BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10283_c0_seq2-m.105 complete 77-1009(+) 311 (+)
         (310 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|330841406|ref|XP_003292689.1| hypothetical protein DICPUDRAFT...   127   5e-27   Dictyostelium purpureum
gi|410955477|ref|XP_003984379.1| PREDICTED: interferon-induced, ...   125   1e-26   Felis catus [cat]
gi|219689078|ref|NP_001137272.1| interferon-induced, double-stra...   124   2e-26   Equus caballus [domestic horse]
gi|398391991|ref|XP_003849455.1| hypothetical protein MYCGRDRAFT...   124   2e-26   Zymoseptoria tritici IPO323
gi|301758056|ref|XP_002914888.1| PREDICTED: interferon-induced, ...   124   3e-26   
gi|302817708|ref|XP_002990529.1| hypothetical protein SELMODRAFT...   121   2e-25   Selaginella moellendorffii
gi|302817836|ref|XP_002990593.1| hypothetical protein SELMODRAFT...   121   2e-25   Selaginella moellendorffii
gi|511891810|ref|XP_004765593.1| PREDICTED: interferon-induced, ...   121   2e-25   
gi|511990376|ref|XP_004812890.1| PREDICTED: interferon-induced, ...   121   2e-25   
gi|507480551|gb|AGM48640.1| double stranded RNA-dependent protei...   121   2e-25   Pteropus alecto
gi|208690905|gb|ACI31228.1| eukaryotic translation initiation fa...   120   5e-25   Hylobates alibarbis
gi|47523704|ref|NP_999484.1| double stranded RNA-dependent prote...   119   7e-25   Sus scrofa [pigs]
gi|208690879|gb|ACI31215.1| eukaryotic translation initiation fa...   119   8e-25   Nomascus leucogenys [White-cheeked Gibbon]
gi|472381348|ref|XP_004410070.1| PREDICTED: interferon-induced, ...   119   8e-25   Odobenus rosmarus divergens
gi|208690907|gb|ACI31229.1| eukaryotic translation initiation fa...   119   9e-25   Symphalangus syndactylus
gi|488549239|ref|XP_004466096.1| PREDICTED: interferon-induced, ...   118   2e-24   
gi|384495653|gb|EIE86144.1| hypothetical protein RO3G_10855 [Rhi...   117   3e-24   Rhizopus delemar RA 99-880
gi|114326369|ref|NP_001041600.1| interferon-induced, double-stra...   117   5e-24   Canis lupus familiaris [dogs]
gi|9506993|ref|NP_062208.1| interferon-induced, double-stranded ...   116   6e-24   Rattus norvegicus [brown rat]
gi|149050635|gb|EDM02808.1| rCG61784 [Rattus norvegicus]              116   6e-24   Rattus norvegicus [brown rat]
gi|6467479|gb|AAF13156.1| double stranded RNA activated protein ...   116   7e-24   Homo sapiens [man]
gi|60812550|gb|AAX36216.1| protein kinase interferon-inducible d...   116   7e-24   synthetic construct
gi|61364980|gb|AAX42635.1| protein kinase interferon-inducible d...   116   8e-24   synthetic construct
gi|219520292|gb|AAI43231.1| EIF2AK2 protein [Homo sapiens]            116   8e-24   Homo sapiens [man]
gi|60824577|gb|AAX36685.1| protein kinase interferon-inducible d...   116   8e-24   synthetic construct
gi|4506103|ref|NP_002750.1| interferon-induced, double-stranded ...   116   8e-24   Homo sapiens [man]
gi|27371006|gb|AAH40851.1| EIF2AK2 protein, partial [Homo sapien...   116   8e-24   Homo sapiens [man]
gi|126722609|ref|NP_001075682.1| interferon-induced, double-stra...   115   1e-23   Oryctolagus cuniculus [European rabbit]
gi|395846101|ref|XP_003795753.1| PREDICTED: interferon-induced, ...   115   2e-23   
gi|344288852|ref|XP_003416160.1| PREDICTED: interferon-induced, ...   115   2e-23   
gi|440900896|gb|ELR51925.1| Interferon-induced, double-stranded ...   114   2e-23   Bos mutus
gi|78101184|pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Am...   114   3e-23   Homo sapiens [man]
gi|208690881|gb|ACI31216.1| eukaryotic translation initiation fa...   114   3e-23   Gorilla gorilla [gorilla]
gi|55730356|emb|CAH91900.1| hypothetical protein [Pongo abelii]       114   4e-23   Pongo abelii [Orang-utan]
gi|208690883|gb|ACI31217.1| eukaryotic translation initiation fa...   114   4e-23   Pongo pygmaeus pygmaeus
gi|321462490|gb|EFX73513.1| hypothetical protein DAPPUDRAFT_2005...   114   4e-23   Daphnia pulex
gi|281341947|gb|EFB17531.1| hypothetical protein PANDA_002815 [A...   114   4e-23   Ailuropoda melanoleuca
gi|411024135|pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Ki...   114   4e-23   Homo sapiens [man]
gi|222537768|ref|NP_001138509.1| interferon-induced, double-stra...   114   5e-23   Pan troglodytes
gi|400260985|pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bo...   113   6e-23   Homo sapiens [man]
gi|426335299|ref|XP_004029165.1| PREDICTED: interferon-induced, ...   113   7e-23   
gi|348574347|ref|XP_003472952.1| PREDICTED: interferon-induced, ...   113   8e-23   
gi|507630811|ref|XP_004627776.1| PREDICTED: interferon-induced, ...   112   1e-22   
gi|117935051|ref|NP_835210.2| interferon-induced, double-strande...   112   1e-22   Bos taurus [bovine]
gi|45383189|ref|NP_989818.1| interferon-induced, double-stranded...   112   1e-22   Gallus gallus [bantam]
gi|444723303|gb|ELW63961.1| Interferon-induced, double-stranded ...   112   1e-22   Tupaia chinensis
gi|471358158|ref|XP_004369663.1| PREDICTED: interferon-induced, ...   112   2e-22   
gi|221236967|gb|ACM16036.1| eukaryotic translation initiation fa...   111   2e-22   Aotus trivirgatus [night monkey]
gi|354990646|gb|AER45377.1| double-stranded RNA activated kinase...   111   3e-22   Takifugu rubripes rubripes
gi|29292938|dbj|BAC66440.1| double stranded RNA-dependent protei...   111   3e-22   Bos taurus [bovine]
gi|208690889|gb|ACI31220.1| eukaryotic translation initiation fa...   111   3e-22   Cercocebus atys
gi|208690901|gb|ACI31226.1| eukaryotic translation initiation fa...   111   3e-22   Trachypithecus francoisi [Francois's leaf monkey]
gi|402890561|ref|XP_003908553.1| PREDICTED: interferon-induced, ...   110   4e-22   
gi|449496746|ref|XP_002191239.2| PREDICTED: interferon-induced, ...   110   4e-22   Taeniopygia guttata
gi|208690895|gb|ACI31223.1| eukaryotic translation initiation fa...   110   5e-22   Plecturocebus moloch [Dusky titi]
gi|428174596|gb|EKX43491.1| hypothetical protein GUITHDRAFT_7316...   110   5e-22   Guillardia theta CCMP2712
gi|426226436|ref|XP_004007349.1| PREDICTED: interferon-induced, ...   110   6e-22   Ovis aries [domestic sheep]
gi|507957834|ref|XP_004686089.1| PREDICTED: interferon-induced, ...   109   1e-21   
gi|465981509|ref|XP_004265100.1| PREDICTED: interferon-induced, ...   108   1e-21   
gi|390474609|ref|XP_003734807.1| PREDICTED: LOW QUALITY PROTEIN:...   108   1e-21   
gi|118405094|ref|NP_001072537.1| eukaryotic translation initiati...   108   2e-21   Xenopus tropicalis [western clawed frog]
gi|56675108|emb|CAH68531.1| Z-DNA binding protein kinase [Danio ...   108   2e-21   Danio rerio [leopard danio]
gi|470634653|ref|XP_004322869.1| PREDICTED: interferon-induced, ...   108   2e-21   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|54289574|gb|AAV32090.1| interferon-induced dsRNA-dependent pr...   108   2e-21   Chlorocebus aethiops [African green monkey]
gi|208690885|gb|ACI31218.1| eukaryotic translation initiation fa...   108   2e-21   Erythrocebus patas [hussar]
gi|145301625|ref|NP_001077417.1| interferon-induced, double-stra...   108   2e-21   Macaca mulatta [rhesus macaque]
gi|208690903|gb|ACI31227.1| eukaryotic translation initiation fa...   108   2e-21   Miopithecus talapoin talapoin
gi|208690887|gb|ACI31219.1| eukaryotic translation initiation fa...   108   2e-21   Macaca mulatta [rhesus macaque]
gi|208690891|gb|ACI31221.1| eukaryotic translation initiation fa...   108   2e-21   Ateles geoffroyi [Central American spider monkey]
gi|208690873|gb|ACI31212.1| eukaryotic translation initiation fa...   108   2e-21   Chlorocebus aethiops [African green monkey]
gi|108802827|gb|ABG21364.1| eukaryotic translation initiation fa...   108   2e-21   Mesocricetus auratus [Syrian golden hamster]
gi|334303194|gb|AEG75818.1| eukaryotic translation initiation fa...   108   2e-21   Mesocricetus auratus [Syrian golden hamster]
gi|323451492|gb|EGB07369.1| hypothetical protein AURANDRAFT_1327...   108   2e-21   Aureococcus anophagefferens
gi|223993419|ref|XP_002286393.1| predicted protein [Thalassiosir...   107   3e-21   Thalassiosira pseudonana CCMP1335
gi|208690893|gb|ACI31222.1| eukaryotic translation initiation fa...   107   3e-21   Saguinus labiatus
gi|410925411|ref|XP_003976174.1| PREDICTED: interferon-induced, ...   107   3e-21   Takifugu rubripes [tiger puffer]
gi|200210|gb|AAA39885.1| 65 kD protein kinase [Mus musculus]          107   4e-21   Mus musculus [mouse]
gi|302756755|ref|XP_002961801.1| hypothetical protein SELMODRAFT...   107   4e-21   Selaginella moellendorffii
gi|6755160|ref|NP_035293.1| interferon-induced, double-stranded ...   107   4e-21   Mus musculus [mouse]
gi|16741143|gb|AAH16422.1| Eif2ak2 protein [Mus musculus] >gi|11...   107   4e-21   Mus musculus [mouse]
gi|208690897|gb|ACI31224.1| eukaryotic translation initiation fa...   107   4e-21   Lagothrix lagotricha [Humboldt's woolly monkey]
gi|201068|gb|AAA40150.1| serine/threonine-specific protein kinas...   107   5e-21   Mus musculus domesticus
gi|134105965|gb|ABO60959.1| eukaryotic translation initiation fa...   107   5e-21   Macaca mulatta [rhesus macaque]
gi|302762907|ref|XP_002964875.1| hypothetical protein SELMODRAFT...   107   5e-21   Selaginella moellendorffii
gi|208690899|gb|ACI31225.1| eukaryotic translation initiation fa...   107   6e-21   Colobus guereza [eastern black-and -white colobus]
gi|147906536|ref|NP_001091256.1| eukaryotic translation initiati...   106   7e-21   Xenopus laevis [clawed frog]
gi|326915415|ref|XP_003204013.1| PREDICTED: interferon-induced, ...   106   7e-21   
gi|163916108|gb|AAI57422.1| Double stranded RNA activated protei...   106   7e-21   Xenopus laevis [clawed frog]
gi|123437775|ref|XP_001309680.1| STE family protein kinase [Tric...   106   7e-21   Trichomonas vaginalis G3
gi|403269719|ref|XP_003926863.1| PREDICTED: interferon-induced, ...   106   9e-21   Saimiri boliviensis boliviensis
gi|224104109|ref|XP_002333983.1| predicted protein [Populus tric...   105   1e-20   
gi|219114079|ref|XP_002176217.1| predicted protein [Phaeodactylu...   105   2e-20   Phaeodactylum tricornutum CCAP 1055/1
gi|168984493|emb|CAO98760.1| double-stranded RNA activated prote...   105   2e-20   Takifugu rubripes [tiger puffer]
gi|395509391|ref|XP_003758981.1| PREDICTED: interferon-induced, ...   103   5e-20   
gi|443726212|gb|ELU13457.1| hypothetical protein CAPTEDRAFT_2163...   103   6e-20   Capitella teleta
gi|499018016|ref|XP_004559804.1| PREDICTED: eukaryotic translati...   102   1e-19   
gi|327262381|ref|XP_003216003.1| PREDICTED: interferon-induced, ...   101   2e-19   
gi|505845357|ref|XP_004616160.1| PREDICTED: interferon-induced, ...   101   2e-19   Sorex araneus [Eurasian shrew]
gi|428170935|gb|EKX39856.1| hypothetical protein GUITHDRAFT_7610...   101   3e-19   Guillardia theta CCMP2712
gi|428185038|gb|EKX53892.1| hypothetical protein GUITHDRAFT_8432...   101   3e-19   Guillardia theta CCMP2712
gi|512953961|ref|XP_004839354.1| PREDICTED: interferon-induced, ...   101   3e-19   Heterocephalus glaber [naked mole rat]
gi|351711673|gb|EHB14592.1| Interferon-induced, double-stranded ...   101   3e-19   Heterocephalus glaber [naked mole rat]
gi|512916093|ref|XP_004903211.1| PREDICTED: interferon-induced, ...   101   3e-19   
gi|225543243|ref|NP_001139363.1| dsRNA-activated protein kinase ...   100   5e-19   Oncorhynchus mykiss
gi|348507393|ref|XP_003441240.1| PREDICTED: interferon-induced, ...   100   7e-19   
gi|155573864|gb|ABU24344.1| dsRNA-activated protein kinase R [Sa...   100   7e-19   Salmo salar
gi|219968357|emb|CAO98758.1| double-stranded RNA activated prote...    99   1e-18   Tetraodon nigroviridis
gi|164508744|emb|CAM07147.1| double stranded RNA activated prote...    99   1e-18   Tetraodon nigroviridis
gi|29125872|emb|CAD67790.1| double stranded RNA-activated protei...    99   1e-18   Tetraodon nigroviridis
gi|71042556|pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha P...    99   2e-18   Saccharomyces cerevisiae [brewer's yeast]
gi|71042560|pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha P...    99   2e-18   Saccharomyces cerevisiae [brewer's yeast]
gi|168984503|emb|CAO98765.1| double-stranded RNA activated prote...    99   2e-18   Xenopus tropicalis [western clawed frog]
gi|307190380|gb|EFN74439.1| Serine/threonine-protein kinase Nek5...    97   4e-18   Camponotus floridanus
gi|359478149|ref|XP_002264839.2| PREDICTED: probable serine/thre...    97   5e-18   Vitis vinifera
gi|508712990|gb|EOY04887.1| Kinase family protein isoform 2 [The...    97   6e-18   Theobroma cacao [chocolate]
gi|508712991|gb|EOY04888.1| Serine/threonine-protein kinase GCN2...    97   6e-18   Theobroma cacao [chocolate]
gi|345307793|ref|XP_001508965.2| PREDICTED: interferon-induced, ...    97   7e-18   Ornithorhynchus anatinus [duck-billed platypus]
gi|354491534|ref|XP_003507910.1| PREDICTED: interferon-induced, ...    97   8e-18   
gi|212291457|gb|ACJ23858.1| double-stranded RNA-dependent protei...    97   8e-18   Oplegnathus fasciatus [striped knifejaw]
gi|356544520|ref|XP_003540698.1| PREDICTED: probable serine/thre...    97   8e-18   
gi|167517643|ref|XP_001743162.1| hypothetical protein [Monosiga ...    96   1e-17   Monosiga brevicollis MX1
gi|432906952|ref|XP_004077608.1| PREDICTED: LOW QUALITY PROTEIN:...    96   1e-17   
gi|452820850|gb|EME27887.1| ATP-dependent RNA helicase [Galdieri...    96   1e-17   Galdieria sulphuraria
gi|383863376|ref|XP_003707157.1| PREDICTED: uncharacterized prot...    96   2e-17   
gi|468181285|gb|AGH29116.1| RNA-dependent protein kinase, partia...    96   2e-17   Anser cygnoides [white Chinese goose]
gi|307194540|gb|EFN76832.1| Serine/threonine-protein kinase Nek5...    95   2e-17   Harpegnathos saltator
gi|348507385|ref|XP_003441236.1| PREDICTED: interferon-induced, ...    95   2e-17   
gi|499018022|ref|XP_004559807.1| PREDICTED: interferon-induced, ...    94   4e-17   
gi|224105789|ref|XP_002333765.1| predicted protein [Populus tric...    94   4e-17   
gi|260829345|ref|XP_002609622.1| hypothetical protein BRAFLDRAFT...    94   4e-17   Branchiostoma floridae
gi|504138282|ref|XP_004581596.1| PREDICTED: serine/threonine-pro...    94   5e-17   
gi|71042541|pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha P...    94   5e-17   Saccharomyces cerevisiae [brewer's yeast]
gi|345786694|ref|XP_533795.3| PREDICTED: serine/threonine-protei...    94   6e-17   
gi|462399598|gb|EMJ05266.1| hypothetical protein PRUPE_ppb013779...    93   9e-17   Prunus persica
gi|348545937|ref|XP_003460435.1| PREDICTED: interferon-induced, ...    93   9e-17   
gi|334338572|ref|XP_001367535.2| PREDICTED: serine/threonine-pro...    92   1e-16   
gi|159464559|ref|XP_001690509.1| NimA-related protein kinase 5 [...    92   1e-16   Chlamydomonas reinhardtii
gi|301608714|ref|XP_002933926.1| PREDICTED: interferon-induced, ...    92   1e-16   Xenopus tropicalis [western clawed frog]
gi|332227208|ref|XP_003262783.1| PREDICTED: interferon-induced, ...    92   1e-16   
gi|499018020|ref|XP_004559806.1| PREDICTED: interferon-induced, ...    92   2e-16   Maylandia zebra
gi|431899876|gb|ELK07823.1| Serine/threonine-protein kinase Nek4...    92   2e-16   Pteropus alecto
gi|167520308|ref|XP_001744493.1| hypothetical protein [Monosiga ...    92   2e-16   Monosiga brevicollis MX1
gi|168984497|emb|CAO98762.1| double-stranded RNA activated prote...    92   2e-16   Oryzias latipes [Japanese rice fish]
gi|410037063|ref|XP_516519.4| PREDICTED: serine/threonine-protei...    92   2e-16   
gi|31747519|gb|AAP57628.1| interferon-inducible double-stranded ...    92   2e-16   Homo sapiens [man]
gi|41055987|ref|NP_957306.1| serine/threonine-protein kinase Nek...    92   2e-16   Danio rerio [leopard danio]
gi|410920417|ref|XP_003973680.1| PREDICTED: LOW QUALITY PROTEIN:...    91   3e-16   
gi|168984505|emb|CAO98766.1| double-stranded RNA activated prote...    91   3e-16   Xenopus tropicalis [western clawed frog]
gi|208431829|ref|NP_001129124.1| interferon-induced, double-stra...    91   3e-16   Homo sapiens [man]
