192

Query: 151 LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSR 210
           L+DGFKSF SGHSS SFAG+ +LS+YLAGKLHV D KG  ++ F              +R
Sbjct: 193 LQDGFKSFPSGHSSVSFAGLFYLSIYLAGKLHVLDAKGEVWRSFIVMVPALGAALITGTR 252

Query: 211 TEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
             D RHH  DV +G+L+G L+++ +Y QY+P +
Sbjct: 253 IMDARHHPFDVISGALLGILVAWGSYRQYFPPV 285



>gi|425775486|gb|EKV13754.1| hypothetical protein PDIP_47070 [Penicillium digitatum Pd1]
          Length = 292

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 82/242 (33%), Positives = 123/242 (50%), Gaps = 4/242 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           + YA D++ L F+  G       + P+HR+FSL++K IQ+PFA  ERVP+          
Sbjct: 10  RTYAADYIALGFLVAGWLLIQIFVNPFHRMFSLDNKAIQYPFAVHERVPVLWSVIFAGLI 69

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   +   +  +                   +T+V KN  GRPRPD + RC+PS  
Sbjct: 70  PFLVILAWSAIFRVGVQKTQVTVLGLFVALMLTSFLTDVIKNAAGRPRPDLLSRCKPSRG 129

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
                 L   T+CT ++  +L++G++SF SGHSS SF G+G+L L+L G++HVF  +   
Sbjct: 130 -TANNALVAWTVCTESNQHVLQEGWRSFPSGHSSFSFGGLGYLYLFLCGQMHVFRPRTDL 188

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR  DYRH  +DV  G L+G L+++F+Y +YYP L S I D 
Sbjct: 189 GRCLLAFSPLLCALMVALSRLADYRHDVYDVTCGGLLGMLIAWFSYRRYYPPLRSVICDV 248

Query: 251 PF 252
           P+
Sbjct: 249 PY 250



>gi|425766320|gb|EKV04936.1| hypothetical protein PDIG_86000 [Penicillium digitatum PHI26]
          Length = 310

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 82/242 (33%), Positives = 123/242 (50%), Gaps = 4/242 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           + YA D++ L F+  G       + P+HR+FSL++K IQ+PFA  ERVP+          
Sbjct: 28  RTYAADYIALGFLVAGWLLIQIFVNPFHRMFSLDNKAIQYPFAVHERVPVLWSVIFAGLI 87

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   +   +  +                   +T+V KN  GRPRPD + RC+PS  
Sbjct: 88  PFLVILAWSAIFRVGVQKTQVTVLGLFVALMLTSFLTDVIKNAAGRPRPDLLSRCKPSRG 147

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
                 L   T+CT ++  +L++G++SF SGHSS SF G+G+L L+L G++HVF  +   
Sbjct: 148 -TANNALVAWTVCTESNQHVLQEGWRSFPSGHSSFSFGGLGYLYLFLCGQMHVFRPRTDL 206

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR  DYRH  +DV  G L+G L+++F+Y +YYP L S I D 
Sbjct: 207 GRCLLAFSPLLCALMVALSRLADYRHDVYDVTCGGLLGMLIAWFSYRRYYPPLRSVICDV 266

Query: 251 PF 252
           P+
Sbjct: 267 PY 268



>gi|327348655|gb|EGE77512.1| hypothetical protein BDDG_00449 [Ajellomyces dermatitidis ATCC
           18188]
          Length = 321

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 126/244 (51%), Gaps = 4/244 (1%)

Query: 13  LKAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           L++YA D+V L  + +G       + P++R+F+L++ +IQFPFAE ERVP+         
Sbjct: 31  LRSYAADYVSLIVLVVGWILIQIFVRPFYRMFTLDNVSIQFPFAEVERVPVLWSIIYAGV 90

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                    A+ I+   H  H +             +T++ KN VGRPRPD + RC P  
Sbjct: 91  MPLIIIIVWAVIIRPETHFTHVSVLGLLVTLALTSFLTDIIKNAVGRPRPDLLSRCSPEK 150

Query: 132 AFDPGLGLSNSTIC--TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
              P   +    +C    +  L +G++SF SGHSS +FAG+G+L+++ AG+LHVF  +  
Sbjct: 151 G-TPAHKMVTIEVCGAPESHRLHEGWRSFPSGHSSFAFAGLGYLAMFFAGQLHVFQPRTG 209

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISD 249
             +                SR  DYRH  +DV  GSL+G  ++YF Y +YYP L S   D
Sbjct: 210 LARFLFSLSPLLGALLIAMSRLADYRHDVYDVAVGSLLGISVAYFTYRRYYPPLQSVYCD 269

Query: 250 KPFT 253
            P++
Sbjct: 270 APYS 273



>gi|471572212|gb|EMR70745.1| putative pap2 superfamily protein [Eutypa lata UCREL1]
          Length = 315

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 115/222 (51%), Gaps = 6/222 (2%)

Query: 36  LEPYHRLFSLEDKTIQFPFAEKERVPMWLC---AXXXXXXXXXXXXXXALAIKKSMHDWH 92
           +EP+HR+F + D  I FP AE ERVP+WL    A                  + S H  H
Sbjct: 47  VEPFHRMFYINDLRIAFPHAEIERVPVWLNFVYALFAPLGVLLAWNTVVARARSSFHKQH 106

Query: 93  HASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--L 150
                          +T++ KNTVGRPRPD + RC+P     P   L    +CT TD   
Sbjct: 107 STILGLAISLILASFLTDIVKNTVGRPRPDLVARCKPGPG-APRDVLVTIDVCTETDHHT 165

Query: 151 LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSR 210
           L DG++SF SGHSS SFAG+G+L+L+LAG+L +F  +    +                SR
Sbjct: 166 LHDGWRSFPSGHSSFSFAGLGYLALFLAGQLRIFRDRRDLGRALVCIAPLVGAAMIAISR 225

Query: 211 TEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
            +DYRH  +DV  GS +G  +++F+Y +Y+P L  +  D+P+
Sbjct: 226 CQDYRHDVYDVCVGSALGLTVAWFSYRRYWPRLSHRDCDEPY 267



>gi|462422633|gb|EMJ26896.1| hypothetical protein PRUPE_ppa008624mg [Prunus persica]
          Length = 324

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 124/236 (52%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKER-VPMWLCAXX 68
           +++L+ +  DW++  +   I   ++ +EP+HR F  ED      +  K+  VP W     
Sbjct: 16  VKVLRIHMHDWLILLVLAAIDLGLNLIEPFHR-FVGEDMMTDLKYPLKDNTVPFWGVPII 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I+K ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AVLLPLAVILVYYF-IRKDVYDLHHAILGLLFSIFITAVLTDAIKDGVGRPRPDFFWRCF 133

Query: 129 P--SAAFDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     FDP   ++ + +CT +  ++K+G KSF SGH+S SFAG+GF++ YL+GK+ VFD
Sbjct: 134 PDGKGVFDP---ITKNVMCTGSKSVIKEGHKSFPSGHTSWSFAGLGFIAWYLSGKVRVFD 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW DVFAG L+G  ++ F Y Q++P
Sbjct: 191 RRGHVAKLCIVFLPLLLAAMVAVSRVDDYWHHWQDVFAGGLIGITIASFCYLQFFP 246



>gi|238602578|ref|XP_002395717.1| hypothetical protein MPER_04183 [Moniliophthora perniciosa FA553]
 gi|215466933|gb|EEB96647.1| hypothetical protein MPER_04183 [Moniliophthora perniciosa FA553]
          Length = 240

 Score =  147 bits (371), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 87/124 (70%)

Query: 135 PGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGF 194
           P  GLS   ICTRTDLL DGF+SF SGHSS SFAG+GF + YLAGKLH+FD++G+  K +
Sbjct: 19  PEFGLSTWLICTRTDLLTDGFRSFPSGHSSLSFAGLGFFAYYLAGKLHLFDKRGHAGKAW 78

Query: 195 XXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFTI 254
                         SRT DYRHHW DV  GS++G ++SYFAY QYYP L S++S KPF+ 
Sbjct: 79  ISLAPFAAAALVAISRTMDYRHHWQDVLIGSILGTIMSYFAYRQYYPPLSSEMSHKPFSP 138

Query: 255 RLKK 258
           R+K+
Sbjct: 139 RIKR 142



>gi|396470303|ref|XP_003838611.1| similar to lipid phosphate phosphatase 1 [Leptosphaeria maculans
           JN3]
 gi|312215179|emb|CBX95132.1| similar to lipid phosphate phosphatase 1 [Leptosphaeria maculans
           JN3]
          Length = 522

 Score =  147 bits (371), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 85/276 (30%), Positives = 136/276 (49%), Gaps = 37/276 (13%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           KK++S+    +++ +Y +D+++  + +G+F  VD++ P+H+ FSL++ T+ +PFA KERV
Sbjct: 17  KKRLSK----KVIFSYIVDYLIIVVLIGVFAIVDKIPPFHQHFSLDNYTLHYPFAVKERV 72

Query: 61  PMWLCAXXXXXXXXXXXXXXALAI--------------------------KKSMHDWHHA 94
           P+                   L I                          K  + + +  
Sbjct: 73  PVIWLCVYVMGAPAVVIGIYTLVIDGLFSHQTTMPSGRSGIKRLSGRYRFKDRLWELNCG 132

Query: 95  SXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP-----SAAFDPGLGLSNSTICTRTD 149
                        +T   KN +G+PRPD + RC+      +A       L+   ICT+ D
Sbjct: 133 ILGLALSVAAAFTITGALKNAIGKPRPDLMSRCEADPVKIAAVRAVNYTLATIDICTQKD 192

Query: 150 --LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXX 207
             +L+DGFKSF SGHSS SFAG+ +LS+YLAGKLHV D KG  ++ F             
Sbjct: 193 DYILQDGFKSFPSGHSSVSFAGLFYLSIYLAGKLHVMDAKGEVWRTFLVMVPALGAALIT 252

Query: 208 XSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
            +R  D RHH  DV +G+ +G  +++ +Y QY+P +
Sbjct: 253 GTRIMDARHHPFDVLSGATLGIAVAWVSYRQYFPPV 288



>gi|255942779|ref|XP_002562158.1| Pc18g03180 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586891|emb|CAP94542.1| Pc18g03180 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 413

 Score =  147 bits (370), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 125/237 (52%), Gaps = 2/237 (0%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +++ +Y  D+V+    +  F  ++ +EPYH+ FSL + +IQ+P+A  ER+PM      
Sbjct: 15  RPRVVISYIFDYVIIIACVAGFAILNTIEPYHQHFSLNNISIQYPYAVHERIPMAYAVCI 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        L I   + + +               +T+  KN  G+PRPD IDRCQ
Sbjct: 75  SCGFPLVLIIVYTLFIDGLLWELNCGVLGLLLAQGLAFVITQALKNACGKPRPDLIDRCQ 134

Query: 129 PSAAF-DPGLGLSNSTICT-RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
           P A   D   GLSNS+ICT    LL DGF+S+ SGHSS+SFAG+ ++SL+L GKLHV D 
Sbjct: 135 PRAGSKDLFPGLSNSSICTGDPHLLTDGFRSWPSGHSSSSFAGLVYISLWLGGKLHVMDN 194

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           +G  +K                SR  D RHH  DV  GS++G    + AY QY+P L
Sbjct: 195 RGEAWKALLVMTPLLAATLVAVSRIMDARHHPFDVITGSMLGIACGFVAYRQYFPPL 251



>gi|402218896|gb|EJT98971.1| PAP2-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 376

 Score =  146 bits (369), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 97/253 (38%), Positives = 138/253 (54%), Gaps = 6/253 (2%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           ++++YA D+ L  +   IF  +     + + FS  D +IQ  +A+ ERVPMW        
Sbjct: 42  LIRSYAPDYALTILLFFIFGLIAHRPGFKQQFSTLDPSIQHTYAQHERVPMWAAVLIAAV 101

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ-PS 130
                         +S++D H A+            +T++ K TVGRPRPD + RC  P 
Sbjct: 102 FPFTCFLFIGGVWLRSLYDLHAATLGLLLTLSLTTVLTDLCKLTVGRPRPDLLARCLLPP 161

Query: 131 AAFDPGL---GLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
              D G    GL ++++CT+T+  +L DGFKSF SGHSS SFAG+GFLS YLAGK+ ++D
Sbjct: 162 DTSDAGFPYYGLVSASLCTQTNQHILNDGFKSFFSGHSSFSFAGLGFLSFYLAGKVGLWD 221

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
           +KG+  K +              SR  DYRHHW D+  GSLVG+L+S+F Y  YYP L S
Sbjct: 222 RKGHAIKPWICGAPLVVAALVAISRVMDYRHHWQDIVVGSLVGWLMSWFVYRLYYPPLTS 281

Query: 246 KISDKPFTIRLKK 258
             + KP+  R+  
Sbjct: 282 PHASKPYAPRVPP 294



>gi|189202966|ref|XP_001937819.1| lipid phosphate phosphatase 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187984918|gb|EDU50406.1| lipid phosphate phosphatase 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 516

 Score =  146 bits (369), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 131/271 (48%), Gaps = 34/271 (12%)

Query: 7   FSKIQILKA----YALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPM 62
           FSK ++ K+    Y  D+++ F  L IF  VD++ P+H+ F+LE+ T+ +PFA KERVP+
Sbjct: 15  FSKKRLPKSVIFSYIGDYLIIFALLIIFTIVDKIPPFHQHFALENYTLHYPFATKERVPV 74

Query: 63  WLCAXXXXXXXXXXXXXXALAI--------------------------KKSMHDWHHASX 96
           +                  + I                          K  + + +    
Sbjct: 75  FWLCVYVILAPAVIIGIYTMVIDGLFSHQTAMPAGRAGIKRLSGRYRFKDRLWELNCGIL 134

Query: 97  XXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ--PSAAFDPGLGLSNSTICTRTD--LLK 152
                      +T   KN +G+PRPD I RC    +        L    ICT+T+  +L+
Sbjct: 135 GLGLSIGAAYTITGALKNAIGKPRPDLISRCMIDETKINTAKYALQTIDICTQTNNYILQ 194

Query: 153 DGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTE 212
           DGFKSF SGHSS SFAG+ +LS+YLAGKLHV D KG  ++                +R  
Sbjct: 195 DGFKSFPSGHSSVSFAGLFYLSIYLAGKLHVMDAKGEVWRTLIVLVPALGAALITGTRIM 254

Query: 213 DYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           D RHH  DV +G+L+G L+S+ +Y QY+P +
Sbjct: 255 DARHHPFDVISGALIGILVSWASYRQYFPPV 285



>gi|156047531|ref|XP_001589784.1| hypothetical protein SS1G_09506 [Sclerotinia sclerotiorum 1980]
 gi|154693901|gb|EDN93639.1| hypothetical protein SS1G_09506 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 305

 Score =  146 bits (368), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 142/295 (48%), Gaps = 20/295 (6%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQL-EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           K+YA D++   + L  +  ++ L EP+HR+F + +  IQ+P A  ERV +W         
Sbjct: 27  KSYAPDYLGFVLLLTAYILIEFLQEPFHRMFFINNINIQYPHARVERVSVWWNLMYAGAV 86

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                       + ++H  H               +T+V KN VGRPRPD I RC+P+  
Sbjct: 87  PCITLALWLGISRANLHKCHVTMLGFLIGLVLTSFITDVIKNAVGRPRPDLISRCKPTPG 146

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L    +CT  D   L DG++SF SGHSS +FAG+G+L+ + AG+ HVF  +   
Sbjct: 147 -TPENKLVTIDVCTERDHHTLHDGWRSFPSGHSSFAFAGLGYLAFFFAGQTHVFRPRTDL 205

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR EDYRH  +DV  GS++G  L+YF+Y +Y+P L S    +
Sbjct: 206 GRVLLALAPLLGAAMIAISRCEDYRHDVYDVTCGSILGISLAYFSYRRYFPRLQSSKCHE 265

Query: 251 PFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQLLLKDSRALLADSSSNNTEG 305
           P         P  +A F+   G       +KNDE+  +   RA  +D S N ++ 
Sbjct: 266 PH--------PSREAVFNQGFGK------IKNDEETEI--GRARESDISDNESDA 304



>gi|402079808|gb|EJT75073.1| hypothetical protein GGTG_08911 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 309

 Score =  146 bits (368), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 126/259 (48%), Gaps = 33/259 (12%)

Query: 21  VLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXX 80
           V  ++ + IF     +EP+HR+FS+ D  + FP AE ERVP+ +                
Sbjct: 37  VAAYVCIVIF-----VEPFHRMFSISDLAVSFPHAEAERVPVLMNVVYAGLAPLAAVALT 91

Query: 81  ALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLS 140
                 S H  H A             VT+V KN VGRPRPD + RC+P AA  P   L 
Sbjct: 92  NCISGASAHKHHVALLGLLVGLAVTTLVTDVVKNAVGRPRPDLLARCKP-AAGTPRDVLV 150

Query: 141 NSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY--------- 189
           + T+CT T   LL DG++SF SGHSS SFAG+G+ +L+LAG+L VF  +G          
Sbjct: 151 DWTVCTETAHHLLHDGWRSFPSGHSSFSFAGLGYTALFLAGQLRVFSARGLDGGNGNDDD 210

Query: 190 ----------------TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSY 233
                             +                SR +DYRH  +DV  G+L+G +++Y
Sbjct: 211 ATVVAERTVQAHAGNDLGRALLCLAPVLGAAMIAISRCQDYRHDVYDVCTGALLGSVVAY 270

Query: 234 FAYHQYYPDLHSKISDKPF 252
           ++Y +Y+P L S  SD+P+
Sbjct: 271 WSYRRYWPRLTSGRSDEPY 289



>gi|340915046|gb|EGS18387.1| hypothetical protein CTHT_0064120 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 299

 Score =  145 bits (367), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 138/287 (48%), Gaps = 16/287 (5%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D++    +FLG  + V    P+HRLF+L D  I FP AE ERVP+          
Sbjct: 3   RSYASDYIGFISLFLGYTYLVFTARPFHRLFTLHDTRISFPHAEHERVPLGQALLYSLAT 62

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                    L  +    + H +             VTEV KN VGRPRPD + RC P+  
Sbjct: 63  PMIVMTIVNLLRRAPARNHHLSLMPFLLAMILTPFVTEVIKNAVGRPRPDLLARCIPAKG 122

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF--DQKG 188
             P   L    +CT+ D  +L+DG++SF SGHSS +F G+G+LSL+L G+  VF   QKG
Sbjct: 123 -TPTDKLVGIEVCTQDDDFILQDGWRSFPSGHSSFAFCGLGYLSLWLCGQAKVFVLRQKG 181

Query: 189 YT----------YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQ 238
                        K                SRT+DYRH   DV  G+L+GF + +++Y +
Sbjct: 182 EERSAVVVRGDFIKAMVCGSPLIGAILIAVSRTQDYRHDVWDVSVGALLGFAIGWWSYRR 241

Query: 239 YYPDLHSKISDKPFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQ 285
           Y+P L S   ++P+   L        A +  +   E  +++ + +++
Sbjct: 242 YWPRLTSPYCNEPYAAPLPIEEAAAAARYGRVRDEEEAVSLGRGEDR 288



>gi|46121977|ref|XP_385542.1| hypothetical protein FG05366.1 [Fusarium graminearum PH-1]
          Length = 292

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 84/255 (32%), Positives = 129/255 (50%), Gaps = 7/255 (2%)

Query: 4   MSEFSKIQILKAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPM 62
           M +     +   +A D+V   F+  G   +V  ++P+HR+F + D  I +P+A  ERVP+
Sbjct: 1   MRQMETHSLQTTHAPDYVGFLFLLAGWILTVLFVDPFHRMFFINDLQISYPYAVHERVPV 60

Query: 63  WLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPD 122
           ++                 +A +                      +T++ KN VGRPRPD
Sbjct: 61  FMNFVYALFIPLGVLIAFNVATRAPAAKHEVTYLSFLISIVLTSFITDIIKNAVGRPRPD 120

Query: 123 FIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGK 180
            +DRCQP+        L    +CTR D  +L++G++SF SGHSS SFAG+GFLSL+LAG+
Sbjct: 121 LLDRCQPAVGTKANT-LVTIDVCTREDGHILQEGWRSFPSGHSSFSFAGLGFLSLFLAGQ 179

Query: 181 LHVFDQKGYTY---KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           LHVF          +                SR EDYRH  +DV  GS +G  ++Y++Y 
Sbjct: 180 LHVFRYAAGGRDLSRALVCLLPLIGAGMVAISRCEDYRHDVYDVCVGSALGMSIAYWSYR 239

Query: 238 QYYPDLHSKISDKPF 252
           +++P L S+  D+P+
Sbjct: 240 RHWPRLSSQKCDEPY 254



>gi|310795928|gb|EFQ31389.1| PAP2 superfamily protein [Glomerella graminicola M1.001]
          Length = 306

 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/244 (34%), Positives = 127/244 (52%), Gaps = 7/244 (2%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQ-LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           + +A D++   I L  + ++   +EP+HR+F + D  I +P AE ERVP+++        
Sbjct: 25  RTHAPDYLGFIILLAGWMTMLAFIEPFHRMFFINDLHISYPHAEVERVPVYMNIVYALFL 84

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                    +  K S H                  +T++ KN VGRPRPD + RC+P A 
Sbjct: 85  PLGVLVAYNVVTKASPHKHEVTYLSFAIAIVMSSFITDLVKNAVGRPRPDLLARCKPVAG 144

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P + L    +CT T   LL DG++SF SGHSS SFAG+GFLSL+ AG+LH+F      
Sbjct: 145 TKPNV-LVTIDVCTETGHHLLHDGWRSFPSGHSSFSFAGLGFLSLFFAGQLHIFRHNSGG 203

Query: 191 Y---KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKI 247
               K                SR EDYRH  +DV  GSL+G+L++Y++Y +++P L ++ 
Sbjct: 204 RDLSKALICLLPLLGAALIAISRCEDYRHDVYDVSIGSLLGYLVAYWSYRRHWPKLTARE 263

Query: 248 SDKP 251
             +P
Sbjct: 264 CHEP 267



>gi|358389240|gb|EHK26832.1| hypothetical protein TRIVIDRAFT_72904 [Trichoderma virens Gv29-8]
          Length = 301

 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/239 (35%), Positives = 120/239 (50%), Gaps = 19/239 (7%)

Query: 20  WVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXX 79
           W++  +F+          P+HR+F + D  I +P+AE ERV + L               
Sbjct: 41  WIMIMLFV---------NPFHRMFFINDLRISYPYAEHERVSVPLNFLYALFIPLGALIA 91

Query: 80  XALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGL 139
                + S H                  +T++ KN VGRPRPD + RCQPSA   P + L
Sbjct: 92  YNTVTRASTHKHEATYLSLAISIVLSSFITDIVKNAVGRPRPDLLARCQPSADTKPNV-L 150

Query: 140 SNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT-----YK 192
               +CT  D   L+DG++SF SGHSS SFAG+GFLSL+LAG+LHVF+   YT      +
Sbjct: 151 VTMAVCTAPDGHTLQDGWRSFPSGHSSFSFAGLGFLSLFLAGQLHVFNY--YTGGRDLSR 208

Query: 193 GFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
                           SR EDYRH  +DV  GS +G  ++Y++Y +++P L S   D+P
Sbjct: 209 ALICLSPLIGAALIAISRCEDYRHDVYDVCVGSALGMTVAYWSYRRHFPKLTSPTCDEP 267



>gi|470126109|ref|XP_004299036.1| PREDICTED: putative lipid phosphate phosphatase 3,
           chloroplastic-like [Fragaria vesca subsp. vesca]
          Length = 335

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 123/236 (52%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           + + K +  DW++  +   I   +  +EP+HR    +  T +++P  E   VP W     
Sbjct: 37  VAVAKNHKHDWLILVLLGVIEIVLYIIEPFHRFVGKDMMTDLKYPLKENT-VPAWAVPVY 95

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        +  +K ++D HH+             +TE  KN VGRPRPDF  RC 
Sbjct: 96  AVLLPIAIFLLFYVR-RKDVYDLHHSILGLLFSVLVTVVITEAIKNGVGRPRPDFFWRCF 154

Query: 129 PSA--AFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P    ++D   G     +C  +  ++K+G+KSF SGH+S SFAG+GFL+LYL+GK+ VFD
Sbjct: 155 PDGKDSYDDTWG---DVMCHGKASVMKEGYKSFPSGHASGSFAGLGFLALYLSGKIKVFD 211

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +KG+  K                SR  DY HHW DVFAGSL+GF+++ F Y Q++P
Sbjct: 212 RKGHVAKLCIVALPLLGASLVAVSRVSDYWHHWQDVFAGSLLGFVVAAFCYRQFFP 267



>gi|470130769|ref|XP_004301275.1| PREDICTED: lipid phosphate phosphatase 2-like [Fragaria vesca
           subsp. vesca]
          Length = 405

 Score =  144 bits (364), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 126/238 (52%), Gaps = 13/238 (5%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ K++  DW++  +   I  +++ +EP+HR  S +    + +PF   + +PMW     
Sbjct: 16  VKVAKSHMYDWMILVVLGAIDITLNLIEPFHRFISEQMMNDVSYPF-HPDTIPMWAVPIF 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        L  +K ++D HH+             +T+  K+ VGRPRP+F  RC 
Sbjct: 75  AIILPAGIFFAFYLK-RKDVYDLHHSILGLLYSVLITLVITDSIKDAVGRPRPNFFWRCF 133

Query: 129 PSAAFDPGLGLSN----STICTRTDLL-KDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           P      G+G+ +    + +CT   L+ K+G+KSF SGHSS SFAG+GFLS YLAGK+ V
Sbjct: 134 PD-----GIGVYDQKYGNVMCTGDKLIIKEGYKSFPSGHSSVSFAGLGFLSWYLAGKIKV 188

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           FD++G++ K                SR +DY HHW DV  GSL+G +++   Y Q +P
Sbjct: 189 FDRRGHSAKLCIVLFPLLCAALVATSRVDDYWHHWQDVLCGSLIGIVIASICYLQSFP 246



>gi|408391143|gb|EKJ70525.1| hypothetical protein FPSE_09278 [Fusarium pseudograminearum CS3096]
          Length = 304

 Score =  144 bits (363), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 126/243 (51%), Gaps = 7/243 (2%)

Query: 16  YALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXX 74
           +A D+V   F+  G   +V  ++P+HR+F + D  I +P+A  ERVP+++          
Sbjct: 25  HAPDYVGFLFLLAGWILTVLFVDPFHRMFFINDLQISYPYAVHERVPVFMNFVYALFIPL 84

Query: 75  XXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFD 134
                  +A +                      +T++ KN VGRPRPD +DRCQP+    
Sbjct: 85  GVLIAFNIATRAPAAKHEVTYLSFLISIVLTSFITDIIKNAVGRPRPDLLDRCQPAVGTK 144

Query: 135 PGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY- 191
               L    +CTR D  +L++G++SF SGHSS SFAG+GFLSL+LAG+LHVF        
Sbjct: 145 ANT-LVTIDVCTREDGHILQEGWRSFPSGHSSFSFAGLGFLSLFLAGQLHVFRYSAGGRD 203

Query: 192 --KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISD 249
             +                SR EDYRH  +DV  GS +G  ++Y++Y +++P L S+  D
Sbjct: 204 LSRALVCLLPLIGAGMVAISRCEDYRHDVYDVCVGSALGMSIAYWSYRRHWPRLSSQKCD 263

Query: 250 KPF 252
           +P+
Sbjct: 264 EPY 266



>gi|238491364|ref|XP_002376919.1| phosphatidic acid phosphatase, putative [Aspergillus flavus
           NRRL3357]
 gi|220697332|gb|EED53673.1| phosphatidic acid phosphatase, putative [Aspergillus flavus
           NRRL3357]
          Length = 435

 Score =  144 bits (362), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 144/311 (46%), Gaps = 32/311 (10%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV--PMWLCA 66
           + +I+ +Y LD+V+    +  F+ +D +EPYH+ FSL + ++ +P+A  ERV  P+ LC 
Sbjct: 16  RPRIVISYILDYVILVACIAGFYILDSIEPYHQHFSLNNISLMYPYAVHERVSIPLALCI 75

Query: 67  XXXXXXXXXXXXXXAL-----------------------AIKKSMHDWHHASXXXXXXXX 103
                          +                         K  + +++           
Sbjct: 76  SGVAPLIIIAVYTLLIDGLFSHNKPVDPTSGKRKLTGPYRFKDRLWEFNCGFLGLLLSQG 135

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQP-SAAFDPGLGLSNSTICT-RTDLLKDGFKSFLSG 161
               +T+V KN  G+PRPD IDRCQP   + DP  GLSN TICT    ++KDGF+S+   
Sbjct: 136 LAFLITQVLKNACGKPRPDIIDRCQPRPGSEDPFRGLSNYTICTGDPAIIKDGFRSW--- 192

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
             S SFAG+ +L+L+L GKLH  D +G  +K                SR  D RHH  DV
Sbjct: 193 -PSASFAGLFYLTLWLCGKLHFMDNRGEVWKAIIIIIPCIGATLIAVSRIMDARHHPFDV 251

Query: 222 FAGSLVGFLLSYFAYHQYYPDLHSKISD-KPFTIRLKKVVPEYKAEFSFMDGSEVEITVV 280
             GSL+G + +Y AY QY+P +       + + IR     P   +E + +  +      +
Sbjct: 252 ITGSLLGIVCAYIAYRQYFPSITEPWKKGRAYPIRSWGRDPVVPSEAAPLVTTNESTVAL 311

Query: 281 KNDEQLLLKDS 291
           +N E+  L  S
Sbjct: 312 RNPEEERLNAS 322



>gi|255946483|ref|XP_002564009.1| Pc20g15370 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211588744|emb|CAP86866.1| Pc20g15370 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 291

 Score =  143 bits (361), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 125/245 (51%), Gaps = 12/245 (4%)

Query: 14  KAYALDWV-LCFIFLG---IFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXX 69
           + YA D++ L F+  G   +F S     P+HR+FSL+++ IQ+PFA  ERVP+       
Sbjct: 10  RTYAADYIALGFLVAGWIQLFVS-----PFHRMFSLDNRAIQYPFAVHERVPVLWSVVFA 64

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                      +   +  +                   +T++ KN  GRPRPD + RC+P
Sbjct: 65  GLIPFLIILAWSAMFRAGVQKTQVTVLGLFVALMLTSFLTDIIKNAAGRPRPDLLSRCKP 124