gi|511826912|ref|XP_004738221.1| PREDICTED: serine/threonine-pro...    91   3e-16   
gi|432859957|ref|XP_004069320.1| PREDICTED: serine/threonine-pro...    91   3e-16   Oryzias latipes [Japanese rice fish]
gi|472384301|ref|XP_004411522.1| PREDICTED: serine/threonine-pro...    91   3e-16   Odobenus rosmarus divergens
gi|167555192|ref|NP_001107942.1| interferon-induced, double-stra...    91   3e-16   Danio rerio [leopard danio]
gi|390475090|ref|XP_002807636.2| PREDICTED: serine/threonine-pro...    91   4e-16   Callithrix jacchus [common marmoset]
gi|164508752|emb|CAM07151.1| double-stranded RNA activated prote...    91   4e-16   Danio rerio [leopard danio]
gi|432090833|gb|ELK24132.1| Serine/threonine-protein kinase Nek4...    91   4e-16   Myotis davidii
gi|386267042|gb|AFJ00092.1| PKR-like protein [Cynoglossus semila...    91   4e-16   Cynoglossus semilaevis
gi|397495933|ref|XP_003818798.1| PREDICTED: serine/threonine-pro...    91   4e-16   Pan paniscus [bonobo]
gi|354465727|ref|XP_003495328.1| PREDICTED: serine/threonine-pro...    91   4e-16   
gi|441610120|ref|XP_003257229.2| PREDICTED: serine/threonine-pro...    91   4e-16   
gi|194221227|ref|XP_001492502.2| PREDICTED: serine/threonine-pro...    91   4e-16   Equus caballus [domestic horse]
gi|148839316|ref|NP_003148.2| serine/threonine-protein kinase Ne...    91   4e-16   Homo sapiens [man]
gi|197102246|ref|NP_001126729.1| serine/threonine-protein kinase...    91   4e-16   Pongo abelii [Orang-utan]
gi|348245|gb|AAA36658.1| protein serine/threonine kinase [Homo s...    91   4e-16   Homo sapiens [man]
gi|402859855|ref|XP_003894352.1| PREDICTED: serine/threonine-pro...    91   4e-16   
gi|297285606|ref|XP_002802834.1| PREDICTED: serine/threonine-pro...    91   4e-16   
gi|198442857|ref|NP_001013152.2| serine/threonine-protein kinase...    91   4e-16   Rattus norvegicus [brown rat]
gi|38648684|gb|AAH63044.1| NEK4 protein [Homo sapiens]                 91   5e-16   Homo sapiens [man]
gi|395832772|ref|XP_003789429.1| PREDICTED: serine/threonine-pro...    91   5e-16   
gi|507555047|ref|XP_004661295.1| PREDICTED: serine/threonine-pro...    91   5e-16   
gi|478491355|ref|XP_004420048.1| PREDICTED: serine/threonine-pro...    91   5e-16   
gi|297667845|ref|XP_002812174.1| PREDICTED: interferon-induced, ...    91   5e-16   
gi|488545942|ref|XP_004464495.1| PREDICTED: serine/threonine-pro...    90   7e-16   Dasypus novemcinctus
gi|6754822|ref|NP_035979.1| serine/threonine-protein kinase Nek4...    90   7e-16   Mus musculus [mouse]
gi|116283241|gb|AAH15515.1| NEK4 protein [Homo sapiens]                90   7e-16   Homo sapiens [man]
gi|47227254|emb|CAF96803.1| unnamed protein product [Tetraodon n...    90   7e-16   Tetraodon nigroviridis
gi|29337019|sp|Q9Z1J2.1|NEK4_MOUSE RecName: Full=Serine/threonin...    90   7e-16   Mus musculus [mouse]
gi|488545940|ref|XP_004464494.1| PREDICTED: serine/threonine-pro...    90   7e-16   
gi|148692831|gb|EDL24778.1| NIMA (never in mitosis gene a)-relat...    90   7e-16   Mus musculus [mouse]
gi|148692832|gb|EDL24779.1| NIMA (never in mitosis gene a)-relat...    90   7e-16   Mus musculus [mouse]
gi|2570047|emb|CAA70436.1| MSTK2S kinase-like protein [Mus muscu...    90   8e-16   Mus musculus [mouse]
gi|261326823|emb|CBH09796.1| protein kinase, putative [Trypanoso...    90   8e-16   Trypanosoma brucei gambiense DAL972
gi|507930759|ref|XP_004676625.1| PREDICTED: serine/threonine-pro...    90   8e-16   
gi|72386653|ref|XP_843751.1| protein kinase [Trypanosoma brucei ...    90   8e-16   Trypanosoma brucei brucei TREU927
gi|493559077|ref|WP_006512527.1| protein kinase family protein [...    90   8e-16   Xenococcus sp. PCC 7305
gi|296044642|gb|ADG85735.1| type 1 double stranded RNA activated...    90   9e-16   Gadus morhua
gi|498959851|ref|XP_004545164.1| PREDICTED: serine/threonine-pro...    90   9e-16   Maylandia zebra
gi|498959845|ref|XP_004545163.1| PREDICTED: serine/threonine-pro...    90   9e-16   Maylandia zebra
gi|498959861|ref|XP_004545166.1| PREDICTED: serine/threonine-pro...    90   9e-16   Maylandia zebra
gi|498959855|ref|XP_004545165.1| PREDICTED: serine/threonine-pro...    90   9e-16   Maylandia zebra
gi|350424832|ref|XP_003493927.1| PREDICTED: hypothetical protein...    90   9e-16   
gi|344276193|ref|XP_003409893.1| PREDICTED: serine/threonine-pro...    90   9e-16   Loxodonta africana [African bush elephant]
gi|340374012|ref|XP_003385533.1| PREDICTED: membrane-associated ...    90   9e-16   
gi|348507763|ref|XP_003441425.1| PREDICTED: serine/threonine-pro...    90   1e-15   
gi|334330580|ref|XP_003341381.1| PREDICTED: serine/threonine-pro...    89   1e-15   
gi|410951421|ref|XP_003982395.1| PREDICTED: serine/threonine-pro...    89   1e-15   
gi|348588791|ref|XP_003480148.1| PREDICTED: serine/threonine-pro...    89   1e-15   
gi|340725006|ref|XP_003400866.1| PREDICTED: hypothetical protein...    89   1e-15   
gi|348588793|ref|XP_003480149.1| PREDICTED: serine/threonine-pro...    89   1e-15   
gi|148342563|gb|ABQ59054.1| NEK4 protein [Homo sapiens]                89   2e-15   Homo sapiens [man]
gi|471356412|ref|XP_004368805.1| PREDICTED: serine/threonine-pro...    89   2e-15   Trichechus manatus latirostris
gi|291393839|ref|XP_002713296.1| PREDICTED: NIMA-related kinase ...    89   2e-15   
gi|507646670|ref|XP_004631703.1| PREDICTED: serine/threonine-pro...    89   2e-15   
gi|56789503|gb|AAH88323.1| Nek4 protein [Rattus norvegicus]            89   2e-15   Rattus norvegicus [brown rat]
gi|118349085|ref|XP_001033419.1| Protein kinase domain containin...    89   2e-15   
gi|348507383|ref|XP_003441235.1| PREDICTED: interferon-induced, ...    88   2e-15   
gi|47087325|ref|NP_998638.1| mitogen-activated protein kinase 4 ...    88   2e-15   Danio rerio [leopard danio]
gi|301767174|ref|XP_002919037.1| PREDICTED: serine/threonine-pro...    88   3e-15   
gi|355559575|gb|EHH16303.1| hypothetical protein EGK_11567, part...    88   3e-15   Macaca mulatta [rhesus macaque]
gi|297743778|emb|CBI36661.3| unnamed protein product [Vitis vini...    88   3e-15   Vitis vinifera
gi|413941907|gb|AFW74556.1| putative DUF26-domain receptor-like ...    88   3e-15   Zea mays [maize]
gi|47217494|emb|CAG10874.1| unnamed protein product [Tetraodon n...    88   4e-15   Tetraodon nigroviridis
gi|443690811|gb|ELT92847.1| hypothetical protein CAPTEDRAFT_2240...    88   4e-15   Capitella teleta
gi|302842401|ref|XP_002952744.1| NimA-related protein kinase 5 [...    87   4e-15   Volvox carteri f. nagariensis
gi|74207641|dbj|BAE40066.1| unnamed protein product [Mus musculus]     87   4e-15   Mus musculus [mouse]
gi|281338028|gb|EFB13612.1| hypothetical protein PANDA_007567 [A...    87   4e-15   Ailuropoda melanoleuca
gi|505843319|ref|XP_004615157.1| PREDICTED: serine/threonine-pro...    87   4e-15   Sorex araneus [Eurasian shrew]
gi|395520997|ref|XP_003764608.1| PREDICTED: serine/threonine-pro...    87   4e-15   Sarcophilus harrisii
gi|164508748|emb|CAM07149.1| double stranded RNA activated prote...    87   5e-15   Tetraodon nigroviridis
gi|462421868|gb|EMJ26131.1| hypothetical protein PRUPE_ppa021700...    87   5e-15   Prunus persica
gi|342180168|emb|CCC89645.1| putative protein kinase [Trypanosom...    87   6e-15   Trypanosoma congolense IL3000
gi|443694315|gb|ELT95488.1| hypothetical protein CAPTEDRAFT_1012...    87   6e-15   Capitella teleta
gi|513005954|ref|XP_004864435.1| PREDICTED: serine/threonine-pro...    87   6e-15   Heterocephalus glaber [naked mole rat]
gi|123496113|ref|XP_001326893.1| CAMK family protein kinase [Tri...    87   6e-15   Trichomonas vaginalis G3
gi|118353227|ref|XP_001009885.1| Protein kinase domain containin...    87   7e-15   
gi|221487881|gb|EEE26113.1| protein kinase domain-containing pro...    87   8e-15   
gi|237830969|ref|XP_002364782.1| protein kinase domain-containin...    87   8e-15   Toxoplasma gondii ME49
gi|195390339|ref|XP_002053826.1| GJ23132 [Drosophila virilis] >g...    87   8e-15   Drosophila virilis
gi|50557052|ref|XP_505934.1| YALI0F27159p [Yarrowia lipolytica] ...    87   8e-15   Yarrowia lipolytica CLIB122
gi|159468884|ref|XP_001692604.1| flagellar autonomy 2 NIMA famil...    87   9e-15   Chlamydomonas reinhardtii
gi|470467457|ref|XP_004341798.1| protein kinase domain containin...    86   1e-14   Acanthamoeba castellanii str. Neff
gi|213404804|ref|XP_002173174.1| eukaryotic translation initiati...    86   1e-14   
gi|471229273|ref|XP_004035499.1| hypothetical protein IMG5_09849...    86   1e-14   Ichthyophthirius multifiliis
gi|189065491|dbj|BAG35330.1| unnamed protein product [Homo sapiens]    86   1e-14   Homo sapiens [man]
gi|118382027|ref|XP_001024173.1| Protein kinase domain containin...    86   1e-14   
gi|345325087|ref|XP_001513277.2| PREDICTED: serine/threonine-pro...    86   1e-14   
gi|291221185|ref|XP_002730606.1| PREDICTED: NIMA-related kinase ...    86   1e-14   
gi|513204248|ref|XP_004944439.1| PREDICTED: serine/threonine-pro...    86   2e-14   Gallus gallus [bantam]
gi|118096697|ref|XP_414252.2| PREDICTED: serine/threonine-protei...    86   2e-14   Gallus gallus [bantam]
gi|452824359|gb|EME31362.1| Wee1-like protein kinase putative ty...    86   2e-14   Galdieria sulphuraria
gi|28475311|emb|CAD67778.1| double stranded RNA-activated protei...    86   2e-14   Tetraodon nigroviridis
gi|356522466|ref|XP_003529867.1| PREDICTED: serine/threonine-pro...    86   2e-14   
gi|507961853|ref|XP_004687467.1| PREDICTED: serine/threonine-pro...    85   2e-14   Condylura cristata
gi|401412051|ref|XP_003885473.1| CBL-interacting protein kinase ...    85   2e-14   Neospora caninum Liverpool
gi|449473811|ref|XP_002191486.2| PREDICTED: serine/threonine-pro...    85   2e-14   
gi|507961855|ref|XP_004687468.1| PREDICTED: serine/threonine-pro...    85   2e-14   
gi|53776|emb|CAA44427.1| protein kinase [Mus musculus] >gi|57059...    85   3e-14   Mus musculus [mouse]
gi|403366056|gb|EJY82819.1| Protein kinase domain containing pro...    85   3e-14   Oxytricha trifallax
gi|449281936|gb|EMC88879.1| Serine/threonine-protein kinase 4, p...    85   3e-14   Columba livia [carrier pigeon]
gi|356560221|ref|XP_003548392.1| PREDICTED: serine/threonine-pro...    85   3e-14   
gi|428184437|gb|EKX53292.1| hypothetical protein GUITHDRAFT_6445...    85   3e-14   Guillardia theta CCMP2712
gi|290992314|ref|XP_002678779.1| predicted protein [Naegleria gr...    85   3e-14   Naegleria gruberi strain NEG-M
gi|297843094|ref|XP_002889428.1| hypothetical protein ARALYDRAFT...    85   3e-14   Arabidopsis lyrata subsp. lyrata
gi|237834945|ref|XP_002366770.1| calcium-dependent protein kinas...    84   3e-14   Toxoplasma gondii ME49
gi|294881160|ref|XP_002769274.1| serine/threonine protein kinase...    84   4e-14   Perkinsus marinus ATCC 50983
gi|431913791|gb|ELK15220.1| Serine/threonine-protein kinase Nek5...    84   4e-14   Pteropus alecto
gi|328779449|ref|XP_395523.4| PREDICTED: hypothetical protein LO...    84   4e-14   
gi|470614182|ref|XP_004316604.1| PREDICTED: serine/threonine-pro...    84   4e-14   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|30353923|gb|AAH51798.1| TAOK2 protein, partial [Homo sapiens]       84   4e-14   Homo sapiens [man]
gi|465999358|ref|XP_004268083.1| PREDICTED: serine/threonine-pro...    84   4e-14   
gi|334326085|ref|XP_003340711.1| PREDICTED: LOW QUALITY PROTEIN:...    84   4e-14   
gi|158297483|ref|XP_317709.4| AGAP007798-PA [Anopheles gambiae s...    84   4e-14   Anopheles gambiae str. PEST
gi|432924104|ref|XP_004080537.1| PREDICTED: serine/threonine-pro...    84   5e-14   Oryzias latipes [Japanese rice fish]
gi|348507387|ref|XP_003441237.1| PREDICTED: eukaryotic translati...    84   5e-14   
gi|123472115|ref|XP_001319253.1| CAMK family protein kinase [Tri...    84   5e-14   Trichomonas vaginalis G3
gi|505844850|ref|XP_004615912.1| PREDICTED: serine/threonine-pro...    84   6e-14   Sorex araneus [Eurasian shrew]
gi|512914845|ref|XP_004902904.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|512914841|ref|XP_004902903.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|512914833|ref|XP_004902901.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|511909113|ref|XP_004773986.1| PREDICTED: serine/threonine-pro...    84   6e-14   Mustela putorius furo [black ferret]
gi|511909111|ref|XP_004773985.1| PREDICTED: serine/threonine-pro...    84   6e-14   Mustela putorius furo [black ferret]
gi|507975385|ref|XP_004692062.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|507975382|ref|XP_004692061.1| PREDICTED: serine/threonine-pro...    84   6e-14   Condylura cristata
gi|507615044|ref|XP_004623011.1| PREDICTED: serine/threonine-pro...    84   6e-14   Octodon degus
gi|507615042|ref|XP_004623010.1| PREDICTED: serine/threonine-pro...    84   6e-14   Octodon degus
gi|507615040|ref|XP_004623009.1| PREDICTED: serine/threonine-pro...    84   6e-14   Octodon degus
gi|505844852|ref|XP_004615913.1| PREDICTED: serine/threonine-pro...    84   6e-14   Sorex araneus [Eurasian shrew]
gi|504149037|ref|XP_004586924.1| PREDICTED: serine/threonine-pro...    84   6e-14   Ochotona princeps [southern American pika]
gi|504149035|ref|XP_004586923.1| PREDICTED: serine/threonine-pro...    84   6e-14   Ochotona princeps [southern American pika]
gi|504149033|ref|XP_004586922.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|488539862|ref|XP_004461543.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|478530604|ref|XP_004439461.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|478530602|ref|XP_004439460.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|472355182|ref|XP_004397246.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|471410257|ref|XP_004386696.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|471410255|ref|XP_004386695.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|470632001|ref|XP_004322129.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|470631998|ref|XP_004322128.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|466003140|ref|XP_004268704.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|466003136|ref|XP_004268703.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|440907047|gb|ELR57239.1| Serine/threonine-protein kinase TAO2...    84   6e-14   
gi|431906816|gb|ELK10937.1| Serine/threonine-protein kinase TAO2...    84   6e-14   
gi|426381787|ref|XP_004057515.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|45505130|ref|NP_057235.2| serine/threonine-protein kinase TAO...    84   6e-14   
gi|410984828|ref|XP_003998727.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|403276973|ref|XP_003930154.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|397475995|ref|XP_003809397.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|355710103|gb|EHH31567.1| Serine/threonine-protein kinase TAO2...    84   6e-14   
gi|512914837|ref|XP_004902902.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|345801893|ref|XP_547063.3| PREDICTED: serine/threonine-protei...    84   6e-14   
gi|344253770|gb|EGW09874.1| Serine/threonine-protein kinase TAO2...    84   6e-14   
gi|338712739|ref|XP_001496471.3| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|332845669|ref|XP_510917.3| PREDICTED: serine/threonine-protei...    84   6e-14   
gi|332266087|ref|XP_003282047.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|297698503|ref|XP_002826357.1| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|297283773|ref|XP_001106511.2| PREDICTED: serine/threonine-pro...    84   6e-14   
gi|281346493|gb|EFB22077.1| hypothetical protein PANDA_017148 [A...    84   6e-14   
gi|255003684|ref|NP_001157247.1| serine/threonine-protein kinase...    84   6e-14   
gi|354721195|ref|NP_001238972.1| serine/threonine-protein kinase...    84   6e-14   
gi|355765350|gb|EHH62403.1| Serine/threonine-protein kinase TAO2...    84   6e-14   
gi|148745103|gb|AAI42664.1| TAO kinase 2 [Homo sapiens] >gi|1532...    84   6e-14   
gi|5616074|gb|AAD45616.1|AF061943_1 prostate derived STE20-like ...    84   6e-14   