Query: 130 SAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
           S        L   T+CT ++  +L++G++SF SGHSS SF G+G+L L+L G++HVF  +
Sbjct: 125 SRGTSSN-ALVAWTVCTESNQHILQEGWRSFPSGHSSFSFGGLGYLYLFLCGQMHVFRPR 183

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKI 247
               +                SR  DYRH  +DV  G L+G L+++F+Y +YYP L S +
Sbjct: 184 TDLGRCLLAFFPLLCALMVALSRLADYRHDVYDVTCGGLLGMLIAWFSYRRYYPPLRSVM 243

Query: 248 SDKPF 252
            D P+
Sbjct: 244 CDVPY 248



>gi|477527939|gb|ENH79731.1| pap2 domain protein [Colletotrichum orbiculare MAFF 240422]
          Length = 307

 Score =  143 bits (360), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 120/237 (50%), Gaps = 15/237 (6%)

Query: 20  WVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXX 79
           W++  +F+         EP+HR+F + D  I FP AE ERVP+ +               
Sbjct: 41  WMVMLVFI---------EPFHRMFFINDLHISFPHAEVERVPVLMNFVYALFIPLGIMVA 91

Query: 80  XALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGL 139
             L  K S H                  +T++ KN VGRPRPD + RC+P+    P + L
Sbjct: 92  YNLMTKASPHKHEVTYLTFAICLIMTTFITDLIKNAVGRPRPDLLARCKPAKGTKPNV-L 150

Query: 140 SNSTICTRT--DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY---KGF 194
               +CT T   LL DG++SF SGHSS SFAG+GFLSL+ AG+LH+F          +  
Sbjct: 151 VTIDVCTETAHHLLHDGWRSFPSGHSSFSFAGLGFLSLFFAGQLHIFRHNSGGRDLSRAL 210

Query: 195 XXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
                         SR EDYRH  +DV  GSL+G++++Y++Y +++P L +K   +P
Sbjct: 211 VCLAPLLGAALIAISRCEDYRHDVYDVCVGSLLGYVVAYWSYRRHWPRLTAKDCHEP 267



>gi|302890273|ref|XP_003044021.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256724940|gb|EEU38308.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 310

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 121/238 (50%), Gaps = 15/238 (6%)

Query: 20  WVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXX 79
           W+L  +F+          P+HR+F + D  I +PFA KERVP+++               
Sbjct: 44  WILIVLFV---------NPFHRMFYINDLRISYPFAVKERVPVFMNFVYALFIPLGVLIA 94

Query: 80  XALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGL 139
             +  + S                    +T++ KN VGRPRPD +DRCQP+A       L
Sbjct: 95  YNVIARSSAAKHEVTYLSFLISIVLTSFLTDIIKNAVGRPRPDLLDRCQPAATTKANT-L 153

Query: 140 SNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY---KGF 194
               +CT  D  +L++G++SF SGHSS SFAG+GFLSL+LAG+LHVF          +  
Sbjct: 154 VTIEVCTAHDGHVLQEGWRSFPSGHSSFSFAGLGFLSLFLAGQLHVFRYSAGGRDLSRAL 213

Query: 195 XXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
                         SR EDYRH  +DV  GS +G  ++Y++Y +++P L S+  D+P+
Sbjct: 214 VCLLPLIGAALVAISRCEDYRHDVYDVCVGSALGMSIAYWSYRRHWPRLSSQRCDEPY 271



>gi|317145915|ref|XP_001821158.2| phosphatidic acid phosphatase [Aspergillus oryzae RIB40]
          Length = 439

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/311 (31%), Positives = 149/311 (47%), Gaps = 28/311 (9%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV--PMWLCA 66
           + +I+ +Y LD+V+    +  F+ +D +EPYH+ FSL + ++ +P+A  ERV  P+ LC 
Sbjct: 16  RPRIVISYILDYVILVACIAGFYILDSIEPYHQHFSLNNISLMYPYAVHERVSIPLALCI 75

Query: 67  XXXXXXXXXXXXXXAL-----------------------AIKKSMHDWHHASXXXXXXXX 103
                          +                         K  + +++           
Sbjct: 76  SGVAPLIIIAVYTLLIDGLFSHNKPVDPTSGKRKLTGPYRFKDRLWEFNCGFLGLLLSQG 135

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQP-SAAFDPGLGLSNSTICT-RTDLLKDGFKSFLSG 161
               +T+V KN  G+PRPD IDRCQP   + DP  GLSN TICT    ++KDGF+S+ SG
Sbjct: 136 LAFLITQVLKNACGKPRPDIIDRCQPRPGSEDPFRGLSNYTICTGDPAIIKDGFRSWPSG 195

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
           HSS+SFAG+ +L+L+L GKLH  D +G  +K                SR  D RHH  DV
Sbjct: 196 HSSSSFAGLFYLTLWLCGKLHFMDNRGEVWKAIIIIIPCIGATLIAVSRIMDARHHPFDV 255

Query: 222 FAGSLVGFLLSYFAYHQYYPDLHSKISD-KPFTIRLKKVVPEYKAEFSFMDGSEVEITVV 280
             GSL+G + +Y AY QY+P +       + + IR     P   +E + +  +      +
Sbjct: 256 ITGSLLGIVCAYIAYRQYFPSITEPWKKGRAYPIRSWGRDPVVPSEAAPLVTTNESTVAL 315

Query: 281 KNDEQLLLKDS 291
           +N E+  L  S
Sbjct: 316 RNPEEERLNAS 326



>gi|451997242|gb|EMD89707.1| hypothetical protein COCHEDRAFT_1177552 [Bipolaris maydis C5]
 gi|477593010|gb|ENI10080.1| hypothetical protein COCC4DRAFT_158799 [Bipolaris maydis ATCC
           48331]
          Length = 511

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 132/273 (48%), Gaps = 34/273 (12%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           KK++S+    +++ +Y  D+++  + +  F  VD++ P+H+ FSL++ T+ +PFA KERV
Sbjct: 17  KKRLSK----KVIFSYIGDYLIIIVLMLTFAIVDKIPPFHQPFSLDNYTLHYPFATKERV 72

Query: 61  PMWLCAXXXXXXXXXXXXXXALAI--------------------------KKSMHDWHHA 94
           P+                   + I                          K  + + +  
Sbjct: 73  PVIWLCVYVVLAPAVIIGIYTMVIDGLFSHQTAMPANRTGLKRLSGRYRFKDRLWELNCG 132

Query: 95  SXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA--FDPGLGLSNSTICTRTD--L 150
                        +T   KN +G+PRPD I RC    A        L    ICT+ D  +
Sbjct: 133 ILGLGLSIGAAFTITGALKNAIGKPRPDLISRCLVDQAKINTERYALQTIDICTQKDNYI 192

Query: 151 LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSR 210
           L+DGFKSF SGHSS SFAG+ +LS+YL+GKLHV D KG  ++ F              +R
Sbjct: 193 LQDGFKSFPSGHSSVSFAGLFYLSIYLSGKLHVLDAKGEVWRTFIVMVPTLGAALITGTR 252

Query: 211 TEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
             D RHH  DV +G+L+G L+++ +Y QY+P +
Sbjct: 253 IMDARHHPFDVISGALLGILVAWGSYRQYFPPV 285



>gi|470126107|ref|XP_004299035.1| PREDICTED: lipid phosphate phosphatase 2-like [Fragaria vesca
           subsp. vesca]
          Length = 325

 Score =  142 bits (357), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 122/236 (51%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKER-VPMWLCAXX 68
           +Q+ + +  DW++  +   I   ++ +EP+HR F  ED      +  K+  VP+W     
Sbjct: 22  VQVARFHMHDWIILVVLAAIDLGLNLIEPFHR-FVGEDMMTDLKYPLKDNTVPVWSVPII 80

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I++ ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 81  AILLPLAIILVYYF-IRRDVYDLHHAILGLLFSVFITAVLTDAIKDGVGRPRPDFFWRCF 139

Query: 129 P--SAAFDPGLGLSNSTICT-RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     FD    ++ + +CT +  ++K+G KSF SGH+S SFAG+ FL+ YL+GK+ VFD
Sbjct: 140 PDGKGVFD---RITKNVMCTGKKSVIKEGHKSFPSGHTSWSFAGLTFLAWYLSGKVRVFD 196

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +KG+  K                SR +DY HHW DVFAG L+G  +S F Y Q++P
Sbjct: 197 RKGHVAKLCIVFAPLLLAAMVGVSRVDDYWHHWQDVFAGGLLGVTVSSFCYLQFFP 252



>gi|462411842|gb|EMJ16891.1| hypothetical protein PRUPE_ppa008752mg [Prunus persica]
          Length = 320

 Score =  142 bits (357), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/280 (30%), Positives = 140/280 (50%), Gaps = 9/280 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           + + + +  DWV+  +   I   ++ + P++R    +  T +++P  +   VP+W     
Sbjct: 16  MTVARTHMHDWVILMLLGLIVVILNVIHPFYRFVGKDMMTDLKYPL-KSNTVPVWAIPMY 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                           ++ ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AVALPIAIFFIVYFR-RRDVYDLHHAILGLLFSVLITGVITDAIKDAVGRPRPDFFWRCF 133

Query: 129 PSAAFDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
           P    D    L N     +  ++K+G KSF SGH+S SFAG+GFLSLYL+GK+ VFD+KG
Sbjct: 134 PDGK-DVYDQLGNVVCHGKKSVIKEGHKSFPSGHTSWSFAGLGFLSLYLSGKIKVFDRKG 192

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKIS 248
           +  K                SR +DY HHW DVFAG L+GF+++ F Y Q++P  +    
Sbjct: 193 HVAKLCIVFLPLLFASLVGVSRVDDYWHHWQDVFAGGLLGFIVASFCYLQFFPPPYHAQG 252

Query: 249 DKPFTIRLKKVVPEYKA---EFSFMDGSEVEITVVKNDEQ 285
             P+     +V+ E ++     + ++GS V++T  + + Q
Sbjct: 253 WGPYA--YFQVLEESRSVTQAATIVNGSNVQVTEARVENQ 290



>gi|462405795|gb|EMJ11259.1| hypothetical protein PRUPE_ppa018484mg, partial [Prunus persica]
          Length = 282

 Score =  142 bits (357), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 123/236 (52%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ K +  DW++  +   +  +++ +EP+HR    E  T +++P   K+ +P+W     
Sbjct: 16  VKVAKVHKYDWLILLLLAAVDITLNVIEPFHRFVGEEMMTDLKYP-CHKDTIPLWAVPIY 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                           +K ++D HHA             +T+  K+ VGRPRP+F  RC 
Sbjct: 75  AVILPLVIFLLYYFC-RKDVYDLHHAILGLFYSVLITLVITDSIKDAVGRPRPNFFWRCF 133

Query: 129 PSAA--FDPGLGLSNSTICTR-TDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     FDP   +S + +C     ++K+G KSF SGH+S SFAG+GFL+ YL+GK+ VFD
Sbjct: 134 PDGIGEFDP---VSGNAMCNGDKKVIKEGHKSFPSGHTSVSFAGLGFLAWYLSGKIKVFD 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G++ K                SR +DY HHW DVFAG L+G  ++   Y Q +P
Sbjct: 191 RRGHSAKLCIAFLPLLCAALVGISRVDDYWHHWQDVFAGGLIGITIASICYLQSFP 246



>gi|239611335|gb|EEQ88322.1| PAP2 domain-containing protein [Ajellomyces dermatitidis ER-3]
          Length = 312

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 126/244 (51%), Gaps = 5/244 (2%)

Query: 13  LKAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           L++YA D+V L  + +G       + P++R+F+L++ +IQFPFAE ERVP+         
Sbjct: 31  LRSYAADYVSLIVLVVGWILIQIFVRPFYRMFTLDNVSIQFPFAEVERVPVLWSIIYAGV 90

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                    A+ I+   H  H +             +T++ KN VGRPRPD + RC P  
Sbjct: 91  MPLIIIIVWAVIIRPETHFTHVSVLGLLVTLALTSFLTDIIKNAVGRPRPDLLSRCSPEK 150

Query: 132 AFDPGLGLSNSTIC--TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
              P   +    +C    +  L +G++SF SGHSS +FAG+G+L+++ AG+LHVF  +  
Sbjct: 151 G-TPAHKMVTIEVCGAPESHRLHEGWRSFPSGHSSFAFAGLGYLAMFFAGQLHVFQPRTG 209

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL-HSKIS 248
             +                SR  DYRH  +DV  GSL+G  ++YF Y +YYP L  S+I 
Sbjct: 210 LARFLFSLSPLLGALLIAMSRLADYRHDVYDVAVGSLLGISVAYFTYRRYYPPLRRSEIP 269

Query: 249 DKPF 252
            + F
Sbjct: 270 PEGF 273



>gi|115434438|ref|NP_001041977.1| Os01g0139600 [Oryza sativa Japonica Group]
 gi|113531508|dbj|BAF03891.1| Os01g0139600 [Oryza sativa Japonica Group]
 gi|215706445|dbj|BAG93301.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 313

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 120/236 (50%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ + +  DWV+  +   +  ++    P+ R    +  T + +P  ++  VP W     
Sbjct: 24  VRLARNHLHDWVVLILLAAVVIALHFAPPFSRFVGKDMMTYVSYP-VKQSTVPAWGVPII 82

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        +A ++ ++D HHA+            VT V KN VGRPRPDF  RC 
Sbjct: 83  SIVCPVIIFLSVYIA-RRDVYDLHHATLGVLYSVLITAVVTTVVKNAVGRPRPDFFWRCF 141

Query: 129 PSAA--FDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     +D    ++   IC      LKDG KSF SGH+S SFAG+GFLSLYL+GK+ VFD
Sbjct: 142 PDGKQLYDQ---VTGDVICHGEKSFLKDGRKSFPSGHTSWSFAGLGFLSLYLSGKIKVFD 198

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DYRHHW DVFAG L+GF+++   Y  ++P
Sbjct: 199 RQGHVAKLCIMILPLLIASLVGISRIDDYRHHWEDVFAGGLLGFIMAMLCYLHFFP 254



>gi|225557388|gb|EEH05674.1| PAP2 domain-containing protein [Ajellomyces capsulatus G186AR]
          Length = 307

 Score =  141 bits (355), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 121/243 (49%), Gaps = 4/243 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V L  + +G+      + P++R+F+L+D  IQFPFA+ ERVP           
Sbjct: 31  RSYAADYVSLILLCVGLMLIQIWVRPFNRMFTLDDVAIQFPFAQVERVPFLWSVTYAGVT 90

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   AL I++  H  H +             +T++ KN  GRPRPD + RC+P   
Sbjct: 91  PLIIIILWALMIRRESHFAHVSVLGLLVTLILTSFLTDIIKNAAGRPRPDLLARCRPQKG 150

Query: 133 FDPGLGLSNSTIC--TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L  S +C    +  L +G++SF SGHSS +F G+G+L ++ AG+LHVF  +   
Sbjct: 151 -TPAHQLVASDVCGAPESHQLDEGWRSFPSGHSSFAFGGLGYLFMFFAGQLHVFQPRTGL 209

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
                             SR  DYRH  +DV AG+L+G  ++Y  Y +Y+P L S     
Sbjct: 210 ACFLFALSPLLGALMIAMSRLADYRHDVYDVTAGALLGLSVAYSIYRRYFPTLLSADCHT 269

Query: 251 PFT 253
           P+ 
Sbjct: 270 PYN 272



>gi|330940962|ref|XP_003306009.1| hypothetical protein PTT_19016 [Pyrenophora teres f. teres 0-1]
 gi|311316710|gb|EFQ85897.1| hypothetical protein PTT_19016 [Pyrenophora teres f. teres 0-1]
          Length = 511

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 110/217 (50%), Gaps = 3/217 (1%)

Query: 38  PYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXX 97
           P+HR+FSL++  I +P A  ERV +                  AL ++   H  H     
Sbjct: 253 PFHRMFSLDNLAISYPHATTERVSVPWLFIYAGAVPLGVLIAWALLVRPGAHKAHVTLLG 312

Query: 98  XXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGF 155
                     +T+V KN VGRPRPD I RC+P     P   L    +CT T+  +L DG+
Sbjct: 313 WGISMVLTMFITDVIKNAVGRPRPDLIARCKPKPG-TPAHTLVTWEVCTETNHHVLHDGW 371

Query: 156 KSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYR 215
           +SF SGHSS +F+G+G+L+L++AG+ HV+  +    +                SR EDYR
Sbjct: 372 RSFPSGHSSFAFSGLGYLALFIAGQCHVYRPRADLARVLLAMAPLLGAALIAISRCEDYR 431

Query: 216 HHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
           H   DV  GSL+G  ++++ Y +YYP L ++    PF
Sbjct: 432 HDVWDVSVGSLLGMGVAHYTYRRYYPALRNRACASPF 468



>gi|443925824|gb|ELU44586.1| oligosaccharyl transferase subunit OST3/OST6 family [Rhizoctonia
           solani AG-1 IA]
          Length = 941

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 129/285 (45%), Gaps = 69/285 (24%)

Query: 29  IFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSM 88
           IF+ +D++E + R FSL D +I F  A  ERVP WL                      + 
Sbjct: 466 IFYLLDEIEGFKRQFSLTDTSIHF--AVHERVPPWLLYIVALIGWLGLLLGLGTTGSLT- 522

Query: 89  HDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRP-----------------------DFID 125
                                +V K TVGRPRP                       D +D
Sbjct: 523 ---------------------QVVKVTVGRPRPGKCGAQSSRHIALRVHLLTICFVDLLD 561

Query: 126 RCQPSAAFD--PGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKL 181
           RCQP A     P  GL  + +CT  +   LKDGF+SF SGHSS +FAG+GFLS YLAGK+
Sbjct: 562 RCQPRANVQNAPVYGLVTADVCTTDNHERLKDGFRSFFSGHSSLTFAGLGFLSFYLAGKM 621

Query: 182 HVFDQKGYTYKG--FXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQY 239
           H+FDQ+G+T +G  +              SRT DYR              +LSYF+Y QY
Sbjct: 622 HLFDQRGHTVRGKAWISLAPLTGALLVAISRTMDYRR------------LVLSYFSYRQY 669

Query: 240 YPDLHSKISDKPFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDE 284
           YP L S  S +P++ R    +P Y+ + + +  SE  ITV    E
Sbjct: 670 YPSLASPFSHRPYSPR----IPRYEQDQAGIPNSEPTITVTPPAE 710



>gi|429852094|gb|ELA27245.1| pap2 domain protein [Colletotrichum gloeosporioides Nara gc5]
          Length = 248

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 115/218 (52%), Gaps = 6/218 (2%)

Query: 36  LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHAS 95
           LEP+HR+F + D  I +P AE ERVP+++                 L  K S H      
Sbjct: 5   LEPFHRMFFINDLRISYPHAEVERVPVYMNFVYALFVPLGVLIIYNLMTKASPHKHEVTY 64

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRT--DLLKD 153
                       +T++ KN VGRPRPD + RC+P+A   P L L    +CT     LL D
Sbjct: 65  LSLGISVIMTSFITDLIKNAVGRPRPDLLARCKPAAGTKPDL-LVTIDVCTEKAHHLLHD 123

Query: 154 GFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTED 213
           G++SF SGHSS SFAG+GFLS++LAG+LH         +                SR ED
Sbjct: 124 GWRSFPSGHSSFSFAGLGFLSIFLAGQLHSGRDLS---RALICLVPLLGAALIAISRCED 180

Query: 214 YRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
           YRH  +DV  GSL+G++++Y++Y +++P L +K   +P
Sbjct: 181 YRHDVYDVCVGSLLGWVVAYWSYRRHWPKLTAKECHEP 218



>gi|508708142|gb|EOY00039.1| Lipid phosphate phosphatase 2 isoform 4 [Theobroma cacao]
          Length = 296

 Score =  140 bits (354), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 125/236 (52%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKER-VPMWLCAXX 68
           +++ +A+  DW++  + + I   ++ +EP+HR F  ED      +  K+  VP W     
Sbjct: 27  VKVARAHMHDWLILLLLIVIDVILNVIEPFHR-FVGEDMMTDLEYPLKDNTVPFWAVPII 85

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I++ ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 86  AIILPFSVILVYYF-IRRDVYDLHHAILGLLFSVLITGVITDAIKDAVGRPRPDFFWRCF 144

Query: 129 P--SAAFDPGLGLSNSTICT-RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     FDP   ++ + +CT    ++K+G KSF SGH+S SFAG+GFL+LYL+GK+ VFD
Sbjct: 145 PDGKGVFDP---VTKNVMCTGLRSVIKEGHKSFPSGHTSWSFAGLGFLALYLSGKIRVFD 201

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW D+FAG L+G  +S F Y Q++P
Sbjct: 202 RRGHVAKLCIVFLPLLIAALVGISRVDDYWHHWQDIFAGGLLGITVSSFCYLQFFP 257



>gi|327302378|ref|XP_003235881.1| PAP2 domain-containing protein [Trichophyton rubrum CBS 118892]
 gi|326461223|gb|EGD86676.1| PAP2 domain-containing protein [Trichophyton rubrum CBS 118892]
          Length = 306

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 121/243 (49%), Gaps = 6/243 (2%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQL--EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           ++Y  D+ +  IFL   + + QL   P+H+LFSL+D +IQ+PFA  ERVP+         
Sbjct: 25  RSYGGDYSI-LIFLVFAWVMLQLFVHPFHQLFSLDDSSIQYPFAVVERVPVLWSIIYSGI 83

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                        +   H  H               +T++ KN VGRPRPD I RC+P  
Sbjct: 84  FPLLAIGIWCALFRPGSHFVHVTLLGLIASLLVTIFITDIIKNAVGRPRPDLISRCKPEK 143

Query: 132 AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
              P   L + T+CT TD  +L +G++SF SGHSS +F+G+G+LS +L G+L  +  +  
Sbjct: 144 G-TPEHTLVDHTVCTSTDTHILNEGWRSFPSGHSSFAFSGLGYLSFFLTGQLRAWRPRSG 202

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISD 249
             +                SR  DYRH  +DV +GS++G   +Y  Y  YYP L S   D
Sbjct: 203 LARLLVSLSPLLGALMIAISRIADYRHDVYDVCSGSIIGLGTAYLVYRCYYPSLWSADCD 262

Query: 250 KPF 252
            P+
Sbjct: 263 TPY 265



>gi|392576709|gb|EIW69839.1| hypothetical protein TREMEDRAFT_61609 [Tremella mesenterica DSM
           1558]
          Length = 433

 Score =  140 bits (353), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 89/137 (64%), Gaps = 4/137 (2%)

Query: 108 VTEVFKNTVGRPRPDFIDRCQPS-AAFD-PGLGLSNSTICTRTDL--LKDGFKSFLSGHS 163
           VT+V K +VGRPRPD I+RC+P+  A D P  GLS   ICT   +  L DGFKSF SGHS
Sbjct: 280 VTQVIKMSVGRPRPDLINRCEPAPGAIDHPVYGLSTVEICTSVHIARLNDGFKSFPSGHS 339

Query: 164 STSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFA 223
           S SFAG+GFL+LYLAGK+H++D++G+  + +              SRTED RHHW DV  
Sbjct: 340 SLSFAGLGFLALYLAGKMHLWDRRGHRNRAWFALSPLLGGAMVAISRTEDNRHHWQDVLV 399

Query: 224 GSLVGFLLSYFAYHQYY 240
           GS +G  +++  Y  YY
Sbjct: 400 GSALGLFIAWVTYRTYY 416



>gi|508708139|gb|EOY00036.1| Lipid phosphate phosphatase 2 isoform 1 [Theobroma cacao]
          Length = 347

 Score =  140 bits (353), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 125/236 (52%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKER-VPMWLCAXX 68
           +++ +A+  DW++  + + I   ++ +EP+HR F  ED      +  K+  VP W     
Sbjct: 44  VKVARAHMHDWLILLLLIVIDVILNVIEPFHR-FVGEDMMTDLEYPLKDNTVPFWAVPII 102

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I++ ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 103 AIILPFSVILVYYF-IRRDVYDLHHAILGLLFSVLITGVITDAIKDAVGRPRPDFFWRCF 161

Query: 129 P--SAAFDPGLGLSNSTICTR-TDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     FDP   ++ + +CT    ++K+G KSF SGH+S SFAG+GFL+LYL+GK+ VFD
Sbjct: 162 PDGKGVFDP---VTKNVMCTGLRSVIKEGHKSFPSGHTSWSFAGLGFLALYLSGKIRVFD 218

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW D+FAG L+G  +S F Y Q++P
Sbjct: 219 RRGHVAKLCIVFLPLLIAALVGISRVDDYWHHWQDIFAGGLLGITVSSFCYLQFFP 274



>gi|508708140|gb|EOY00037.1| Lipid phosphate phosphatase 2 isoform 2 [Theobroma cacao]
 gi|508708141|gb|EOY00038.1| Lipid phosphate phosphatase 2 isoform 2 [Theobroma cacao]
          Length = 319

 Score =  140 bits (352), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 125/236 (52%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKER-VPMWLCAXX 68
           +++ +A+  DW++  + + I   ++ +EP+HR F  ED      +  K+  VP W     
Sbjct: 16  VKVARAHMHDWLILLLLIVIDVILNVIEPFHR-FVGEDMMTDLEYPLKDNTVPFWAVPII 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I++ ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AIILPFSVILVYYF-IRRDVYDLHHAILGLLFSVLITGVITDAIKDAVGRPRPDFFWRCF 133

Query: 129 PSA--AFDPGLGLSNSTICTR-TDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     FDP   ++ + +CT    ++K+G KSF SGH+S SFAG+GFL+LYL+GK+ VFD
Sbjct: 134 PDGKGVFDP---VTKNVMCTGLRSVIKEGHKSFPSGHTSWSFAGLGFLALYLSGKIRVFD 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW D+FAG L+G  +S F Y Q++P
Sbjct: 191 RRGHVAKLCIVFLPLLIAALVGISRVDDYWHHWQDIFAGGLLGITVSSFCYLQFFP 246



>gi|477521628|gb|ENH73712.1| Diacylglycerol pyrophosphate phosphatase 1 [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 305

 Score =  140 bits (352), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 124/246 (50%), Gaps = 7/246 (2%)

Query: 13  LKAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           +  +A D+V   F+  G   +V  + P+HR+F + D  I +PFA  ERVP+++       
Sbjct: 23  VTTHAPDYVGFLFLLTGWILTVLFVNPFHRMFFINDLQISYPFAVHERVPVFMNFVYALF 82

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                     +  + S                    +T++ KN VGRPRPD +DRC+P+ 
Sbjct: 83  IPLGVLIAYNIIARSSAAKHEVTYLSFLISIVLTSFITDIIKNAVGRPRPDLLDRCKPAI 142

Query: 132 AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
                  L    +CT  D  +L++G++SF SGHSS SFAG+GFLSL+LAG+LHVF     
Sbjct: 143 GTKANT-LVTIDVCTAEDGHILQEGWRSFPSGHSSFSFAGLGFLSLFLAGQLHVFRYSAG 201

Query: 190 TY---KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSK 246
                +                SR EDYRH  +DV  GS +G  ++Y++Y +++P L S 
Sbjct: 202 GRDLSRALVCLLPLIGAGLVAISRCEDYRHDVYDVCVGSALGMSIAYWSYRRHFPRLSST 261

Query: 247 ISDKPF 252
             D+P+
Sbjct: 262 KCDEPY 267



>gi|460386404|ref|XP_004238888.1| PREDICTED: lipid phosphate phosphatase 2-like [Solanum
           lycopersicum]
          Length = 323

 Score =  139 bits (351), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 121/236 (51%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ + +  DW + F+ + I   ++ +EP+HR    +  T + +P  +   +P W     
Sbjct: 16  VEVARFHMHDWFILFVLVVIDIILNVIEPFHRFVGSDMMTDLSYPLKDNT-IPFWAVPII 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I+K ++D H A             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AIVLPLLVILVFYF-IRKDVYDVHQAILGLLYSVLISSVLTDAIKDAVGRPRPDFFWRCF 133

Query: 129 P--SAAFDPGLGLSNSTICT-RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     FDP   ++++  CT    ++K+G KSF SGHSS SFAG+GFL+ YL+GK+ VFD
Sbjct: 134 PDGKGVFDP---ITSNVKCTGLKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLSGKIKVFD 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           Q+G+  K                SR +DY HHW DVFAG L+G  ++   Y Q++P
Sbjct: 191 QRGHVAKLCLVFLPLLMAALVAVSRVDDYWHHWQDVFAGGLLGLTVASICYLQFFP 246



>gi|325096092|gb|EGC49402.1| PAP2 domain-containing protein [Ajellomyces capsulatus H88]
          Length = 319

 Score =  139 bits (351), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 120/243 (49%), Gaps = 4/243 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V L  + +G+      + P++R+F+L+D  IQ PFA+ ERVP           
Sbjct: 31  RSYAADYVSLILLCVGLILIQIWVRPFNRMFALDDVAIQLPFAQVERVPFLWSITYAGVT 90

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   AL I++  H  H +             +T++ KN  GRPRPD + RC+P   
Sbjct: 91  PLIIIILWALMIRRESHFAHVSVLGLLVTLILTSFLTDIIKNAAGRPRPDLLARCRPQKG 150

Query: 133 FDPGLGLSNSTIC--TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L  S +C    +  L +G++SF SGHSS +F G+G+L ++ AG+LHVF  +   
Sbjct: 151 -TPAHQLVTSDVCGAPESHQLDEGWRSFPSGHSSFAFGGLGYLFMFFAGQLHVFQPRTGL 209

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
                             SR  DYRH  +DV AG+L+G  ++Y  Y +Y+P L S     
Sbjct: 210 ACFLFALSPLLGALMIAMSRLADYRHDVYDVTAGALLGLSVAYSIYRRYFPTLLSADCHT 269

Query: 251 PFT 253
           P+ 
Sbjct: 270 PYN 272



>gi|224111600|ref|XP_002315916.1| predicted protein [Populus trichocarpa]
 gi|222864956|gb|EEF02087.1| predicted protein [Populus trichocarpa]
          Length = 314

 Score =  139 bits (350), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 126/236 (53%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           IQI + +  DW++  + + I   ++ +EP+HR    +  T + +P  +   VP+W     
Sbjct: 16  IQIARTHMHDWLILLLLVVIEVVLNVIEPFHRFVGKDMLTDLSYPL-QDNTVPIWAVPIV 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I+++++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AILLPMAIILVYYF-IRRNVYDMHHAILGLLFSVLITGVITDAIKDAVGRPRPDFFWRCF 133