gi|431901769|gb|ELK08646.1| Serine/threonine-protein kinase 3 [P...    84   6e-14   
gi|321476347|gb|EFX87308.1| hypothetical protein DAPPUDRAFT_3125...    84   6e-14   
gi|13929032|ref|NP_113923.1| serine/threonine-protein kinase 3 [...    84   6e-14   
gi|149067799|gb|EDM17351.1| TAO kinase 2, isoform CRA_b [Rattus ...    84   7e-14   
gi|12083665|ref|NP_073193.1| serine/threonine-protein kinase TAO...    84   7e-14   
gi|301756382|ref|XP_002914046.1| PREDICTED: serine/threonine-pro...    84   7e-14   
gi|34189885|gb|AAH31825.1| TAOK2 protein, partial [Homo sapiens]       84   7e-14   
gi|441647761|ref|XP_004090830.1| PREDICTED: LOW QUALITY PROTEIN:...    84   7e-14   
gi|488539866|ref|XP_004461545.1| PREDICTED: serine/threonine-pro...    83   7e-14   
gi|512904933|ref|XP_004900498.1| PREDICTED: serine/threonine-pro...    83   8e-14   
gi|449284091|gb|EMC90672.1| Serine/threonine-protein kinase 3, p...    83   8e-14   
gi|403305040|ref|XP_003943084.1| PREDICTED: LOW QUALITY PROTEIN:...    83   8e-14   
gi|241701230|ref|XP_002411906.1| serine/threonine protein kinase...    83   8e-14   
gi|308493335|ref|XP_003108857.1| CRE-ZYG-1 protein [Caenorhabdit...    83   8e-14   
gi|197098350|ref|NP_001125669.1| serine/threonine-protein kinase...    83   8e-14   
gi|488539868|ref|XP_004461546.1| PREDICTED: serine/threonine-pro...    83   8e-14   
gi|355698125|gb|EHH28673.1| hypothetical protein EGK_19159 [Maca...    83   8e-14   
gi|354489652|ref|XP_003506975.1| PREDICTED: serine/threonine-pro...    83   8e-14   
gi|507625439|ref|XP_004697757.1| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|148685525|gb|EDL17472.1| mCG22407, isoform CRA_d [Mus musculu...    83   9e-14   
gi|410910834|ref|XP_003968895.1| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|345310884|ref|XP_001513882.2| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|118142813|gb|AAH15204.1| TAOK2 protein [Homo sapiens]               83   9e-14   
gi|56554138|pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Ki...    83   9e-14   
gi|390338050|ref|XP_781787.3| PREDICTED: serine/threonine-protei...    83   9e-14   
gi|512858507|ref|XP_004889127.1| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|507658958|ref|XP_004705740.1| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|507658954|ref|XP_004705739.1| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|466036295|ref|XP_004275398.1| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|440898606|gb|ELR50065.1| Serine/threonine-protein kinase 3, p...    83   9e-14   
gi|326917934|ref|XP_003205248.1| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|471360456|ref|XP_004370798.1| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|73974096|ref|XP_532280.2| PREDICTED: serine/threonine-protein...    83   9e-14   
gi|472365732|ref|XP_004402416.1| PREDICTED: serine/threonine-pro...    83   9e-14   
gi|432118715|gb|ELK38171.1| Serine/threonine-protein kinase 3, p...    83   9e-14   
gi|348513229|ref|XP_003444145.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|327269545|ref|XP_003219554.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|511978221|ref|XP_004807002.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|498978052|ref|XP_004549236.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|444706068|gb|ELW47430.1| Serine/threonine-protein kinase 3 [T...    83   1e-13   
gi|351710073|gb|EHB12992.1| Serine/threonine-protein kinase Nek4...    83   1e-13   
gi|507938014|ref|XP_004679756.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|432953023|ref|XP_004085273.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|195052233|ref|XP_001993261.1| GH13714 [Drosophila grimshawi] ...    83   1e-13   
gi|504136439|ref|XP_004580685.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|344272980|ref|XP_003408306.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|426360347|ref|XP_004047407.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|881958|gb|AAA75300.1| Mess1 [Mus musculus]                          83   1e-13   
gi|17536877|ref|NP_496095.1| Protein WEE-1.3 [Caenorhabditis ele...    83   1e-13   
gi|391342770|ref|XP_003745688.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|146178978|ref|XP_001470898.1| Serine/threonine-protein kinase...    83   1e-13   
gi|145523832|ref|XP_001447749.1| hypothetical protein [Parameciu...    83   1e-13   
gi|512976293|ref|XP_004850213.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|195053464|ref|XP_001993646.1| GH20866 [Drosophila grimshawi] ...    83   1e-13   
gi|114794045|pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporin...    83   1e-13   
gi|335309055|ref|XP_003361475.1| PREDICTED: LOW QUALITY PROTEIN:...    83   1e-13   
gi|410987602|ref|XP_004000087.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|321453523|gb|EFX64750.1| hypothetical protein DAPPUDRAFT_6592...    83   1e-13   
gi|507558593|ref|XP_004663032.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|209156282|gb|ACI34373.1| Eukaryotic translation initiation fa...    83   1e-13   
gi|390407755|ref|NP_001254604.1| double-stranded RNA activated p...    83   1e-13   
gi|465995380|gb|EMP39758.1| Serine/threonine-protein kinase Nek4...    83   1e-13   
gi|75325486|sp|Q6Z829.1|WEE1_ORYSJ RecName: Full=Wee1-like prote...    83   1e-13   
gi|149733680|ref|XP_001503215.1| PREDICTED: serine/threonine-pro...    83   1e-13   
gi|256089413|ref|XP_002580804.1| serine/threonine protein kinase...    82   1e-13   
gi|118395404|ref|XP_001030052.1| Protein kinase domain containin...    82   1e-13   
gi|222622126|gb|EEE56258.1| hypothetical protein OsJ_05288 [Oryz...    82   1e-13   
gi|507573462|ref|XP_004670317.1| PREDICTED: serine/threonine-pro...    82   1e-13   
gi|507573460|ref|XP_004670316.1| PREDICTED: serine/threonine-pro...    82   1e-13   
gi|507573458|ref|XP_004670315.1| PREDICTED: serine/threonine-pro...    82   1e-13   
gi|384253171|gb|EIE26646.1| kinase-like protein [Coccomyxa subel...    82   1e-13   
gi|505853038|ref|XP_004619954.1| PREDICTED: serine/threonine-pro...    82   1e-13   
gi|428135195|gb|AFY97674.1| hpo protein [Macrostomum lignano]          82   1e-13   
gi|360043505|emb|CCD78918.1| serine/threonine kinase [Schistosom...    82   1e-13   
gi|195113499|ref|XP_002001305.1| GI10715 [Drosophila mojavensis]...    82   1e-13   
gi|168984499|emb|CAO98763.1| double-stranded RNA activated prote...    82   1e-13   
gi|511978223|ref|XP_004807003.1| PREDICTED: serine/threonine-pro...    82   2e-13   
gi|470632449|ref|XP_004322273.1| PREDICTED: serine/threonine-pro...    82   2e-13   
gi|339245855|ref|XP_003374561.1| serine/threonine-protein kinase...    82   2e-13   
gi|403366577|gb|EJY83091.1| Wee1 kinase [Oxytricha trifallax]          82   2e-13   
gi|511898856|ref|XP_004768986.1| PREDICTED: serine/threonine-pro...    82   2e-13   
gi|340377849|ref|XP_003387441.1| PREDICTED: serine/threonine-pro...    82   2e-13   
gi|260820944|ref|XP_002605794.1| hypothetical protein BRAFLDRAFT...    82   2e-13   
gi|478512309|ref|XP_004430417.1| PREDICTED: serine/threonine-pro...    82   2e-13   
gi|432959293|ref|XP_004086244.1| PREDICTED: serine/threonine-pro...    82   2e-13   
gi|390471488|ref|XP_002756091.2| PREDICTED: serine/threonine-pro...    82   2e-13   
gi|15218666|ref|NP_171796.1| Wee1-like protein kinase [Arabidops...    82   2e-13   
gi|6056405|gb|AAF02869.1|AC009525_3 Similar to Wee1 protein kina...    82   2e-13   
gi|367004140|ref|XP_003686803.1| hypothetical protein TPHA_0H016...    82   2e-13   
gi|167518662|ref|XP_001743671.1| hypothetical protein [Monosiga ...    82   2e-13   
gi|478512311|ref|XP_004430418.1| PREDICTED: serine/threonine-pro...    82   2e-13   
gi|66805167|ref|XP_636316.1| hypothetical protein DDB_G0289277 [...    82   2e-13   
gi|356537788|ref|XP_003537407.1| PREDICTED: cysteine-rich recept...    82   2e-13   
gi|471223150|ref|XP_004030360.1| protein kinase domain protein [...    82   2e-13   
gi|45361343|ref|NP_989249.1| serine/threonine-protein kinase 4 [...    82   2e-13   
gi|410922848|ref|XP_003974894.1| PREDICTED: mitogen-activated pr...    82   2e-13   
gi|345310337|ref|XP_001515737.2| PREDICTED: LOW QUALITY PROTEIN:...    82   2e-13   
gi|170063438|ref|XP_001867104.1| mitosis inhibitor protein kinas...    82   2e-13   
gi|308512071|ref|XP_003118218.1| CRE-CST-1 protein [Caenorhabdit...    82   2e-13   
gi|444725819|gb|ELW66373.1| Serine/threonine-protein kinase TAO2...    82   2e-13   
gi|390348742|ref|XP_003727069.1| PREDICTED: serine/threonine-pro...    82   2e-13   
gi|342182213|emb|CCC91692.1| putative protein kinase [Trypanosom...    82   2e-13   
gi|294945318|ref|XP_002784620.1| Ovarian-specific serine/threoni...    82   2e-13   
gi|308474246|ref|XP_003099345.1| hypothetical protein CRE_09708 ...    82   3e-13   
gi|294883770|ref|XP_002771066.1| Ovarian-specific serine/threoni...    82   3e-13   
gi|403270661|ref|XP_003927288.1| PREDICTED: serine/threonine-pro...    82   3e-13   
gi|307103827|gb|EFN52084.1| hypothetical protein CHLNCDRAFT_3700...    82   3e-13   
gi|50293717|ref|XP_449270.1| hypothetical protein [Candida glabr...    81   3e-13   
gi|94969337|ref|YP_591385.1| serine/threonin protein kinase [Can...    81   3e-13   
gi|332031109|gb|EGI70686.1| Serine/threonine-protein kinase Nek5...    81   3e-13   
gi|226069432|dbj|BAH36933.1| Serine/threonine-protein kinase hip...    81   3e-13   
gi|426236187|ref|XP_004012054.1| PREDICTED: serine/threonine-pro...    81   3e-13   
gi|499018018|ref|XP_004559805.1| PREDICTED: interferon-induced, ...    81   3e-13   
gi|341891306|gb|EGT47241.1| hypothetical protein CAEBREN_14753 [...    81   3e-13   
gi|145508293|ref|XP_001440096.1| hypothetical protein [Parameciu...    81   3e-13   
gi|512858869|ref|XP_002936837.2| PREDICTED: serine/threonine-pro...    81   3e-13   
gi|341898622|gb|EGT54557.1| hypothetical protein CAEBREN_22695 [...    81   4e-13   
gi|6946695|emb|CAB72316.1| Wee1-like CDK Tyrosine kinase [Daphni...    81   4e-13   
gi|504129073|ref|XP_004577734.1| PREDICTED: serine/threonine-pro...    81   4e-13   
gi|148234933|ref|NP_001085661.1| serine/threonine-protein kinase...    81   4e-13   
gi|321469972|gb|EFX80950.1| hypothetical protein DAPPUDRAFT_2116...    81   4e-13   
gi|222630085|gb|EEE62217.1| hypothetical protein OsJ_17004 [Oryz...    81   4e-13   
gi|340057992|emb|CCC52345.1| putative protein kinase [Trypanosom...    81   4e-13   
gi|432867335|ref|XP_004071141.1| PREDICTED: serine/threonine-pro...    81   4e-13   
gi|502127648|ref|XP_004499785.1| PREDICTED: cysteine-rich recept...    81   4e-13   
gi|156389257|ref|XP_001634908.1| predicted protein [Nematostella...    81   4e-13   
gi|478519076|ref|XP_004433760.1| PREDICTED: serine/threonine-pro...    81   4e-13   
gi|405952183|gb|EKC20024.1| Serine/threonine-protein kinase 3 [C...    81   5e-13   
gi|291190158|ref|NP_001167085.1| Serine/threonine-protein kinase...    81   5e-13   
gi|466032818|ref|XP_004274688.1| PREDICTED: serine/threonine-pro...    80   5e-13   
gi|498957801|ref|XP_004524211.1| PREDICTED: wee1-like protein ki...    80   5e-13   
gi|356503464|ref|XP_003520528.1| PREDICTED: serine/threonine-pro...    80   5e-13   
gi|297481059|ref|XP_002691791.1| PREDICTED: serine/threonine-pro...    80   5e-13   
gi|148685522|gb|EDL17469.1| mCG22407, isoform CRA_a [Mus musculus]     80   5e-13   
gi|403331591|gb|EJY64750.1| hypothetical protein OXYTRI_15212 [O...    80   5e-13   
gi|17536875|ref|NP_496058.1| Protein WEE-1.1 [Caenorhabditis ele...    80   5e-13   
gi|260833406|ref|XP_002611648.1| hypothetical protein BRAFLDRAFT...    80   5e-13   
gi|157113643|ref|XP_001652034.1| serine/threonine protein kinase...    80   6e-13   
gi|72391902|ref|XP_846245.1| protein kinase [Trypanosoma brucei ...    80   6e-13   
gi|497242309|ref|WP_009556534.1| protein kinase family protein [...    80   6e-13   
gi|170027953|ref|XP_001841861.1| serine/threonine-protein kinase...    80   6e-13   
gi|118404384|ref|NP_001072729.1| TAO kinase 2 [Xenopus (Silurana...    80   6e-13   
gi|218196026|gb|EEC78453.1| hypothetical protein OsI_18315 [Oryz...    80   6e-13   
gi|40788971|dbj|BAA74904.2| KIAA0881 protein [Homo sapiens]            80   6e-13   
gi|37360134|dbj|BAC98045.1| mKIAA0881 protein [Mus musculus] >gi...    80   6e-13   
gi|145502897|ref|XP_001437426.1| hypothetical protein [Parameciu...    80   6e-13   
gi|402912411|ref|XP_003918760.1| PREDICTED: serine/threonine-pro...    80   6e-13   
gi|194671856|ref|XP_001788461.1| PREDICTED: serine/threonine-pro...    80   6e-13   
gi|81912644|sp|Q7TSC3.1|NEK5_MOUSE RecName: Full=Serine/threonin...    80   6e-13   
gi|499016565|ref|XP_004559089.1| PREDICTED: serine/threonine-pro...    80   7e-13   
gi|168012895|ref|XP_001759137.1| predicted protein [Physcomitrel...    80   7e-13   
gi|321474964|gb|EFX85928.1| hypothetical protein DAPPUDRAFT_3091...    80   7e-13   
gi|145509032|ref|XP_001440460.1| hypothetical protein [Parameciu...    80   7e-13   
gi|195354708|ref|XP_002043838.1| GM17781 [Drosophila sechellia] ...    80   7e-13   
gi|472355184|ref|XP_004397247.1| PREDICTED: serine/threonine-pro...    80   7e-13   
gi|189233973|ref|XP_975713.2| PREDICTED: similar to serine/threo...    80   7e-13   
gi|328706800|ref|XP_001950941.2| PREDICTED: serine/threonine-pro...    80   7e-13   
gi|194745949|ref|XP_001955447.1| GF18771 [Drosophila ananassae] ...    80   7e-13   
gi|499016567|ref|XP_004559090.1| PREDICTED: serine/threonine-pro...    80   7e-13   
gi|432111654|gb|ELK34751.1| Serine/threonine-protein kinase TAO2...    80   7e-13   
gi|348528793|ref|XP_003451900.1| PREDICTED: serine/threonine-pro...    80   7e-13   
gi|512988508|ref|XP_004856171.1| PREDICTED: serine/threonine-pro...    80   7e-13   
gi|471410259|ref|XP_004386697.1| PREDICTED: serine/threonine-pro...    80   7e-13   
gi|470632004|ref|XP_004322130.1| PREDICTED: serine/threonine-pro...    80   7e-13   
gi|322795456|gb|EFZ18201.1| hypothetical protein SINV_14160 [Sol...    80   7e-13   
gi|195331760|ref|XP_002032567.1| GM23458 [Drosophila sechellia] ...    80   7e-13   
gi|510904012|ref|XP_004830595.1| protein kinase domain-containin...    80   7e-13   
gi|332017045|gb|EGI57844.1| Serine/threonine-protein kinase 3 [A...    80   7e-13   
gi|440902351|gb|ELR53149.1| Serine/threonine-protein kinase Nek5...    80   8e-13   
gi|148700960|gb|EDL32907.1| NIMA (never in mitosis gene a)-relat...    80   8e-13   
gi|512988510|ref|XP_004856172.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|507975388|ref|XP_004692063.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|507615046|ref|XP_004623012.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|410925409|ref|XP_003976173.1| PREDICTED: eukaryotic translati...    80   8e-13   
gi|125772887|ref|XP_001357702.1| GA10662 [Drosophila pseudoobscu...    80   8e-13   
gi|511909115|ref|XP_004773987.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|157129164|ref|XP_001661625.1| mitosis inhibitor protein kinas...    80   8e-13   
gi|507615048|ref|XP_004623013.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|505844854|ref|XP_004615914.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|488539864|ref|XP_004461544.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|395846271|ref|XP_003795834.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|432851314|ref|XP_004066961.1| PREDICTED: mitogen-activated pr...    80   8e-13   
gi|348584286|ref|XP_003477903.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|499048235|ref|XP_004574667.1| PREDICTED: serine/threonine-pro...    80   8e-13   
gi|60391907|sp|O15865.3|CDPK2_PLAFK RecName: Full=Calcium-depend...    80   8e-13   
gi|195573607|ref|XP_002104783.1| GD18266 [Drosophila simulans] >...    80   8e-13   
gi|73958451|ref|XP_858335.1| PREDICTED: serine/threonine-protein...    80   8e-13   
gi|466003147|ref|XP_004268705.1| PREDICTED: serine/threonine-pro...    80   8e-13   