Query: 129 PSA--AFDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     F P   +++  +CT    ++K+G KSF SGH+S SFAG+GFL+LYL+GK+ VFD
Sbjct: 134 PDGKGVFHP---VTSDVMCTGVKSVIKEGHKSFPSGHTSWSFAGLGFLALYLSGKVRVFD 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW DVFAG+L+G  ++ F Y Q++P
Sbjct: 191 RRGHVAKLCIVFLPLLVAALVAVSRVDDYWHHWQDVFAGALIGLTVASFCYLQFFP 246



>gi|169612053|ref|XP_001799444.1| hypothetical protein SNOG_09142 [Phaeosphaeria nodorum SN15]
 gi|160702427|gb|EAT83334.2| hypothetical protein SNOG_09142 [Phaeosphaeria nodorum SN15]
          Length = 717

 Score =  139 bits (350), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 114/218 (52%), Gaps = 3/218 (1%)

Query: 37  EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASX 96
           +P+HR+F L++ +I +P AE ERV +                  AL ++ S H  H    
Sbjct: 459 QPFHRMFFLDNLSISYPHAEVERVSVLWLFIYAGALPLTTLILWALLLRPSPHKAHVTLL 518

Query: 97  XXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDG 154
                      +T+V KN VGRPRPD I RC+P A   P   L    +CT T+  +L DG
Sbjct: 519 GWLVSMLLTLFITDVIKNAVGRPRPDLIARCKP-APGTPAHTLVTWEVCTETNHHVLHDG 577

Query: 155 FKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDY 214
           ++SF SGHSS SFAG+G+LSL++AG+ HV+  +    +                SR EDY
Sbjct: 578 WRSFPSGHSSFSFAGLGYLSLWIAGQCHVYRPRADLARVLVALAPLLGAALIAISRCEDY 637

Query: 215 RHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
           RH   DV  GSL+G  +++  Y +YYP L S+   +P+
Sbjct: 638 RHDVWDVSVGSLLGLGVAHATYRRYYPGLGSRGCAEPY 675



>gi|67522429|ref|XP_659275.1| hypothetical protein AN1671.2 [Aspergillus nidulans FGSC A4]
 gi|40745635|gb|EAA64791.1| hypothetical protein AN1671.2 [Aspergillus nidulans FGSC A4]
 gi|259487010|tpe|CBF85338.1| TPA: PAP2 domain protein (AFU_orthologue; AFUA_4G08970)
           [Aspergillus nidulans FGSC A4]
          Length = 436

 Score =  139 bits (350), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 101/324 (31%), Positives = 152/324 (46%), Gaps = 34/324 (10%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +++ +Y +D+V+    +  F+ +D++EPYH+ FSL + ++Q+P+A  ER+ ++     
Sbjct: 16  RPRVVISYIIDYVILIALVICFWILDRIEPYHQRFSLNNISLQYPYAVHERISIYEAVAC 75

Query: 69  XXXXXXXXXXXXALAI------------------------KKSMHDWHHASXXXXXXXXX 104
                        L I                        K  + + +            
Sbjct: 76  SGGGPLIIIAIWTLFIDGLFSHNKPIKAGGKRKFTGPYRWKDRLWELNCGFLGLILSQAL 135

Query: 105 XXXVTEVFKNTVGRPRPDFIDRCQP-SAAFDP-GLGLSNSTICTR-TDLLKDGFKSFLSG 161
              +T+  KN  G+PRPD IDRCQP   + DP   GLS+ +ICT    LLKDGF+S+ SG
Sbjct: 136 CFVITQALKNACGKPRPDIIDRCQPRPGSADPKPYGLSDISICTGDPHLLKDGFRSWPSG 195

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
           HSS+SFAG+ +LSL+L GKLH+ D KG  +K F              SR  D RHH  DV
Sbjct: 196 HSSSSFAGLFYLSLWLGGKLHIMDNKGEVWKMFIVMFPCLGATLIAVSRIMDARHHPFDV 255

Query: 222 FAGSLVGFLLSYFAYHQYYPDLHSKI-SDKPFTIRLKKVVPEYKAEFSFMDGSEVEITVV 280
             GSL+G L +  +Y QY+P L       + + IR     P Y     +  GS      +
Sbjct: 256 ITGSLLGILCATISYRQYFPSLAEPWKKGRAYPIRTWGTEPSYPGGAPY--GSTDSTAAL 313

Query: 281 KNDEQLLLKDSRALLADSSSNNTE 304
            N E+   ++      + SS N E
Sbjct: 314 TNPEEERFREH----GNGSSENPE 333



>gi|453088448|gb|EMF16488.1| acid phosphatase/Vanadium-dependent haloperoxidase [Mycosphaerella
           populorum SO2202]
          Length = 301

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 123/249 (49%), Gaps = 4/249 (1%)

Query: 6   EFSKIQILKAYALDWVLCFIFLGIFFSVDQL-EPYHRLFSLEDKTIQFPFAEKERVPMWL 64
           E SK    ++YA D++   + +  +  +    EP+H  F L+D  +Q P AE ERV +  
Sbjct: 20  ETSKRFYQRSYAGDYLGVALLVAAYILIKLFGEPFHSQFRLDDPRLQHPHAEVERVDVTW 79

Query: 65  CAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFI 124
                           A   + S H  H               +T++ K+ +GRPRPD I
Sbjct: 80  LLIYALLVPLVLLILWAAVTRPSTHKIHITILGLIISILLATFITDILKDAIGRPRPDLI 139

Query: 125 DRCQPSAAFDPGLGLSNSTICTRT--DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLH 182
            RC+P A   PG  + +  +CT T    L DG++S+ SGHSS +FAG+G++SL LA +LH
Sbjct: 140 ARCKP-AKGTPGNKMVSVEVCTETAHHTLHDGWRSYPSGHSSLAFAGLGWISLVLASQLH 198

Query: 183 VFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPD 242
           V   +                     SR EDYRH   DV +GS++GF+++YF + +YYP 
Sbjct: 199 VLRPRASLMVVLSCLAPLLGAALIAVSRLEDYRHDVFDVVSGSILGFMVTYFNWRRYYPS 258

Query: 243 LHSKISDKP 251
           L +   ++P
Sbjct: 259 LMAPGCEEP 267



>gi|296813831|ref|XP_002847253.1| PAP2 domain-containing protein [Arthroderma otae CBS 113480]
 gi|238842509|gb|EEQ32171.1| PAP2 domain-containing protein [Arthroderma otae CBS 113480]
          Length = 292

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/243 (33%), Positives = 122/243 (50%), Gaps = 6/243 (2%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQL--EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           ++YA D+ +  IFL + + + QL   P+H++FSL++ +IQ+PFA  ERVP+         
Sbjct: 10  RSYAADYSI-LIFLVVTWVMLQLFVHPFHQMFSLDNTSIQYPFAIVERVPVLWSIIYSGV 68

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                    ++  +   H  H               VT++ KN VGRPRPD I RC+P  
Sbjct: 69  FPLLAIVVWSVLFRPGSHFVHVTLLGLLAALLVTIFVTDIIKNAVGRPRPDLISRCKPEK 128

Query: 132 AFDPGLGLSNSTICTRTDL--LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
              P   L + TICT T+   L +G++SF SGHSS  F+G+G+LS +L G+L  +     
Sbjct: 129 G-TPEHALVDYTICTSTNQHNLNEGWRSFPSGHSSFGFSGLGYLSFFLTGQLRAWRPHSG 187

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISD 249
             +                SR  DYRH  +DV +GS++G   +Y  Y  YYP L +   D
Sbjct: 188 LARLLVSLSPLLGALMIAISRVADYRHDVYDVSSGSIIGLGTAYLVYRCYYPSLWAVDCD 247

Query: 250 KPF 252
            P+
Sbjct: 248 TPY 250



>gi|508773877|gb|EOY21133.1| Lipid phosphate phosphatase 2 [Theobroma cacao]
          Length = 325

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 126/240 (52%), Gaps = 9/240 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ + +  DW++    + I   ++ +EP+HR    E  T ++FPF  K+ +P W     
Sbjct: 16  VKVARIHLYDWLILVFLVVIDGLLNFIEPFHRFVGEEMMTDLKFPF-HKDTIPFW-AVPF 73

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                           +K ++D+HHA             +T+  K+ VGRPRP+F  RC 
Sbjct: 74  LAVLLPLVIFSIYYYFRKDVYDFHHAVLGLLFSVLVTGVITDSVKDAVGRPRPNFFWRCF 133

Query: 129 P--SAAFDPGLGLSNSTICTRTD-LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P   A FD  +G     +C   +  +K+G+KSF SGH+S SFAG+ FLS Y++GK+ VFD
Sbjct: 134 PDGKAVFDRIIG---DVVCHGNEKYIKEGYKSFPSGHTSWSFAGLSFLSWYMSGKIRVFD 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
           ++G+  K                SR +DY HHW DVFAG+L+G  ++ F Y Q++P  H+
Sbjct: 191 RRGHVAKLCVVFLPVLVAALVGVSRVDDYWHHWTDVFAGALIGSTMAAFCYLQFFPSPHN 250



>gi|400598336|gb|EJP66053.1| PAP2 superfamily protein [Beauveria bassiana ARSEF 2860]
          Length = 302

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/246 (34%), Positives = 125/246 (50%), Gaps = 7/246 (2%)

Query: 13  LKAYALDWVLCFIFL-GIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           + ++A ++V  F+ L G    V  + P+HR+FS++D  I FP AE ERVP+ +       
Sbjct: 22  MTSHAPEYVGFFLLLIGWICLVLFVTPFHRMFSIDDLQISFPHAEHERVPVVMNFVYAFF 81

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                     L ++                      +T+V KN VGRPRPD +DRCQP A
Sbjct: 82  IPLGVLISYNLIMRSPATKHEVTYLSFLISVALTLFLTDVIKNAVGRPRPDLLDRCQPRA 141

Query: 132 AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
              P   L +  +CT  D   L+DG++SF SGHSS SFAG+GF+SLY AG+  +F     
Sbjct: 142 GTKPHT-LVSIDVCTTGDGHKLQDGWRSFPSGHSSFSFAGLGFVSLYFAGQFQIFRTATG 200

Query: 190 TY---KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSK 246
                +                SR EDYRH  +DV  GS +GF ++Y++Y +++P L S 
Sbjct: 201 GRDLSRALFCLAPLIGAALIAISRCEDYRHDVYDVCVGSTLGFTVAYWSYRRHWPPLASP 260

Query: 247 ISDKPF 252
           +  +P+
Sbjct: 261 LCAQPY 266



>gi|115439331|ref|NP_001043945.1| Os01g0693300 [Oryza sativa Japonica Group]
 gi|56784972|dbj|BAD82502.1| phosphatidic acid phosphatase beta-like [Oryza sativa Japonica
           Group]
 gi|113533476|dbj|BAF05859.1| Os01g0693300 [Oryza sativa Japonica Group]
 gi|126165538|gb|ABN80230.1| acid phosphatase ACP2 [Oryza sativa]
 gi|215715202|dbj|BAG94953.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 322

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 124/241 (51%), Gaps = 11/241 (4%)

Query: 5   SEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMW 63
           S  SKI  L  Y  DW++  + + +   ++ +EP+HR    +  T +++P  +   VP W
Sbjct: 19  SHGSKIARLHMY--DWIVLILLVVVDGILNIIEPFHRFVGSDMMTDLRYPMKDNT-VPFW 75

Query: 64  LCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDF 123
                                K++++D+HHA             +T+  K+ VGRPRPDF
Sbjct: 76  AVPIIGIIGPMIIITGIYFK-KRNVYDFHHAILGLLFSVLITAVITDAIKDGVGRPRPDF 134

Query: 124 IDRCQPSA--AFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGK 180
             RC P    A+D     +   +C  +  ++K+G KSF SGH+S SFAG+GFLS YLAGK
Sbjct: 135 FWRCFPDGVPAYD---NFTTGVLCHGKASVIKEGHKSFPSGHTSWSFAGLGFLSWYLAGK 191

Query: 181 LHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYY 240
           + VFD++G+  K                SR +DY HHW DVF G ++G ++S F Y Q++
Sbjct: 192 IKVFDRRGHVAKLCIIILPLLLAALVAVSRVDDYWHHWQDVFTGGILGLVVSSFCYLQFF 251

Query: 241 P 241
           P
Sbjct: 252 P 252



>gi|194694718|gb|ACF81443.1| unknown [Zea mays]
 gi|195607996|gb|ACG25828.1| lipid phosphate phosphatase 3 [Zea mays]
 gi|413947351|gb|AFW80000.1| lipid phosphate phosphatase 3 [Zea mays]
          Length = 305

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 122/248 (49%), Gaps = 9/248 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ + +  DWV+  +   +  +V    P+ R    +  T I++P  +   VP W     
Sbjct: 16  VRLARKHTHDWVVLILLAALVVAVHYAPPFSRFVGKDMMTDIRYP-VKPSTVPAWAVPMI 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        +A ++ ++D HHA+             T+V K  VGRPRPDF  RC 
Sbjct: 75  SILCPWLVFISIYVA-RRDVYDLHHAALGVLFAVLITAVFTDVIKTAVGRPRPDFFWRCF 133

Query: 129 PSAA--FDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     +D  +G     IC    + LKDG KSF SGH+S SFAG+GFLSLYL+GK+  F+
Sbjct: 134 PDGKQLYDQVIG---DVICHGDKNFLKDGRKSFPSGHTSWSFAGLGFLSLYLSGKIKAFN 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
           ++G+  K                SR +DYRHHW DVF G L+GF+++   Y  ++P  + 
Sbjct: 191 RQGHVAKLCIVILPLLLASLVGVSRVDDYRHHWEDVFVGGLIGFIMAVLCYLHFFPPPYH 250

Query: 246 KISDKPFT 253
               +P+ 
Sbjct: 251 DQGCRPYA 258



>gi|154274686|ref|XP_001538194.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150414634|gb|EDN09996.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 319

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 119/243 (48%), Gaps = 4/243 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V L  + +G+      + P++R+F+L+D  IQ PFA  ERVP           
Sbjct: 31  RSYAADYVSLILLCVGLILIQIWVRPFNRMFTLDDVAIQLPFALVERVPFLWSITYAGVT 90

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   AL I++  H  H +             +T++ KN  GRPRPD + RC+P   
Sbjct: 91  PLIIIILWALMIRRESHFAHVSVLGLLVTLILTSFLTDIIKNAAGRPRPDLLARCRPQKG 150

Query: 133 FDPGLGLSNSTIC--TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L  S +C    +  L +G++SF SGHSS +F G+G+L ++ AG+LHVF  +   
Sbjct: 151 -TPAHQLVTSDVCGAPESHQLDEGWRSFPSGHSSFAFGGLGYLFMFFAGQLHVFQPRTGL 209

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
                             SR  DYRH  +DV AG+L+G  ++Y  Y +Y+P L S     
Sbjct: 210 ACFLFALSPLLGALMIAMSRLADYRHDVYDVTAGALLGLSVAYSIYRRYFPTLLSVDCHN 269

Query: 251 PFT 253
           P+ 
Sbjct: 270 PYN 272



>gi|340514373|gb|EGR44636.1| hypothetical protein TRIREDRAFT_69858 [Trichoderma reesei QM6a]
          Length = 279

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 118/237 (49%), Gaps = 15/237 (6%)

Query: 20  WVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXX 79
           W+L  +F+          P+HR+F + D  I +P AE ERV + L               
Sbjct: 18  WILIIVFV---------NPFHRMFFINDLRISYPHAEHERVTVPLNFLYALFIPLGILIA 68

Query: 80  XALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGL 139
                + S H                  +T+V KN VGRPRPD + RCQP A   P + L
Sbjct: 69  YNTITRASTHKHEATYLSLAISIVLASFLTDVVKNAVGRPRPDLLARCQPHADTKPNV-L 127

Query: 140 SNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY---KGF 194
            + ++CT +D  +L+DG++SF SGHSS SFAG+GFLSL+LAG+LHVF+         +  
Sbjct: 128 VDISVCTASDGHVLQDGWRSFPSGHSSFSFAGLGFLSLFLAGQLHVFNYPSGGRDLSRAL 187

Query: 195 XXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
                         SR EDYRH  +DV  GS +G  ++Y++Y +++P L      +P
Sbjct: 188 LCLAPLLGAALIAISRCEDYRHDVYDVCIGSALGMTVAYWSYRRHFPRLSGPKCHEP 244



>gi|448082153|ref|XP_004195066.1| Piso0_005607 [Millerozyma farinosa CBS 7064]
 gi|359376488|emb|CCE87070.1| Piso0_005607 [Millerozyma farinosa CBS 7064]
          Length = 307

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 130/281 (46%), Gaps = 21/281 (7%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           +  MS  S + I   Y LD ++    + IF  V++L+P+ R FSL D TIQ  F++ ERV
Sbjct: 33  QASMSAISNL-IKGKYQLDLLVGIALVFIFLVVEKLKPFFRDFSLSDPTIQHKFSKHERV 91

Query: 61  PMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXX-----------XXXXXXXXXVT 109
              LC                +A ++    W  +                        + 
Sbjct: 92  SANLCLSIISIVPSAVIAMAVVADRR----WKRSKTQQLQLLTVSLLGLMLTTTMAGVLI 147

Query: 110 EVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRT---DLLKDGFKSFLSGHSSTS 166
           ++ K+ +GRPRPDF+ RC P  +  P +GL +  +CT       L DG +S  SGHS  S
Sbjct: 148 DILKSWIGRPRPDFLQRCGPKKS-TPVIGLVSIDVCTAPLGKRALIDGMRSMPSGHSGLS 206

Query: 167 FAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSL 226
           F+ + +L+L+L G+  +F +    YK                SRT+DYRHH+ D+  G  
Sbjct: 207 FSSLFYLTLWLGGQFKIFHRSQPLYKSLIAALPTIGACYVALSRTQDYRHHFSDIVVGGF 266

Query: 227 VGFLLSYFAYHQYYPDLHSKISDKPFTIRLK-KVVPEYKAE 266
           +G  LS   YH+Y+P L    S+KP  +  +  V+P Y  +
Sbjct: 267 IGIALSVVTYHRYFPVLWDTDSNKPLEVESESSVLPMYSLD 307



>gi|482812402|gb|EOA89121.1| hypothetical protein SETTUDRAFT_159543 [Setosphaeria turcica Et28A]
          Length = 701

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 113/218 (51%), Gaps = 3/218 (1%)

Query: 37  EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASX 96
           +P+HR+F L++  I +P AE ERV ++                 AL ++   H  H    
Sbjct: 438 QPFHRMFFLDNLAIGYPHAEIERVSVFWLFIYAGLVPLAMLITWALVVRPGTHKAHVTIL 497

Query: 97  XXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDG 154
                      +T+V KN VGRPRPD I RC+P A   P   L    +CT T+  +L DG
Sbjct: 498 GFMISMILTSFITDVIKNAVGRPRPDLIARCKP-APGTPAHQLVTFEVCTETNHHVLHDG 556

Query: 155 FKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDY 214
           ++SF SGHSS +F+G+G+L+L++AG+ HV+  +    +                SR EDY
Sbjct: 557 WRSFPSGHSSFAFSGLGYLALFIAGQCHVYRPRADLARVLVALAPLLGAALIAISRCEDY 616

Query: 215 RHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
           RH  +DV  GS++G  ++++ Y +YYP L  +    PF
Sbjct: 617 RHDVYDVTVGSVLGMAVAHYTYRRYYPALRHRHCATPF 654



>gi|336466569|gb|EGO54734.1| hypothetical protein NEUTE1DRAFT_141018 [Neurospora tetrasperma
           FGSC 2508]
 gi|350286543|gb|EGZ67790.1| PAP2-domain-containing protein [Neurospora tetrasperma FGSC 2509]
          Length = 343

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 124/262 (47%), Gaps = 23/262 (8%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++Y  DWV    + +G  +    +EP+HRLF++ D  I FP AE ERVP+          
Sbjct: 29  RSYTSDWVAFSLLLVGYIYIAAFVEPFHRLFTINDIRISFPHAEVERVPLAHLFGYVLFL 88

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                      +    H  H  +            +T++ KN VGRPRPD IDRCQP  +
Sbjct: 89  PLALLTLTNYLLSSPRHIHHLTTLGFLTSIILTTFLTDLIKNMVGRPRPDLIDRCQPDPS 148

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L +  +CT+TD   L DG++SF SGHSS +F+G+G+L+L+  G+  VF      
Sbjct: 149 TPPN-KLVSVEVCTQTDHHTLHDGWRSFPSGHSSFAFSGLGYLALFWCGQFRVFASSSPL 207

Query: 191 -------------------YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLL 231
                               K                SR  DYRH   DV  G+++G+++
Sbjct: 208 SSSPGIMEGMEKVLVRRDLLKALLCLSPLLGALMIAISRCMDYRHDVEDVCVGAVMGWVI 267

Query: 232 SYFAYHQYYPDLHSKISDKPFT 253
           +Y++Y +Y+P L S   ++P++
Sbjct: 268 TYWSYRRYWPRLSSVRCEEPYS 289



>gi|218187478|gb|EEC69905.1| hypothetical protein OsI_00314 [Oryza sativa Indica Group]
          Length = 329

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 119/236 (50%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ + +  DWV+  +   +  ++    P+ R    +  T + +P  ++  VP W     
Sbjct: 40  VRLARNHLHDWVVLILLAAVVIALHFAPPFSRFVGKDMMTYVSYP-VKQSTVPAWGVPII 98

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        +A ++ ++D HHA+            VT V KN VGRPRPDF  RC 
Sbjct: 99  SIVCPVIIFLSVYIA-RRDVYDLHHATLGVLYSVLITAVVTTVVKNAVGRPRPDFFWRCF 157

Query: 129 PSAA--FDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     +D    ++   IC      LKDG KSF SGH+S SFAG+ FLSLYL+GK+ VFD
Sbjct: 158 PDGKQLYDQ---VTGDVICHGEKSFLKDGRKSFPSGHTSWSFAGLVFLSLYLSGKIKVFD 214

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DYRHHW DVFAG L+GF+++   Y  ++P
Sbjct: 215 RQGHVAKLCIMILPLLIASLVGISRIDDYRHHWEDVFAGGLLGFIMAMLCYLHFFP 270



>gi|238883401|gb|EEQ47039.1| hypothetical protein CAWG_05594 [Candida albicans WO-1]
          Length = 306

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 84/250 (33%), Positives = 123/250 (49%), Gaps = 7/250 (2%)

Query: 13  LKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           +K    D++L  + + +FF   Q EP+HR F L D TIQ PFAE ERV            
Sbjct: 30  IKWRITDFILIIVLIVLFFVTSQAEPFHRQFYLNDMTIQHPFAEHERVTNIQLGLYSTVI 89

Query: 73  XXXXXXXXAL----AIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                   AL      K  +++   +S            VT + KN  GR RPDF+DRCQ
Sbjct: 90  PLSVIIIVALISTCPPKYKLYNTWVSSIGLLLSVLITSFVTNIVKNWFGRLRPDFLDRCQ 149

Query: 129 PSAAFDPGLGLSNSTICTRTDL--LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
           P A   P   L +  +CT  +L  L DGF++  SGHSS SFAG+ +L+L+L G+    + 
Sbjct: 150 P-ANDTPKDKLVSIEVCTTDNLDRLADGFRTTPSGHSSISFAGLFYLTLFLLGQSQANNG 208

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSK 246
           K  +++                SRT+DYRHH+ DVF GS +G +++ + Y + +P     
Sbjct: 209 KTSSWRTMISFIPWLMACYIALSRTQDYRHHFIDVFVGSCLGLIIAIWQYFRLFPWFGGN 268

Query: 247 ISDKPFTIRL 256
            ++  F  R+
Sbjct: 269 QANDSFNNRI 278



>gi|225681234|gb|EEH19518.1| diacylglycerol pyrophosphate phosphatase [Paracoccidioides
           brasiliensis Pb03]
          Length = 302

 Score =  137 bits (345), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 119/243 (48%), Gaps = 23/243 (9%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V L  I +G       + P+HR+F+L++ +IQFPF E ERVP+          
Sbjct: 32  RSYAADYVSLIVIVVGWMLIQIFVLPFHRMFTLDNVSIQFPFTEVERVPVLWSIIYSEVF 91

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   A+ I+  +H  H                     N VGRPRPD + RC P   
Sbjct: 92  PLVVIVLWAVIIRPEVHFAH-------------------VSNAVGRPRPDLLSRCSPKKG 132

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L    +C   D   L +G++SF SGHSS +F G+G+L+++L+G+L VF  +   
Sbjct: 133 -TPDHLLVTLDVCGEPDSHKLHEGWRSFPSGHSSIAFGGLGYLAMFLSGQLRVFRPRTGL 191

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            K                SR EDYRH  +DV AGSL+G   +YF Y +YYP L S   + 
Sbjct: 192 AKFLFSLSPLLGALMIAMSRLEDYRHDVYDVTAGSLLGLSAAYFTYRRYYPPLRSVDCEN 251

Query: 251 PFT 253
           P++
Sbjct: 252 PYS 254



>gi|68469030|ref|XP_721302.1| hypothetical protein CaO19.6459 [Candida albicans SC5314]
 gi|68470063|ref|XP_720793.1| hypothetical protein CaO19.13817 [Candida albicans SC5314]
 gi|77022846|ref|XP_888867.1| hypothetical protein CaO19_6459 [Candida albicans SC5314]
 gi|46442679|gb|EAL01966.1| hypothetical protein CaO19.13817 [Candida albicans SC5314]
 gi|46443212|gb|EAL02495.1| hypothetical protein CaO19.6459 [Candida albicans SC5314]
 gi|76573680|dbj|BAE44764.1| hypothetical protein [Candida albicans]
          Length = 306

 Score =  137 bits (345), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 84/250 (33%), Positives = 123/250 (49%), Gaps = 7/250 (2%)

Query: 13  LKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           +K    D++L  + + +FF   Q EP+HR F L D TIQ PFAE ERV            
Sbjct: 30  IKWRITDFILIIVLIVLFFVTSQAEPFHRQFYLNDMTIQHPFAEHERVTNIQLGLYSTVI 89

Query: 73  XXXXXXXXAL----AIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                   AL      K  +++   +S            VT + KN  GR RPDF+DRCQ
Sbjct: 90  PLSVIIIVALISTCPPKYKLYNTWVSSIGLLLSVLITSFVTNIVKNWFGRLRPDFLDRCQ 149

Query: 129 PSAAFDPGLGLSNSTICTRTDL--LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
           P A   P   L +  +CT  +L  L DGF++  SGHSS SFAG+ +L+L+L G+    + 
Sbjct: 150 P-ANDTPKDKLVSIEVCTTDNLDRLADGFRTTPSGHSSISFAGLFYLTLFLLGQSQANNG 208

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSK 246
           K  +++                SRT+DYRHH+ DVF GS +G +++ + Y + +P     
Sbjct: 209 KTSSWRTMISFIPWLMACYIALSRTQDYRHHFIDVFVGSCLGLIIAIWQYFRLFPWFGGN 268

Query: 247 ISDKPFTIRL 256
            ++  F  R+
Sbjct: 269 QANDSFNNRI 278



>gi|326500976|dbj|BAJ95154.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326520984|dbj|BAJ92855.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 322

 Score =  137 bits (345), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 91/314 (28%), Positives = 147/314 (46%), Gaps = 31/314 (9%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRL---FSLEDKTIQFPFAEKERVPMWLCAX 67
           ++ + +  DW++  +   I   ++ + P+HR    F ++D  +++P  +   +P+W    
Sbjct: 25  KMARRHMYDWIVLLLLAAIEVVLNVITPFHRFVAEFMMDD--LRYPM-KPNTIPVWAVPI 81

Query: 68  XXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC 127
                         +  KK+ +D HHA             +T+  K+ VGRPRP+F  RC
Sbjct: 82  YAVILPMLIFAVIYVK-KKNAYDLHHAILGLLFSVLITGVLTDAIKDGVGRPRPNFYYRC 140

Query: 128 QPSAAFDPGLGLSNSTICTR-------TDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGK 180
            P        G+ N    TR         ++K+G KSF SGH+S SFAG+GFLS YLAGK
Sbjct: 141 FPD-------GVPNYEAITRQVICHGDAKVIKEGHKSFPSGHTSWSFAGLGFLSWYLAGK 193

Query: 181 LHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYY 240
           + VFD+ G+  K                SR  DY HHW DVFAG ++G +++ F Y Q++
Sbjct: 194 IRVFDRGGHIAKLCIVILPLLFAAMVGVSRVADYWHHWQDVFAGGILGLVVASFCYLQFF 253

Query: 241 PDLHSKISDKPFTIRLKKVVPEYKAEF---SFMDGSEVEITVVKNDEQLLLK-DSRALLA 296
           P   SK    P    L  + PE + +    +   G   ++++V     + ++ + RAL  
Sbjct: 254 PHPASKKGLWPHAFHLHNLNPETENQVTTDTHQSGLPHDLSMVPYVPSMEMRTNGRAL-- 311

Query: 297 DSSSNNTEGGSADI 310
               +N E G   +
Sbjct: 312 ----DNMEAGGGRV 321



>gi|115478468|ref|NP_001062829.1| Os09g0308900 [Oryza sativa Japonica Group]
 gi|51091484|dbj|BAD36223.1| putative phosphatidic acid phosphatase beta [Oryza sativa Japonica
           Group]
 gi|51091689|dbj|BAD36472.1| putative phosphatidic acid phosphatase beta [Oryza sativa Japonica
           Group]
 gi|113631062|dbj|BAF24743.1| Os09g0308900 [Oryza sativa Japonica Group]
 gi|222641291|gb|EEE69423.1| hypothetical protein OsJ_28801 [Oryza sativa Japonica Group]
          Length = 307

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 117/233 (50%), Gaps = 5/233 (2%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W      
Sbjct: 16  KVARLHMYDWIILLLLAVIDGLLNIIEPFHRFVGRDMMTDLRYPL-KGNTVPFWAVPLIG 74

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          KK+ +D HH              +T+  K+ VGRPRPDF  RC P
Sbjct: 75  IVLPCAIFGGIYFK-KKNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFP 133

Query: 130 SAAFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
               D    ++   IC     ++K+G KSF SGHSS SFAG+GFL+ YLAGK+ VFD++G
Sbjct: 134 DGK-DVYDNVTTGVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAGKITVFDRRG 192