>gi|330841406|ref|XP_003292689.1| hypothetical protein DICPUDRAFT_9913 [Dictyostelium purpureum]
 gi|325077033|gb|EGC30773.1| hypothetical protein DICPUDRAFT_9913 [Dictyostelium purpureum]
          Length = 254

 Score =  127 bits (318), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 133/257 (51%), Gaps = 25/257 (9%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYM--VFQEAQALAKLE 71
           YE+ F +L+ +GKG +GSV+   +K D   YA+KKI       I++  V +E + LA L 
Sbjct: 2   YEEDFCELEKVGKGGYGSVYRVKNKLDGEYYALKKIPFKNTTKIFLEKVLREVKTLASLN 61

Query: 72  HPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDG-QIDPLFNIKI 130
           H N+VRY S+W+++     T +T    T++I M+L S +L + LE R   Q++   N+ I
Sbjct: 62  HRNIVRYHSAWLETEEIVSTSIT----TLYIVMQLYSQTLSQWLENRPPDQVNEEENLNI 117

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPK-------IGDFGLVKSEEPTHL 183
           F  I  G+ Y+H K ++HRDLK  N+FL  I  + + +           G +    P   
Sbjct: 118 FKQICIGLRYIHSKGIIHRDLKPGNVFLVRIEDQHLSRSLEHCKHTSAVGTLTYSSPEQK 177

Query: 184 EANTKE-NDIYCLGVVLKDLYFP-------RKSLDDLLIMVEQQG---DFNNIIELIFKM 232
           +    E  DIY LG++L +LYFP        + L DL   +  +     +  + +LI +M
Sbjct: 178 KGLYNEKTDIYSLGIILFELYFPLTTRMEKARVLSDLRNGIFPKSFAQKYPQVADLILQM 237

Query: 233 TKMTGSDPPQATKILES 249
            K    + P A+ IL+S
Sbjct: 238 MKSNPDERPSASDILKS 254



>gi|410955477|ref|XP_003984379.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Felis catus]
          Length = 542

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 143/263 (54%), Gaps = 38/263 (14%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F++++ +G G +G V+ A H+ D+ TY +K++   K ++     +E +ALA L HPN+V 
Sbjct: 271 FTEIEPIGSGGYGQVFKAKHRIDRKTYVVKRV---KYDSDRKAEREVKALAALNHPNIVH 327

Query: 78  YFSSWI----QSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQI-DPLFNIKIF 131
           Y+S W      S +S  T   P    +FIQME C   +L++ ++ R GQ  D    ++++
Sbjct: 328 YYSCWFGDDYHSVDSINTS-RPKTKCLFIQMEFCGKGTLEQWIDSRRGQTPDKHLALELY 386

Query: 132 HGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK--------------- 176
             I  G++Y+H K+L+HRDLK  N+FL  ++T+ + KIGDFGLV                
Sbjct: 387 EQITAGVDYIHCKQLIHRDLKPGNVFL--VDTKQV-KIGDFGLVTSLKNYANRTRNTGTL 443

Query: 177 ---SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMVEQ--QGDFNNIIE---- 227
              S E   L+    E DI+ LG++L +L +   ++ + L + ++   G F+++ +    
Sbjct: 444 RYMSPEQISLQEYGNEVDIFALGLILAELLYICPTVSETLQIFKELRDGKFSDVFDGREK 503

Query: 228 -LIFKMTKMTGSDPPQATKILES 249
            L+ K+     +  P A++ILE+
Sbjct: 504 ILLQKLLSPEPTKRPHASEILET 526



>gi|219689078|ref|NP_001137272.1| interferon-induced, double-stranded RNA-activated protein kinase
           [Equus caballus]
 gi|61889230|gb|AAX47275.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Equus
           caballus]
          Length = 540

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 137/262 (52%), Gaps = 39/262 (14%)

Query: 16  KTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNV 75
           K F  +  +G G FG V+ A H+ D  TY IK++   K +      +E +ALA+L+HPN+
Sbjct: 261 KDFISISEIGSGGFGQVFKAQHRLDGKTYVIKRV---KYDREKKAEREVKALAELDHPNI 317

Query: 76  VRYFSSWIQSCNSDWTDLTPVKLT------IFIQMELCS-TSLKRVLEKRDGQ-IDPLFN 127
           V Y++ W+    +D+     + L+      +FIQME C+  +L++ ++ R GQ  D   +
Sbjct: 318 VHYYNCWV---GNDYDPEESINLSRSKTDCLFIQMEFCNKGTLEQWIDNRRGQETDKQLS 374

Query: 128 IKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK----------- 176
           ++ F  I  G++Y+H K+L+HRDLK  NIFL  ++ + I KIGDFGLV            
Sbjct: 375 LEFFEQITTGVDYIHSKELIHRDLKPSNIFL--VDAKHI-KIGDFGLVTSLKYDDKRTSN 431

Query: 177 -------SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMVE--QQGDFNNIIE 227
                  S E    E    E DIY LGV+L +L +   +  + + ++E  + G F+N+ +
Sbjct: 432 RGTKRYMSPEQISSEVYGNEVDIYALGVILAELLYICPTARETVEILEKLKAGIFSNVFD 491

Query: 228 LIFK--MTKMTGSDPPQATKIL 247
              K  + K+   DP +  K  
Sbjct: 492 KREKILLQKLVSKDPKERPKTF 513



>gi|398391991|ref|XP_003849455.1| hypothetical protein MYCGRDRAFT_30507, partial [Zymoseptoria
           tritici IPO323]
 gi|339469332|gb|EGP84431.1| hypothetical protein MYCGRDRAFT_30507 [Zymoseptoria tritici IPO323]
          Length = 277

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 123/226 (54%), Gaps = 44/226 (19%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           Y K F +L +LGKG +G V+   H+ D  TYA+KK ++ +      +  E ++L++L+HP
Sbjct: 4   YLKDFDELGILGKGGYGQVFHVRHRLDGRTYAVKKAVLDE------ILTEVRSLSRLDHP 57

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLE-KRDGQIDPL---FNI- 128
           NVVRYFSSWI+ C++     +   L I +QM++   +L   L   +   ++PL   F+I 
Sbjct: 58  NVVRYFSSWIE-CDAGLISSSEPSLAIHLQMDIYPMTLADFLSPPQTSSVEPLAHCFHIS 116

Query: 129 ---KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQ-EINTEF------IPKIGDFGLVKS- 177
              +I   I+ G+EY+H + +VHRDLK  NIFL+ E N++       + +IGDFGLV S 
Sbjct: 117 PSLRILLAILDGVEYLHSEGIVHRDLKPANIFLRLESNSKAASSCVDLVRIGDFGLVTSI 176

Query: 178 ---------EEPTHL-------EANTKEN-----DIYCLGVVLKDL 202
                      PTH         A +K +     DI+ LG++  +L
Sbjct: 177 AQSGDLTSDPPPTHAVGTELYRPAASKSSVSPKLDIFALGIIACEL 222



>gi|301758056|ref|XP_002914888.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Ailuropoda melanoleuca]
          Length = 539

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 85/262 (32%), Positives = 140/262 (53%), Gaps = 36/262 (13%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F+++  +G G +G V+ A HK D  TY IK++   K +    V +E +ALA L HPN+V 
Sbjct: 268 FTEITPIGSGGYGQVFKAKHKIDGKTYVIKRV---KYDKDKKVEREVKALAALRHPNIVH 324

Query: 78  YFSSWIQSCNSDWTDLTPVKLTI---FIQMELC-STSLKRVLEKRDGQ-IDPLFNIKIFH 132
           Y S W     +    + P +  I    IQME C   +L+  ++ R G+  D   +++++ 
Sbjct: 325 YCSCWAGEDYNPEDSINPSRPKIKCLLIQMEFCDKGTLEAWIDNRRGKKPDKPLSLELYE 384

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS--------------- 177
            I  G+EY+H ++L+HRDLK  NIFL  +NT+ I KIGDFGLV S               
Sbjct: 385 QIAAGVEYIHNQQLIHRDLKPGNIFL--VNTKHI-KIGDFGLVTSLKDYENRTSNKGTLR 441

Query: 178 -EEPTHLEAN--TKENDIYCLGVVLKDLYFPRKSLDDLLIMVEQ--QGDFNNIIELIFK- 231
              P  + +    KE DI+ LG++L +L +   +L + + + ++   G F+++ +   K 
Sbjct: 442 YMSPEQISSREYGKEVDIFALGLILAELLYICPTLSETVEIFKELRAGKFSDVFDAREKI 501

Query: 232 -MTKMTGSDP---PQATKILES 249
            + ++   DP   P A++ILE+
Sbjct: 502 LLERLLSHDPMKRPSASEILET 523



>gi|302817708|ref|XP_002990529.1| hypothetical protein SELMODRAFT_161006 [Selaginella moellendorffii]
 gi|300141697|gb|EFJ08406.1| hypothetical protein SELMODRAFT_161006 [Selaginella moellendorffii]
          Length = 396

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 135/268 (50%), Gaps = 48/268 (17%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N  + + F+ ++ LG+G+ G V+   HK+D   YA+K+I V K  ++  V +EA+ L+ L
Sbjct: 146 NTKFNEEFTLIKQLGRGADGVVYMCRHKFDGQVYAVKQIHVRK--DLESVMKEARTLSTL 203

Query: 71  EHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDP--LFNI 128
            H N+V+Y +SW       W +       ++IQM+ C++SLK +LE      DP  L  +
Sbjct: 204 AHANIVKYHTSW-------WEEQPGGGCVVYIQMQYCTSSLKDMLE------DPKALIPV 250

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSE---------- 178
             F+ +++ +EY+HEKK++HRD+   NIF  + N     K+GDFGL K +          
Sbjct: 251 AAFNELVQAVEYLHEKKIIHRDIAPKNIFFDDYNRL---KLGDFGLAKKKLSLPREGGKV 307

Query: 179 ------EPTHLEANTKENDIYCLGVVLKDL---YFPRKSLDDLLIMVEQQGDF------- 222
                  P  LE N   +DI+ LG++L +L   + P     D  + + + G F       
Sbjct: 308 GTGMYSSPKQLE-NEMASDIFSLGMILFELNCRFSPENQDRDSTMQLAKDGIFPKEWEIA 366

Query: 223 -NNIIELIFKMTKMTGSDPPQATKILES 249
              + E I  M     S  P A++IL S
Sbjct: 367 NQELAEKIRSMLHPNRSLRPTASQILAS 394



>gi|302817836|ref|XP_002990593.1| hypothetical protein SELMODRAFT_448096 [Selaginella moellendorffii]
 gi|300141761|gb|EFJ08470.1| hypothetical protein SELMODRAFT_448096 [Selaginella moellendorffii]
          Length = 351

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 135/268 (50%), Gaps = 48/268 (17%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N  + + F+ ++ LG+G+ G V+   HK+D   YA+K+I V K  ++  V +EA+ L+ L
Sbjct: 101 NTKFNEEFTLIKQLGRGADGVVYMCRHKFDGQVYAVKQIHVRK--DLESVMKEARTLSTL 158

Query: 71  EHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDP--LFNI 128
            H N+V+Y +SW       W +       ++IQM+ C++SLK +LE      DP  L  +
Sbjct: 159 AHANIVKYHTSW-------WEEQPGGGCVVYIQMQYCTSSLKDMLE------DPKALIPV 205

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSE---------- 178
             F+ +++ +EY+HEKK++HRD+   NIF  + N     K+GDFGL K +          
Sbjct: 206 AAFNELVQAVEYLHEKKIIHRDIAPKNIFFDDYNRL---KLGDFGLAKKKLSLPREGGKV 262

Query: 179 ------EPTHLEANTKENDIYCLGVVLKDL---YFPRKSLDDLLIMVEQQGDF------- 222
                  P  LE N   +DI+ LG++L +L   + P     D  + + + G F       
Sbjct: 263 GTGMYSSPKQLE-NEMASDIFSLGMILFELNCRFSPENQDRDSTMQLAKDGIFPKEWEIA 321

Query: 223 -NNIIELIFKMTKMTGSDPPQATKILES 249
              + E I  M     S  P A++IL S
Sbjct: 322 NQELAEKIRSMLHPNRSLRPTASQILAS 349



>gi|511891810|ref|XP_004765593.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Mustela putorius furo]
          Length = 505

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 142/268 (52%), Gaps = 36/268 (13%)

Query: 12  ETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLE 71
           E + K F+++  +G G +G V+ A HK     Y IK++   K EN   V +E +ALA+L 
Sbjct: 228 ERFVKDFTEITPIGSGGYGHVFKAKHKIVGKIYVIKRVKYDK-EN--KVEREVKALAELH 284

Query: 72  HPNVVRYFSSWIQSCNSDWTDLTPVKLTI---FIQMELC--STSLKRVLEKRDGQIDPLF 126
           HPN+V+Y + W            P +  I    IQME C   T  K + E+RD   D   
Sbjct: 285 HPNIVQYCNCWAGEDYHPEDSENPSRSKIKCLLIQMEFCDKGTLEKWIDERRDKTPDKPL 344

Query: 127 NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS-EEPTHLEA 185
           +++++  I +G+EY+H K+L+HRDLK  NIF+  +NT+ I KIGDFGLV S  + T+  +
Sbjct: 345 SLELYEQIAEGVEYIHSKELIHRDLKPSNIFM--VNTKHI-KIGDFGLVTSLRDHTNRTS 401

Query: 186 NT-----------------KENDIYCLGVVLKDLYFPRKSLDDLLIMVEQQGD--FNNII 226
           N                  KE DI+ +G++L +L +   ++ + + + +   D  F ++ 
Sbjct: 402 NKGTLRYMSPEQISSPEYGKEVDIFAMGLILAELLYICPTISETIQIFKALRDEKFPDVF 461

Query: 227 ELI--FKMTKMTGSDP---PQATKILES 249
           +    F + K+   DP   P A++ILE+
Sbjct: 462 DAREKFLLQKLLSHDPTKRPNASEILET 489



>gi|511990376|ref|XP_004812890.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Mustela putorius furo]
          Length = 539

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 142/268 (52%), Gaps = 36/268 (13%)

Query: 12  ETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLE 71
           E + K F+++  +G G +G V+ A HK     Y IK++   K EN   V +E +ALA+L 
Sbjct: 262 ERFVKDFTEITPIGSGGYGHVFKAKHKIVGKIYVIKRVKYDK-EN--KVEREVKALAELH 318

Query: 72  HPNVVRYFSSWIQSCNSDWTDLTPVKLTI---FIQMELC--STSLKRVLEKRDGQIDPLF 126
           HPN+V+Y + W            P +  I    IQME C   T  K + E+RD   D   
Sbjct: 319 HPNIVQYCNCWAGEDYHPEDSENPSRSKIKCLLIQMEFCDKGTLEKWIDERRDKTPDKPL 378

Query: 127 NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS-EEPTHLEA 185
           +++++  I +G+EY+H K+L+HRDLK  NIF+  +NT+ I KIGDFGLV S  + T+  +
Sbjct: 379 SLELYEQIAEGVEYIHSKELIHRDLKPSNIFM--VNTKHI-KIGDFGLVTSLRDHTNRTS 435

Query: 186 NT-----------------KENDIYCLGVVLKDLYFPRKSLDDLLIMVEQQGD--FNNII 226
           N                  KE DI+ +G++L +L +   ++ + + + +   D  F ++ 
Sbjct: 436 NKGTLRYMSPEQISSPEYGKEVDIFAMGLILAELLYICPTISETIQIFKALRDEKFPDVF 495

Query: 227 ELI--FKMTKMTGSDP---PQATKILES 249
           +    F + K+   DP   P A++ILE+
Sbjct: 496 DAREKFLLQKLLSHDPTKRPNASEILET 523



>gi|507480551|gb|AGM48640.1| double stranded RNA-dependent protein kinase [Pteropus alecto]
          Length = 539

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 121/216 (56%), Gaps = 31/216 (14%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F ++  +G G +G V+ A H+ D  TY IK++   K +N  +V +E +ALA L HPN+VR
Sbjct: 268 FLEITSIGSGGYGQVFKAKHRIDGVTYVIKRV---KYDNEKVV-REVKALAALSHPNIVR 323

Query: 78  YFSSW----IQSCNSDWTDLTPVKLTIFIQMELC--STSLKRVLEKRDGQIDPLFNIKIF 131
           Y++ W      S +SD          +FIQME C   T  + + ++RD + D   ++++F
Sbjct: 324 YYNCWDGIDYASEDSDNGRFESCTKCLFIQMEFCEEGTLEQWINKRRDQKTDKHLSLELF 383

Query: 132 HGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV---KSEE--------- 179
             I KG+ ++H K L+HRDLK  NIFL  ++T+ I KIGDFGLV   K++E         
Sbjct: 384 EQIAKGVNFIHSKGLIHRDLKPSNIFL--VDTKKI-KIGDFGLVTFLKNDEKRTNNRGTP 440

Query: 180 ----PTHLEANTKEN--DIYCLGVVLKDLYFPRKSL 209
               P  L +    N  DIY LG++L +L +  ++L
Sbjct: 441 RYMSPEQLSSTEYGNEVDIYPLGLILAELLYISRTL 476



>gi|208690905|gb|ACI31228.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Hylobates alibarbis]
          Length = 551

 Score =  120 bits (301), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 119/222 (53%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D+ TY IK++      N   V +E +ALAKL+H N+V+
Sbjct: 267 FKEIELIGSGGFGQVFKAEHRIDRKTYVIKRVKY----NSERVEREVKALAKLDHVNIVK 322

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL---------TIFIQMELCS-TSLKRVLEKRD 119
           Y   W          S + + +D  P             +FIQME C   +L++ ++ R 
Sbjct: 323 YNGCWDGFDYDPETSSYDPESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIDNRR 382

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-- 176
           G+ +D +  ++ F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV   
Sbjct: 383 GKNLDKVLALEFFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTSL 439

Query: 177 ----------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                           S E   L+   KE D+Y LG++L +L
Sbjct: 440 KNDGKRSRNTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 481



>gi|47523704|ref|NP_999484.1| double stranded RNA-dependent protein kinase [Sus scrofa]
 gi|29292936|dbj|BAC66439.1| double stranded RNA-dependent protein kinase [Sus scrofa]
          Length = 537

 Score =  119 bits (299), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 137/277 (49%), Gaps = 54/277 (19%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKII--VSKVENIYMVFQEAQALA 68
           N  + + F Q++ +G G FG V+ A HK DK TY IK++     KVE      +E +ALA
Sbjct: 261 NPRFVEDFIQIEPIGSGGFGQVFKAKHKIDKKTYVIKRVKYDCEKVE------REVKALA 314

Query: 69  KLEHPNVVRYFSSWIQSCNSDWTDLTPVK---------LTIFIQMELC--STSLKRVLEK 117
            L+HPN+V Y+  W      D  D  P +           +FIQME C   T  + +  +
Sbjct: 315 TLKHPNIVLYYGCW------DGNDYDPEQSMNTLRSKTRCLFIQMEYCDKGTLEQWIDSQ 368

Query: 118 RDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK- 176
           R+ + D    ++ F  I  G+ Y+H K+L+HRDLK  NIFL  ++T  I KIGDFGLV  
Sbjct: 369 RNKEPDKCLALEFFEQITTGVHYIHSKQLIHRDLKPGNIFL--VDTNQI-KIGDFGLVTS 425

Query: 177 -----------------SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMVE-- 217
                            S E +  E    E DIY LG++L +L    ++  + L + E  
Sbjct: 426 LKNDEKRTSRKGTLRYMSPEQSSSEDYGNEVDIYALGLILAELLHICRTFSETLKLFECL 485

Query: 218 QQG--DFNNIIELIFKMTKMTGSDP---PQATKILES 249
           + G  D  N  E    + K+  +DP   P A++IL++
Sbjct: 486 KAGVLDVFNYKEKGL-LRKLLSNDPKKRPNASEILKT 521



>gi|208690879|gb|ACI31215.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Nomascus
           leucogenys]
          Length = 551

 Score =  119 bits (299), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 118/222 (53%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D+ TY IK++      N   V +E +ALAKL+H N+V+
Sbjct: 267 FKEIELIGSGGFGQVFKAEHRIDRKTYVIKRVKY----NSEKVEREVKALAKLDHVNIVK 322

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL---------TIFIQMELCS-TSLKRVLEKRD 119
           Y   W          S + +  D  P             +FIQME C   +L++ ++ R 
Sbjct: 323 YNGCWDGFDYDPETSSYDPESDDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIDNRR 382

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-- 176
           G+ +D +  ++ F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ I KIGDFGLV   
Sbjct: 383 GKKLDKVLALEFFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQI-KIGDFGLVTSL 439

Query: 177 ----------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                           S E   L+   KE D+Y LG++L +L
Sbjct: 440 KNDGKRSRSTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 481



>gi|472381348|ref|XP_004410070.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Odobenus rosmarus divergens]
          Length = 540

 Score =  119 bits (299), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 135/267 (50%), Gaps = 46/267 (17%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F+ +  +G G +G V+ A HK D  TY IK++   K +    V +E +ALA L+HPN+V 
Sbjct: 270 FTDITPIGSGGYGQVFKAKHKIDGKTYVIKRV---KYDTEKKVEREVKALAALDHPNIVH 326

Query: 78  YFSSWI-------QSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQ-IDPLFNI 128
           Y+  W         S NS    +      + IQME C   +L+  +  R G+  D   ++
Sbjct: 327 YYGCWAGKDYHLEDSVNSSRAKIK----CLLIQMEFCDKGTLEAWINNRRGKKPDKRLSL 382

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK------------ 176
           +++  I  G+EY+H K+L+HRDLK  NIFL  +NT+ I KIGDFGLV             
Sbjct: 383 ELYEQIAAGVEYIHGKQLIHRDLKPGNIFL--VNTKHI-KIGDFGLVTSLKDCANRTSNR 439

Query: 177 ------SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLL-----IMVEQQGDFNNI 225
                 S E    +   KE DI+ LG++L +L +   +  + +     +  ++  D  ++
Sbjct: 440 GTFTYMSPEQISSQEYGKEVDIFALGLILAELLYICPTFSETIKIFKDLRTDKFPDVFDV 499

Query: 226 IELIFKMTKMTGSDP---PQATKILES 249
            E I  + K+   DP   P A++ILE+
Sbjct: 500 REKIL-LQKLLAHDPTKRPNASEILET 525



>gi|208690907|gb|ACI31229.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Symphalangus syndactylus]
          Length = 551

 Score =  119 bits (299), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 118/222 (53%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D+ TY IK++      N   V +E +ALAKL+H N+V+
Sbjct: 267 FKEIELIGSGGFGQVFKAEHRIDRKTYVIKRVKY----NSEKVEREVKALAKLDHVNIVK 322

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL---------TIFIQMELCS-TSLKRVLEKRD 119
           Y   W          S + +  D  P             +FIQME C   +L++ ++ R 
Sbjct: 323 YNGCWDGFDYDPETSSYDPESDDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIDNRR 382

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-- 176
           G+ +D +  ++ F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ I KIGDFGLV   
Sbjct: 383 GKKLDKVLALEFFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQI-KIGDFGLVTSL 439

Query: 177 ----------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                           S E   L+   KE D+Y LG++L +L
Sbjct: 440 KTDGKRSRNTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 481



>gi|488549239|ref|XP_004466096.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Dasypus novemcinctus]
          Length = 576

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 90/275 (32%), Positives = 141/275 (51%), Gaps = 49/275 (17%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           ++ + K F++++ +G G +G V+ A H+ DK TY IK++   K +N   V +E +ALA L
Sbjct: 299 DDRFAKDFTEIEPIGTGGYGQVFKAKHRIDKKTYVIKRV---KYDN-KKVEREVKALAAL 354

Query: 71  EHPNVVRYFSSWIQSCNSDWTDLTPVKL---------TIFIQMELC-STSLKRVLEKR-D 119
            H N+V Y+S W      D  D  P K           +FI+ME C   +L+  +EKR D
Sbjct: 355 NHENIVHYYSCW------DGMDYDPEKSINVSRSKTKCLFIKMEFCDQGTLEHWIEKRRD 408

Query: 120 GQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE 179
            + D    + +F  I KG+ Y+H K+L+HRDLK  NIFL  +  + I KIGDFGLV   E
Sbjct: 409 KESDKNLALDLFEQITKGVAYIHSKQLIHRDLKPSNIFL--VGLKKI-KIGDFGLVTPLE 465

Query: 180 ----------------PTHLEANTKEN--DIYCLGVVLKDLYFPRKSLDDLLIMVE--QQ 219
                           P  L +    N  DIY LG++L +L    K++ + + + E  + 
Sbjct: 466 TNEQRTGKKGTFRYMSPEQLSSQEYGNEVDIYALGIILAELLHICKTVRETVKISEDLKM 525

Query: 220 GDFNNIIE-----LIFKMTKMTGSDPPQATKILES 249
           G F ++ +     L+ K+      + P+A  IL++
Sbjct: 526 GIFPDVFDDPEKNLLQKLLSKEPKERPKAPDILKT 560



>gi|384495653|gb|EIE86144.1| hypothetical protein RO3G_10855 [Rhizopus delemar RA 99-880]
          Length = 551

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 106/194 (54%), Gaps = 30/194 (15%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI-IVSKVENIY-MVFQEAQALAKLE 71
           Y   F +  M+G+G F S W A +K D   YA+KKI +  + +  Y  +F+E ++LA+LE
Sbjct: 121 YRNDFIEESMIGRGGFASAWRARNKLDDIIYAVKKIRLFGRDDEKYEHIFREIKSLARLE 180

Query: 72  HPNVVRYFSSWIQSC-----------NSDWT---DLTPVK-------LTIFIQMELCSTS 110
           H NVVRY+SSW++             + D+T   D+  V          ++IQM+LC ++
Sbjct: 181 HRNVVRYYSSWLEYASVLEKEDLDGEDYDYTFEEDIYAVDDSDRIDGFILYIQMQLCPST 240

Query: 111 LKRVLEKRDGQIDPL-------FNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINT 163
           L   +  R+ + +          NI++F  I++G  Y+H++ L+HRDLK  NIF+     
Sbjct: 241 LHECITSRNQKENRKDEDDFRKNNIQLFSQILQGAAYIHQQGLIHRDLKPSNIFISYDAD 300

Query: 164 EFIPKIGDFGLVKS 177
             +PKIGDFGL  S
Sbjct: 301 LTVPKIGDFGLAAS 314



>gi|114326369|ref|NP_001041600.1| interferon-induced, double-stranded RNA-activated protein kinase
           [Canis lupus familiaris]
 gi|62002572|gb|AAX58777.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Canis
           lupus familiaris]
          Length = 532

 Score =  117 bits (292), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 83/261 (31%), Positives = 141/261 (54%), Gaps = 35/261 (13%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F++++ +G G +G V+ A HK D   Y IK++   K ++   V +E +ALA L+H N+V 
Sbjct: 263 FTEIEPIGSGGYGQVFKAKHKIDGKIYVIKRV---KYDSDKKVEREVKALAALDHVNIVH 319

Query: 78  YFSSWIQSCNSDWTDLTPVKLT--IFIQMELCS-TSLKRVLEKRDG-QIDPLFNIKIFHG 133
           Y S W     +    + P + T  +FIQME C   +L++ ++ R G + D    +++F  
Sbjct: 320 YRSCWAGEDYNPEDSVNPSRTTKCLFIQMEFCDKGTLEQWIDNRRGKEQDKPLALELFEQ 379

Query: 134 IMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK----------------- 176
           I+ G+ Y+H K+L+HRDLK  NIFL  ++T+ I KIGDFGLV                  
Sbjct: 380 IVAGVNYIHSKQLIHRDLKPGNIFL--VDTKHI-KIGDFGLVTSLKDFANRTSNKGTLRY 436

Query: 177 -SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMVEQ--QGDFNNIIEL--IFK 231
            S E    +   KE DI+ LG++L +L +   ++ + L + ++   G F+++ +      
Sbjct: 437 MSPEQISSQEYGKEVDIFALGLILAELLYICPTVSETLKIFKELRAGKFSDVFDAREKQL 496

Query: 232 MTKMTGSDP---PQATKILES 249
           + K+   +P   P A++ILE+
Sbjct: 497 LQKLLSLEPMKRPNASEILET 517



>gi|9506993|ref|NP_062208.1| interferon-induced, double-stranded RNA-activated protein kinase
           [Rattus norvegicus]
 gi|81910551|sp|Q63184.1|E2AK2_RAT RecName: Full=Interferon-induced, double-stranded RNA-activated
           protein kinase; AltName: Full=Eukaryotic translation
           initiation factor 2-alpha kinase 2; Short=eIF-2A protein
           kinase 2; AltName: Full=Interferon-inducible
           RNA-dependent protein kinase; AltName: Full=Protein
           kinase RNA-activated; Short=PKR; AltName:
           Full=Tyrosine-protein kinase EIF2AK2
 gi|468373|gb|AAA61926.1| RNA-dependent initiation factor-2 kinase [Rattus norvegicus]
          Length = 513