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +  K                SR +DY HHW DVFAGSL+G  ++ F Y Q++P
Sbjct: 193 HVAKLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGSLIGLTVASFCYLQFFP 245



>gi|116787331|gb|ABK24466.1| unknown [Picea sitchensis]
          Length = 338

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 133/271 (49%), Gaps = 21/271 (7%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           IQ+++ +  DW++    + I   ++ + P++R       T + +PF +   VP+W  A  
Sbjct: 19  IQLVQYHKHDWLMILGLVVIVILLNVINPFYRFVGRGMMTDLMYPF-KGNTVPIWAVAIF 77

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        +  K+ ++D+HH+             +TE  K+ VGRPRPDF  RC 
Sbjct: 78  AIILPIFIFSIHYIR-KRDLNDFHHSIMGLLFAVLITAVITESIKDAVGRPRPDFFWRCF 136

Query: 129 PSAA--FDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     +D    ++ + IC     ++K+G KSF SGH+S +FAG+G+LSLYLA K+++FD
Sbjct: 137 PDGKENYD---SVTGNVICHGDRKVIKEGHKSFPSGHTSLAFAGLGYLSLYLAAKINIFD 193

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
           ++G+  K                SR +DY HHW DVFAG L+G  ++   Y Q++P  + 
Sbjct: 194 RQGHASKLCIIFFPLLIAALIGISRVDDYWHHWQDVFAGGLIGLTIATLCYRQFFPAPYD 253

Query: 246 KISDKPFTIRLKKVVPEYKAEFSFMDGSEVE 276
             +  P+            A F F+ G  V 
Sbjct: 254 SDAVGPY------------AYFQFLTGEHVN 272



>gi|226507286|ref|NP_001141145.1| lipid phosphate phosphatase 3 isoform 1 [Zea mays]
 gi|194702878|gb|ACF85523.1| unknown [Zea mays]
 gi|223944189|gb|ACN26178.1| unknown [Zea mays]
 gi|414589314|tpg|DAA39885.1| TPA: lipid phosphate phosphatase 3 isoform 1 [Zea mays]
 gi|414589315|tpg|DAA39886.1| TPA: lipid phosphate phosphatase 3 isoform 2 [Zea mays]
 gi|414589316|tpg|DAA39887.1| TPA: lipid phosphate phosphatase 3 isoform 3 [Zea mays]
          Length = 310

 Score =  136 bits (343), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 92/300 (30%), Positives = 140/300 (46%), Gaps = 16/300 (5%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXX 72
           + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W         
Sbjct: 19  RLHMYDWIILLLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPM-KGNTVPFWAVPLIGIIL 77

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                       KK+ +D HH              +T+  K+ VGRPRPDF  RC P+  
Sbjct: 78  PWAIFVGIYFK-KKNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFPNGN 136

Query: 133 FDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY 191
            D    ++   IC     ++K+G KSF SGHSS SFAG+GFL+ YLAGKL  FD+KG+  
Sbjct: 137 -DVYDNITTGVICNGVKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAGKLTAFDRKGHIA 195

Query: 192 KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
           K                SR +DY HHW DVFAG L+G  ++ F Y Q++P      +  P
Sbjct: 196 KLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGGLIGLTVASFCYLQFFPYPFDGDALWP 255

Query: 252 --FTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQLL-LKDSRALLADSSSNNTEGGSA 308
             + +RL +      A    +  +E+E   +     ++ L+D+         N+ E GSA
Sbjct: 256 HAYAVRLAEEGNSRNANSYSVRPTEIETVDIPGHGGIITLRDTL--------NDVESGSA 307



>gi|218201893|gb|EEC84320.1| hypothetical protein OsI_30819 [Oryza sativa Indica Group]
          Length = 409

 Score =  136 bits (342), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 117/233 (50%), Gaps = 5/233 (2%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W      
Sbjct: 118 KVARLHMYDWIILLLLAVIDGLLNIIEPFHRFVGRDMMTDLRYPL-KGNTVPFWAVPLIG 176

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          KK+ +D HH              +T+  K+ VGRPRPDF  RC P
Sbjct: 177 IVLPCAIFGGIYFK-KKNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFP 235

Query: 130 SAAFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
               D    ++   IC     ++K+G KSF SGHSS SFAG+GFL+ YLAGK+ VFD++G
Sbjct: 236 DGK-DVYDNVTTGVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAGKITVFDRRG 294

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +  K                SR +DY HHW DVFAGSL+G  ++ F Y Q++P
Sbjct: 295 HVAKLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGSLIGLTVASFCYLQFFP 347



>gi|195653563|gb|ACG46249.1| lipid phosphate phosphatase 3 [Zea mays]
          Length = 310

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 114/230 (49%), Gaps = 5/230 (2%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXX 72
           + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W         
Sbjct: 19  RLHMYDWIILLLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPM-KGNTVPFWAVPLIGIIL 77

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                       KK+ +D HH              +T+  K+ VGRPRPDF  RC P+  
Sbjct: 78  PWAIFVGIYFK-KKNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFPNGN 136

Query: 133 FDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY 191
            D    ++   IC     ++K+G KSF SGHSS SFAG+GFL+ YLAGKL  FD+KG+  
Sbjct: 137 -DVYDNITTGVICNGVKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAGKLTAFDRKGHIA 195

Query: 192 KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           K                SR +DY HHW DVFAG L+G  ++ F Y Q++P
Sbjct: 196 KLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGGLIGLTVASFCYLQFFP 245



>gi|297844410|ref|XP_002890086.1| ATPAP2 [Arabidopsis lyrata subsp. lyrata]
 gi|297335928|gb|EFH66345.1| ATPAP2 [Arabidopsis lyrata subsp. lyrata]
          Length = 312

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 124/238 (52%), Gaps = 13/238 (5%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           + + + +  DW++  + + I   ++ +EP+HR    +  T +++P  +   +P W     
Sbjct: 16  VTVARFHMHDWLILLLLIVIDIVLNIIEPFHRFVGEDMLTDLRYPL-QDNTIPFWAVPLI 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I+  ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AVVLPFAVICVYYF-IRNDVYDLHHAILGLLFSVLITGVITDAIKDAVGRPRPDFFWRCF 133

Query: 129 PSAAFDPGLGL----SNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           P      G+G+    + + +CT   D++K+G KSF SGH+S SFAG+GFLSLYL+GK+ V
Sbjct: 134 PD-----GIGIFHNVTRNVLCTGAKDVVKEGHKSFPSGHTSWSFAGLGFLSLYLSGKIRV 188

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           FDQ+G+  K                SR +DY HHW DVF G+++G  ++ F Y Q++P
Sbjct: 189 FDQRGHVAKLCIVILPLLVAALVGVSRVDDYWHHWQDVFGGAIIGLTVATFCYLQFFP 246



>gi|195624942|gb|ACG34301.1| lipid phosphate phosphatase 3 [Zea mays]
          Length = 310

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 114/230 (49%), Gaps = 5/230 (2%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXX 72
           + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W         
Sbjct: 19  RLHMYDWIILLLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPM-KGNTVPFWAVPLIGIIL 77

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                       KK+ +D HH              +T+  K+ VGRPRPDF  RC P+  
Sbjct: 78  PWAIFVGIYFK-KKNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFPNGN 136

Query: 133 FDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY 191
            D    ++   IC     ++K+G KSF SGHSS SFAG+GFL+ YLAGKL  FD+KG+  
Sbjct: 137 -DVYDNITTGVICNGVKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAGKLTAFDRKGHIA 195

Query: 192 KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           K                SR +DY HHW DVFAG L+G  ++ F Y Q++P
Sbjct: 196 KLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGGLIGLTVASFCYLQFFP 245



>gi|218201024|gb|EEC83451.1| hypothetical protein OsI_28949 [Oryza sativa Indica Group]
          Length = 582

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 121/236 (51%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSV-DQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAX 67
           I++ K +  DW++  IFL + + + + +EP+HR    +  T +++P  +   VP W    
Sbjct: 288 IKVAKFHLYDWMI-LIFLAVVYGLFNIIEPFHRFVGSDMLTDLRYPL-KGNTVPFWAVPL 345

Query: 68  XXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC 127
                            KK+++D HH              +T+  KN VGRPRPDF  RC
Sbjct: 346 IAIVLPWAIFGGIYFK-KKNVYDLHHGILGILYSVLITAVITDAIKNGVGRPRPDFFWRC 404

Query: 128 QPSAAFDPGLG-LSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
            P     P    ++   IC     ++K+G+KSF SGHSS +FAG+GFL+ YLAGKL  F+
Sbjct: 405 FPDG--KPNFNNVTGDVICHGERSVIKEGYKSFPSGHSSGAFAGLGFLAWYLAGKLKAFN 462

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW DVFAG ++G  ++ F Y Q++P
Sbjct: 463 REGHIAKLCLVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVASFCYLQFFP 518



 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (60%), Gaps = 1/104 (0%)

Query: 139 LSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXX 197
           ++ + IC     ++K+G KSF SGHSS SFAG+GFL+ YLA KL  FD+KG+  K     
Sbjct: 77  VTTNVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAVKLKAFDRKGHIAKLCIVF 136

Query: 198 XXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
                      SR +DY HHW DVFAG ++G  +S F Y Q++P
Sbjct: 137 LPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVSSFCYLQFFP 180



>gi|500257193|gb|EOO00375.1| putative pap2 superfamily protein [Togninia minima UCRPA7]
          Length = 313

 Score =  136 bits (342), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 90/259 (34%), Positives = 132/259 (50%), Gaps = 26/259 (10%)

Query: 15  AYALDWVLCFIFLGIFFSVDQ-LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXX 73
           +YA D+V     L  +  ++  LEP+HR+F + D  I FP AE ERVP+ +         
Sbjct: 27  SYAPDYVGFLALLVAYILMEFFLEPFHRMFFINDLAISFPHAEHERVPVAM-EFVYSLFV 85

Query: 74  XXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAF 133
                  AL  + S+H +H               +T+  KN VGRPRPD +DRC+P+   
Sbjct: 86  PLAIIIIALIRRPSLHKYHVTILGFAIALILTSFLTDFVKNAVGRPRPDLVDRCKPA--- 142

Query: 134 DPGLG---LSNSTICTRT--DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF---- 184
            PG     L    +CT T   +L DG++SF SGHSS +FAG+G+LSL+LAG+L +F    
Sbjct: 143 -PGTSRDVLVTIEVCTETRHHVLHDGWRSFPSGHSSFAFAGLGYLSLFLAGQLRLFVLGG 201

Query: 185 ------DQKGYTYKG-----FXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSY 233
                 D K    +G                    SR +DYRH  +DV  G+L+G++++Y
Sbjct: 202 GRGEQADGKAIYARGDLGRALICLVPLIGAAMIAISRCQDYRHDVYDVCTGALLGWVVAY 261

Query: 234 FAYHQYYPDLHSKISDKPF 252
           + Y +Y+P L S   D+P+
Sbjct: 262 WNYRRYWPKLSSSHCDEPY 280



>gi|148910218|gb|ABR18190.1| unknown [Picea sitchensis]
          Length = 338

 Score =  136 bits (342), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 84/281 (29%), Positives = 137/281 (48%), Gaps = 22/281 (7%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           IQ+++ +  DW++    + I   ++ + P++R       T + +P  +   VP+W  A  
Sbjct: 19  IQLVQYHKHDWLMILGLVVIVILLNLINPFYRFVGRGMMTDLMYPL-KGNTVPIWAVAIF 77

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        +  K+ ++D+HH+             +TE  K+ VGRPRPDF  RC 
Sbjct: 78  AIILPIFIFSIHYIR-KRDLNDFHHSILGLLFAVLITAVITESIKDAVGRPRPDFFWRCF 136

Query: 129 PSAA--FDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     +D    ++ + IC     ++K+G KSF SGH+S +FAG+G+LSLYLA K+++FD
Sbjct: 137 PDGKGNYD---SVTGNVICHGDRKVIKEGHKSFPSGHTSLAFAGLGYLSLYLAAKINIFD 193

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
           ++G+  K                SR +DY HHW DVFAG L+G  ++   Y Q++P  + 
Sbjct: 194 RQGHASKLCIIFFPLLIAALIGISRVDDYWHHWQDVFAGGLIGLTIATLCYRQFFPAPYD 253

Query: 246 KISDKPFTIRLKKVVPEYKAEFSFMDGSEV-EITVVKNDEQ 285
             +  P+            A F F+ G  V E+  +  D Q
Sbjct: 254 SDAVGPY------------AYFQFLTGEHVNELENIGQDAQ 282



>gi|194693160|gb|ACF80664.1| unknown [Zea mays]
 gi|414870668|tpg|DAA49225.1| TPA: hypothetical protein ZEAMMB73_828601 [Zea mays]
 gi|414870669|tpg|DAA49226.1| TPA: hypothetical protein ZEAMMB73_828601 [Zea mays]
          Length = 315

 Score =  136 bits (342), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 119/246 (48%), Gaps = 16/246 (6%)

Query: 5   SEFSKIQILKAYALDWV--LCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVP 61
           S  +K+  L  Y  DW+  LC   L    ++  +EP+HR    +  T + +P  +   +P
Sbjct: 13  SHGTKVATLHMY--DWIILLCLAVLDGLLNI--IEPFHRFVGRDMMTDLSYPL-KGNTIP 67

Query: 62  MWLCAXXXXXXXXXXXXXXALAI----KKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVG 117
            W                   A+    KK+++D HH              +T+  K+ VG
Sbjct: 68  FWAVPVCSALLIAIVLPLVIFAVIYFKKKNVYDLHHGILGILYSVLITAVITDAIKDGVG 127

Query: 118 RPRPDFIDRCQPSAAFDPGLG-LSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSL 175
           RPRPDF  RC P     P    ++   IC     ++K+G KSF SGHSS SFAG+GFL+ 
Sbjct: 128 RPRPDFFWRCFPDGK--PNFNNITTDVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAW 185

Query: 176 YLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFA 235
           YLAGKL  FD+KG+  K                SR +DY HHW DVFAG ++G  ++ F 
Sbjct: 186 YLAGKLKAFDRKGHIAKLCLVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVASFC 245

Query: 236 YHQYYP 241
           Y Q++P
Sbjct: 246 YLQFFP 251



>gi|242096386|ref|XP_002438683.1| hypothetical protein SORBIDRAFT_10g024290 [Sorghum bicolor]
 gi|241916906|gb|EER90050.1| hypothetical protein SORBIDRAFT_10g024290 [Sorghum bicolor]
          Length = 321

 Score =  136 bits (342), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 125/245 (51%), Gaps = 9/245 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLED--KTIQFPFAEKERVPMWLCAXX 68
           Q+ + +  DW++  + + ++  + +L+P+HR F  ED   ++++P  +   VP W  A  
Sbjct: 26  QVARLHLFDWIVLLLLIAMYAVLGRLQPFHR-FVAEDMMASLRYPM-KGNTVPSW--AVP 81

Query: 69  XXXXXXXXXXXXALAIKK-SMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC 127
                        + IK+ +++D HHA             +T   K+ VG PRPDF  RC
Sbjct: 82  IIAIVVPMIFMVGIYIKRRNVYDLHHAILGLLFSVLITAILTVAIKDAVGWPRPDFFWRC 141

Query: 128 QPSAAFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
            P    +    ++   IC  +  ++++G KSF SGHSS  F+G+GFLS YLAGK+  FD+
Sbjct: 142 FPDGVPNYN-NITGGVICHGQQSVIEEGHKSFPSGHSSGCFSGLGFLSWYLAGKIKAFDR 200

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSK 246
            G+  K                SR  DY HHW DVFAG ++G +++ F Y Q++P  +SK
Sbjct: 201 GGHVAKLCIVLLPLLLATMVAVSRVSDYWHHWQDVFAGGVLGLVVASFCYLQFFPPPYSK 260

Query: 247 ISDKP 251
               P
Sbjct: 261 QGVWP 265



>gi|195636994|gb|ACG37965.1| lipid phosphate phosphatase 3 [Zea mays]
          Length = 310

 Score =  136 bits (342), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 114/230 (49%), Gaps = 5/230 (2%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXX 72
           + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W         
Sbjct: 19  RLHMYDWIILLLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPM-KGNTVPFWAVPLIGIIL 77

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                       KK+ +D HH              +T+  K+ VGRPRPDF  RC P+  
Sbjct: 78  PWTIFVGIYFK-KKNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFPNGN 136

Query: 133 FDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY 191
            D    ++   IC     ++K+G KSF SGHSS SFAG+GFL+ YLAGKL  FD+KG+  
Sbjct: 137 -DVYDNITTGVICNGVKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAGKLTAFDRKGHIA 195

Query: 192 KGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           K                SR +DY HHW DVFAG L+G  ++ F Y Q++P
Sbjct: 196 KLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGGLIGLTVASFCYLQFFP 245



>gi|475599288|gb|EMT24205.1| Putative lipid phosphate phosphatase 3, chloroplastic [Aegilops
           tauschii]
          Length = 233

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 118/224 (52%), Gaps = 11/224 (4%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKER-VPMWLCAXX 68
           ++I +++A DWV   + + +   ++ +EP+HR F  E       +  K   VP+W  A  
Sbjct: 6   VRIARSHAYDWVALLLLIAMECVLNAIEPFHR-FVGEGMIADLRYPMKSNTVPVW--AVP 62

Query: 69  XXXXXXXXXXXXALAI-KKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC 127
                       A+ I +++ +D HHA+            +T+  KN VGRPRP+F  RC
Sbjct: 63  IVAVIAPMLIFMAIYIWRRNAYDLHHATIGILFSVLITGVLTDAIKNAVGRPRPNFFWRC 122

Query: 128 QPS--AAFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF 184
            P   A +D    ++ + IC     ++K+G KSF SGHSS SFAG+GFLS YLAGK+ VF
Sbjct: 123 FPDGIAVYD---NITTAVICHGDASVIKEGHKSFPSGHSSWSFAGLGFLSWYLAGKITVF 179

Query: 185 DQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVG 228
           D++G+  K                SR +DY HHW DVFAG ++G
Sbjct: 180 DRRGHVAKLCVVILPLLVAAVIAISRVDDYWHHWQDVFAGGILG 223



>gi|15218051|ref|NP_172961.1| lipid phosphate phosphatase 2 [Arabidopsis thaliana]
 gi|41017421|sp|Q9XI60.1|LPP2_ARATH RecName: Full=Lipid phosphate phosphatase 2; Short=AtLPP2; AltName:
           Full=Phosphatidic acid phosphatase 2; Short=AtPAP2;
           AltName: Full=Prenyl diphosphate phosphatase
 gi|5103807|gb|AAD39637.1|AC007591_2 Contains similarity to gb|AF014403 type-2 phosphatidic acid
           phosphatase alpha-2 (PAP2_a2) from Homo sapiens. ESTs
           gb|T88254 and gb|AA394650 come from this gene
           [Arabidopsis thaliana]
 gi|14020949|dbj|BAB47574.1| phosphatidic acid phosphatase [Arabidopsis thaliana]
 gi|21593261|gb|AAM65210.1| putative phosphatidic acid phosphatase [Arabidopsis thaliana]
 gi|26005745|dbj|BAC41335.1| prenyl diphosphate phosphatase [Arabidopsis thaliana]
 gi|28393050|gb|AAO41959.1| putative phosphatidic acid phosphatase [Arabidopsis thaliana]
 gi|28827316|gb|AAO50502.1| putative phosphatidic acid phosphatase [Arabidopsis thaliana]
 gi|332191142|gb|AEE29263.1| Lipid phosphate phosphatase 2 [Arabidopsis thaliana]
          Length = 290

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 124/238 (52%), Gaps = 13/238 (5%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           + + + +  DW++  + + I   ++ +EP+HR    +  T +++P  +   +P W     
Sbjct: 16  VTVARFHMHDWLILLLLIVIEIVLNVIEPFHRFVGEDMLTDLRYPL-QDNTIPFWAVPLI 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I+  ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AVVLPFAVICVYYF-IRNDVYDLHHAILGLLFSVLITGVITDAIKDAVGRPRPDFFWRCF 133

Query: 129 PSAAFDPGLGL----SNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           P      G+G+    + + +CT   D++K+G KSF SGH+S SFAG+GFLSLYL+GK+ V
Sbjct: 134 PD-----GIGIFHNVTKNVLCTGAKDVVKEGHKSFPSGHTSWSFAGLGFLSLYLSGKIRV 188

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           FDQ+G+  K                SR +DY HHW DVF G+++G  ++ F Y Q++P
Sbjct: 189 FDQRGHVAKLCIVILPLLVAALVGVSRVDDYWHHWQDVFGGAIIGLTVATFCYLQFFP 246



>gi|315040614|ref|XP_003169684.1| diacylglycerol pyrophosphate phosphatase 1 [Arthroderma gypseum CBS
           118893]
 gi|311345646|gb|EFR04849.1| diacylglycerol pyrophosphate phosphatase 1 [Arthroderma gypseum CBS
           118893]
          Length = 284

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 122/243 (50%), Gaps = 6/243 (2%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQL--EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           ++Y  D+ +  IFL + + + QL   P+++LFSL++ +IQ+PFA  ERVP+         
Sbjct: 10  RSYGADYSI-LIFLVLAWVMLQLFVHPFYQLFSLDNTSIQYPFAVVERVPVLWSIIYSGI 68

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                        +   H  H               +T++ KN VGRPRPD I RC+P  
Sbjct: 69  FPLLAIGFWCALFRPGSHFVHVTLLGLLASLLVTIFITDLIKNAVGRPRPDLISRCKPDK 128

Query: 132 AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
              P   L + T+CT TD  +L +G++SF SGHSS  F+G+G+LS +L+G+L  +  +  
Sbjct: 129 G-TPEHTLVDYTVCTTTDQHILNEGWRSFPSGHSSFGFSGLGYLSFFLSGQLRAWRPRSG 187

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISD 249
             +                SR  DYRH  +DV +GS++G   +Y  Y  YYP L S   D
Sbjct: 188 LARLLVSLSPLLGALMIAISRIADYRHDVYDVSSGSIIGIGTAYLVYRCYYPSLWSADCD 247

Query: 250 KPF 252
            P+
Sbjct: 248 IPY 250



>gi|512186343|gb|EPE02139.1| pap2 superfamily protein [Ophiostoma piceae UAMH 11346]
          Length = 303

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 125/251 (49%), Gaps = 13/251 (5%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQ-LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
            +YA D+    + L  +  +   +EP+HR+F + +  I FP A  ERVP+ +        
Sbjct: 27  SSYASDYAGFTLLLAGYICIQFFVEPFHRMFYINNLNISFPHAVVERVPVAMNFVYALFI 86

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                         S+H  H +             VT++ KN VGRPRPD I RC P+A 
Sbjct: 87  PLFLLLLYNTIAGSSVHKHHVSILGIAIALVLASTVTDIIKNMVGRPRPDLIARCSPTAG 146

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVF------ 184
             P   L +  +CT T+   L DG++SF SGHSS +FAG+G++SL+LAG+L +F      
Sbjct: 147 -TPINTLVSIDVCTETNHHTLHDGWRSFPSGHSSFAFAGLGYMSLFLAGQLQIFILSTTD 205

Query: 185 ---DQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
                +G   K                SR +DYRH  +DV  G+L+G+ ++Y++Y +Y+P
Sbjct: 206 DKVHVRGDLGKVLVCLTPLLGAAMIAISRCQDYRHDVYDVCTGALLGWTIAYWSYRRYWP 265

Query: 242 DLHSKISDKPF 252
            L S    +P+
Sbjct: 266 HLGSLRCSEPY 276



>gi|297737764|emb|CBI26965.3| unnamed protein product [Vitis vinifera]
          Length = 361

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 125/250 (50%), Gaps = 14/250 (5%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFS---LEDKTIQFPFAEKERVPMWLCA 66
           +Q+ K +  DW++  + + I   +  + P++R      ++D  +++P  +   VP+W   
Sbjct: 50  LQVAKDHKHDWLILLLLVMIAIILLVIHPFYRFVGKDMMDD--LKYPLKDNT-VPVWAIP 106

Query: 67  XXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDR 126
                          L  ++ ++D HH+             +TE  K+ VGRPRPDF  R
Sbjct: 107 IYAVLLPIVIFILFYLR-RRDVYDLHHSILGLFFSMLITAVITEAIKDAVGRPRPDFFWR 165

Query: 127 CQPSA--AFDPGLGLSNSTICTRTD-LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           C P     +D         IC   D ++++G KSF SGH+S SFAG+GFLSLYL+GK+  
Sbjct: 166 CFPDGKDVYDQW----GDVICHGKDSVIREGHKSFPSGHTSWSFAGLGFLSLYLSGKIQA 221

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           FD+KG+  K                SR +DY HHW DVFAG L+G ++++F Y Q++P  
Sbjct: 222 FDRKGHVAKLCIVFLPLLAASLVGVSRVDDYWHHWQDVFAGGLLGLVVAFFCYLQFFPPP 281

Query: 244 HSKISDKPFT 253
           +      P+ 
Sbjct: 282 YDNNGSGPYA 291



>gi|425769181|gb|EKV07682.1| hypothetical protein PDIP_72740 [Penicillium digitatum Pd1]
 gi|425770739|gb|EKV09203.1| hypothetical protein PDIG_63360 [Penicillium digitatum PHI26]
          Length = 600

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 122/263 (46%), Gaps = 33/263 (12%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSV-DQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAX 67
           + +++ +Y  D+V+  I   I FS+ +++EP+H+ FSL + +IQ+P+A  ER+PM     
Sbjct: 15  RPRVVISYVFDYVI-IIVCAIGFSILNKVEPFHQHFSLNNISIQYPYAVHERIPMVYALC 73

Query: 68  XXXXXXXXXXXXXALAIK------------------KSMHDW-------HHASXXXXXXX 102
                         L I                   +  H W       +          
Sbjct: 74  ISAVFPVVLIILYTLVIDGLFSHNKPQDVSSGKRRVRGPHRWKDRLWELNCGILGLLLAQ 133

Query: 103 XXXXXVTEVFKNTVGRPRPDFIDRCQPSAAF-DPGLGLSNSTICT-RTDLLKDGFKSFLS 160
                +T+  K   G+PRPD IDRCQP A   D   GLSNSTICT    LL DGF+S+  
Sbjct: 134 GLAFFITQALKTACGKPRPDLIDRCQPRAGSKDLFPGLSNSTICTGDPALLTDGFRSW-- 191

Query: 161 GHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHD 220
              S SFAG+ + SL+L GKLH+ D +G  +K                SR  D RHH  D
Sbjct: 192 --PSASFAGLVYTSLWLGGKLHIMDNRGEAWKALLVMVPLLAASLVAVSRIMDARHHPFD 249

Query: 221 VFAGSLVGFLLSYFAYHQYYPDL 243
           V  GS++G    + AY QY+P L
Sbjct: 250 VITGSMLGVACGFVAYRQYFPPL 272



>gi|378731650|gb|EHY58109.1| PAP2 domain-containing protein [Exophiala dermatitidis NIH/UT8656]
          Length = 345

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 121/242 (50%), Gaps = 4/242 (1%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V L  +F     +   +EP+HR+F+L+D   Q+P A  +RV            
Sbjct: 50  RSYASDYVGLALLFAAYLGAQFFVEPFHRMFTLDDHAKQYPHALVQRVSNLENIIYAGVG 109

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                   +L  +  +H  H               +T++ KN VGRPRPD I RC+P   
Sbjct: 110 PLVFIIMWSLVFRPGLHKTHVTIFGLLVSLFLSSLLTDIIKNAVGRPRPDLIARCKPQPG 169

Query: 133 FDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             P   L   ++CT T+   L DG++SF SGHSS +F+G+G+L+L+LAG+L +F      
Sbjct: 170 -TPEHELVTISVCTETNHHRLHDGWRSFPSGHSSWAFSGLGYLALFLAGQLRIFRPHADL 228

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            +                SR  DYRH   DV  GSL+G L++YF+Y +YY  L+    D 
Sbjct: 229 SRVLMVMAPLVGASLIAMSRLADYRHDVFDVTCGSLLGMLVAYFSYRRYYRPLNHPKCDV 288

Query: 251 PF 252
           P+
Sbjct: 289 PY 290



>gi|389636133|ref|XP_003715719.1| diacylglycerol pyrophosphate phosphatase 1 [Magnaporthe oryzae
           70-15]
 gi|351648052|gb|EHA55912.1| diacylglycerol pyrophosphate phosphatase 1 [Magnaporthe oryzae
           70-15]
          Length = 335

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 130/269 (48%), Gaps = 34/269 (12%)

Query: 14  KAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           ++YA D+V    +  G    V  +EP+HR+FS+ D  I FP AE ERVP+++        
Sbjct: 26  RSYAPDYVGFGALVAGYMVLVFFVEPFHRMFSISDLAISFPHAEHERVPVFMNIVYAAAV 85

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                    LA + S H  H A             +T+V KN VGRPRPD + RC+P   
Sbjct: 86  PLAVVVATNLATRASAHKHHVAILGLAVGLVLTSFLTDVVKNAVGRPRPDLLARCKPR-- 143

Query: 133 FDPGLG---LSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
             PG     L + T+CT  +  LL DG++SF SGHSS SFAG+G+ +L+LAG+L +F   
Sbjct: 144 --PGTAENRLVDWTVCTEKEHHLLHDGWRSFPSGHSSFSFAGLGYTALFLAGQLRIFAYD 201

Query: 188 GYT--------------------YKGFXXX----XXXXXXXXXXXSRTEDYRHHWHDVFA 223
           G                       +G                   SR +DYRH  +DV  
Sbjct: 202 GERDGEEDGSGAGKMERVVSAAHGRGLGTALFCMIPLLGATMIAISRCQDYRHDVYDVCT 261

Query: 224 GSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
           G+L+G +++Y++Y +Y+P   S    +P+
Sbjct: 262 GALLGSVVTYWSYRRYWPRFGSYRCSEPW 290



>gi|357145826|ref|XP_003573780.1| PREDICTED: putative lipid phosphate phosphatase 3,
           chloroplastic-like [Brachypodium distachyon]
          Length = 310

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/232 (32%), Positives = 113/232 (48%), Gaps = 3/232 (1%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++ F    +   ++ +EP+HR    +  T + +P  +   +P W      
Sbjct: 17  KVARLHMYDWIILFFLAVVDGLLNIIEPFHRFVGRDMMTDLSYPL-KGNTIPFWAVPLFA 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          KK+++D HH              +T+  K+ VGRPRPDF  RC P
Sbjct: 76  VVLPWIIFVGIYFK-KKNVYDLHHGILGILYSVLITAVITDAIKDAVGRPRPDFFWRCFP 134

Query: 130 SAAFDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
               +     SN        ++K+G KSF SGHSS SFAG+GFL+ YLAGKL  FD+KG+
Sbjct: 135 DGKPNYDKFTSNVICHGEKSVIKEGHKSFPSGHSSGSFAGLGFLAWYLAGKLAAFDRKGH 194

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
             K                SR +DY HHW DVFAG ++G  ++ F Y Q++P
Sbjct: 195 IAKLCLVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVASFCYLQFFP 246



>gi|359472919|ref|XP_002282839.2| PREDICTED: putative lipid phosphate phosphatase 3,
           chloroplastic-like isoform 1 [Vitis vinifera]
          Length = 343

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 125/250 (50%), Gaps = 14/250 (5%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFS---LEDKTIQFPFAEKERVPMWLCA 66
           +Q+ K +  DW++  + + I   +  + P++R      ++D  +++P  +   VP+W   
Sbjct: 40  LQVAKDHKHDWLILLLLVMIAIILLVIHPFYRFVGKDMMDD--LKYPLKDNT-VPVWAIP 96

Query: 67  XXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDR 126
                          L  ++ ++D HH+             +TE  K+ VGRPRPDF  R
Sbjct: 97  IYAVLLPIVIFILFYLR-RRDVYDLHHSILGLFFSMLITAVITEAIKDAVGRPRPDFFWR 155

Query: 127 CQPSA--AFDPGLGLSNSTICTRTD-LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           C P     +D         IC   D ++++G KSF SGH+S SFAG+GFLSLYL+GK+  
Sbjct: 156 CFPDGKDVYDQ----WGDVICHGKDSVIREGHKSFPSGHTSWSFAGLGFLSLYLSGKIQA 211

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           FD+KG+  K                SR +DY HHW DVFAG L+G ++++F Y Q++P  
Sbjct: 212 FDRKGHVAKLCIVFLPLLAASLVGVSRVDDYWHHWQDVFAGGLLGLVVAFFCYLQFFPPP 271

Query: 244 HSKISDKPFT 253
           +      P+ 
Sbjct: 272 YDNNGSGPYA 281



>gi|222640424|gb|EEE68556.1| hypothetical protein OsJ_27038 [Oryza sativa Japonica Group]
          Length = 673

 Score =  135 bits (340), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 120/236 (50%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSV-DQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAX 67
           I++ K +  DW++  IFL + + + + +EP+HR    +  T +++P  +   VP W    
Sbjct: 379 IKVAKFHLYDWMI-LIFLAVVYGLFNIIEPFHRFVGSDMLTDLRYPL-KGNTVPFWAVPL 436

Query: 68  XXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC 127
                            KK+++D HH              +T+  KN VGRPRPDF  RC
Sbjct: 437 IAIVLPWAIFGGIYFK-KKNVYDLHHGILGILYSVLITAVITDAIKNGVGRPRPDFFWRC 495

Query: 128 QPSAAFDPGLG-LSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
            P     P    ++   IC     ++K+G+KSF SGHSS +FAG+GFL+ YLAGKL  F 
Sbjct: 496 FPDG--KPNFNNVTGDVICHGERSVIKEGYKSFPSGHSSGAFAGLGFLAWYLAGKLKAFK 553

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW DVFAG ++G  ++ F Y Q++P
Sbjct: 554 REGHIAKLCLVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVASFCYLQFFP 609



 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 116/235 (49%), Gaps = 9/235 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
            + + +  DW++      +   ++ +EP+HR    +  T +++P  +   +P W      
Sbjct: 17  SVARLHMYDWIILLFLAVVDGLLNIIEPFHRFVGRDMMTDLRYPL-KGNTIPFWAVPLIA 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          KK+++D HH              +T+  K+ VGRPRPDF  RC P
Sbjct: 76  IVLPWVVFGGIYFK-KKNVYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFP 134

Query: 130 SAA--FDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
                FD    ++ + IC     ++K+G KSF SGHSS SFAG+GFL+ YLAGKL  FD+
Sbjct: 135 DGIPKFD---NVTTNVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAGKLKAFDR 191

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           KG+  K                SR +DY HHW DVFAG ++G  +S F Y Q++P
Sbjct: 192 KGHIAKLCIVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVSSFCYLQFFP 246



>gi|242091283|ref|XP_002441474.1| hypothetical protein SORBIDRAFT_09g027540 [Sorghum bicolor]
 gi|241946759|gb|EES19904.1| hypothetical protein SORBIDRAFT_09g027540 [Sorghum bicolor]
          Length = 326

 Score =  135 bits (340), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW +  + +     ++ +EP+HR    +  T +++P  +   VP+W      
Sbjct: 31  KVARLHGFDWAVLLLLVAADVGLNLIEPFHRFVGEDMLTDLRYPL-KSNTVPVWAVPIYA 89

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                       L  +++++D HHA             +T+  K+ VGRPRP+F  RC P
Sbjct: 90  VIGPIVVFVGVYLK-RRNVYDMHHAILGLLFSVLITGVLTDAIKDGVGRPRPNFFWRCFP 148

Query: 130 SAA--FDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
                +D     +   +C     ++K+G KSF SGHSS SFAG+GFLS YLAGK+ VFD+
Sbjct: 149 DGVPKYD---NFTRGVLCDGVASVIKEGHKSFPSGHSSWSFAGLGFLSWYLAGKVKVFDR 205

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +G+  K                SR +DY HHW DVFAG ++G +++ F Y Q++P
Sbjct: 206 RGHVAKLCVVVLPLLLAAMVAVSRVDDYWHHWQDVFAGGILGLVVASFCYLQFFP 260



>gi|115476064|ref|NP_001061628.1| Os08g0359100 [Oryza sativa Japonica Group]
 gi|38637527|dbj|BAD03780.1| putative phosphatidic acid phosphatase beta [Oryza sativa Japonica
           Group]
 gi|113623597|dbj|BAF23542.1| Os08g0359100 [Oryza sativa Japonica Group]
 gi|215695380|dbj|BAG90571.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 310

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 120/236 (50%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSV-DQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAX 67
           I++ K +  DW++  IFL + + + + +EP+HR    +  T +++P  +   VP W    
Sbjct: 16  IKVAKFHLYDWMI-LIFLAVVYGLFNIIEPFHRFVGSDMLTDLRYPL-KGNTVPFWAVPL 73

Query: 68  XXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC 127
                            KK+++D HH              +T+  KN VGRPRPDF  RC
Sbjct: 74  IAIVLPWAIFGGIYFK-KKNVYDLHHGILGILYSVLITAVITDAIKNGVGRPRPDFFWRC 132

Query: 128 QPSAAFDPGLG-LSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
            P     P    ++   IC     ++K+G+KSF SGHSS +FAG+GFL+ YLAGKL  F 
Sbjct: 133 FPDG--KPNFNNVTGDVICHGERSVIKEGYKSFPSGHSSGAFAGLGFLAWYLAGKLKAFK 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW DVFAG ++G  ++ F Y Q++P
Sbjct: 191 REGHIAKLCLVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVASFCYLQFFP 246



>gi|356569496|ref|XP_003552936.1| PREDICTED: lipid phosphate phosphatase 2-like [Glycine max]
          Length = 291

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 117/227 (51%), Gaps = 9/227 (3%)

Query: 19  DWVLCFIFLGIFFSVDQLEPYHRLFSLED-KTIQFPFAEKERVPMWLCAXXXXXXXXXXX 77
           DW++  +   +  +++ +EP+HR    +  + + FPF E + +PMW              
Sbjct: 17  DWLILLLLAAMDGALNMIEPFHRYIGKDMMRDLMFPFKE-DTIPMWGVPILSIFIPILIF 75

Query: 78  XXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS--AAFDP 135
                A ++ ++D HHA+            +T+  K+ VGRPRP+F  RC P     FD 
Sbjct: 76  IAFYFA-RRDVYDLHHATLGLMFSSLITGVITDSIKDAVGRPRPNFFHRCFPDNIPVFDK 134

Query: 136 GLGLSNSTICTRTD-LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGF 194
             G     +CT    ++K+G+KSF SGH+S SFAG+GFLS YL+GK+ VFD++G+  K  
Sbjct: 135 DNG---DVLCTGIKAVIKEGYKSFPSGHTSWSFAGLGFLSWYLSGKVRVFDRRGHIGKLC 191

Query: 195 XXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
                         +R +DY HHW DVFAG L+G  +S   Y   +P
Sbjct: 192 LVLLPLLIAALVGITRVDDYWHHWTDVFAGGLIGLTVSSICYLLLFP 238



>gi|359472921|ref|XP_003631216.1| PREDICTED: putative lipid phosphate phosphatase 3,
           chloroplastic-like isoform 2 [Vitis vinifera]
          Length = 342

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 125/250 (50%), Gaps = 14/250 (5%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFS---LEDKTIQFPFAEKERVPMWLCA 66
           +Q+ K +  DW++  + + I   +  + P++R      ++D  +++P  +   VP+W   
Sbjct: 39  LQVAKDHKHDWLILLLLVMIAIILLVIHPFYRFVGKDMMDD--LKYPLKDNT-VPVWAIP 95

Query: 67  XXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDR 126
                          L  ++ ++D HH+             +TE  K+ VGRPRPDF  R
Sbjct: 96  IYAVLLPIVIFILFYLR-RRDVYDLHHSILGLFFSMLITAVITEAIKDAVGRPRPDFFWR 154

Query: 127 CQPSA--AFDPGLGLSNSTICTRTD-LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           C P     +D         IC   D ++++G KSF SGH+S SFAG+GFLSLYL+GK+  
Sbjct: 155 CFPDGKDVYDQ----WGDVICHGKDSVIREGHKSFPSGHTSWSFAGLGFLSLYLSGKIQA 210

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
           FD+KG+  K                SR +DY HHW DVFAG L+G ++++F Y Q++P  
Sbjct: 211 FDRKGHVAKLCIVFLPLLAASLVGVSRVDDYWHHWQDVFAGGLLGLVVAFFCYLQFFPPP 270

Query: 244 HSKISDKPFT 253
           +      P+ 
Sbjct: 271 YDNNGSGPYA 280



>gi|225424095|ref|XP_002282854.1| PREDICTED: lipid phosphate phosphatase 2 [Vitis vinifera]
 gi|297737763|emb|CBI26964.3| unnamed protein product [Vitis vinifera]
          Length = 321

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 120/236 (50%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ +++  DW++  + + I   ++ +EP+HR    E  T + +P  +   +P W     
Sbjct: 16  LKVARSHMHDWLILILLVVIEVILNVIEPFHRFVGKEMLTDLSYPL-QTNTIPFWSVPLI 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I++ ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AILLPIVVILVYYF-IRQDVYDLHHAILGLLFSVLITAVITDAIKDAVGRPRPDFFWRCF 133

Query: 129 PSA--AFDPGLGLSNSTICT-RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P+    FD     +   +CT    ++K+G KSF SGH+S SFAG+ FLS YL+GK+  FD
Sbjct: 134 PNGKGVFDTR---TTDVLCTGDKSVIKEGHKSFPSGHTSWSFAGLSFLSWYLSGKIRAFD 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +KG+  K                SR +DY HHW DVFAG ++G  ++ F Y Q++P
Sbjct: 191 RKGHVAKLCIVFLPILLAALVGVSRVDDYWHHWQDVFAGGVIGATVASFCYLQFFP 246



>gi|115476066|ref|NP_001061629.1| Os08g0359200 [Oryza sativa Japonica Group]
 gi|38637528|dbj|BAD03781.1| unknown protein [Oryza sativa Japonica Group]
 gi|113623598|dbj|BAF23543.1| Os08g0359200 [Oryza sativa Japonica Group]
          Length = 310

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 116/235 (49%), Gaps = 9/235 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
            + + +  DW++      +   ++ +EP+HR    +  T +++P  +   +P W      
Sbjct: 17  SVARLHMYDWIILLFLAVVDGLLNIIEPFHRFVGRDMMTDLRYPL-KGNTIPFWAVPLIA 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          KK+++D HH              +T+  K+ VGRPRPDF  RC P
Sbjct: 76  IVLPWVVFGGIYFK-KKNVYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFP 134

Query: 130 SAA--FDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
                FD    ++ + IC     ++K+G KSF SGHSS SFAG+GFL+ YLAGKL  FD+
Sbjct: 135 DGIPKFD---NVTTNVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAGKLKAFDR 191

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           KG+  K                SR +DY HHW DVFAG ++G  +S F Y Q++P
Sbjct: 192 KGHIAKLCIVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVSSFCYLQFFP 246



>gi|119471100|ref|XP_001258128.1| PAP2 domain protein [Neosartorya fischeri NRRL 181]
 gi|119406280|gb|EAW16231.1| PAP2 domain protein [Neosartorya fischeri NRRL 181]
          Length = 324

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 129/238 (54%), Gaps = 4/238 (1%)

Query: 17  ALDWVLCFIFLGIFFSVDQ-LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXX 75
           A+D++      GI+  +   ++P+HR+FSL++++IQ+PFA  ERVP+             
Sbjct: 29  AVDYIALACLAGIWVMIQLFVDPFHRMFSLDNRSIQYPFAVIERVPVVWSIIYAGVVPLL 88

Query: 76  XXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDP 135
                A   +   +                  +T++ KN VGRPRPD I RC P     P
Sbjct: 89  ILLCWAAIFRPKPYQVQVTILGLLVALMLTSLITDIIKNAVGRPRPDLISRCMPKKG-TP 147

Query: 136 GLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKG 193
              L   T+CT+++  +L++G++SF SGHSS SF+G+G+LS++L+G++HVF  +   ++ 
Sbjct: 148 ANTLVAWTVCTQSNNHILQEGWRSFPSGHSSFSFSGLGYLSMFLSGQMHVFRPRADLWRC 207

Query: 194 FXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
                          SR EDYRH  +DV  GS++G ++++F+Y +YYP L S   D P
Sbjct: 208 ILALIPMLCALMIAISRLEDYRHDVYDVTCGSILGLIIAHFSYRRYYPPLRSVACDVP 265



>gi|258577633|ref|XP_002542998.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237903264|gb|EEP77665.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 416

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 103/187 (55%), Gaps = 14/187 (7%)

Query: 108 VTEVFKNTVGRPRPDFIDRCQPSAAFD--PGLGLSNSTICTRTD--LLKDGFKSFLSGHS 163
           +T   KN  G+PRPD IDRC+P    +  P  GLSNSTICT+TD  +LKDGF+S+     
Sbjct: 132 ITSALKNATGKPRPDIIDRCRPRPGSEDAPVFGLSNSTICTQTDNAILKDGFRSW----P 187

Query: 164 STSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFA 223
           S +FAG+ +LSLYLAGKLHV D +G  +K F              SR  D RHH  DV +
Sbjct: 188 SAAFAGLFYLSLYLAGKLHVLDSRGEVWKAFVVLIPTLGAGLVAVSRIMDARHHPFDVIS 247

Query: 224 GSLVGFLLSYFAYHQYYPDLHSK-ISDKPFTIRLKKVVPE-----YKAEFSFMDGSEVEI 277
           GS++G L ++ AY QY+P +       + + IR    +P+      +  F   D  E + 
Sbjct: 248 GSMLGVLCAWMAYRQYFPPISEPWRKGRAYPIRSWGTIPQPPLYSERRRFELDDDDEAKP 307

Query: 278 TVVKNDE 284
              +++E
Sbjct: 308 MASRDEE 314



>gi|410079713|ref|XP_003957437.1| hypothetical protein KAFR_0E01480 [Kazachstania africana CBS 2517]
 gi|372464023|emb|CCF58302.1| hypothetical protein KAFR_0E01480 [Kazachstania africana CBS 2517]
          Length = 305

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 120/244 (49%), Gaps = 15/244 (6%)

Query: 19  DWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXX 78
           D +L  I +   + V   +P+ R FSL D TI  P+   ERV                  
Sbjct: 26  DVILLSILVIFSYPVYYQKPFERQFSLNDLTISHPYTLVERV----SDTMLFVYSLVVPL 81

Query: 79  XXALAIKKSMHDWHHASXXXXXXXXXXXXV-------TEVFKNTVGRPRPDFIDRCQPSA 131
              +AI  +M D  H +                    T   KN +GR RPDF+DRCQP A
Sbjct: 82  IVVVAIGFAMADSRHRNYLVYISVLGLLVTWFSTTLFTNFIKNWIGRLRPDFLDRCQPKA 141

Query: 132 AFDPGLGLSNSTICT--RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV-FDQKG 188
                +    S +CT   + LL DGF++  SGHSS SFAG+G+L L+L+G+L + +DQ G
Sbjct: 142 NLPLNIMFYASEVCTNENSSLLLDGFRTTPSGHSSASFAGLGYLQLWLSGQLLIKYDQVG 201

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKIS 248
           + ++ +              SRT+DYRHH+ DV  GS++G+ ++Y  Y +Y+P L S + 
Sbjct: 202 F-WRTYVAMLPLLGASLIALSRTQDYRHHFIDVLIGSVLGYWIAYSTYRRYFPALGSSLP 260

Query: 249 DKPF 252
            KP 
Sbjct: 261 FKPL 264



>gi|462424643|gb|EMJ28906.1| hypothetical protein PRUPE_ppa008175mg [Prunus persica]
          Length = 342

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/234 (34%), Positives = 119/234 (50%), Gaps = 10/234 (4%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXX 70
           + K +  DW++  +   I   +  ++P+HR    +  T +++P  +   VP+W       
Sbjct: 40  LAKNHMHDWLILLLLAVIEVILFIIQPFHRFVGKDMMTDLKYPM-KGNTVPVWAVPMYAV 98

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS 130
                       A +K ++D HH++            VT+  KN VGRPRPDF  RC P 
Sbjct: 99  LLPIAVFVLF-YARRKDVYDLHHSTLGLLFAVLITGVVTDAIKNAVGRPRPDFFWRCFPD 157

Query: 131 A--AFDPGLGLSNSTICTRTDL-LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
               +D   G+    +C   D  +K+G KSF SGH+S SFAG+GFLSLYL GK+  FD+K
Sbjct: 158 GKDVYDQWGGV----LCHGKDSDIKEGHKSFPSGHASWSFAGLGFLSLYLCGKIKAFDRK 213

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           G+  K                SR +DY HHW DVFAG L+G +++ F Y Q++P
Sbjct: 214 GHVAKLCIVFLPLLAASLVGISRVDDYWHHWQDVFAGGLLGLVVAAFCYRQFFP 267



>gi|241950025|ref|XP_002417735.1| DGPP phosphatase, putative; diacylglycerol pyrophosphate
           phosphatase, putative; phosphatidate phosphatase,
           putative [Candida dubliniensis CD36]
 gi|223641073|emb|CAX45447.1| DGPP phosphatase, putative [Candida dubliniensis CD36]
          Length = 284

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 124/249 (49%), Gaps = 17/249 (6%)

Query: 19  DWVLCFIFLGIFFSVDQLE-PYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXX 77
           DW++  + +  FFSV +   P+ R FSL+D TI  PFA KERV   LC            
Sbjct: 24  DWIVATVTVVFFFSVAETALPFQRQFSLDDLTISHPFAIKERVSGILCIEIAAFVPLFVI 83

Query: 78  XXXAL---------AIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
               L         + ++++H    +             +T++ K  + RPRPDF++RC 
Sbjct: 84  LASLLVKYQHGAFSSHQQALHCLQISVLGLIISLSLNGVITDILKIWIARPRPDFLERCG 143

Query: 129 PSAAFDPGLGLSNSTICTRT---DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P+    P   L +S++CT      LL DG KS  SGHSS SF G+ +L+L+L+G+  +F 
Sbjct: 144 PAPG-TPLHQLVDSSVCTAPLGKALLVDGMKSTPSGHSSISFGGLFYLTLWLSGQFKLFQ 202

Query: 186 QKG---YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPD 242
            +    Y YK F              SRT+DYRHH+ D+  G  +G   ++++YH Y+  
Sbjct: 203 NRESSRYVYKYFLAFSPLSLATYIALSRTQDYRHHFTDIVLGGAIGISFAWWSYHHYFNR 262

Query: 243 LHSKISDKP 251
           L S+ S KP
Sbjct: 263 LVSEESHKP 271



>gi|502129835|ref|XP_004500441.1| PREDICTED: lipid phosphate phosphatase 2-like [Cicer arietinum]
          Length = 241

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/231 (33%), Positives = 118/231 (51%), Gaps = 13/231 (5%)

Query: 19  DWVLCFIFLGIFFSVDQLEPYHRLFS---LEDKTIQFPFAEKERVPMWLCAXXXXXXXXX 75
           DW++  I   +   ++++EP+HR      ++D    +PF +K+ +PMW            
Sbjct: 17  DWLILLILAVMDGVLNKIEPFHRYVGKDMMQDS--MYPF-KKDTIPMWGVPIYSIFIPIL 73

Query: 76  XXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS--AAF 133
                   I++ ++D HHA+            +T+  K+ VGRPRP+F  RC P     F
Sbjct: 74  IFIAFYF-IRRDIYDLHHATLGILFASLITAVITDCIKDAVGRPRPNFFQRCFPDKIPVF 132

Query: 134 DPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYK 192
           D   G     +CT    ++++G+KSF SGH+S SFAG+GFLS YL+GK+ VFD++G+  K
Sbjct: 133 DKETG---DVLCTGIKSVIREGYKSFPSGHTSLSFAGLGFLSWYLSGKVRVFDRRGHIGK 189

Query: 193 GFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
                           +R +DY HHW DVF G L+G  +S   Y   +P L
Sbjct: 190 LCIVLLPLLIASLVGVTRVDDYWHHWTDVFTGGLIGLTVSTICYLLLFPIL 240



>gi|315051566|ref|XP_003175157.1| PAP2 domain-containing protein [Arthroderma gypseum CBS 118893]
 gi|311340472|gb|EFQ99674.1| PAP2 domain-containing protein [Arthroderma gypseum CBS 118893]
          Length = 423

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 90/158 (56%), Gaps = 7/158 (4%)

Query: 108 VTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSST 165
           +T   KN  G+PRPD IDRC+P     P  GLSN TICT+T+  +LKDGF+SF     S 
Sbjct: 141 ITGALKNACGKPRPDLIDRCKPRTFDQPEFGLSNYTICTQTNHEILKDGFRSF----PSA 196

Query: 166 SFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGS 225
           SFAG+ +LSLYLAGKLHV D +G  +K F              SR  D RHH  DV +GS
Sbjct: 197 SFAGLFYLSLYLAGKLHVMDSRGEVWKAFIVMVPTLSAGLVAVSRIMDARHHPFDVISGS 256

Query: 226 LVGFLLSYFAYHQYYPDLHSK-ISDKPFTIRLKKVVPE 262
           L+G    + AY QY+P L       + + IR    +PE
Sbjct: 257 LLGVGCGWVAYRQYFPSLSEPWKKGRAYPIRTWGSIPE 294



>gi|326491437|dbj|BAJ94196.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326494216|dbj|BAJ90377.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 312

 Score =  134 bits (337), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 118/235 (50%), Gaps = 9/235 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W      
Sbjct: 17  KVARLHMYDWIILLLLAVIDGLLNIIEPFHRFIGKDMMTDLRYPL-KGNTVPFWAVPLIG 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          KK+++D HH              +T+  K+ VGRPRPDF  RC P
Sbjct: 76  IVLPCVIFGGIYFK-KKNIYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFP 134

Query: 130 SAA--FDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
                +D    ++   +C     ++K+G KSF SGHSS SFAG+GFL+ YL GK+ VFD+
Sbjct: 135 DGKDFYD---NVTTGVLCHGEKSVIKEGHKSFPSGHSSWSFAGLGFLTWYLTGKIAVFDR 191

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           KG+  K                SR +DY HHW DVFAG+++G  ++ F Y Q++P
Sbjct: 192 KGHIAKLCIIVLPLLTAALVAVSRVDDYWHHWQDVFAGAIIGLTVASFCYLQFFP 246



>gi|226500530|ref|NP_001152212.1| lipid phosphate phosphatase 3 [Zea mays]
 gi|195653885|gb|ACG46410.1| lipid phosphate phosphatase 3 [Zea mays]
 gi|224031373|gb|ACN34762.1| unknown [Zea mays]
 gi|414884961|tpg|DAA60975.1| TPA: lipid phosphate phosphatase 3 [Zea mays]
          Length = 309

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 90/300 (30%), Positives = 139/300 (46%), Gaps = 17/300 (5%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXX 72
           + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W  A      
Sbjct: 19  RLHMYDWIILLLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPM-KGNTVPFW--AVPLIGI 75

Query: 73  XXXXXXXXALAIKKS-MHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                    +  KK+  +D HH              +T+  K+ VGRPRPDF  RC P  
Sbjct: 76  ILPWAIFVGIYFKKNNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFPDG 135

Query: 132 AFDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             D    ++   IC     ++K+G KSF SGH+S SFAG+GFL+ YLAGKL  FD+KG+ 
Sbjct: 136 N-DVYDNITTGVICNGVKSVIKEGHKSFPSGHTSWSFAGLGFLAWYLAGKLTAFDRKGHI 194

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            K                SR +DY HHW DVFAG L+G  ++ F Y Q++P      +  
Sbjct: 195 RKLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGGLIGLTVASFCYLQFFPYPFDGDALW 254

Query: 251 P--FTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQLLLKDSRALLADSSSNNTEGGSA 308
           P  +T++L +           +  +E+E   +     + L+D+         N+ E GS 
Sbjct: 255 PHAYTVQLAEEGSSRNTNSYSVRPAEIETVNIPGHGGITLRDTL--------NDMESGSG 306



>gi|190347010|gb|EDK39216.2| hypothetical protein PGUG_03314 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 270

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 116/248 (46%), Gaps = 12/248 (4%)

Query: 14  KAYALDWVLCFIFLGIFFSV-DQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           + Y LDWV     L  FF V +  +P+ R FSL+D TIQ PFA  ERV    C       
Sbjct: 11  RRYQLDWVCGLAILVYFFVVAEHAKPFFRQFSLDDPTIQHPFAVHERVSGIACILISAIV 70

Query: 73  XXXXXXXXALAIKKS-------MHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFID 125
                    L   ++       +H    +             VT++ KN + RPRPDF+ 
Sbjct: 71  PTVVILGSVLVKTRNFRLSNDQLHLIQVSILGLLLSLAISGTVTDILKNWIARPRPDFLA 130

Query: 126 RCQPSAAFDPGLGLSNSTICTR---TDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLH 182
           RC P     P   L    +CT      +L DG +S  SGHSS SFAGM +L+L+L G+  
Sbjct: 131 RCGPKEG-TPVNQLVGVEVCTSPLGIAVLIDGMRSTPSGHSSISFAGMLYLTLWLYGQTQ 189

Query: 183 VFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPD 242
           VF ++   Y                 SRT+DYRHH+ D+  G+ +G  +S   YH+Y+  
Sbjct: 190 VFSKRQPIYLTLACSLPLLLSSYIALSRTQDYRHHFMDIVLGTSLGVFMSATVYHRYFNG 249

Query: 243 LHSKISDK 250
           + S+ S+K
Sbjct: 250 IFSEDSNK 257



>gi|414884960|tpg|DAA60974.1| TPA: lipid phosphate phosphatase 3 [Zea mays]
          Length = 367

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 90/300 (30%), Positives = 139/300 (46%), Gaps = 17/300 (5%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXX 72
           + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W  A      
Sbjct: 77  RLHMYDWIILLLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPM-KGNTVPFW--AVPLIGI 133

Query: 73  XXXXXXXXALAIKKS-MHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                    +  KK+  +D HH              +T+  K+ VGRPRPDF  RC P  
Sbjct: 134 ILPWAIFVGIYFKKNNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFPDG 193

Query: 132 AFDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
             D    ++   IC     ++K+G KSF SGH+S SFAG+GFL+ YLAGKL  FD+KG+ 
Sbjct: 194 N-DVYDNITTGVICNGVKSVIKEGHKSFPSGHTSWSFAGLGFLAWYLAGKLTAFDRKGHI 252

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            K                SR +DY HHW DVFAG L+G  ++ F Y Q++P      +  
Sbjct: 253 RKLCIVFLPLLTAALVAVSRVDDYWHHWQDVFAGGLIGLTVASFCYLQFFPYPFDGDALW 312

Query: 251 P--FTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQLLLKDSRALLADSSSNNTEGGSA 308
           P  +T++L +           +  +E+E   +     + L+D+         N+ E GS 
Sbjct: 313 PHAYTVQLAEEGSSRNTNSYSVRPAEIETVNIPGHGGITLRDTL--------NDMESGSG 364



>gi|350397056|ref|XP_003484756.1| PREDICTED: phosphatidate phosphatase PPAPDC1A-like [Bombus
           impatiens]
          Length = 267

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 113/243 (46%), Gaps = 8/243 (3%)

Query: 13  LKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           L  Y  D +L  + +G+F  ++  EP+ R    ED+   +     E              
Sbjct: 10  LTEYWFDILLRIVLVGLFIELENAEPFTRKIH-EDELWLYKNPRTESYVPTTILWPLVFI 68

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                      + K   D + A             +T++ K  VGRPRPDF  RC P   
Sbjct: 69  MPAIVILFVFLVYKDKTDIYQAVLSVTLALGFNGVITDIIKLVVGRPRPDFFWRCFPDGQ 128

Query: 133 FDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD--QKGYT 190
            +P    + + +     L+KDG KSF SGHSS +FA  GF++LY+AGKLH F    KG +
Sbjct: 129 TNPDFKCNGNPV-----LIKDGKKSFPSGHSSFAFASFGFIALYIAGKLHTFSLMGKGQS 183

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
           +K                SRT DY HHW DV AGS++G++L+Y  Y  YYP L S++  K
Sbjct: 184 WKLCAFVLPICIALLIALSRTCDYHHHWQDVVAGSIIGYILAYMCYRHYYPPLDSQVCHK 243

Query: 251 PFT 253
           P+ 
Sbjct: 244 PYA 246



>gi|340725842|ref|XP_003401274.1| PREDICTED: phosphatidate phosphatase PPAPDC1A-like [Bombus
           terrestris]
          Length = 267

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 113/243 (46%), Gaps = 8/243 (3%)