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 116/221 (52%), Gaps = 36/221 (16%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           ++ + K F  ++ +G G FG V+ A H+ D  TYAIK+I      N     +E QALA+L
Sbjct: 229 DDRFSKDFEDIEEIGSGGFGQVFKAKHRIDGKTYAIKRITY----NTKKAKREVQALAEL 284

Query: 71  EHPNVVRYFSSW------IQSCNSDWTDLTPVKL-TIFIQMELCS-TSLKRVLEKRD-GQ 121
            H N+V+Y   W          NS   D +  K   +FIQME C   +L++ LEKR+  Q
Sbjct: 285 NHANIVQYRVCWEGEDYDYDPENSTNGDTSRYKTRCLFIQMEFCDKGTLQQWLEKRNRSQ 344

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS---- 177
            D    +++F  I+ G++Y+H K L+HRDLK  NIFL  ++ + I KIGDFGL  +    
Sbjct: 345 EDKALVLELFEQIVTGVDYIHSKGLIHRDLKPGNIFL--VDEKHI-KIGDFGLATALEND 401

Query: 178 ----------------EEPTHLEANTKENDIYCLGVVLKDL 202
                           E+ + L    KE DI+ LG++L +L
Sbjct: 402 GNPRTKYTGTPQYMSPEQKSSLVEYGKEVDIFALGLILAEL 442



>gi|149050635|gb|EDM02808.1| rCG61784 [Rattus norvegicus]
          Length = 513

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 116/221 (52%), Gaps = 36/221 (16%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           ++ + K F  ++ +G G FG V+ A H+ D  TYAIK+I      N     +E QALA+L
Sbjct: 229 DDRFSKDFEDIEEIGSGGFGQVFKAKHRIDGKTYAIKRITY----NTKKAKREVQALAEL 284

Query: 71  EHPNVVRYFSSW------IQSCNSDWTDLTPVKL-TIFIQMELCS-TSLKRVLEKRD-GQ 121
            H N+V+Y   W          NS   D +  K   +FIQME C   +L++ LEKR+  Q
Sbjct: 285 NHANIVQYRVCWEGEDYDYDPENSTNGDTSRYKTRCLFIQMEFCDKGTLQQWLEKRNRSQ 344

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS---- 177
            D    +++F  I+ G++Y+H K L+HRDLK  NIFL  ++ + I KIGDFGL  +    
Sbjct: 345 EDKALVLELFEQIVTGVDYIHSKGLIHRDLKPGNIFL--VDEKHI-KIGDFGLATALEND 401

Query: 178 ----------------EEPTHLEANTKENDIYCLGVVLKDL 202
                           E+ + L    KE DI+ LG++L +L
Sbjct: 402 GNPRTKYTGTPQYMSPEQKSSLVEYGKEVDIFALGLILAEL 442



>gi|6467479|gb|AAF13156.1| double stranded RNA activated protein kinase [Homo sapiens]
          Length = 551

 Score =  116 bits (291), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 120/223 (53%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 267 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 322

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +EKR
Sbjct: 323 YNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKC-LFIQMEFCDKGTLEQWIEKR 381

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV S
Sbjct: 382 RGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 438

Query: 178 ----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                             P  + +    KE D+Y LG++L +L
Sbjct: 439 LKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 481



>gi|60812550|gb|AAX36216.1| protein kinase interferon-inducible double stranded RNA dependent
           [synthetic construct]
          Length = 551

 Score =  116 bits (291), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 122/223 (54%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 267 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 322

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +EKR
Sbjct: 323 YNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKC-LFIQMEFCDKGTLEQWIEKR 381

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV-- 175
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV  
Sbjct: 382 RGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 438

Query: 176 --------KSE------EPTHLEAN--TKENDIYCLGVVLKDL 202
                   +SE       P  + +    KE D+Y LG++L +L
Sbjct: 439 LKNDGKRTRSEGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 481



>gi|61364980|gb|AAX42635.1| protein kinase interferon-inducible double stranded RNA dependent
           [synthetic construct]
          Length = 552

 Score =  116 bits (291), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 120/223 (53%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 267 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 322

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +EKR
Sbjct: 323 YNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKC-LFIQMEFCDKGTLEQWIEKR 381

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV S
Sbjct: 382 RGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 438

Query: 178 ----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                             P  + +    KE D+Y LG++L +L
Sbjct: 439 LKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 481



>gi|219520292|gb|AAI43231.1| EIF2AK2 protein [Homo sapiens]
          Length = 546

 Score =  116 bits (291), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 120/223 (53%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 267 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 322

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +EKR
Sbjct: 323 YNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKC-LFIQMEFCDKGTLEQWIEKR 381

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV S
Sbjct: 382 RGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 438

Query: 178 ----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                             P  + +    KE D+Y LG++L +L
Sbjct: 439 LKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 481



>gi|60824577|gb|AAX36685.1| protein kinase interferon-inducible double stranded RNA dependent
           [synthetic construct]
          Length = 552

 Score =  116 bits (290), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 120/223 (53%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 267 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 322

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +EKR
Sbjct: 323 YNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKC-LFIQMEFCDKGTLEQWIEKR 381

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV S
Sbjct: 382 RGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 438

Query: 178 ----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                             P  + +    KE D+Y LG++L +L
Sbjct: 439 LKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 481



>gi|4506103|ref|NP_002750.1| interferon-induced, double-stranded RNA-activated protein kinase
           isoform a [Homo sapiens]
 gi|208431827|ref|NP_001129123.1| interferon-induced, double-stranded RNA-activated protein kinase
           isoform a [Homo sapiens]
 gi|125527|sp|P19525.2|E2AK2_HUMAN RecName: Full=Interferon-induced, double-stranded RNA-activated
           protein kinase; AltName: Full=Eukaryotic translation
           initiation factor 2-alpha kinase 2; Short=eIF-2A protein
           kinase 2; AltName: Full=Interferon-inducible
           RNA-dependent protein kinase; AltName: Full=P1/eIF-2A
           protein kinase; AltName: Full=Protein kinase
           RNA-activated; Short=PKR; AltName: Full=Tyrosine-protein
           kinase EIF2AK2; AltName: Full=p68 kinase
 gi|189506|gb|AAA36409.1| p68 kinase [Homo sapiens]
 gi|189782|gb|AAA18253.1| P1/eIF-2a protein kinase [Homo sapiens]
 gi|1537049|gb|AAC50768.1| interferon-inducible RNA-dependent protein kinase [Homo sapiens]
 gi|28372413|gb|AAO38055.1| protein kinase, interferon-inducible double stranded RNA dependent
           [Homo sapiens]
 gi|61354795|gb|AAX41060.1| protein kinase interferon-inducible double stranded RNA dependent
           [synthetic construct]
 gi|62739920|gb|AAH93676.1| Eukaryotic translation initiation factor 2-alpha kinase 2 [Homo
           sapiens]
 gi|62988930|gb|AAY24317.1| unknown [Homo sapiens]
 gi|75517635|gb|AAI01476.1| Eukaryotic translation initiation factor 2-alpha kinase 2 [Homo
           sapiens]
 gi|119620811|gb|EAX00406.1| eukaryotic translation initiation factor 2-alpha kinase 2, isoform
           CRA_a [Homo sapiens]
 gi|119620812|gb|EAX00407.1| eukaryotic translation initiation factor 2-alpha kinase 2, isoform
           CRA_a [Homo sapiens]
 gi|119620813|gb|EAX00408.1| eukaryotic translation initiation factor 2-alpha kinase 2, isoform
           CRA_a [Homo sapiens]
 gi|119620814|gb|EAX00409.1| eukaryotic translation initiation factor 2-alpha kinase 2, isoform
           CRA_a [Homo sapiens]
 gi|158254742|dbj|BAF83344.1| unnamed protein product [Homo sapiens]
 gi|189054047|dbj|BAG36554.1| unnamed protein product [Homo sapiens]
          Length = 551

 Score =  116 bits (290), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 120/223 (53%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 267 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 322

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +EKR
Sbjct: 323 YNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKC-LFIQMEFCDKGTLEQWIEKR 381

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV S
Sbjct: 382 RGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 438

Query: 178 ----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                             P  + +    KE D+Y LG++L +L
Sbjct: 439 LKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 481



>gi|27371006|gb|AAH40851.1| EIF2AK2 protein, partial [Homo sapiens]
 gi|34784744|gb|AAH57805.1| EIF2AK2 protein, partial [Homo sapiens]
          Length = 513

 Score =  116 bits (290), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 120/223 (53%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 267 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 322

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +EKR
Sbjct: 323 YNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKC-LFIQMEFCDKGTLEQWIEKR 381

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV S
Sbjct: 382 RGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 438

Query: 178 ----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                             P  + +    KE D+Y LG++L +L
Sbjct: 439 LKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 481



>gi|126722609|ref|NP_001075682.1| interferon-induced, double-stranded RNA-activated protein kinase
           [Oryctolagus cuniculus]
 gi|71068410|gb|AAZ23127.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Oryctolagus cuniculus]
          Length = 547

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 115/225 (51%), Gaps = 42/225 (18%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIV--SKVENIYMVFQEAQALA 68
           N  +   F +++ +G G FG V+ A H+ D  TY IK++     KVE      +E +ALA
Sbjct: 262 NPRFANDFKEIEPIGAGGFGQVFKAKHRIDGKTYVIKRVKYDSEKVE------REVKALA 315

Query: 69  KLEHPNVVRYFSSWI------QSCNSDWTDLTPVKLTI-----FIQMELCS-TSLKRVLE 116
            L HPN+V Y+  W+      +S NSD  +   + L +      IQME C   +L + +E
Sbjct: 316 ALTHPNIVHYYGCWVGHDYDPESSNSDTENSMNMNLGVKTRCLLIQMEFCDLGTLDQWIE 375

Query: 117 KRDGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV 175
            R  Q  +    ++ F  I  G++Y+H K+L+HRDLK +NIFL  IN     KIGDFGLV
Sbjct: 376 TRSHQKSEKALALEFFWQITTGLKYIHSKELIHRDLKPNNIFLVAINQ---IKIGDFGLV 432

Query: 176 KSEE----------------PTHLEANT--KENDIYCLGVVLKDL 202
            S +                P  + +    KE DIY LG++L +L
Sbjct: 433 TSLQNNEKRTVNKGTLRYMSPEQISSQNYGKEVDIYALGLILAEL 477



>gi|395846101|ref|XP_003795753.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Otolemur garnettii]
          Length = 570

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 92/291 (31%), Positives = 143/291 (49%), Gaps = 57/291 (19%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N+ + K + +++ +GKG +G V+ A H+ DK TY IK++      N   V +E +ALA L
Sbjct: 278 NDRFAKDYKEIEPIGKGGYGQVFKAKHRIDKKTYVIKRVKY----NSEKVEREVKALAGL 333

Query: 71  -EHPNVVRYFSSW-----------IQSCNSDW------TDLTPVKLTIFIQMELCS-TSL 111
            EH N+VRY   W             +  SD+        L      +FIQME C   +L
Sbjct: 334 DEHENIVRYHGCWDGEDYDPETSGYDTETSDYDSKKNANHLGRTTRCLFIQMEFCDKGTL 393

Query: 112 KRVLEKRDGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIG 170
           ++ ++ R G+  D    ++ F  I KG++++H K+L+HRDLK  NIFL  ++ + I KIG
Sbjct: 394 EQWIDNRRGKKPDKALALEFFEQITKGVDFIHSKQLIHRDLKPSNIFL--VDKKKI-KIG 450

Query: 171 DFGLVKSEE----------------PTHLEAN--TKENDIYCLGVVLKD-LYFPRKSLDD 211
           DFGLV S E                P  + +    KE DIY LG++L + LY    S + 
Sbjct: 451 DFGLVTSLENDEKRTSNRGTRRYMSPEQISSQEYGKEVDIYALGLILAELLYICDTSTET 510

Query: 212 LLIMVEQQGDFNNIIELIFK------MTKMTGSDPPQATKILESDIFNMLS 256
             I ++ +   N ++  +F       + K+   DP +      S+I N LS
Sbjct: 511 AKIFIDLR---NGLVPNVFDNKEKILLQKLLSKDPKERPNT--SEILNTLS 556



>gi|344288852|ref|XP_003416160.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Loxodonta africana]
          Length = 540

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 127/266 (47%), Gaps = 46/266 (17%)

Query: 16  KTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNV 75
           K F +++ +G G +G V+ A H+ DK TY IK++      N   V +E +ALA L H N+
Sbjct: 268 KDFEEIEPIGSGGYGDVFKAKHRIDKKTYVIKRVKY----NNEKVEREVKALANLNHANI 323

Query: 76  VRYFSSWIQSCNSDWTDLTP---------VKLTIFIQMELCS-TSLKRVLEKRDG-QIDP 124
           V Y   W      D  D  P         V   +FIQME C   +L++ +E R G Q D 
Sbjct: 324 VHYHYCW------DGYDYDPENSTNNSRSVTKCLFIQMEFCDKGTLEQWIESRRGKQSDK 377

Query: 125 LFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-------- 176
              + +F  I KG+ Y+H ++L+HRDLK  NIFL  I      KIGDFGLV         
Sbjct: 378 DLALDLFEQITKGVAYIHSQRLIHRDLKPSNIFLVHIKQ---VKIGDFGLVTSLKNDEKR 434

Query: 177 ----------SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMVE--QQGDFNN 224
                     S E   L+    E DI+ LG++L +L     ++ + + +    +QG F +
Sbjct: 435 TVDKGTWRYMSPEQMSLQEYGNEVDIFALGLILAELLHICTTVQETVKIFNDLRQGIFPD 494

Query: 225 IIELIFK--MTKMTGSDPPQATKILE 248
           + +   K  + K+   DP +  K  E
Sbjct: 495 VFDTKEKNLLQKLLSKDPKERLKAPE 520



>gi|440900896|gb|ELR51925.1| Interferon-induced, double-stranded RNA-activated protein kinase
           [Bos grunniens mutus]
          Length = 533

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 109/220 (49%), Gaps = 39/220 (17%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           NE     F+++  +G G FG V+ A HK DK TY IK +      N   V +E +ALA L
Sbjct: 256 NERLVNDFTEVTPIGSGGFGQVFKAKHKIDKKTYVIKCVKY----NSEKVEREVKALATL 311

Query: 71  EHPNVVRYFSSWI-------QSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQ- 121
            HPN+V Y S W        QS NS  +        +FIQME C   +L + +EKR G+ 
Sbjct: 312 NHPNIVHYHSCWDGHDYDPEQSLNSSRSKTR----CLFIQMEYCDKGTLDQWIEKRRGKK 367

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV------ 175
            D    +  F  I  G+ Y+H ++L+HRDLK  NIFL  +N     KIGDFGLV      
Sbjct: 368 PDKRLALDFFQQITTGVHYIHSEQLIHRDLKPGNIFLVAMNQ---IKIGDFGLVTYLKND 424

Query: 176 -------------KSEEPTHLEANTKENDIYCLGVVLKDL 202
                          E+ + ++    E DIY LG++L +L
Sbjct: 425 ETRTSKKGTLRYMSPEQLSSVKDYGNEVDIYALGLILAEL 464



>gi|78101184|pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex.
 gi|78101185|pdb|2A19|C Chain C, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex.
 gi|78101187|pdb|2A1A|B Chain B, Pkr Kinase Domain-Eif2alpha Complex
          Length = 284

 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 117/215 (54%), Gaps = 43/215 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 13  FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 68

Query: 78  YFSSWIQSCNSDWTDLTPVKLT----------IFIQMELCS-TSLKRVLEKRDGQ-IDPL 125
           Y   W      D  D  P   +          +FIQME C   +L++ +EKR G+ +D +
Sbjct: 69  YNGCW------DGFDYDPETSSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKV 122

Query: 126 FNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE------ 179
             +++F  I KG++Y+H KKL++RDLK  NIFL  ++T+ + KIGDFGLV S +      
Sbjct: 123 LALELFEQITKGVDYIHSKKLINRDLKPSNIFL--VDTKQV-KIGDFGLVTSLKNDGKRX 179

Query: 180 ----------PTHLEAN--TKENDIYCLGVVLKDL 202
                     P  + +    KE D+Y LG++L +L
Sbjct: 180 RSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 214



>gi|208690881|gb|ACI31216.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Gorilla
           gorilla]
          Length = 551

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 119/223 (53%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 267 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 322

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +E R
Sbjct: 323 YNGCWDGVDYDPETSDDYLESSDYDPENSKNSSRSKTKC-LFIQMEFCDKGTLEQWIENR 381

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV S
Sbjct: 382 RGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 438

Query: 178 ----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                             P  + +    KE D+Y LG++L +L
Sbjct: 439 LKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 481



>gi|55730356|emb|CAH91900.1| hypothetical protein [Pongo abelii]
          Length = 512

 Score =  114 bits (285), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 114/225 (50%), Gaps = 50/225 (22%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL H N+VR
Sbjct: 267 FIEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLNHVNIVR 322