Query: 13  LKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           L  Y  D +L  + +G+F  ++  EP+ R    ED+   +     E              
Sbjct: 10  LTEYWFDILLRIVLVGLFIELENAEPFTRKIH-EDELWLYKNPRTESYVPTTILWPLVFI 68

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                      + K   D + A             +T++ K  VGRPRPDF  RC P   
Sbjct: 69  MPAIVILFVFLVYKDKTDIYQAVLSVTLALGFNGVITDIIKLVVGRPRPDFFWRCFPDGQ 128

Query: 133 FDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD--QKGYT 190
            +P    + + +     L+KDG KSF SGHSS +FA  GF++LY+AGKLH F    KG +
Sbjct: 129 TNPDFKCNGNPV-----LIKDGKKSFPSGHSSFAFASFGFIALYIAGKLHTFSLMGKGQS 183

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
           +K                SRT DY HHW DV AGS++G++L+Y  Y  YYP L S++  K
Sbjct: 184 WKLCAFVLPICIALLIALSRTCDYHHHWQDVVAGSIIGYILAYMCYRHYYPPLDSQVCHK 243

Query: 251 PFT 253
           P+ 
Sbjct: 244 PYA 246



>gi|195611848|gb|ACG27754.1| lipid phosphate phosphatase 3 [Zea mays]
 gi|195620648|gb|ACG32154.1| lipid phosphate phosphatase 3 [Zea mays]
 gi|414870663|tpg|DAA49220.1| TPA: lipid phosphate phosphatase 3 isoform 1 [Zea mays]
 gi|414870664|tpg|DAA49221.1| TPA: lipid phosphate phosphatase 3 isoform 2 [Zea mays]
 gi|414870665|tpg|DAA49222.1| TPA: lipid phosphate phosphatase 3 isoform 3 [Zea mays]
 gi|414870666|tpg|DAA49223.1| TPA: lipid phosphate phosphatase 3 isoform 4 [Zea mays]
          Length = 310

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 117/242 (48%), Gaps = 13/242 (5%)

Query: 5   SEFSKIQILKAYALDWV--LCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVP 61
           S  +K+  L  Y  DW+  LC   L    ++  +EP+HR    +  T + +P  +   +P
Sbjct: 13  SHGTKVATLHMY--DWIILLCLAVLDGLLNI--IEPFHRFVGRDMMTDLSYPL-KGNTIP 67

Query: 62  MWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRP 121
            W                     KK+++D HH              +T+  K+ VGRPRP
Sbjct: 68  FWAVPLIAIVLPLVIFAVIYFK-KKNVYDLHHGILGILYSVLITAVITDAIKDGVGRPRP 126

Query: 122 DFIDRCQPSAAFDPGLG-LSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAG 179
           DF  RC P     P    ++   IC     ++K+G KSF SGHSS SFAG+GFL+ YLAG
Sbjct: 127 DFFWRCFPDGK--PNFNNITTDVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAG 184

Query: 180 KLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQY 239
           KL  FD+KG+  K                SR +DY HHW DVFAG ++G  ++ F Y Q+
Sbjct: 185 KLKAFDRKGHIAKLCLVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVASFCYLQF 244

Query: 240 YP 241
           +P
Sbjct: 245 FP 246



>gi|226528214|ref|NP_001146751.1| uncharacterized protein LOC100280353 [Zea mays]
 gi|219888607|gb|ACL54678.1| unknown [Zea mays]
 gi|413946372|gb|AFW79021.1| hypothetical protein ZEAMMB73_476147 [Zea mays]
 gi|413946373|gb|AFW79022.1| hypothetical protein ZEAMMB73_476147 [Zea mays]
          Length = 331

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 121/236 (51%), Gaps = 11/236 (4%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLED--KTIQFPFAEKERVPMWLCAXX 68
           ++ + + LDW +  +       ++ +EP+HR F  ED    +++P  +   VP+W     
Sbjct: 29  KVARLHRLDWAVLLLIAAADVGLNLVEPFHR-FVGEDMLADLRYPL-KSNTVPVWAVPVY 86

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        L  +++++D HHA             +T+  K+ VGRPRP+F  RC 
Sbjct: 87  AVIGPIVVFVGLYLK-RRNVYDMHHAILGLLFSVLITGVLTDAIKDGVGRPRPNFFWRCF 145

Query: 129 PSAA--FDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     +D    ++   +C     ++K+G KSF SGHSS SFAG+GFLS YLAGK+  FD
Sbjct: 146 PDGVPKYD---NITRGVLCDGVASVIKEGHKSFPSGHSSWSFAGLGFLSWYLAGKVKAFD 202

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW DVFAG ++G +++ F Y Q++P
Sbjct: 203 RRGHVAKLCVVLLPLLLAAMVAVSRVDDYWHHWQDVFAGGILGLVVASFCYLQFFP 258



>gi|223943131|gb|ACN25649.1| unknown [Zea mays]
 gi|413946370|gb|AFW79019.1| hypothetical protein ZEAMMB73_476147 [Zea mays]
          Length = 324

 Score =  133 bits (335), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 121/236 (51%), Gaps = 11/236 (4%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLED--KTIQFPFAEKERVPMWLCAXX 68
           ++ + + LDW +  +       ++ +EP+HR F  ED    +++P  +   VP+W     
Sbjct: 22  KVARLHRLDWAVLLLIAAADVGLNLVEPFHR-FVGEDMLADLRYPL-KSNTVPVWAVPVY 79

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        L  +++++D HHA             +T+  K+ VGRPRP+F  RC 
Sbjct: 80  AVIGPIVVFVGLYLK-RRNVYDMHHAILGLLFSVLITGVLTDAIKDGVGRPRPNFFWRCF 138

Query: 129 PSAA--FDPGLGLSNSTICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     +D    ++   +C     ++K+G KSF SGHSS SFAG+GFLS YLAGK+  FD
Sbjct: 139 PDGVPKYD---NITRGVLCDGVASVIKEGHKSFPSGHSSWSFAGLGFLSWYLAGKVKAFD 195

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW DVFAG ++G +++ F Y Q++P
Sbjct: 196 RRGHVAKLCVVLLPLLLAAMVAVSRVDDYWHHWQDVFAGGILGLVVASFCYLQFFP 251



>gi|116788989|gb|ABK25074.1| unknown [Picea sitchensis]
          Length = 338

 Score =  133 bits (335), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 132/280 (47%), Gaps = 16/280 (5%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           IQ+++ +  DW++    + I   ++ + P++R       T + +PF +   VP W     
Sbjct: 19  IQLVQYHKHDWLMILGLVVIEILLNVINPFYRFVGSGMMTDLMYPF-KGNTVPFWAVPIF 77

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                        +  K+ ++D+HH+             +T+  K+ VGRPRPDF  RC 
Sbjct: 78  AIIVPIFIFSIHYIR-KRDLNDFHHSILGLLFAVLITAVITDSIKDAVGRPRPDFFWRCF 136

Query: 129 PSAAFDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
           P    +      N        ++K+G KSF SGH+S SFAG+G+LSLYLA K+++FD++G
Sbjct: 137 PDGKGNYDSVTGNVICHGDRKVIKEGHKSFPSGHTSWSFAGLGYLSLYLAAKINIFDRQG 196

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKIS 248
           +  K                SR +DY HHW DVFAG L+G  ++   Y Q++P  +   +
Sbjct: 197 HASKLCIIFFPLLAAALIGISRVDDYWHHWQDVFAGGLIGLTIATLCYRQFFPAPYDSDA 256

Query: 249 DKPFTIRLKKVVPEYKAEFSFMDGSEV-EITVVKNDEQLL 287
             P+            A F F+ G  V E+  +  D Q +
Sbjct: 257 VGPY------------AYFQFLTGEHVNELENIGQDAQQM 284



>gi|328783604|ref|XP_623887.2| PREDICTED: phosphatidate phosphatase PPAPDC1A-like [Apis mellifera]
          Length = 265

 Score =  133 bits (334), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 115/255 (45%), Gaps = 35/255 (13%)

Query: 13  LKAYALDWVLCFIFLGIFFSVDQLEPYHRLF--------------SLEDKTIQFPFAEKE 58
           L  Y  D +L  + +G+F  +++ EP+ R+               S    TI +P     
Sbjct: 10  LVGYLFDILLRIVLVGLFIELEKAEPFTRIIHEDELWLYKKPRTESYVPTTILWPLVFTM 69

Query: 59  RVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGR 118
            V +  C                  + K   D + A             +T++ K  VGR
Sbjct: 70  PVIVIFCV---------------FLVYKDKTDIYQAILAVTLALGFNGVITDIIKLIVGR 114

Query: 119 PRPDFIDRCQPSAAFDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLA 178
           PRPDF  RC P    +P    + + +     ++KDG KSF SGHSS +F   GF++LY+A
Sbjct: 115 PRPDFFWRCFPDGQTNPDFKCNGNPV-----VIKDGKKSFPSGHSSFAFTSFGFIALYIA 169

Query: 179 GKLHVFD-QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           GKLH F   KG  +K F              SRT DY HHW DV  GS++G+ L+Y  Y 
Sbjct: 170 GKLHTFSLGKGQLWKLFAFVLPICIALLIALSRTFDYHHHWQDVVVGSIIGYFLAYMCYR 229

Query: 238 QYYPDLHSKISDKPF 252
            YYP L S++  KP+
Sbjct: 230 YYYPPLDSQVCHKPY 244



>gi|414870667|tpg|DAA49224.1| TPA: hypothetical protein ZEAMMB73_828601 [Zea mays]
          Length = 263

 Score =  133 bits (334), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 116/240 (48%), Gaps = 9/240 (3%)

Query: 5   SEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMW 63
           S  +K+  L  Y  DW++      +   ++ +EP+HR    +  T + +P  +   +P W
Sbjct: 13  SHGTKVATLHMY--DWIILLCLAVLDGLLNIIEPFHRFVGRDMMTDLSYPL-KGNTIPFW 69

Query: 64  LCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDF 123
                                KK+++D HH              +T+  K+ VGRPRPDF
Sbjct: 70  AVPLIAIVLPLVIFAVIYFK-KKNVYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDF 128

Query: 124 IDRCQPSAAFDPGLG-LSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKL 181
             RC P     P    ++   IC     ++K+G KSF SGHSS SFAG+GFL+ YLAGKL
Sbjct: 129 FWRCFPDG--KPNFNNITTDVICHGEKSVIKEGHKSFPSGHSSWSFAGLGFLAWYLAGKL 186

Query: 182 HVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
             FD+KG+  K                SR +DY HHW DVFAG ++G  ++ F Y Q++P
Sbjct: 187 KAFDRKGHIAKLCLVFLPLLVASLVAVSRVDDYWHHWQDVFAGGIIGLTVASFCYLQFFP 246



>gi|171682780|ref|XP_001906333.1| hypothetical protein [Podospora anserina S mat+]
 gi|170941349|emb|CAP66999.1| unnamed protein product [Podospora anserina S mat+]
          Length = 295

 Score =  133 bits (334), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 120/248 (48%), Gaps = 21/248 (8%)

Query: 21  VLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXX 80
           V+ +I +  F     +EP+HR+FSL D  I FP+AE ERVP+                  
Sbjct: 17  VVVYILIQFF-----VEPFHRMFSLNDLRISFPYAEVERVPLTHDFIYALFLPLILICLS 71

Query: 81  ALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLS 140
            L    S H  H               +T++ KN VGRPRPD + RC P     P   L 
Sbjct: 72  NLLSSASSHKHHVTLLGLAISLILTSLLTDIIKNAVGRPRPDLLARCAPLPD-TPLDKLV 130

Query: 141 NSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ------------ 186
           + ++CT T    L DG++SF SGHSS SFAG+G+LSL+LAG+  +F              
Sbjct: 131 DISVCTETGHHKLHDGWRSFPSGHSSFSFAGLGYLSLFLAGQTRIFAHGPGSIAEHTEKV 190

Query: 187 -KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
            +G   K                SR +DYRH  +DV  G L+G+ ++Y++Y +Y+P L S
Sbjct: 191 VRGDLLKALFCLAPLVGATMIAISRCQDYRHDVYDVTIGGLLGWTVAYWSYRRYWPRLSS 250

Query: 246 KISDKPFT 253
              D+P+ 
Sbjct: 251 AKCDEPYA 258



>gi|357157977|ref|XP_003577977.1| PREDICTED: lipid phosphate phosphatase 2-like [Brachypodium
           distachyon]
          Length = 314

 Score =  133 bits (334), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 141/299 (47%), Gaps = 10/299 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W      
Sbjct: 17  KVARLHMYDWIILVLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPL-KGNTVPFWAVPLIG 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          KK+ +D HH              +T+  K+ VGRPRPDF  RC P
Sbjct: 76  IVLPCAIFGGIYFK-KKNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFP 134

Query: 130 SAAFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
               D    ++   +C     ++K+G KSF SGH+S SFAG+GFL+ YL GK+ VFD+KG
Sbjct: 135 DGK-DMYDNITTGVLCHGEKSVIKEGHKSFPSGHTSWSFAGLGFLAWYLTGKIAVFDRKG 193

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKIS 248
           +  K                SR +DY HHW DVFAG+++G  ++ F Y Q++P  +   +
Sbjct: 194 HIAKLCIMVLPLLTAALVAVSRVDDYWHHWQDVFAGAIIGLTVASFCYLQFFPYPYDTDA 253

Query: 249 DKP--FTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDE---QLLLKDSRALLADSSSNN 302
             P  +T++L +      A    +  +E+E   +        + L+D+  +L +  S  
Sbjct: 254 LWPHAYTLQLAEARSSGIANSYSVRPAEIETVNIPEGHGHGGITLRDTSPILDNMESGR 312



>gi|449303736|gb|EMC99743.1| hypothetical protein BAUCODRAFT_119318 [Baudoinia compniacensis
           UAMH 10762]
          Length = 305

 Score =  133 bits (334), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 120/249 (48%), Gaps = 13/249 (5%)

Query: 37  EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHASX 96
           EP+H++F L++  IQ+P AE E VP                    +  + S+H  H    
Sbjct: 54  EPFHKMFRLDNARIQYPHAEMETVPALWLFIYGGAVPLATLIVWTVTFRPSIHKAHVTIL 113

Query: 97  XXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRT--DLLKDG 154
                      +T++ KN VGRPRPD I RC+P+ +  P   L    +CT T  +LL DG
Sbjct: 114 GLATTILLTLIITDMLKNGVGRPRPDLIARCKPADS-TPTDILVTWKVCTETQHNLLHDG 172

Query: 155 FKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDY 214
           ++S+ SGHSS +++G+G+L+L+LA + H    +                     SR EDY
Sbjct: 173 WRSWPSGHSSFAWSGLGYLALFLASQTHALRARASLALVLLCLLPLAGASFVAISRLEDY 232

Query: 215 RHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFTIR----------LKKVVPEYK 264
           RH   DV  GSL+G  ++YF + +YYP L S+  D+P   R           ++V  E +
Sbjct: 233 RHQVEDVICGSLLGMGIAYFNWRRYYPSLLSESCDEPHAPRGSGKLGANGGFQRVRDEEE 292

Query: 265 AEFSFMDGS 273
             FS  D S
Sbjct: 293 GRFSISDES 301



>gi|302659979|ref|XP_003021674.1| PAP2 domain protein [Trichophyton verrucosum HKI 0517]
 gi|291185583|gb|EFE41056.1| PAP2 domain protein [Trichophyton verrucosum HKI 0517]
          Length = 346

 Score =  132 bits (333), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 77/184 (41%), Positives = 94/184 (51%), Gaps = 29/184 (15%)

Query: 108 VTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSG---- 161
           +T   KN  G+PRPD IDRC+P     P  GLSN TICT+TD  +LKDGF+SF SG    
Sbjct: 30  ITGALKNACGKPRPDLIDRCKPRTFEQPEFGLSNYTICTQTDHEILKDGFRSFPSGAYNY 89

Query: 162 ----------------------HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXX 199
                                 HSS+SFAG+ +LSLYLAGKLHV D +G  +K F     
Sbjct: 90  QSLWIEEGPFLLRTNFSFLVLGHSSSSFAGLFYLSLYLAGKLHVMDSRGEVWKAFIVMVP 149

Query: 200 XXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISD-KPFTIRLKK 258
                    SR  D RHH  DV +GSL+G    + AY QY+P L       +   IR   
Sbjct: 150 TLSAGLVAVSRIMDARHHPFDVISGSLLGVGCGWVAYRQYFPSLAEPWKKGRAHPIRTWG 209

Query: 259 VVPE 262
            +PE
Sbjct: 210 SIPE 213



>gi|357136024|ref|XP_003569606.1| PREDICTED: putative lipid phosphate phosphatase 3,
           chloroplastic-like [Brachypodium distachyon]
          Length = 319

 Score =  132 bits (333), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++  + + I   ++ +EP+HR    +  T +++P  +K  +P W      
Sbjct: 23  KVARLHMYDWIVLLLLVVIDGVLNTIEPFHRFVGSDMMTDLRYPM-KKNTIPFWAVPIYG 81

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          +++++D HHA             +T+  K+ VGRPRPDF  RC P
Sbjct: 82  IIGPMVIITVIYFK-RRNVYDLHHAILGLLFSVLITAVLTDAIKDGVGRPRPDFFWRCFP 140

Query: 130 SA--AFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
               A+D    ++   +C  +   +K+G KSF SGH+S SFAG+GFLS YLAGK+ VFDQ
Sbjct: 141 DGVPAYD---KITTGVLCHGKASDIKEGHKSFPSGHTSWSFAGLGFLSWYLAGKIKVFDQ 197

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           KG+  K                SR +DY HHW DV  G ++G L++   Y Q++P
Sbjct: 198 KGHIAKLCIVLLPLLLAALVAVSRVDDYWHHWQDVCTGGILGLLVASLCYLQFFP 252



>gi|482572743|gb|EOA36930.1| hypothetical protein CARUB_v10009800mg [Capsella rubella]
          Length = 315

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 124/238 (52%), Gaps = 13/238 (5%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ + +  DW++  + + I   ++ +EP+HR    +  T +++P  +   +P W     
Sbjct: 16  VKVARFHMHDWLILLLLVVIVVVLNVIEPFHRFVGEDMLTDLRYPL-QDNTIPFWAVPLI 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I+  ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AVVLPFAVIVVYYF-IRNDVYDLHHAVLGLLFSVLITGVLTDAIKDAVGRPRPDFFWRCF 133

Query: 129 PSAAFDPGLGL----SNSTICT-RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHV 183
           P      G+G+    +   +CT   D++K+G KSF SGH+S SFAG+GFL+LYL+GK+ V
Sbjct: 134 PD-----GIGIFHNVTRDVLCTGNKDVVKEGHKSFPSGHTSWSFAGLGFLALYLSGKIKV 188

Query: 184 FDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           FDQ+G+  K                SR +DY HHW DVF G+++G  ++ F Y Q++P
Sbjct: 189 FDQRGHVAKLCIVILPLLVAALVGVSRVDDYWHHWQDVFGGAIIGLTVATFCYLQFFP 246



>gi|367029241|ref|XP_003663904.1| hypothetical protein MYCTH_52645 [Myceliophthora thermophila ATCC
           42464]
 gi|347011174|gb|AEO58659.1| hypothetical protein MYCTH_52645 [Myceliophthora thermophila ATCC
           42464]
          Length = 327

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 114/240 (47%), Gaps = 23/240 (9%)

Query: 36  LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHAS 95
           +EP+HR+FSL D  I FP AE ERVP+                   LA     H  H   
Sbjct: 50  VEPFHRMFSLNDLRIAFPHAEVERVPLLNDFIYALFLPLGVLILANLATHAPPHKHHVTV 109

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKD 153
                       +T+V KN VGRPRPD + RC P     P   L    +CT+TD   L D
Sbjct: 110 LGLAISLILASFLTDVIKNAVGRPRPDLLARCVPRPD-TPRDVLVTIDVCTQTDHHTLHD 168

Query: 154 GFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ--------------------KGYTYKG 193
           G++SF SGHSS +FAG+G+LSL+LAG++ +F                      +G   + 
Sbjct: 169 GWRSFPSGHSSFAFAGLGYLSLFLAGQMRIFAHGGGGGGGGGASAGDKVEKLVRGDLLRA 228

Query: 194 FXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFT 253
                          SR +DYRH  +DV  G L+G+ ++Y++Y +Y+P L S   ++P+ 
Sbjct: 229 LLCGAPLLGATMIAISRCQDYRHDVYDVCVGGLLGWTVAYWSYRRYWPRLGSWRCEEPYA 288



>gi|146415927|ref|XP_001483933.1| hypothetical protein PGUG_03314 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 270

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 116/248 (46%), Gaps = 12/248 (4%)

Query: 14  KAYALDWVLCFIFLGIFFSV-DQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           + Y LDWV     L  FF V +  +P+ R FSL+D TIQ PFA  ERV    C       
Sbjct: 11  RRYQLDWVCGLAILVYFFVVAEHAKPFFRQFSLDDPTIQHPFAVHERVSGIACILISAIV 70

Query: 73  XXXXXXXXALAIKKS-------MHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFID 125
                    L   ++       +H    +             VT++ KN + RPRPDF+ 
Sbjct: 71  PTVVILGSVLVKTRNFRLSNDQLHLIQVSILGLLLSLAISGTVTDILKNWIARPRPDFLA 130

Query: 126 RCQPSAAFDPGLGLSNSTICTR---TDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLH 182
           RC P     P   L    +CT      +L DG +S  SGHSS SFAGM +L+L+L G+  
Sbjct: 131 RCGPKEG-TPVNQLVGVEVCTSPLGIAVLIDGMRSTPSGHSSISFAGMLYLTLWLYGQTQ 189

Query: 183 VFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPD 242
           VF ++   Y                 SRT+DYRHH+ D+  G+ +G  +S   YH+Y+  
Sbjct: 190 VFLKRQPIYLTLACSLPLLLSSYIALSRTQDYRHHFMDIVLGTSLGVFMSATVYHRYFNG 249

Query: 243 LHSKISDK 250
           + S+ S+K
Sbjct: 250 IFSEDSNK 257



>gi|54290302|dbj|BAD61302.1| phosphatidic acid phosphata -like [Oryza sativa Japonica Group]
          Length = 253

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 85  KKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA--FDPGLGLSNS 142
           ++ ++D HHA+            VT V KN VGRPRPDF  RC P     +D    ++  
Sbjct: 38  RRDVYDLHHATLGVLYSVLITAVVTTVVKNAVGRPRPDFFWRCFPDGKQLYDQ---VTGD 94

Query: 143 TIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXX 201
            IC      LKDG KSF SGH+S SFAG+GFLSLYL+GK+ VFD++G+  K         
Sbjct: 95  VICHGEKSFLKDGRKSFPSGHTSWSFAGLGFLSLYLSGKIKVFDRQGHVAKLCIMILPLL 154

Query: 202 XXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
                  SR +DYRHHW DVFAG L+GF+++   Y  ++P
Sbjct: 155 IASLVGISRIDDYRHHWEDVFAGGLLGFIMAMLCYLHFFP 194



>gi|374671175|gb|AEZ56253.1| phosphatidate phosphatase [Jatropha curcas]
          Length = 311

 Score =  132 bits (333), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++  + + I   ++ +EP+HR    +  T + +P  +   VP W      
Sbjct: 17  KVARVHMHDWLILLLLVVIDVVLNVIEPFHRFVGRDMMTDLSYPLKDNT-VPFWAVPIVG 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                         I++ ++D HHA             +T+  K+ VGRPRPDF  RC P
Sbjct: 76  ILLPFVIISVYYF-IRRDVYDLHHAILGLLFSVLITAVITDAIKDGVGRPRPDFFWRCFP 134

Query: 130 SA--AFDPGLGLSNSTICT-RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
           +    FD    ++   ICT    ++K+G KSF SGH+S SFAG+GFLS YL+GK+ VFD+
Sbjct: 135 NGKGVFD---NVTTDVICTGDKSVIKEGHKSFPSGHTSWSFAGLGFLSWYLSGKIRVFDR 191

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +G+  K                SR +DY HHW DVFAG L+G  ++ F Y Q++P
Sbjct: 192 RGHVAKLCIVILPLLVAALIGISRVDDYWHHWQDVFAGGLIGLTVASFCYLQFFP 246



>gi|308044341|ref|NP_001183694.1| uncharacterized protein LOC100502288 [Zea mays]
 gi|238013938|gb|ACR38004.1| unknown [Zea mays]
 gi|413950989|gb|AFW83638.1| hypothetical protein ZEAMMB73_011922 [Zea mays]
          Length = 320

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 118/239 (49%), Gaps = 7/239 (2%)

Query: 5   SEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMW 63
           S  SK+  L  Y  DW++  +   +   ++ +EP+HR    E  T +++P  +   VP W
Sbjct: 19  SHGSKVARLHMY--DWIVLILLAVLDGVLNIIEPFHRFVGSEMMTDLRYPM-KGNTVPFW 75

Query: 64  LCAXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDF 123
                                K++++D HHA             +T+  K+ VGRPRPDF
Sbjct: 76  AVPIIGIIGPMVIITVIYFK-KRNVYDLHHAILGLLFSVLITAVLTDAIKDGVGRPRPDF 134

Query: 124 IDRCQPSAAFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLH 182
             RC P    +     +   IC  +  ++K+G KSF SGH+S SFAG+GFLS YLAGK+ 
Sbjct: 135 FWRCFPDGKPEYN-NFTTGAICHGQASVIKEGHKSFPSGHTSWSFAGLGFLSWYLAGKIK 193

Query: 183 VFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           VFD++G+  K                SR +DY HHW DV  G L+GF ++   Y Q++P
Sbjct: 194 VFDRRGHVAKVCIVLSPLLLAALVAVSRVDDYWHHWQDVCTGGLLGFTVASICYLQFFP 252



>gi|119500738|ref|XP_001267126.1| PAP2 domain protein [Neosartorya fischeri NRRL 181]
 gi|119415291|gb|EAW25229.1| PAP2 domain protein [Neosartorya fischeri NRRL 181]
          Length = 424

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 137/305 (44%), Gaps = 32/305 (10%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           + +++ +Y  D+++    +  F+  D +EPYH+ FSL + +IQ+P+A  ER+ +      
Sbjct: 16  RPRVIISYIADYLILIGCIAGFYIFDSIEPYHQHFSLRNISIQYPYAVHERISIQAALLI 75

Query: 69  XXXXXXXXXXXXALAI-------------------------KKSMHDWHHASXXXXXXXX 103
                        L I                         K  + +++           
Sbjct: 76  SCVTPLAIIAVYTLVIDGLFSHHKPYNPASGKRKLTGPYRWKDRLWEFNCGFLGLLLSQG 135

Query: 104 XXXXVTEVFKNTVGRPRPDFIDRCQP-SAAFDPGLGLSNSTICT-RTDLLKDGFKSFLSG 161
               +T+V K   G+PRPD IDRC+P   + D   GLSNSTICT    ++KDGF+S+   
Sbjct: 136 LAFLITQVLKTACGKPRPDLIDRCKPRPGSEDLIPGLSNSTICTGDPAIIKDGFRSW--- 192

Query: 162 HSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDV 221
             S SFAG+ +L+L+L GKLH  D +G  +K                SR  D RHH  DV
Sbjct: 193 -PSASFAGLFYLTLWLCGKLHFMDNRGEVWKAIIVIIPCLAATLVAVSRIMDARHHPFDV 251

Query: 222 FAGSLVGFLLSYFAYHQYYPDLHSKISD-KPFTIRLKKVVPEYKAEFSFMDGSEVEITVV 280
             GSL+G + +Y +Y QY+P +       + + IR     P   +  S +       + +
Sbjct: 252 ITGSLLGIVCAYISYRQYFPPISEPWKKGRAYPIRSWGTDPVAPSNASPLSDHYASTSAL 311

Query: 281 KNDEQ 285
           +N E+
Sbjct: 312 RNLEE 316



>gi|255574320|ref|XP_002528074.1| phosphatidic acid phosphatase, putative [Ricinus communis]
 gi|223532535|gb|EEF34324.1| phosphatidic acid phosphatase, putative [Ricinus communis]
          Length = 319

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 116/233 (49%), Gaps = 4/233 (1%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           I + + +  DW++  + + +   +  + P++R    +  T +++P  +   VP W     
Sbjct: 16  ITVARTHMHDWLILMLLVMLDVILYVIHPFYRYVGKDMMTDLRYPM-KSNTVPFWAVPLY 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                           ++ ++D HHA             +T+  KN VGRPRPDF  RC 
Sbjct: 75  SILLPMVIFLIIYFR-RRDIYDLHHAILGLLYSILVTAVITDSIKNAVGRPRPDFFWRCF 133

Query: 129 PSAAFDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
           P    D    L N        ++K+G KSF SGH+S SFAG+GFLSLYL+GK+ VFD++G
Sbjct: 134 PDGK-DVYDQLGNVICHGDKSVIKEGHKSFPSGHTSGSFAGLGFLSLYLSGKIKVFDRRG 192

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +  K                SR +DY HHW DVFAG L+G +++ F Y Q++P
Sbjct: 193 HVAKLCIVFLPLLVACLVGISRVDDYWHHWQDVFAGGLLGLVVATFCYLQFFP 245



>gi|50305447|ref|XP_452683.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641816|emb|CAH01534.1| KLLA0C10835p [Kluyveromyces lactis]
          Length = 297

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 122/257 (47%), Gaps = 6/257 (2%)

Query: 13  LKAYAL-DWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           LK + L D +LC +   +   V   +P+ R F + D TI  PFAE E V           
Sbjct: 19  LKKWKLTDLILCVVLFLVNIPVYYQKPFQRQFFINDLTISHPFAEVEMVNNHALIVYSYF 78

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXX---XXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                    +L +  S H W+                  +T   KN  GR RPDF+ RC 
Sbjct: 79  VPFFTIILFSLLLADSKHRWYLMYISLLGLSFTWISTSLLTNYLKNWFGRHRPDFLARCA 138

Query: 129 PSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
           P         +    +CT TD  +L DGF++  SGHSS SFAG+GFL L+L G+L     
Sbjct: 139 PKHGTPKNTLVYAIDVCTSTDYAVLYDGFRTTPSGHSSESFAGLGFLFLWLCGQLLTELP 198

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSK 246
           +  +++                SRT+DYRHH+ DV  GSL+G L+++++Y +Y+P +HSK
Sbjct: 199 ETGSWRTIVACLPLVGASVIALSRTQDYRHHFVDVMLGSLLGILVAHWSYRRYFPSIHSK 258