Query: 78  YFSSW--------IQSCNSDWTDLTP---------VKLTIFIQMELCSTSLKRVLEK--- 117
           Y   W          + + + +D  P             +FIQME C    K  LE+   
Sbjct: 323 YNGCWDGIDYDPETSAYDPESSDYDPENSKNSSRSRTKCLFIQMEFCD---KGTLEQWID 379

Query: 118 --RDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV 175
             R  ++D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV
Sbjct: 380 NTRGKKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLV 436

Query: 176 K------------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                              S E   L+   KE D+Y LG++L +L
Sbjct: 437 TSLTNDVKRTRNTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 481



>gi|208690883|gb|ACI31217.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Pongo
           pygmaeus pygmaeus]
          Length = 551

 Score =  114 bits (285), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 114/225 (50%), Gaps = 50/225 (22%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL H N+VR
Sbjct: 267 FIEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLNHVNIVR 322

Query: 78  YFSSW--------IQSCNSDWTDLTP---------VKLTIFIQMELCSTSLKRVLEK--- 117
           Y   W          + + + +D  P             +FIQME C    K  LE+   
Sbjct: 323 YNGCWDGIDYDPETSAYDPESSDYDPENSKNSSRSRTKCLFIQMEFCD---KGTLEQWID 379

Query: 118 --RDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV 175
             R  ++D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV
Sbjct: 380 NTRGKKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLV 436

Query: 176 K------------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                              S E   L+   KE D+Y LG++L +L
Sbjct: 437 TSLTNDVKRTRNTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 481



>gi|321462490|gb|EFX73513.1| hypothetical protein DAPPUDRAFT_200507 [Daphnia pulex]
          Length = 346

 Score =  114 bits (285), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 104/199 (52%), Gaps = 24/199 (12%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIY-MVFQEAQALAKLEH 72
           Y   F  +Q LG+G FG V+   ++ D   YA+K+I +   E     V +E +ALAKL++
Sbjct: 18  YLTDFEPIQCLGRGGFGLVFEVRNRLDDCHYAVKRIQLPNSEEAREKVMREVKALAKLDN 77

Query: 73  PNVVRYFSSWIQSCNSDWTDLTP---------VKLTIFIQMELCST-SLKRVLEKRDGQI 122
           P++VRYF +WI+ C        P          K+ +FIQM+LC   SL+  L       
Sbjct: 78  PHIVRYFHAWIE-CPPPVQRNVPKTPNYTRSDAKMFLFIQMQLCRKESLREWLRAHVSHR 136

Query: 123 DPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIP----KIGDFGLVKS- 177
           D    I++F+ I++ +EYVH + L+HRDLK  NIF       F P    KIGDFGLV + 
Sbjct: 137 DSYQTIQMFNEIVRAVEYVHLQGLIHRDLKPSNIF-------FAPDGAIKIGDFGLVTAM 189

Query: 178 EEPTHLEANTKENDIYCLG 196
            E       + E ++ C G
Sbjct: 190 AEEASYSPMSPEGNVICGG 208



>gi|281341947|gb|EFB17531.1| hypothetical protein PANDA_002815 [Ailuropoda melanoleuca]
          Length = 371

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 97/165 (58%), Gaps = 11/165 (6%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F+++  +G G +G V+ A HK D  TY IK++   K +    V +E +ALA L HPN+V 
Sbjct: 191 FTEITPIGSGGYGQVFKAKHKIDGKTYVIKRV---KYDKDKKVEREVKALAALRHPNIVH 247

Query: 78  YFSSWIQSCNSDWTDLTPVKLTI---FIQMELCS-TSLKRVLEKRDGQ-IDPLFNIKIFH 132
           Y S W     +    + P +  I    IQME C   +L+  ++ R G+  D   +++++ 
Sbjct: 248 YCSCWAGEDYNPEDSINPSRPKIKCLLIQMEFCDKGTLEAWIDNRRGKKPDKPLSLELYE 307

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            I  G+EY+H ++L+HRDLK  NIFL  +NT+ I KIGDFGLV S
Sbjct: 308 QIAAGVEYIHNQQLIHRDLKPGNIFL--VNTKHI-KIGDFGLVTS 349



>gi|411024135|pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain
 gi|411024136|pdb|3UIU|B Chain B, Crystal Structure Of Apo-Pkr Kinase Domain
          Length = 306

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 121/223 (54%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY I+++      N     +E +ALAKL+H N+V 
Sbjct: 14  FKEIELIGSGGFGQVFKAKHRIDGKTYVIRRVKY----NNEKAEREVKALAKLDHVNIVH 69

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +EKR
Sbjct: 70  YNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK-CLFIQMEFCDKGTLEQWIEKR 128

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV S
Sbjct: 129 RGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 185

Query: 178 EE----------------PTHLEAN--TKENDIYCLGVVLKDL 202
            +                P  + +    KE D+Y LG++L +L
Sbjct: 186 LKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 228



>gi|222537768|ref|NP_001138509.1| interferon-induced, double-stranded RNA-activated protein kinase
           [Pan troglodytes]
 gi|397493624|ref|XP_003817703.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Pan paniscus]
 gi|208690875|gb|ACI31213.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Pan
           paniscus]
 gi|208690877|gb|ACI31214.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Pan
           troglodytes]
          Length = 552

 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 119/223 (53%), Gaps = 46/223 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 267 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 322

Query: 78  YFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKR 118
           Y   W             ++S      NS  +  +  K  +FIQME C   +L++ +E R
Sbjct: 323 YNGCWDGFDYDPETSDDDLESSDYDPENSKNSSRSKTKC-LFIQMEFCDKGTLEQWIEDR 381

Query: 119 DGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFGLV S
Sbjct: 382 RGKKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFGLVTS 438

Query: 178 ----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                             P  + +    KE D+Y LG++L +L
Sbjct: 439 LKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 481



>gi|400260985|pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092,
           Delete A660- T867) At 2.28 A Resolution
 gi|400260986|pdb|4G34|A Chain A, Crystal Structure Of Gsk6924 Bound To Perk (R587-R1092,
           Delete A660- T867) At 2.70 A Resolution
          Length = 299

 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 116/231 (50%), Gaps = 46/231 (19%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIY-MVFQEAQALAKLEH 72
           Y   F  +Q LG+G FG V+ A +K D   YAIK+I +   E     V +E +ALAKLEH
Sbjct: 3   YLTDFEPIQCLGRGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEH 62

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-------TSLKRVLEKRDGQIDPL 125
           P +VRYF++W++   ++    +  K+ ++IQM+LC         + +  +E+R+  +   
Sbjct: 63  PGIVRYFNAWLEKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWMNGRCTIEERERSV--- 119

Query: 126 FNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK--------- 176
             + IF  I + +E++H K L+HRDLK  NIF      + + K+GDFGLV          
Sbjct: 120 -CLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFF---TMDDVVKVGDFGLVTAMDQDEEEQ 175

Query: 177 ----------------------SEEPTHLEANTKENDIYCLGVVLKDLYFP 205
                                 S E  H  + + + DI+ LG++L +L +P
Sbjct: 176 TVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP 226



>gi|426335299|ref|XP_004029165.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Gorilla gorilla gorilla]
          Length = 499

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 120/227 (52%), Gaps = 49/227 (21%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 210 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NNEKAEREVKALAKLDHVNIVH 265

Query: 78  YFSSW-------------IQSCNSD-------WTDLTPVKLT--IFIQMELCS-TSLKRV 114
           Y   W             ++S + D         +  P   T  +FIQME C   +L++ 
Sbjct: 266 YNGCWDGVDYDPETSDDYLESSDYDPENSKNSSRNFIPRSKTKCLFIQMEFCDKGTLEQW 325

Query: 115 LEKRDGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFG 173
           +E R G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  ++T+ + KIGDFG
Sbjct: 326 IENRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--VDTKQV-KIGDFG 382

Query: 174 LVKSEE----------------PTHLEAN--TKENDIYCLGVVLKDL 202
           LV S +                P  + +    KE D+Y LG++L +L
Sbjct: 383 LVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 429



>gi|348574347|ref|XP_003472952.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Cavia porcellus]
          Length = 481

 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 138/271 (50%), Gaps = 41/271 (15%)

Query: 6   SENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQ 65
           +EN  N    K +  +  +G+G +G V+ A HK DK    IK++  +  +    V +EAQ
Sbjct: 209 NENSVNGRIAKDYEDIVPIGEGGYGVVFKAKHKLDKTISVIKRVEYTNSK----VLREAQ 264

Query: 66  ALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQI-D 123
           ALA L HPN+V+Y   W +        L   +  +FI ME C   +L++ +E+R G   D
Sbjct: 265 ALATLNHPNIVQYRYCWKEQ-------LLDGQEYLFISMEFCDKGTLEQWIEQRRGNYSD 317

Query: 124 PLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGL---VKSEE- 179
               +++F  I  G+ YVH K ++HRDLK  NIFL +   E   KIGDFGL   +K++E 
Sbjct: 318 KALGLELFEQITTGVCYVHSKNIIHRDLKPGNIFLVD---EKQIKIGDFGLATSLKTDEK 374

Query: 180 ------------PTHLEAN--TKENDIYCLGVVLKDLYFPRKSLDDLLIMVE--QQGDFN 223
                       P  L +    KE DI+ LG++L +L   R +  + + + +  ++G F+
Sbjct: 375 RTEGTGTKSYMSPEQLNSQDYGKEVDIFALGLILSELIHVRATFQETVAVFKDLRKGIFD 434

Query: 224 NIIE-----LIFKMTKMTGSDPPQATKILES 249
           N+ +     L+ K+        P  ++IL++
Sbjct: 435 NVFDNKEKSLLRKLLAKEPQRRPDTSEILKT 465



>gi|507630811|ref|XP_004627776.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Octodon degus]
          Length = 503

 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/227 (32%), Positives = 124/227 (54%), Gaps = 35/227 (15%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N+ + + +  ++++GKG +G V+ A+HK DK   AIK+   +  + +    +E QALA  
Sbjct: 225 NDWFTRIYENIELIGKGGYGEVFKAIHKLDKTINAIKRTKYNGEKEL----REVQALAAF 280

Query: 71  EHPNVVRYFSSWI-----QSCNSDWTDLTPVKLT-IFIQMELCS-TSLKRVLEKRDGQ-I 122
            HPN+V+Y   W        C+ +    + ++ T +FI ME C   +L++ +E+R G+ +
Sbjct: 281 THPNIVQYRVCWYGEDYDPECSRNIN--SRLRCTCLFISMEFCDKGTLEQWIEQRRGENL 338

Query: 123 DPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGL---VKSEE 179
           D    ++ F  I +G++Y+H K ++HRDLK  NIFL  ++ + I KIGDFGL   +KS+E
Sbjct: 339 DKALALEFFEQITRGVDYIHSKDIIHRDLKPANIFL--VDEKHI-KIGDFGLATSLKSDE 395

Query: 180 PTHLEANT---------------KENDIYCLGVVLKDLYFPRKSLDD 211
               E  T               KE DIY LG++  +L +  K+  +
Sbjct: 396 KRTRERGTERYMSPEQIDSENYGKEVDIYALGLIFGELIYICKTCQE 442



>gi|117935051|ref|NP_835210.2| interferon-induced, double-stranded RNA-activated protein kinase
           [Bos taurus]
 gi|117306699|gb|AAI26647.1| Eukaryotic translation initiation factor 2-alpha kinase 2 [Bos
           taurus]
 gi|296482562|tpg|DAA24677.1| TPA: protein kinase, interferon-inducible double stranded RNA
           dependent [Bos taurus]
          Length = 533

 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 109/220 (49%), Gaps = 39/220 (17%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           NE     F+++  +G G FG V+ A H+ DK TY IK +      N   V +E +ALA L
Sbjct: 256 NERLFNDFTEVTPIGSGGFGQVFKAKHRIDKKTYVIKCVKY----NSEKVEREVKALATL 311

Query: 71  EHPNVVRYFSSWI-------QSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQ- 121
            HPN+V Y + W        QS NS  +        +FIQME C   +L + +EKR G+ 
Sbjct: 312 NHPNIVHYHNCWDGHDYDPEQSLNSSRSKTR----CLFIQMEYCDKGTLDQWIEKRRGKK 367

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV------ 175
            D    +  F  I  G+ Y+H ++L+HRDLK  NIFL  +N     KIGDFGLV      
Sbjct: 368 PDKRLALDFFQQITTGVHYIHSEQLIHRDLKPGNIFLVAMNQ---IKIGDFGLVTYLKND 424

Query: 176 -------------KSEEPTHLEANTKENDIYCLGVVLKDL 202
                          E+ + ++    E DIY LG++L +L
Sbjct: 425 ETRTSKKGTLRYMSPEQLSSVKDYGNEVDIYALGLILAEL 464



>gi|45383189|ref|NP_989818.1| interferon-induced, double-stranded RNA-activated protein kinase
           [Gallus gallus]
 gi|38194196|dbj|BAD01484.1| double-stranded RNA-activated protein kinase [Gallus gallus]
          Length = 550

 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 117/213 (54%), Gaps = 35/213 (16%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI-IVSKVENIYMVFQEAQALAK 69
           +E + + +  ++ +GKG FG+V+ A  + D+ TYAIK++ ++++      V +E + LA 
Sbjct: 272 DERFRQQYKNIEPIGKGGFGNVFKATSRTDERTYAIKRVELINR-----NVKREVKELAN 326

Query: 70  LEHPNVVRYFSSWIQSCNSDWTDLTPVKL----TIFIQMELCSTS-LKRVLEKRDGQIDP 124
           LEH N+VRY+ SW  + +  + D +   +     +FIQMELC    L++ +E   G  +P
Sbjct: 327 LEHENIVRYYCSWEGTDHMIYPDSSKNSIVAVSCLFIQMELCEQGPLEKWIENNGG--NP 384

Query: 125 LFNIKI---FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPT 181
            +++     F  I+KG+EY+H K L+HRDLK  NIFL   + E   KIGDFGLV S    
Sbjct: 385 NYHMMAQDKFLQILKGVEYIHSKDLIHRDLKPQNIFL---SYEGKIKIGDFGLVTSVTYN 441

Query: 182 HLEANT----------------KENDIYCLGVV 198
            L  N                 KE DIY LG++
Sbjct: 442 PLTKNRGTQSYMAPEQFGDRYGKEVDIYALGLI 474



>gi|444723303|gb|ELW63961.1| Interferon-induced, double-stranded RNA-activated protein kinase
           [Tupaia chinensis]
          Length = 458

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 111/211 (52%), Gaps = 30/211 (14%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +G G FG V+ A H+ D  TY IK++      N   V +E  ALA+LEH N+V 
Sbjct: 189 FQEIEHIGSGGFGHVFKAKHRIDGKTYVIKRVKY----NNDKVKREVTALARLEHVNIVH 244

Query: 78  YFSSW---IQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPLFNIKIFHG 133
           Y++ W       ++   +L+     +FIQME C   +L + ++ R  + D    ++ F  
Sbjct: 245 YYNCWEGFDYDPDNSMNNLSLKTKCLFIQMEFCDKGTLDQWIKTRVPRSDKALALEFFKQ 304

Query: 134 IMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV---KSEEPTHLEANTK-- 188
           I  G++Y+H ++L+HRDLK  NIFL  +N   I KIGDFGLV   K+EE       TK  
Sbjct: 305 ITTGVDYIHSQRLIHRDLKPSNIFL--VNETHI-KIGDFGLVTSLKNEEKRTSNRGTKLF 361

Query: 189 -------------ENDIYCLGVVLKD-LYFP 205
                        E DIY LG++L   LY P
Sbjct: 362 MSPEQISSLDYGEEVDIYALGIILAMLLYIP 392



>gi|471358158|ref|XP_004369663.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Trichechus manatus latirostris]
          Length = 545

 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 116/218 (53%), Gaps = 36/218 (16%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N  + K F +++ +G G +G V+ A H+ DK TY IK++   K +N   V +E +ALA L
Sbjct: 268 NSRFVKDFEEIEPIGTGGYGQVFKAKHRIDKKTYVIKRV---KYDN-EKVEREVKALASL 323

Query: 71  EHPNVVRYFSSWIQSCNSDWTDLTPVKLT------IFIQMELC--STSLKRVLEKRDGQI 122
            H N+V Y + W      D+     +  +      +FIQME C   T  + +  +RD + 
Sbjct: 324 NHVNIVHYHNCW---AGDDYDPEISINKSRSMTKCLFIQMEFCDKGTLEQWIDNRRDKKS 380

Query: 123 DPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV---KSEE 179
           D    + +F  I KG+ Y+H K+L+HRDLK  NIFL  ++T+ + KIGDFGLV   K++E
Sbjct: 381 DKDLALDLFEQITKGVAYIHSKRLIHRDLKPSNIFL--VHTKQV-KIGDFGLVTTLKNDE 437

Query: 180 PTHLEANT---------------KENDIYCLGVVLKDL 202
              +E  T                E DI+ LG++L +L
Sbjct: 438 KRTVEKGTLLYMSPEQMSSPEYGNEVDIFTLGLILAEL 475