Query: 247 ISDKPFTIRLKKVVPEY 263
           +  KP       V+ EY
Sbjct: 259 LPFKPLLDDSDVVLEEY 275



>gi|449434588|ref|XP_004135078.1| PREDICTED: lipid phosphate phosphatase 2-like [Cucumis sativus]
          Length = 311

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 108/209 (51%), Gaps = 9/209 (4%)

Query: 37  EPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHAS 95
           EP+HR    E  T +++P  +   VP+W                    I+K ++D HHA 
Sbjct: 43  EPFHRFVGQEMMTDLKYPL-QDNTVPLWAVPIIAVLIPFTVFIIYYF-IRKDVYDLHHAI 100

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP--SAAFDPGLGLSNSTICT-RTDLLK 152
                       +T+  K+ VGRPRPDF  RC P     FD     +   +CT   +++K
Sbjct: 101 LGLLFAVLISGVMTDAIKDGVGRPRPDFYWRCFPDGKGVFDRN---TTGVLCTGDKNVIK 157

Query: 153 DGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTE 212
           +G+KSF SGH+S SFAG+GFL+ YL+GK+  FDQ+G+  K                SR +
Sbjct: 158 EGYKSFPSGHTSWSFAGLGFLAWYLSGKIRAFDQRGHVAKLCIVFLPLLIAALVGISRVD 217

Query: 213 DYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           DY HHW DVFAG L+G  ++ F Y Q++P
Sbjct: 218 DYWHHWQDVFAGGLLGLTIASFCYLQFFP 246



>gi|168011250|ref|XP_001758316.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162690351|gb|EDQ76718.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 321

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 117/240 (48%), Gaps = 6/240 (2%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQL-EPYHRLFSLEDKTIQFPFAE-KERVPMWLCAX 67
           +Q++K +  DW+   + + +   V  L  P+HR F  E K  ++ +    + VP W    
Sbjct: 31  VQLIKHHLRDWLWIAVMIALEIIVYLLIPPFHR-FVDETKMQEYKYPTGPDTVPTWSIGV 89

Query: 68  XXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRC 127
                         +  ++S+ D+H+A              T+  KN VG PRPDF DRC
Sbjct: 90  IAVLVPILFFLAYYIK-RRSIRDFHNAFLGLATAIVLTALFTDSIKNMVGMPRPDFFDRC 148

Query: 128 QPSAAFDPGLGLSNSTICTRTDLL--KDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
            P              IC   ++   KDG+KSF SGH S  FAG+G+LSLYLAGKL +FD
Sbjct: 149 FPDGIAVYANDSRRRAICHPNNMTEYKDGYKSFPSGHVSWCFAGLGYLSLYLAGKLSLFD 208

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
           ++GY+ + F              SR  DY+H W D+   + +G  ++YF Y Q+YP +++
Sbjct: 209 KRGYSSRVFFVLFPNLVTVLIAISRVNDYQHRWVDIIGAAFIGLPIAYFCYRQHYPSIYA 268



>gi|449520859|ref|XP_004167450.1| PREDICTED: lipid phosphate phosphatase 2-like [Cucumis sativus]
          Length = 311

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 108/209 (51%), Gaps = 9/209 (4%)

Query: 37  EPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHAS 95
           EP+HR    E  T +++P  +   VP+W                    I+K ++D HHA 
Sbjct: 43  EPFHRFVGQEMMTDLKYPL-QDNTVPLWAVPIIAVLIPFTVFIIYYF-IRKDVYDLHHAI 100

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP--SAAFDPGLGLSNSTICT-RTDLLK 152
                       +T+  K+ VGRPRPDF  RC P     FD     +   +CT   +++K
Sbjct: 101 LGLLFAVLISGVMTDAIKDGVGRPRPDFYWRCFPDGKGVFDRN---TTGVLCTGDKNVIK 157

Query: 153 DGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTE 212
           +G+KSF SGH+S SFAG+GFL+ YL+GK+  FDQ+G+  K                SR +
Sbjct: 158 EGYKSFPSGHTSWSFAGLGFLAWYLSGKIRAFDQRGHVAKLCIVFLPLLIAALVGISRVD 217

Query: 213 DYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           DY HHW DVFAG L+G  ++ F Y Q++P
Sbjct: 218 DYWHHWQDVFAGGLLGLTIASFCYLQFFP 246



>gi|346327453|gb|EGX97049.1| PAP2 domain protein [Cordyceps militaris CM01]
          Length = 302

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 111/222 (50%), Gaps = 6/222 (2%)

Query: 36  LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHAS 95
           + P+HR+FS++D  I FP AE ERV + +                 + ++          
Sbjct: 46  VTPFHRMFSVDDLQISFPHAEHERVTVVMNFVYAFFIPLGVLIAYNVIMRSPAAKHEVTY 105

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKD 153
                       +T+V KN VGRPRPD +DRC P A   P   L    +CT  D   L+D
Sbjct: 106 LSFFISVALTLFLTDVIKNAVGRPRPDLLDRCHPRAGTKPHT-LVTIDVCTTADGHKLQD 164

Query: 154 GFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTY---KGFXXXXXXXXXXXXXXSR 210
           G++SF SGHSS SFAG+GF+SLY AG+  +F          +                SR
Sbjct: 165 GWRSFPSGHSSFSFAGLGFVSLYFAGQFQIFRTATGGRDLSRALFCITPLVGAALIAISR 224

Query: 211 TEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
            EDYRH  +DV  GS++GF ++Y++Y +++P L S +  +P+
Sbjct: 225 CEDYRHDVYDVCVGSILGFSVAYWSYRRHWPRLTSPLCAQPY 266



>gi|255570669|ref|XP_002526289.1| ER Phosphatidate Phosphatase [Ricinus communis]
 gi|223534370|gb|EEF36078.1| ER Phosphatidate Phosphatase [Ricinus communis]
          Length = 316

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 119/236 (50%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ + +  DW +  + + I   ++ +EP+HR    +  T + +P  +   VP W     
Sbjct: 16  VKVARTHMHDWWILALLVVIEVILNVIEPFHRFVGKDMLTDLSYPLKDNT-VPFW-AVPI 73

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I++ ++D HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 74  VAILLPFTIIIIYYFIRRDVYDLHHAILGLLFSVLITGVLTDAIKDAVGRPRPDFFWRCF 133

Query: 129 PSA--AFDPGLGLSNSTICTR-TDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P     FDP   ++   +CT    ++++G KSF SGH+S SFAG+GFLS YL+GK+  FD
Sbjct: 134 PDGKRVFDP---ITTDVMCTGLKSVIREGHKSFPSGHTSWSFAGLGFLSWYLSGKIRAFD 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
            +G+  K                SR +DY HHW DVFAG L+G  ++ F Y Q++P
Sbjct: 191 HRGHIGKLCIVFLPLLVAALIGVSRVDDYWHHWQDVFAGGLLGLTIASFCYLQFFP 246



>gi|473914779|gb|EMS49700.1| Putative lipid phosphate phosphatase 3, chloroplastic [Triticum
           urartu]
          Length = 303

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 112/225 (49%), Gaps = 5/225 (2%)

Query: 19  DWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXXXXXXX 77
           DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W              
Sbjct: 3   DWIILVLLAVIDGLLNIIEPFHRFVGKDMMTDLRYPL-QGNTVPFWAVPVIGIVLPCAIF 61

Query: 78  XXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGL 137
                  KK+ +D HH              +T+  K+ VGRPRPDF  RC P    D   
Sbjct: 62  GGIYFK-KKNFYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFPDGK-DLYD 119

Query: 138 GLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXX 196
            ++   +C     ++K+G KSF SGH+S SFAG+GFL+ YL GK+ VFD+KG+  K    
Sbjct: 120 NVTTGVLCHGEKSVIKEGHKSFPSGHASWSFAGLGFLTWYLTGKIAVFDRKGHIAKLCII 179

Query: 197 XXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
                       SR +DY HHW DVFAG+++G  ++ F Y Q++P
Sbjct: 180 VLPLLTAALVAVSRVDDYWHHWQDVFAGAIIGLTVASFCYLQFFP 224



>gi|474367375|gb|EMS63579.1| Putative lipid phosphate phosphatase 3, chloroplastic [Triticum
           urartu]
          Length = 529

 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 116/233 (49%), Gaps = 5/233 (2%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W      
Sbjct: 17  KVARLHMYDWIILLLLAVIDGLLNIIEPFHRFIGKDMMTDLRYPL-KGNTVPFWAVPLIG 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          KK+++D HH              +T+  K+ VGRPRPDF  RC P
Sbjct: 76  IVLPCVIFGGIYFK-KKNIYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFP 134

Query: 130 SAAFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
               D    ++   +C     ++K+G KSF SGHSS SFAG+GFL+ YL GK+ VFD+KG
Sbjct: 135 DGK-DLYDNVTTGVLCHGEKSVIKEGHKSFPSGHSSWSFAGLGFLTWYLTGKIAVFDRKG 193

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +  K                SR +DY HHW DV AG+++G  ++ F Y Q++P
Sbjct: 194 HIAKLCIIVLPLLTAALVAVSRVDDYWHHWQDVVAGAVLGLTVASFCYLQFFP 246



>gi|508708143|gb|EOY00040.1| Lipid phosphate phosphatase 2 isoform 5 [Theobroma cacao]
 gi|508708144|gb|EOY00041.1| Lipid phosphate phosphatase 2 isoform 5 [Theobroma cacao]
 gi|508708145|gb|EOY00042.1| Lipid phosphate phosphatase 2 isoform 5 [Theobroma cacao]
          Length = 267

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 95/161 (59%), Gaps = 6/161 (3%)

Query: 84  IKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA--AFDPGLGLSN 141
           I++ ++D HHA             +T+  K+ VGRPRPDF  RC P     FDP   ++ 
Sbjct: 37  IRRDVYDLHHAILGLLFSVLITGVITDAIKDAVGRPRPDFFWRCFPDGKGVFDP---VTK 93

Query: 142 STICTRT-DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXX 200
           + +CT    ++K+G KSF SGH+S SFAG+GFL+LYL+GK+ VFD++G+  K        
Sbjct: 94  NVMCTGLRSVIKEGHKSFPSGHTSWSFAGLGFLALYLSGKIRVFDRRGHVAKLCIVFLPL 153

Query: 201 XXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
                   SR +DY HHW D+FAG L+G  +S F Y Q++P
Sbjct: 154 LIAALVGISRVDDYWHHWQDIFAGGLLGITVSSFCYLQFFP 194



>gi|501751832|emb|CCG84068.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 338

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/287 (29%), Positives = 142/287 (49%), Gaps = 23/287 (8%)

Query: 15  AYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXX 74
           +YALDW++    + IF  +  +  + + FSL D  I++ +     +P +           
Sbjct: 11  SYALDWLIIICAVFIFQRIGDIAGHRQHFSLTDIRIKYEYTGPSTIPNYANVMLSVVFPA 70

Query: 75  XXXXXXALAIKKSM--HDWHHAS-------XXXXXXXXXXXXVTEVFKN----TVGRPRP 121
                    +++ +  H    +                    +++VF N    T+GRPRP
Sbjct: 71  LTILVLLTVLERRLASHRTQQSGFMVLYTINTSLLGLALSVSLSQVFTNALKVTIGRPRP 130

Query: 122 DFIDRCQPSA-AFDP-GLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYL 177
           D + RC P+  A DP   GLS S ICT+T+  +L DGF+SF SGHSS +F+G+ +L+L+L
Sbjct: 131 DLLARCMPTTTAVDPVPYGLSTSAICTQTNAAILNDGFRSFPSGHSSMAFSGLAYLTLFL 190

Query: 178 AGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           A +L +F++KG T+K                SR +D RHH  DV  GS +G + S+ A+ 
Sbjct: 191 AWRLSLFNKKGQTWKWTVVMLPFLIASLVAISRIKDNRHHPFDVLFGSGLGIVTSFIAFF 250

Query: 238 QYYPDLHSKISDKPFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDE 284
           QY+P+L +++ ++ F +R K    E   + S  D  E  +  V  ++
Sbjct: 251 QYHPEL-TRVHNR-FPVRFK----ENSRQTSMADDPETNVDDVPEEQ 291



>gi|357130661|ref|XP_003566966.1| PREDICTED: putative lipid phosphate phosphatase 3,
           chloroplastic-like [Brachypodium distachyon]
          Length = 322

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
            + +++A DW+   + + +   ++ +EP+HR       T +++P  +   VP+W      
Sbjct: 25  SVARSHAYDWLALLLLVAVEVLLNAIEPFHRFVGAGMMTDLRYPL-KSNTVPVWAVPVIA 83

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                       +  +++++D HHA             +T+  K+ VGRPRP+F  RC P
Sbjct: 84  VIGPMIIFVVIYIR-RRNVYDLHHAILGILFSVLITGVLTDAIKDAVGRPRPNFFWRCFP 142

Query: 130 S--AAFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
              A +D    ++   IC     ++K+G KSF SGH+S SFAG+GFLS YLAGK+ VFD+
Sbjct: 143 DGIAVYD---NITTGVICHGEASVIKEGHKSFPSGHTSWSFAGLGFLSWYLAGKITVFDR 199

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +G+  K                SR +DY HHW DVF G ++G +++   Y Q++P
Sbjct: 200 RGHVAKLCVVILPLLVAAMIAISRVDDYWHHWQDVFTGGIIGSVVASVCYLQFFP 254



>gi|357508201|ref|XP_003624389.1| Lipid phosphate phosphatase [Medicago truncatula]
 gi|355499404|gb|AES80607.1| Lipid phosphate phosphatase [Medicago truncatula]
          Length = 478

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 120/234 (51%), Gaps = 10/234 (4%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXX 70
           + K +  DW++  + + I   +  + P++R    +  + +++P  +   VP+W       
Sbjct: 171 VAKTHLHDWIILLLLVFIEIMLYLIYPFYRFVGKDMMSDLKYPL-KSNTVPVWAVPMLAV 229

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS 130
                      +  ++ ++D HHA             +T+  K+ VGRPRPDF  RC P 
Sbjct: 230 VLPIVIFLVVYIR-RRDIYDLHHAVLGLLFSILVTAVITDAIKDAVGRPRPDFFWRCFPD 288

Query: 131 A--AFDPGLGLSNSTICTRTD-LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
               +D  LG     IC   + ++K+G KSF SGH+S SFAG+GFLSLYLAGKL  FD+K
Sbjct: 289 GKDVYDK-LG---DVICHGDESVIKEGHKSFPSGHTSWSFAGLGFLSLYLAGKLKAFDRK 344

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           G+  K                SR +DY HHW DVFAG L+G +++ F Y Q++P
Sbjct: 345 GHVAKLCIIFLPLLAASLVGISRVDDYWHHWTDVFAGGLIGLVVATFCYLQFFP 398



>gi|475502190|gb|EMT04406.1| Putative lipid phosphate phosphatase 3, chloroplastic [Aegilops
           tauschii]
          Length = 321

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 116/233 (49%), Gaps = 5/233 (2%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++  +   I   ++ +EP+HR    +  T +++P  +   VP W      
Sbjct: 17  KVARLHMYDWIILLLLAVIDGLLNIIEPFHRFIGKDMMTDLRYPL-KGNTVPFWAVPLIG 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          KK+++D HH              +T+  K+ VGRPRPDF  RC P
Sbjct: 76  IVLPCVIFGGIYFK-KKNIYDLHHGILGILYSVLITAVITDAIKDGVGRPRPDFFWRCFP 134

Query: 130 SAAFDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
               D    ++   +C     ++K+G KSF SGHSS SFAG+GFL+ YL GK+ VFD+KG
Sbjct: 135 DGK-DLYDNVTTGVLCHGEKSVIKEGHKSFPSGHSSWSFAGLGFLTWYLTGKIAVFDRKG 193

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +  K                SR +DY HHW DV AG+++G  ++ F Y Q++P
Sbjct: 194 HIAKLCIIVLPLLTAALVAVSRVDDYWHHWQDVVAGAVLGLTVASFCYLQFFP 246



>gi|336268735|ref|XP_003349130.1| hypothetical protein SMAC_12097 [Sordaria macrospora k-hell]
 gi|380089461|emb|CCC12559.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 370

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 121/266 (45%), Gaps = 26/266 (9%)

Query: 13  LKAYALDWV-LCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXX 71
           +++Y  DWV    + +G  F    +EP+HRLF++ D  I FP AE ERVP+         
Sbjct: 46  MRSYTSDWVAFSLLLVGYIFIAAFVEPFHRLFTINDIRISFPHAEVERVPVSHLFAYALF 105

Query: 72  XXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSA 131
                       +    H  H +             +T++ KN VGRPRPD I RCQP  
Sbjct: 106 LPLFLLLLTNYLLHSPRHIHHLSLLGFLTSIILTTFLTDLIKNMVGRPRPDLIARCQPLP 165

Query: 132 AFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ--- 186
              P   L    ICT+TD   L DG++SF SGHSS +FAG+G+L+L+  G+   F     
Sbjct: 166 DTPPN-KLVGVEICTQTDHHTLHDGWRSFPSGHSSFAFAGLGYLALFWCGQFRAFSTSSS 224

Query: 187 -------------------KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLV 227
                              K    K                SR  DYRH   DV  GSL+
Sbjct: 225 SSPGGGSSGIMDGMEKVLVKRDLLKALLCLSPLLGALMIAISRCMDYRHDVEDVCVGSLM 284

Query: 228 GFLLSYFAYHQYYPDLHSKISDKPFT 253
           G++++Y++Y +Y+P L +    +P++
Sbjct: 285 GWVITYWSYRRYWPRLSNGRCGEPYS 310



>gi|238878437|gb|EEQ42075.1| hypothetical protein CAWG_00273 [Candida albicans WO-1]
          Length = 284

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/249 (32%), Positives = 121/249 (48%), Gaps = 17/249 (6%)

Query: 19  DWVLCFIFLGIFFSVDQLE-PYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXX 77
           DW++  + +  FFSV +   P+ R FSL+D TI  PFA KERV   LC            
Sbjct: 24  DWIVATVTVLFFFSVAETALPFQRQFSLDDLTISHPFAIKERVSGILCIEIAAFVPLFVI 83

Query: 78  XXXAL---------AIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
               L         + ++++H    +             +T++ K  + RPRPDF++RC 
Sbjct: 84  LTSLLVKYQQGAFSSHQQALHCLQISVLGLIISLSLNGVITDILKIWIARPRPDFLERCG 143

Query: 129 PSAAFDPGLGLSNSTICTRT---DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P+    P   L +  +CT      LL DG KS  SGHSS SF G+ +L+L+L G+  +F 
Sbjct: 144 PAPG-TPLHELVDVNVCTAPLDKALLIDGMKSTPSGHSSISFGGLFYLTLWLLGQFKLFQ 202

Query: 186 QK---GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPD 242
            +    Y YK F              SRT+DYRHH+ D+  G  +G   ++++YH Y+  
Sbjct: 203 NRESPQYVYKYFLAFSPLSLATYIALSRTQDYRHHFTDIVLGGAIGISFAWWSYHHYFNK 262

Query: 243 LHSKISDKP 251
           L S+ S KP
Sbjct: 263 LVSEESHKP 271



>gi|68486075|ref|XP_713054.1| hypothetical protein CaO19.8747 [Candida albicans SC5314]
 gi|68486144|ref|XP_713022.1| hypothetical protein CaO19.1155 [Candida albicans SC5314]
 gi|46434488|gb|EAK93896.1| hypothetical protein CaO19.1155 [Candida albicans SC5314]
 gi|46434526|gb|EAK93933.1| hypothetical protein CaO19.8747 [Candida albicans SC5314]
          Length = 284

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/249 (32%), Positives = 121/249 (48%), Gaps = 17/249 (6%)

Query: 19  DWVLCFIFLGIFFSVDQLE-PYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXX 77
           DW++  + +  FFSV +   P+ R FSL+D TI  PFA KERV   LC            
Sbjct: 24  DWIVATVTVLFFFSVAETALPFQRQFSLDDLTISHPFAIKERVSGILCIEIAAFVPLFVI 83

Query: 78  XXXAL---------AIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
               L         + ++++H    +             +T++ K  + RPRPDF++RC 
Sbjct: 84  LTSLLVKYQQGAFSSHQQALHCLQISVLGLIISLSLNGVITDILKIWIARPRPDFLERCG 143

Query: 129 PSAAFDPGLGLSNSTICTRT---DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P+    P   L +  +CT      LL DG KS  SGHSS SF G+ +L+L+L G+  +F 
Sbjct: 144 PAPG-TPLHELVDVNVCTAPLGKALLIDGMKSTPSGHSSISFGGLFYLTLWLLGQFKLFQ 202

Query: 186 QK---GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPD 242
            +    Y YK F              SRT+DYRHH+ D+  G  +G   ++++YH Y+  
Sbjct: 203 NRESPQYVYKYFLAFSPLSLATYIALSRTQDYRHHFTDIVLGGAIGISFAWWSYHHYFNK 262

Query: 243 LHSKISDKP 251
           L S+ S KP
Sbjct: 263 LVSEESHKP 271



>gi|449441718|ref|XP_004138629.1| PREDICTED: putative lipid phosphate phosphatase 3,
           chloroplastic-like [Cucumis sativus]
          Length = 381

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 117/233 (50%), Gaps = 4/233 (1%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           + + + +  DW +  + + I   ++   P++R    +    +++PF +   VP+W     
Sbjct: 76  VAVARIHMHDWFIFLLLVLIVAILNLTHPFYRYVGKDMMNDLKYPFKDNT-VPIWAVPLY 134

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                           ++ ++D HHA             +T+  KN VGRPRP+F  RC 
Sbjct: 135 AMLLPIAVFLFVYWR-RRDVYDLHHAILGLFYSVLITAVITDSIKNAVGRPRPNFFWRCF 193

Query: 129 PSAAFDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKG 188
           P    D    L N       D++K+G KSF SGH+S SFAG+GFLSLYL+GK+ VFDQ+G
Sbjct: 194 PDGK-DVYDKLGNVICHGDADVIKEGHKSFPSGHTSWSFAGLGFLSLYLSGKIKVFDQRG 252

Query: 189 YTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +  K                SR +DY HHW DVFAG L+G ++S F Y Q++P
Sbjct: 253 HIAKLCIVFLPLLFAALVGVSRVDDYWHHWQDVFAGGLIGLVISTFCYLQFFP 305



>gi|367039689|ref|XP_003650225.1| hypothetical protein THITE_2109490 [Thielavia terrestris NRRL 8126]
 gi|346997486|gb|AEO63889.1| hypothetical protein THITE_2109490 [Thielavia terrestris NRRL 8126]
          Length = 356

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 124/289 (42%), Gaps = 50/289 (17%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQL-EPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXX 72
           + YA D++   + L  +  V  L EP+HR+FS+ D  I FP+AE ERVP           
Sbjct: 26  RTYASDYIGFVVLLTAYLLVQFLVEPFHRMFSISDLRISFPYAEVERVPTSHSFIYSLFL 85

Query: 73  XXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAA 132
                    L  +   H  H A             +T+V KN  GRPRPD + RC P A 
Sbjct: 86  PLAVVLVTNLLTRAPAHKHHVAVLGLAISLVLTSLLTDVLKNAAGRPRPDLLARCAP-AP 144

Query: 133 FDPGLGLSNSTICTRTDL------LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
             P   L +   CT T        L DG++SF SGHSS +FAG+G+LSL+LAG+L VF +
Sbjct: 145 GTPRDALVSLAACTTTGTKDSRRRLHDGWRSFPSGHSSFAFAGLGYLSLFLAGQLRVFAR 204

Query: 187 ------------------------------------------KGYTYKGFXXXXXXXXXX 204
                                                     +G   +            
Sbjct: 205 VGGYDYDHDHDHDDGNDGLAGGEGPGISRRGSMAQQHAEHVVRGDLLRALVCLAPLLGAT 264

Query: 205 XXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFT 253
               SR +DYRH  +DV  G+++G+ ++Y++Y +Y+P L S   D P+ 
Sbjct: 265 MIAVSRCQDYRHDVYDVSVGAVLGWTVTYWSYRRYWPRLSSGRCDTPYA 313



>gi|19112260|ref|NP_595468.1| phosphatidic acid phosphatase (predicted) [Schizosaccharomyces
           pombe 972h-]
 gi|74638905|sp|Q9UUA6.1|DPP1_SCHPO RecName: Full=Probable diacylglycerol pyrophosphate phosphatase 1;
           Short=DGPP phosphatase; AltName: Full=Phosphatidate
           phosphatase
 gi|5731925|emb|CAB52620.1| phosphatidic acid phosphatase (predicted) [Schizosaccharomyces
           pombe]
          Length = 279

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/232 (35%), Positives = 113/232 (48%), Gaps = 5/232 (2%)

Query: 21  VLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXX 80
           VL  I L  F     + P+ R FSLED TI  PFA  E+VP                   
Sbjct: 20  VLIAISLSYFVFDVLMLPFTRQFSLEDITISHPFALHEQVPTKYLGIICVFFPALVLYGF 79

Query: 81  ALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLS 140
                 S+  W                V+ + KN VGRPRPDF+ RCQP  +  P  GL 
Sbjct: 80  GKLRNNSLLFWKSLMGLLYSTMVCGLCVS-LLKNAVGRPRPDFLARCQPFES-TPKTGLV 137

Query: 141 NSTICT---RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXX 197
           +   C+      +L+DGF+SF SGH+S SFAG+GFL+++LAG+L +F  K  ++K     
Sbjct: 138 DVLSCSVPWSDKVLQDGFRSFPSGHTSFSFAGLGFLAIFLAGQLKMFRNKTSSWKVVVPL 197

Query: 198 XXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISD 249
                      SR++DYRHH  D+  G+L GF ++Y  Y Q +P L    +D
Sbjct: 198 VPLSIASWIGLSRSQDYRHHKEDIAVGALFGFAIAYVVYRQLFPPLDHHNAD 249



>gi|365984939|ref|XP_003669302.1| hypothetical protein NDAI_0C03990 [Naumovozyma dairenensis CBS 421]
 gi|343768070|emb|CCD24059.1| hypothetical protein NDAI_0C03990 [Naumovozyma dairenensis CBS 421]
          Length = 309

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 115/238 (48%), Gaps = 5/238 (2%)

Query: 19  DWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXX 78
           D ++  IF+ I + V   EP+ R F L D TI  P+A  +RV   +              
Sbjct: 26  DVIVLLIFMIISYPVYYQEPFQRQFYLNDLTISHPYALNQRVSDTMLFVYTLVIPLIAIV 85

Query: 79  XXALAIKKSMHDW---HHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDP 135
              L +    H W   + +              T   KN +GR RPDF+DRCQP      
Sbjct: 86  IMTLILAHPHHRWFLLYISVLGLFLAWFATSLFTNFIKNWIGRLRPDFLDRCQPKPGLPV 145

Query: 136 GLGLSNSTICT--RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKG 193
            +  + S +CT    ++L DGF++  SGHSS SFAG+G+L L+  G+L   +++   ++ 
Sbjct: 146 DMLFTASEVCTTDNKEILLDGFRTTPSGHSSESFAGLGYLYLWTCGQLLTENKEMGYWRK 205

Query: 194 FXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
                          SRT+DYRHH+ DV  GS+ G++++YF Y + +P ++  I  KP
Sbjct: 206 LVALLPLLGASLIALSRTQDYRHHFVDVLLGSIFGYVVAYFNYRRNFPPINDPIPFKP 263



>gi|356530711|ref|XP_003533924.1| PREDICTED: lipid phosphate phosphatase 2-like [Glycine max]
          Length = 302

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXX 69
           ++ + +  DW++  + + I   ++ +EP+HR       + +++P  +   +P W      
Sbjct: 17  KVARTHMHDWLILLLLVIIDGILNVIEPFHRFVGEGMMSDLRYPLKDNT-IPFWAVPIVA 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                       L I+K ++D+HHA             +T+  K+ VGRPRPDF  RC P
Sbjct: 76  ILLPIAIILVYYL-IRKDVYDFHHAILGLLFSVLITAVITDAIKDGVGRPRPDFFWRCFP 134

Query: 130 SA--AFDPGLGLSNSTICT-RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
                FDP   ++ +  CT    ++K+G KSF SGH+S SFAG+GFL+ YL+GK+  FD+
Sbjct: 135 DGKGVFDP---VTRNVRCTGDKSVIKEGHKSFPSGHTSWSFAGLGFLAWYLSGKIKAFDR 191

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           +G+  K                SR +DY HHW DVF G L+G  +S F Y Q++P
Sbjct: 192 RGHVAKLCIVFFPLLVAAMIAVSRVDDYWHHWQDVFTGGLIGLTISSFCYLQFFP 246



>gi|359491469|ref|XP_002277246.2| PREDICTED: lipid phosphate phosphatase 2-like [Vitis vinifera]
          Length = 320

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 123/240 (51%), Gaps = 9/240 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKER-VPMWLCAXXX 69
           ++ + +  DW++  + + I   ++ +EP+HR F  E+  I   +  K+  VP+W      
Sbjct: 17  KVARIHMHDWLILILLIVIDVILNLIEPFHR-FVGEEMMIDLKYPMKDNTVPVWAVPIIA 75

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                          +++++D HHA+            +T+  K+ VGRPRP+F  RC P
Sbjct: 76  ILLPFAAILANYF-YRRNVYDLHHATLGLLYSVLITGVITDAIKDAVGRPRPNFFWRCFP 134

Query: 130 SAA--FDPGLGLSNSTIC-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ 186
           + A  FDP   L+ + IC     ++K+G KSF SGH+S  FAG+ FLS YL+GK+  FD+
Sbjct: 135 NGAALFDP---LTKNVICHGDKGVIKEGHKSFPSGHTSWCFAGLSFLSWYLSGKIRAFDR 191

Query: 187 KGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSK 246
           KG+  K                SR +DY HHW DVF G L+G  ++ F Y Q +P  H K
Sbjct: 192 KGHIAKLAIVLLPLLMAALVGVSRVDDYWHHWQDVFVGGLIGMTVASFCYLQCFPFPHVK 251



>gi|255718079|ref|XP_002555320.1| KLTH0G06490p [Lachancea thermotolerans]
 gi|238936704|emb|CAR24883.1| KLTH0G06490p [Lachancea thermotolerans CBS 6340]
          Length = 292

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 121/255 (47%), Gaps = 6/255 (2%)

Query: 4   MSEFSKIQILKAYAL-DWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPM 62
           M   S+  +L+ + + D +LC +F  I   +   +P+ R F + D T+  P A  +RV  
Sbjct: 10  MERVSRYAVLRKWKISDALLCVLFFLINIPIYHADPFQRQFYVNDPTLSHPHATTQRVNE 69

Query: 63  WLCAXXXXXXXXXXXXXXALAIKKSMHD---WHHASXXXXXXXXXXXXVTEVFKNTVGRP 119
                              L I    H     + +             +T+  KN +GRP
Sbjct: 70  NALLAYSLALPAIVIIVVTLLIADPKHKVYLLYVSLLGLILSWTFTSLLTDYLKNWIGRP 129

Query: 120 RPDFIDRCQPSAAFDPGLGLSNSTICTRTDL--LKDGFKSFLSGHSSTSFAGMGFLSLYL 177
           RPDFI RC+P         ++ + +C   +L  L DGF+S  SGHSS SFAG+G+L L+L
Sbjct: 130 RPDFIARCKPKKGTPLDTLVTAADVCMTKNLPRLMDGFRSTPSGHSSESFAGLGYLYLWL 189

Query: 178 AGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYH 237
           +G+L   + K   ++                SRTEDYRHH+ DV  GSL+G +++Y  Y 
Sbjct: 190 SGQLLTENPKVGYWRSIVAYGPLIGAATIAISRTEDYRHHFVDVLLGSLIGLVIAYKTYF 249

Query: 238 QYYPDLHSKISDKPF 252
           + +P L S+I  KP 
Sbjct: 250 RNFPALSSEIPFKPL 264



>gi|388513345|gb|AFK44734.1| unknown [Medicago truncatula]
          Length = 372

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 120/234 (51%), Gaps = 10/234 (4%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXX 70
           + K +  DW++  + + I   +  + P++R    +  + +++P  +   VP+W       
Sbjct: 65  VAKTHLHDWIILLLLVFIEIMLYLIYPFYRFVGKDMMSDLKYPL-KSNTVPVWAVPMLAV 123

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS 130
                      +  ++ ++D HHA             +T+  K+ VGRPRPDF  RC P 
Sbjct: 124 VLPIVIFLVVYIR-RRDIYDLHHAVLGLLFSILVTAVITDAIKDAVGRPRPDFFWRCFPD 182

Query: 131 A--AFDPGLGLSNSTICTRTD-LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQK 187
               +D  LG     IC   + ++K+G KSF SGH+S SFAG+GFLSLYLAGKL  FD+K
Sbjct: 183 GKDVYDK-LG---DVICHGDESVIKEGHKSFPSGHTSWSFAGLGFLSLYLAGKLKAFDRK 238

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           G+  K                SR +DY HHW DVFAG L+G +++ F Y Q++P
Sbjct: 239 GHVAKLCIIFLPLLAASLVGISRVDDYWHHWTDVFAGGLIGLVVATFCYLQFFP 292



>gi|116203059|ref|XP_001227341.1| hypothetical protein CHGG_09414 [Chaetomium globosum CBS 148.51]
 gi|88177932|gb|EAQ85400.1| hypothetical protein CHGG_09414 [Chaetomium globosum CBS 148.51]
          Length = 339

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 111/233 (47%), Gaps = 17/233 (7%)

Query: 36  LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHAS 95
           +EP+HR+FSL D  I FP AE ERVP+                          H  H   
Sbjct: 67  VEPFHRMFSLNDLRIAFPHAEVERVPLLHDFIYALFIPLGLVTLTNFLTHAPRHKHHVTL 126

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKD 153
                       +T++ KN VGRPRPD + RC P A   P   L    +CT+T    L D
Sbjct: 127 LGLAISLILASLLTDIIKNAVGRPRPDLLARCLP-APNTPRDELVTIAVCTQTHHHTLHD 185

Query: 154 GFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ--------------KGYTYKGFXXXXX 199
           G++SF SGHSS +FAG+G+L+L+LAG++ +F                +G   +       
Sbjct: 186 GWRSFPSGHSSFAFAGLGYLALFLAGQMRIFAHAAPGSVGDHAQKLVRGDLVRALVCGAP 245

Query: 200 XXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
                    SR +DYRH  +DV  G L+G+ + Y++Y +Y+P L S   ++P+
Sbjct: 246 LLGATMIAISRCQDYRHDVYDVGVGGLLGYTVGYWSYRRYWPRLSSGRCEEPY 298



>gi|485928963|gb|EOD52517.1| putative mfs multidrug protein [Neofusicoccum parvum UCRNP2]
          Length = 856

 Score =  130 bits (328), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 114/222 (51%), Gaps = 3/222 (1%)

Query: 36  LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHAS 95
           +EP+HR+FSL++  IQFP AE ERV +                  AL  +   H  H   
Sbjct: 51  VEPFHRMFSLDNLAIQFPHAEIERVSVGWLFIYAGGIPLAILILWALIFRPGGHKAHITI 110

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKD 153
                       +T+V KN VGRPRPD + RC+P     P   L    ICT TD   L D
Sbjct: 111 LGFFISLILTSFITDVVKNAVGRPRPDLLARCKPEKG-TPAHRLVTFEICTETDHHTLHD 169

Query: 154 GFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTED 213
           G++SF SGHSS SF+G+G+LSL++AG+ HVF  +    +                SR ED
Sbjct: 170 GWRSFPSGHSSFSFSGLGYLSLFIAGQCHVFRPRTDLGRVLLALAPLLTAVLIAISRCED 229

Query: 214 YRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFTIR 255
           YRH  +DV  GS +G  +++F Y +YYP L SK  D P+  R
Sbjct: 230 YRHDVYDVTVGSTLGMAVAWFTYRRYYPTLRSKRCDTPYPSR 271



>gi|448086685|ref|XP_004196160.1| Piso0_005607 [Millerozyma farinosa CBS 7064]
 gi|359377582|emb|CCE85965.1| Piso0_005607 [Millerozyma farinosa CBS 7064]
          Length = 271

 Score =  130 bits (328), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 123/263 (46%), Gaps = 20/263 (7%)

Query: 16  YALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXX 75
           Y LD ++    + +F  V+ LEP++R FSL D  IQ  F++ ERV   LC          
Sbjct: 12  YQLDLLVGVALVFVFLVVEMLEPFYRDFSLSDPAIQHEFSKHERVSANLCLSIISMVPSA 71

Query: 76  XXXXXALAIKKSMHDWHHASXXX-----------XXXXXXXXXVTEVFKNTVGRPRPDFI 124
                 +A ++    W  +                        + ++ K+ +GRPRPDF+
Sbjct: 72  VIVMVVVATRR----WKRSKTQQLQLLTVSLLGLMLTTTIAGVLIDILKSWIGRPRPDFL 127

Query: 125 DRCQPSAAFDPGLGLSNSTICTRT---DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKL 181
            RC P  +  P +GL +  +CT       L DG +S  SGHS  SF+ + +L+L+L G+ 
Sbjct: 128 QRCGPKKS-TPVIGLVSIDVCTAPLGKRALIDGMRSMPSGHSGLSFSSLFYLTLWLGGQF 186

Query: 182 HVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
            +F +    YK                SRT+DYRHH+ D+  G  +G +LS   YH+Y+P
Sbjct: 187 KIFHRSQPLYKSLIAALPTIGACYVALSRTQDYRHHFSDIVVGGFIGVILSVVTYHRYFP 246

Query: 242 DLHSKISDKPFTIRLK-KVVPEY 263
            L    S+KP  +  +  V+P Y
Sbjct: 247 VLWDTDSNKPIEVESESSVLPMY 269



>gi|494825341|gb|EON62527.1| hypothetical protein W97_01750 [Coniosporium apollinis CBS 100218]
          Length = 514

 Score =  130 bits (327), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 132/273 (48%), Gaps = 34/273 (12%)

Query: 1   KKKMSEFSKIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERV 60
           KKK+ +    +++ +Y LD+V+  + + +F  +D++  + + F+L++ T+Q+P+A  ERV
Sbjct: 17  KKKLPK----KVIFSYILDYVIIVVLIVVFTIIDKIPGFMQPFALQNYTLQYPYAVHERV 72

Query: 61  PMWLCAXXXXXXXXXXXXXXALAI-------------------------KKSMHDWHHAS 95
            +                   + I                         K  + + +   
Sbjct: 73  SVLALCVLVVFVPAVIIALYTMVIDGLFSHQPPSAPTGKRRILTGRYRMKDRLWELNCGI 132

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP-SAAFDP-GLGLSNSTICTR---TDL 150
                       +T   KN +G+PRPD I RC P   A DP   GLSN TIC     T  
Sbjct: 133 LGLALSVGAAFTITGALKNAIGKPRPDLISRCNPRPGALDPVPFGLSNYTICLTPLDTYA 192

Query: 151 LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSR 210
           +KDGF+SF SGHSS SFAG+ +LS+YLA KLHV D KG  +K F              +R
Sbjct: 193 MKDGFRSFPSGHSSVSFAGLFYLSIYLAAKLHVLDSKGEVWKTFIILVPTLAAALISGTR 252

Query: 211 TEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDL 243
             D RHH  DV +G+ +G L+++ +Y QY+P +
Sbjct: 253 IMDARHHPFDVLSGAALGMLVAWGSYRQYFPPV 285



>gi|213405583|ref|XP_002173563.1| phosphatidic acid phosphatase type 2 domain-containing protein 1B
           [Schizosaccharomyces japonicus yFS275]
 gi|212001610|gb|EEB07270.1| phosphatidic acid phosphatase type 2 domain-containing protein 1B
           [Schizosaccharomyces japonicus yFS275]
          Length = 272

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 121/247 (48%), Gaps = 7/247 (2%)

Query: 7   FSKIQILKAYALDWVLCFIFLGIFFSVD-QLEPYHRLFSLEDKTIQFPFAEKERVPMWLC 65
            S+I +   Y ++W+   +   ++F +D  L P+ R F++ D  I  P+AE E++P    
Sbjct: 1   MSRIPVFFRY-IEWICLLVVCVLYFVLDFTLRPFERQFAVSDLNISHPYAEHEQIPTEYL 59

Query: 66  AXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFID 125
                          A A K+S      AS            +  + KN VGRPRPDF+D
Sbjct: 60  GIIGILGPIVVIFCVA-AWKRSPVLARQASLGLLYSTMLTGLLVTLTKNAVGRPRPDFLD 118

Query: 126 RCQPSAAFDPGLGLSNSTICT---RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLH 182
           RC+P ++  P   L    ICT   +   L DG +SF SGH+S SF+G+G+L+L+LA +L 
Sbjct: 119 RCKPLSS-APTNKLVTVAICTTDQKNKRLLDGMRSFPSGHTSFSFSGLGYLALFLAAQLK 177

Query: 183 VFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPD 242
           +  +    +K                +R++DYRHH  D+  G L G L+++  Y QY+P 
Sbjct: 178 LNSRFSAGWKFVIPVIPLALAGWVGLTRSQDYRHHKEDIVVGGLFGMLMAFAVYRQYFPS 237

Query: 243 LHSKISD 249
           +    SD
Sbjct: 238 IGKTDSD 244



>gi|353249916|ref|NP_001085524.2| phosphatidate phosphatase PPAPDC1B [Xenopus laevis]
          Length = 266

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 75/245 (30%), Positives = 114/245 (46%), Gaps = 8/245 (3%)

Query: 11  QILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTI-QFPFAEKERVPMWLCAXXX 69
           +IL+ +A ++++  +  GIF   + + P+ R+   E+  + + P+   +R+P        
Sbjct: 4   RILEGFAAEFIIRLLLFGIFLISETMHPFERVIQPEEMWLYRNPYVVSDRIPTNSMFLIS 63

Query: 70  XXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQP 129
                       L  K    D   A              T   K  VGRPRPDF+ RC P
Sbjct: 64  FLTPLSVVALARLFWKADGTDSREAGLAASLSLALNGIFTNTVKLIVGRPRPDFLFRCFP 123

Query: 130 SAAFDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQ--K 187
                PGL  +        +L+ +G KSF SGHSS +FAG+GF +LYLAGKL  F    +
Sbjct: 124 DGQESPGLHCTGDP-----ELVIEGRKSFPSGHSSFAFAGLGFTALYLAGKLRCFSPCGR 178

Query: 188 GYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKI 247
           G++++                SRT DY+HHW DV  G+ +G   ++  Y QYYP L  + 
Sbjct: 179 GHSWRLCASLIPLLCAIAIALSRTCDYKHHWQDVVVGAFIGLFFAFLCYRQYYPSLVERD 238

Query: 248 SDKPF 252
             +P+
Sbjct: 239 CHQPY 243



>gi|146414978|ref|XP_001483459.1| hypothetical protein PGUG_04188 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 283

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 82/250 (32%), Positives = 123/250 (49%), Gaps = 11/250 (4%)

Query: 14  KAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXX 73
           +A   D  L  + + +FF    +EP+ R FSL+D TI  PFAE ERV             
Sbjct: 26  RAKVADLGLVAVLIVLFFFTGSIEPFQRQFSLDDLTISHPFAEHERVTN---HELFVYCL 82

Query: 74  XXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXV------TEVFKNTVGRPRPDFIDRC 127
                   +A+  S      AS            V      T++ KN  GR RPDF+ RC
Sbjct: 83  LVPFVMICVALIVSARRGSRASVTYISLLGLIIAVFLTSVATDILKNFFGRLRPDFLARC 142

Query: 128 QPSAAFDPGLGLSNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           +P+A     + +    +CT  +   L DGF++  SGHSS SFAG+G+LSL+L+G+L V  
Sbjct: 143 EPAAGTPTDILVLAKDVCTTKNKGRLLDGFRTTPSGHSSLSFAGLGYLSLWLSGQLVVAS 202

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHS 245
               +++                SRT DYRHH+ DV  GS++G ++S+  Y  Y+P +  
Sbjct: 203 PNVGSWRIVVAWVPAFGAALIALSRTMDYRHHFVDVTLGSILGMVISFVIYRHYFPGIAH 262

Query: 246 KISDKPFTIR 255
           + S +P+T++
Sbjct: 263 EKSYEPWTVQ 272



>gi|317145537|ref|XP_001820873.2| PAP2 domain protein [Aspergillus oryzae RIB40]
          Length = 321

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 84/235 (35%), Positives = 122/235 (51%), Gaps = 12/235 (5%)

Query: 20  WVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXX 79
           W+L  +F+          P+HRLFSL++K IQ+PFA  ERVP+                 
Sbjct: 46  WILIQLFV---------TPFHRLFSLDNKAIQYPFAVVERVPVVWSIIYAGVIPFVIVLL 96

Query: 80  XALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGL 139
            A   +   +                  +T++ KN VGRPRPD I RC P     P   L
Sbjct: 97  WAATFRPKPYKVQVTILGFLVALMLTSLLTDIIKNAVGRPRPDLISRCIPKRG-TPENKL 155

Query: 140 SNSTICTRTD--LLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXX 197
              T+CT+T   +L++G++SF SGHSS SF+G+G+LS +L+G++HVF  +    +     
Sbjct: 156 VAWTVCTQTSQHVLQEGWRSFPSGHSSFSFSGLGYLSFFLSGQMHVFRPRTDLCRCLVAL 215

Query: 198 XXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPF 252
                      SR +DYRH  +DV  GS++G ++SYF+Y +YYP L S I D P+
Sbjct: 216 VPFLCALMIAISRLDDYRHDVYDVTCGSILGTVVSYFSYRRYYPSLRSVICDMPY 270



>gi|168052537|ref|XP_001778706.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669921|gb|EDQ56499.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 301

 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 112/230 (48%), Gaps = 23/230 (10%)

Query: 85  KKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTI 144
           ++S+ D HHA             VT+  K  +GRPRP F  RC  S           + I
Sbjct: 88  RRSVRDLHHAFLGLLTTVALTALVTDAIKIGIGRPRPHFYARCFGSTTAIAQYDNIGNVI 147

Query: 145 C-TRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXX 203
           C T   L+K+ +KSF SGH+S SFAG+G+LS+YLAGKL VFD  G+++K F         
Sbjct: 148 CRTPPALMKEAYKSFPSGHTSWSFAGLGYLSMYLAGKLGVFDHGGHSWKLFPVVLPVLGA 207

Query: 204 XXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKPFTIRLKKVVPEY 263
                +R +DY HHW DV  G+ +G L +YF Y Q++P L       P+  R + V  + 
Sbjct: 208 TFVAITRVDDYWHHWTDVCTGAAIGLLSAYFCYRQHFPSLFDDAPSIPYAHRPRAVSSQ- 266

Query: 264 KAEFSFMDGSEVEITVVKNDEQLLLKDSRALLADSS---SNNTEGGSADI 310
                             +  Q   + S+AL  DSS   +N+ E GS+ I
Sbjct: 267 ------------------SSSQTNARQSQALDRDSSKEMTNDLERGSSQI 298



>gi|384096918|gb|AFH66947.1| prenyl diphosphate phosphatase [Croton stellatopilosus]
          Length = 295

 Score =  129 bits (325), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 111/224 (49%), Gaps = 4/224 (1%)

Query: 19  DWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXXXXXXXXX 77
           DW++  + + I   +  + P+ R    +  T +++P  +   VP+W              
Sbjct: 3   DWLIFLLLVVIEVILYVIHPFKRYAGKDMMTDLRYPL-QSNTVPVWAVPMYAILLPMLVF 61

Query: 78  XXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGL 137
                  ++ ++D HHA             +T+  KN VGRPRPDF  RC P    D   
Sbjct: 62  LVVYFR-RRDIYDLHHAILGLFYSVLVTAVITDSIKNAVGRPRPDFFWRCFPDGK-DVYD 119

Query: 138 GLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXX 197
            L N       +++K+G KSF SGH+S SFAG+GFLSLYL+GKL  FD++G+  K     
Sbjct: 120 QLGNVICHGDKNVIKEGHKSFPSGHTSWSFAGLGFLSLYLSGKLKAFDRRGHVAKLCIIF 179

Query: 198 XXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
                      SR +DY HHW DVFAG L+G  +S F Y Q++P
Sbjct: 180 LPLLVACLVGISRVDDYWHHWQDVFAGGLLGLTVSTFCYLQFFP 223



>gi|502120646|ref|XP_004497034.1| PREDICTED: lipid phosphate phosphatase 2-like isoform X2 [Cicer
           arietinum]
          Length = 323

 Score =  129 bits (325), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 122/236 (51%), Gaps = 9/236 (3%)

Query: 10  IQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXX 68
           +++ + +  DW++  + + I   ++ +EP+HR   +   T + +P  +   +P W     
Sbjct: 16  VRVARIHMHDWLILLLLVLIDAVLNIIEPFHRFVGVGMLTDLSYPLKDNT-IPFWAVPII 74

Query: 69  XXXXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQ 128
                          I+K ++D+HHA             +T+  K+ VGRPRPDF  RC 
Sbjct: 75  AILLPLAVFLVYYF-IRKDVYDFHHAILGLLFSVLITAVITDAIKDGVGRPRPDFFWRCF 133

Query: 129 PSA--AFDPGLGLSNSTICT-RTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFD 185
           P      DP   +++   CT    ++K+G KSF SGH+S SFAG+ FLS YL+GK+ VFD
Sbjct: 134 PDGKQVSDP---VTSDVQCTGDKSVIKEGHKSFPSGHTSWSFAGLVFLSWYLSGKVRVFD 190

Query: 186 QKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
           ++G+  K                SR +DY HHW DVFAG L+G ++S F Y Q++P
Sbjct: 191 RRGHVAKLCLVLLPVLTAAMIGVSRVDDYWHHWQDVFAGGLIGTVISSFCYLQFFP 246



>gi|325088142|gb|EGC41452.1| PAP2 domain-containing protein [Ajellomyces capsulatus H88]
          Length = 437

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 89/308 (28%), Positives = 137/308 (44%), Gaps = 34/308 (11%)

Query: 9   KIQILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXX 68
           +I+I+ +Y  D+V+    +  F+ +D++EP+H+ F++ + ++ +P+AE +RV + L    
Sbjct: 14  RIRIIISYIFDYVILIALMVGFYILDRVEPFHQPFAINNISLFYPYAEHDRVSVPLALAL 73

Query: 69  XXXXXXXXXXXXALAI------------------------KKSMHDWHHASXXXXXXXXX 104
                        + I                        K  + +++            
Sbjct: 74  SGGFPLLVIFIYTIVIDGLFSHNKPVTSSGKRKFTGPYSLKDRLWEFNCGFLGLFLAQAS 133

Query: 105 XXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGL-GLSNSTICTRT---DLLKDGFKSFLS 160
              +T   KN VG+PRPD IDRC+P      G   L    +C      D+LKDGF+SF  
Sbjct: 134 AFVITGALKNAVGKPRPDIIDRCRPKGVDSLGPHELVTFDMCDSKLSHDILKDGFRSF-- 191

Query: 161 GHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHD 220
              S SFAG+ +LSLYLAGK H+ D +G  +K F              +R  D RHH  D
Sbjct: 192 --PSASFAGLFYLSLYLAGKFHLLDSRGEVWKTFLSLFPTLGAGLIAATRIMDARHHPFD 249

Query: 221 VFAGSLVGFLLSYFAYHQYYPDLHSK-ISDKPFTIRLKKVVPEYKAEFSF-MDGSEVEIT 278
           V  GSL+G L  Y AY QY+P L       + + IR     P   +   F M GS   + 
Sbjct: 250 VLFGSLLGILCGYVAYRQYFPPLSEPWRKGRAYPIRTWGTGPTAPSRSRFDMGGSNDSVA 309

Query: 279 VVKNDEQL 286
            ++  + L
Sbjct: 310 PLRRADDL 317



>gi|357480765|ref|XP_003610668.1| Lipid phosphate phosphatase [Medicago truncatula]
 gi|355512003|gb|AES93626.1| Lipid phosphate phosphatase [Medicago truncatula]
          Length = 324

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 118/232 (50%), Gaps = 6/232 (2%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKER-VPMWLCAXXXX 70
           + K +  DW++  + + I   ++ + P+ R F  ED      +  K   VP+W       
Sbjct: 19  VAKTHLYDWIILLLLVLIDIGLNMIYPFFR-FVGEDMMFDLKYPLKSNTVPVWSVPILAV 77

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS 130
                      +  ++ ++D HHA             +T+  K+ VGRPRP+F+ RC P 
Sbjct: 78  VLPMVIFLVVYIR-RRDIYDLHHAVLGLLFSILVTTVITDAIKDAVGRPRPNFLWRCFPD 136

Query: 131 AAFDPGLGLSNSTICTRTDL-LKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGY 189
                  G   + IC    L +K+G+KSF SGH+S SFAG+GFLSLYL+GKL  FD+KG+
Sbjct: 137 G--KDVYGEWGNVICNGDKLVIKEGYKSFPSGHTSWSFAGLGFLSLYLSGKLKAFDRKGH 194

Query: 190 TYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
             K                SR +DY HHW DVFAGSL+G +++ F Y Q++P
Sbjct: 195 VAKLCIIFLPLFAASLVGISRVDDYWHHWTDVFAGSLIGIVVATFCYLQFFP 246



>gi|296087241|emb|CBI33615.3| unnamed protein product [Vitis vinifera]
          Length = 365

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 88/304 (28%), Positives = 140/304 (46%), Gaps = 17/304 (5%)

Query: 12  ILKAYALDWVLCFIFLGIFFSVDQLEPYHRLFSLEDKT-IQFPFAEKERVPMWLCAXXXX 70
           + + +  DW++  + L +   ++ + P++R    +    +++PF +   VP+W       
Sbjct: 70  VARTHMHDWLILILLLVMVIVLNAIHPFYRFVGKDMMVDLKYPF-KNNTVPIWAVPLYSV 128

Query: 71  XXXXXXXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS 130
                         ++ ++D HHA             +T+  KN VGRPRPDF  RC P 
Sbjct: 129 LLPITIFLIIYFR-RRDVYDLHHAILGLLFSVLVTVVITDAIKNAVGRPRPDFFWRCFPD 187

Query: 131 AAFDPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYT 190
              D      N       D +KDG KSF SGH++ SF+G+GFLSLYL+GK+  FD +G+ 
Sbjct: 188 GK-DVYDRWGNVICHGEKDTIKDGHKSFPSGHTAWSFSGLGFLSLYLSGKIRAFDNRGHV 246

Query: 191 YKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDK 250
            K                SR +DYRHHW DVFAG L+G +++ F Y  ++P  +      
Sbjct: 247 AKLCIVFLPLLVATLVGISRVDDYRHHWQDVFAGGLLGLVVATFFYLHFFPPPYHAEGWG 306

Query: 251 PFTIRLKKVVPEYKAEFSFMDGSEVEITVVKNDEQLLLKDSR--------ALLADSSSNN 302
           P+     + + E +A+    +   V+    + + Q   +D R        +L  DSSS  
Sbjct: 307 PYA--YFRTLEESRAQTQAANAVNVQDVEAQVENQ---QDERNRNTFTGLSLAHDSSSRQ 361

Query: 303 TEGG 306
            E G
Sbjct: 362 EENG 365



>gi|363750550|ref|XP_003645492.1| hypothetical protein Ecym_3174 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356889126|gb|AET38675.1| Hypothetical protein Ecym_3174 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 294

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 124/252 (49%), Gaps = 7/252 (2%)

Query: 7   FSKIQILKAYAL-DWVLCFIFLGIFFSVDQLEPYHRLFSLEDKTIQFPFAEKERVPMWLC 65
           F+K  +LK + + D +LC I  G+   +   +P+ R F++ D TI  P+AE +RV  W  
Sbjct: 13  FAKYGVLKKWRVTDVILCLILFGVNIPIYLAKPFQRQFTVNDLTILHPYAEHQRVGDWEL 72

Query: 66  AXXXXXXXXXXXXXXALAIKKSMHDWHHASXXXX---XXXXXXXXVTEVFKNTVGRPRPD 122
                          +L +  S H ++                  +T   KN +GR RPD
Sbjct: 73  IAYSFVIPFGVILLLSLVLSDSRHRFYIMYISLLGLFLSYLSNMLITNYLKNWIGRCRPD 132

Query: 123 FIDRCQPSAAFDPGLGLSNSTICTRT--DLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGK 180
           FI RCQP       + L  + +CT    D L DGF++  SGHSS SFAG+G+L L+L+G+
Sbjct: 133 FIARCQPREGLQNDV-LYTADVCTTANEDRLMDGFRTTPSGHSSQSFAGLGYLFLWLSGQ 191

Query: 181 LHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYY 240
           L        +++                SRT+DYRHH+ DV  GSL+G   +++AY + +
Sbjct: 192 LLTEKPLVGSWRKAVAFIPVMGAAIIALSRTQDYRHHFVDVILGSLLGMWFAWWAYRRNF 251

Query: 241 PDLHSKISDKPF 252
           P + S++  KP 
Sbjct: 252 PPIDSRVPFKPL 263



>gi|502120649|ref|XP_004497035.1| PREDICTED: putative lipid phosphate phosphatase 3,
           chloroplastic-like isoform X1 [Cicer arietinum]
 gi|502120653|ref|XP_004497036.1| PREDICTED: putative lipid phosphate phosphatase 3,
           chloroplastic-like isoform X2 [Cicer arietinum]
          Length = 336

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 114/228 (50%), Gaps = 12/228 (5%)

Query: 19  DWVLCFIFLGIFFSVDQLEPYHRLFS---LEDKTIQFPFAEKERVPMWLCAXXXXXXXXX 75
           DW++  + + I   ++ + P+HR      +ED  +++P  +   VP W            
Sbjct: 43  DWLILVLLMVIEVVLNIIHPFHRFVGRDMMED--LKYPM-KGNTVPAWSVPLYAVLLPIT 99

Query: 76  XXXXXALAIKKSMHDWHHASXXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPS--AAF 133
                 L  ++ ++D HH+             +T+  K+ VGRPRPDF  RC P   A +
Sbjct: 100 VFICFYLR-RRDVYDLHHSVLGLLFAVLITGVLTDSIKDAVGRPRPDFFWRCFPDGVAVY 158

Query: 134 DPGLGLSNSTICTRTDLLKDGFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKG 193
           D    L           +K+G KSF SGH+S SFAG+GFLSLYL GK+ VFD+KG+  K 
Sbjct: 159 DK---LGGVVCHGEASDIKEGHKSFPSGHTSWSFAGLGFLSLYLCGKIKVFDRKGHIAKL 215

Query: 194 FXXXXXXXXXXXXXXSRTEDYRHHWHDVFAGSLVGFLLSYFAYHQYYP 241
                          SR +DY HHW DVFAG L+G +++ F Y Q++P
Sbjct: 216 CIVFFPLLLACLVGISRVDDYWHHWQDVFAGGLLGLVVATFCYSQFFP 263



>gi|70992087|ref|XP_750892.1| PAP2 domain protein [Aspergillus fumigatus Af293]
 gi|66848525|gb|EAL88854.1| PAP2 domain protein [Aspergillus fumigatus Af293]
 gi|159124460|gb|EDP49578.1| PAP2 domain protein [Aspergillus fumigatus A1163]
          Length = 293

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 109/218 (50%), Gaps = 15/218 (6%)

Query: 36  LEPYHRLFSLEDKTIQFPFAEKERVPMWLCAXXXXXXXXXXXXXXALAIKKSMHDWHHAS 95
           ++P+HR+FSL++++IQ+PFA  ERVP+                  A   +   +      
Sbjct: 30  VDPFHRMFSLDNRSIQYPFAVVERVPVVWSIIYAGVVPLLILVCWAAIFRPKPYQVQVTI 89

Query: 96  XXXXXXXXXXXXVTEVFKNTVGRPRPDFIDRCQPSAAFDPGLGLSNSTICTRTD--LLKD 153
                       +T++ KN VGRPRPD I RC P     P   L   T+CT+++  +L++
Sbjct: 90  LGLLVALMLTSLITDIIKNAVGRPRPDLISRCMPKKG-TPANTLVAWTVCTQSNNHILQE 148

Query: 154 GFKSFLSGHSSTSFAGMGFLSLYLAGKLHVFDQKGYTYKGFXXXXXXXXXXXXXXSRTED 213
           G++SF SGHSS +F G+G+LS+               ++                SR ED
Sbjct: 149 GWRSFPSGHSSFAFGGLGYLSI------------ADLWRCILALIPMLCALMIAISRLED 196

Query: 214 YRHHWHDVFAGSLVGFLLSYFAYHQYYPDLHSKISDKP 251
           YRH  +DV  GS++G ++++F+Y +YYP L S   D P
Sbjct: 197 YRHDVYDVTCGSILGLIIAHFSYRRYYPPLRSVACDVP 234