>gi|221236967|gb|ACM16036.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Aotus
           trivirgatus]
          Length = 549

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 113/222 (50%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G+FG V+ A H+ D+ TY IK++      N   V +E +ALA+L+H N+V 
Sbjct: 269 FEEIELIGSGAFGQVFKAKHRIDRKTYVIKRVKY----NSNKVEREVKALAELDHVNIVH 324

Query: 78  YFSSW----IQSCNSDW----TDLTP---------VKLTIFIQMELCS-TSLKRVLEKRD 119
           Y   W        NS++     D  P             +FIQME C   +L++ ++ R 
Sbjct: 325 YKGCWDGFDYDPENSNYDPESNDYDPENSKNNSRSTTKCLFIQMEFCDKGTLEQWIDDRR 384

Query: 120 G-QIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-- 176
           G ++D + +++ F  I  G++Y+H K L+HRDLK  NIFL +I      KIGDFGLV   
Sbjct: 385 GKELDKVLSLEFFEQITTGVDYIHSKNLIHRDLKPSNIFLVDIKQ---IKIGDFGLVTSL 441

Query: 177 ----------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                           S E    E   KE D+Y LG++  +L
Sbjct: 442 KNDEKRTRNTGTPRYMSPEQNSSEEYGKEVDLYALGLIFAEL 483



>gi|354990646|gb|AER45377.1| double-stranded RNA activated kinase [Takifugu rubripes rubripes]
          Length = 522

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 132/267 (49%), Gaps = 44/267 (16%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F+ + +L +GSFG V+ A  K      A+K   +   ++     +E QAL++L HPN+VR
Sbjct: 247 FNSIDLLAQGSFGYVYKARSKLLGKEMAVK---IVNCDDFRKALREVQALSELNHPNIVR 303

Query: 78  YFSSWIQSCNSDWTDLTPVKLTI---FIQMELCST-SLKRVLEKRD---GQIDPLFNIKI 130
           Y++ W++    +    +    T+   +IQMELCST +L++ + K++    Q     ++ +
Sbjct: 304 YYTCWLEDAGYEGRLRSAQDSTLKYLYIQMELCSTETLRKWINKKNRNQNQWRKEESLSV 363

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE----------- 179
           F  I+ G+EYVH +K +HRDLK +NI     N E   KIGDFGLV +E            
Sbjct: 364 FTQIVSGVEYVHSRKFIHRDLKPENIMFSS-NKEV--KIGDFGLVTAEADDAADLVKRTV 420

Query: 180 ----PTHLEANTKEN-------DIYCLGVVLKDLY--FPRKSLDDLLIMVEQQ------- 219
               P ++    KE        DI+ LG++  +L   FP +   ++   ++ Q       
Sbjct: 421 YKGTPRYMAPEQKEKETYDRKVDIFALGLIYFELLWNFPHEERREVWKNIKTQKTPAAFS 480

Query: 220 GDFNNIIELIFKMTKMTGSDPPQATKI 246
           G +    +LI +M  M   D P+A  +
Sbjct: 481 GSYPFEDQLIKRMLSMKPEDRPEAEAV 507



>gi|29292938|dbj|BAC66440.1| double stranded RNA-dependent protein kinase [Bos taurus]
          Length = 533

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 108/220 (49%), Gaps = 39/220 (17%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           NE     F+++  +G G FG V+ A H+ DK TY IK +      N   V +E +ALA L
Sbjct: 256 NERLFNDFTEVTPIGSGGFGQVFKAKHRIDKKTYVIKCVKY----NSEKVEREVKALATL 311

Query: 71  EHPNVVRYFSSWI-------QSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQ- 121
            HPN+V Y + W        QS NS  +        +FIQME C   +L + +EKR G+ 
Sbjct: 312 NHPNIVHYHNCWDGHDYDPEQSLNSSRSKTR----CLFIQMEYCDKGTLDQWIEKRRGKK 367

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV------ 175
            D    +  F  I  G+ Y+H ++L+HRDLK  NIFL  +      KIGDFGLV      
Sbjct: 368 PDKRLALDFFQQITTGVHYIHSEQLIHRDLKPGNIFLVAMTQN---KIGDFGLVTYLKND 424

Query: 176 -------------KSEEPTHLEANTKENDIYCLGVVLKDL 202
                          E+ + ++    E DIY LG++L +L
Sbjct: 425 ETRTSKKGTLRYMSPEQLSSVKDYGNEVDIYALGLILAEL 464



>gi|208690889|gb|ACI31220.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Cercocebus atys]
          Length = 554

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 113/229 (49%), Gaps = 49/229 (21%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 266 FKEIEFISVGGFGQVFKAKHRIDGKTYVIKRVKY----NSKKAEREVKALAKLDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL--------------TIFIQMELCS-TSLKRV 114
           Y   W        I + + + +DL P                  +FIQME C   +L++ 
Sbjct: 322 YHGCWDGLDYDPEISAYDPESSDLDPESQKNSLRNFIPRSKTKCLFIQMEFCEEGTLEKW 381

Query: 115 LEKRDGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFG 173
           LE R G+ +D +  +++F  I KG++Y+H K ++HRDLK  NIFL + N     KIGDFG
Sbjct: 382 LEDRRGKKLDKVLALELFEQITKGLDYIHSKNIIHRDLKPSNIFLVDTNQ---IKIGDFG 438

Query: 174 LVKS----------------EEPTHLEAN--TKENDIYCLGVVLKDLYF 204
           L  S                  P  + +    KE D+Y LG++L +L +
Sbjct: 439 LATSLKNDVKRTRNTGTLRYMSPEQISSQDYGKEVDLYALGLILAELLY 487



>gi|208690901|gb|ACI31226.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Trachypithecus francoisi]
          Length = 550

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 115/222 (51%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 266 FKEIEFISSGGFGQVFKAKHRIDGKTYVIKRVKY----NGEKAEREVKALAKLDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL---------TIFIQMELCS-TSLKRVLEKRD 119
           Y   W        I + +++  D  P  +          +FIQME C   +L++ +E R 
Sbjct: 322 YNGCWGGLDYDPDISAYDAESPDYDPENIKNSSRLKTKCLFIQMEFCEKGTLEQWIENRR 381

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS- 177
           G+ +D +  +++F  I KG++Y+H K ++HRDLK  NIFL  ++T+ I KIGDFGL  S 
Sbjct: 382 GEKLDKVLALELFEQITKGVDYIHSKNIIHRDLKPSNIFL--VDTKQI-KIGDFGLATSL 438

Query: 178 ---------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                            P  + +    KE D+Y LG++L +L
Sbjct: 439 KNDGKRTRNTGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 480



>gi|402890561|ref|XP_003908553.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like, partial [Papio anubis]
          Length = 293

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 135/281 (48%), Gaps = 56/281 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 5   FKEIEFISVGGFGQVFKAKHRIDGKTYVIKRVKY----NSKKAEREVKALAKLDHVNIVH 60

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL--------------TIFIQMELCS-TSLKRV 114
           Y   W        I + + + +DL P                  +FIQME C   +L++ 
Sbjct: 61  YNGCWDGLDYDPEISAYDPESSDLDPESQKNSLRNFIPRSKTKCLFIQMEFCEEGTLEKW 120

Query: 115 LEKRDGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFG 173
           LE R G+ +D +  +++F  I KG++Y+H K ++HRDLK  NIFL + N     KIGDFG
Sbjct: 121 LEDRRGKKLDKVLALELFEQITKGLDYIHSKNIIHRDLKPSNIFLVDTNQ---IKIGDFG 177

Query: 174 LVKSEE----------------PTHLEAN--TKENDIYCLGVVLKDLYFPRKSLDDLLIM 215
           L  S +                P  + +    KE D+Y LG++L +L +   +  +   +
Sbjct: 178 LATSLKNDVKRTRNTGTLRYMSPEQISSQDYGKEVDLYALGLILAELLYVCDTASETSKL 237

Query: 216 VE--QQGDFNNIIE-----LIFKMTKMTGSDPPQATKILES 249
            +  + G  +N+ +     L+ K+      D P  ++IL +
Sbjct: 238 FQDLRDGTISNVFDKREKTLLEKLLSKKPEDRPNTSEILST 278



>gi|449496746|ref|XP_002191239.2| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Taeniopygia guttata]
          Length = 552

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 107/210 (50%), Gaps = 31/210 (14%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N+T+ + F +++ +G G FG+V+  +   DK TYAIK++  +K      V +EAQ LA+L
Sbjct: 277 NKTFLELFEKIEPIGAGGFGNVFKGISTCDKTTYAIKRVEFTK-----KVEREAQGLARL 331

Query: 71  EHPNVVRYFSSWIQSCNSDWTDLTPVK----LTIFIQMELCSTSLKRVLEKRDGQIDPLF 126
            H N+VRY  SW    +  ++D +       L +FIQME C          +  +    +
Sbjct: 332 THENIVRYHCSWKGEDHMKYSDSSQNSGKKILCLFIQMEFCEQGTLENWIAKPSKDRKYY 391

Query: 127 NI--KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLE 184
            +  K F  I+KG+EY+H +KL+HRDLK  NIF+         KIGDFGLV S     L 
Sbjct: 392 EMAQKRFLQIVKGVEYIHSEKLIHRDLKPQNIFISHNKI----KIGDFGLVTSVAFETLT 447

Query: 185 ANT----------------KENDIYCLGVV 198
            N                 KE DIY LG++
Sbjct: 448 ENRGTKSYMAPEQSGVRYGKEVDIYALGLI 477



>gi|208690895|gb|ACI31223.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Callicebus moloch]
          Length = 551

 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 117/222 (52%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D+ TY IK++      N     +E +ALA+L+H N+V 
Sbjct: 267 FKEIKLIGSGGFGQVFKAKHRIDEKTYVIKRVKY----NSDKAEREVKALAELDHVNIVH 322

Query: 78  YFSSW----IQSCNSDW----TDLTP---------VKLTIFIQMELCS-TSLKRVLEKRD 119
           Y   W        +SD+    +D  P             +FIQME C   +L++ +E R 
Sbjct: 323 YNGCWDGIDYDPESSDYDPESSDYDPENSKNNSRSTANCLFIQMEYCDKGTLEQWIEDRR 382

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSE 178
           G+ +D + +++ F  I  G++Y+H K L+HRDLK  NIFL  ++T+ I KIGDFGLV S 
Sbjct: 383 GKKLDKVLSLEFFEQITTGVDYIHSKNLIHRDLKPSNIFL--VDTKQI-KIGDFGLVTSL 439

Query: 179 E----------------PTHLEAN--TKENDIYCLGVVLKDL 202
           E                P  + +    KE D+Y LG++  +L
Sbjct: 440 ENDEKRTRNAGTLRYMSPEQISSQEYGKEVDLYALGLIFAEL 481



>gi|428174596|gb|EKX43491.1| hypothetical protein GUITHDRAFT_73160 [Guillardia theta CCMP2712]
          Length = 386

 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 92/323 (28%), Positives = 143/323 (44%), Gaps = 80/323 (24%)

Query: 7   ENFSN------ETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIV--SKVENIY 58
           +NF N        Y++ F +LQ LG+G FG+VW   ++ D   YAIKKI +  S  E   
Sbjct: 14  DNFGNFGLSVSSRYKQEFEELQWLGEGGFGAVWMCRNRLDGQKYAIKKIRLDPSNAELNK 73

Query: 59  MVFQEAQALAKLEHPNVVRYFSSWIQSCN----SDWTDLTPVKLT-------IFIQMELC 107
            + +E + L+ L H NVVRY+ +WI+S N    S    L  ++         ++IQME C
Sbjct: 74  KLLREVKTLSGLHHQNVVRYYQAWIESVNDHSGSHRDHLDRLQEAGERDQQMLYIQMEYC 133

Query: 108 STSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIP 167
             +L  V+ +           K+F  ++ G+ Y+H K +VHRDLK  NIFL + + +   
Sbjct: 134 QKTLSEVIIEEGLADKGEATWKLFRQLVSGLAYIHSKGIVHRDLKPKNIFL-DFSGDI-- 190

Query: 168 KIGDFGLVK-------------------------SEEPTHLEA----------------- 185
           KIGD GL +                          E   H+                   
Sbjct: 191 KIGDLGLARYSQKLAEQEDTEDAKGGQQHAYKDNDESSAHVGTMLYLAPEIINGGGKPYK 250

Query: 186 NTKENDIYCLGVVLKDLY------FPR-KSLDDLLIM---------VEQQGDFNNIIELI 229
           +  + DIY +G+VL +++        R  S+D L  M         ++ Q + +N+ +LI
Sbjct: 251 DQSKRDIYAIGIVLFEMWCKFDNVLERITSIDRLRRMDVFPEGFERLQVQANRSNVCQLI 310

Query: 230 FKMTKMTGSDPPQATKILESDIF 252
             +T       P A +ILESD+ 
Sbjct: 311 RWLTHHDPHTRPSALEILESDLL 333



>gi|426226436|ref|XP_004007349.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Ovis aries]
          Length = 543

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 111/217 (51%), Gaps = 38/217 (17%)

Query: 16  KTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNV 75
           K F+++  +G G FG V+ A H+ DK TY IK +      N   V +E + LAKL HPN+
Sbjct: 266 KDFTEITPIGSGGFGRVFKAEHRIDKKTYVIKCVKY----NNEKVEREVKVLAKLNHPNI 321

Query: 76  VRYFSSWI-------QSCNSDWTDLTPVKLT--IFIQMELC--STSLKRVLEKRDGQIDP 124
           V Y S W        +S NS  ++  P   T  +FIQME C   T  + + E+R    D 
Sbjct: 322 VHYHSCWDGVDYDPEESLNSS-SEFYPRSKTKCLFIQMEYCDKGTLAEWIDERRGKDPDK 380

Query: 125 LFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV---KSEE-- 179
              ++ F  I  G+ Y+H ++L+HRDLK  NIFL   N     KIGDFGLV   K++E  
Sbjct: 381 RLALEFFQQITIGVHYIHSEQLIHRDLKPSNIFLVAANH---IKIGDFGLVTYLKNDEMR 437

Query: 180 -----------PTHLEA---NTKENDIYCLGVVLKDL 202
                      P  L++      E DIY LG++L +L
Sbjct: 438 TSKKGTLRYMSPEQLDSVKDYGNEVDIYALGLILAEL 474



>gi|507957834|ref|XP_004686089.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Condylura cristata]
          Length = 542

 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 109/213 (51%), Gaps = 31/213 (14%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           + K F+ ++ +  G +  V+ A HK D   Y IK++  ++ E    V +E +ALA  EHP
Sbjct: 267 FTKDFTDIEYIDSGGYSQVFKARHKIDDKIYVIKRVRYNRRE----VEREVKALAMFEHP 322

Query: 74  NVVRYFSSWIQ---SCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDG-QIDPLFNI 128
           N+V Y+  W        +   D +P    +FIQME C   +L+  +  R G + D    +
Sbjct: 323 NIVHYYGCWDGLDYDPKNSINDSSPKIKCLFIQMEFCGQGTLEDWINGRRGKEPDKSLAL 382

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE--------- 179
           + F  I  G++Y+H+K  +HRDLK  NIFL  ++ + I KIGDFGLV S E         
Sbjct: 383 EFFRQITTGVDYIHKKGFIHRDLKPSNIFL--VDAKQI-KIGDFGLVTSLENDGPRTGKR 439

Query: 180 -------PTHLEANTK---ENDIYCLGVVLKDL 202
                  P  + +  K   E DIY LG++L +L
Sbjct: 440 GTWRYMSPEQISSTKKYGNEVDIYTLGLILAEL 472



>gi|465981509|ref|XP_004265100.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Orcinus orca]
          Length = 542

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 112/215 (52%), Gaps = 39/215 (18%)

Query: 16  KTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNV 75
           + F+++  +G G FG V+ A HK D+ TY IK +      N   V +E +ALA L+H N+
Sbjct: 266 RDFTEITPIGAGGFGQVFKAKHKIDEKTYVIKCVKY----NNEKVEREVKALAMLDHANI 321

Query: 76  VRYFSSWI-------QSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDG-QIDPLF 126
           V Y S W        QS NS  +        +FIQME C   +LK+ ++ R G + D   
Sbjct: 322 VHYHSCWDGLDYDPEQSINSSRSKTR----CLFIQMEYCDKGTLKQWIDSRRGKEQDKRL 377

Query: 127 NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV---KSEEPTHL 183
            +  F  I +G+ Y+H K+L+HRDLK  NIFL  + T  I KIGDFGLV   K++E    
Sbjct: 378 ALVFFEQITEGVHYIHSKQLIHRDLKPHNIFL--VGTNQI-KIGDFGLVTYLKNDEARTS 434

Query: 184 EANTK----------------ENDIYCLGVVLKDL 202
           +  T+                E DI+ LG++L +L
Sbjct: 435 KQGTRLYMSPEQIACIEDYGNEVDIFALGLILAEL 469



>gi|390474609|ref|XP_003734807.1| PREDICTED: LOW QUALITY PROTEIN: interferon-induced, double-stranded
           RNA-activated protein kinase [Callithrix jacchus]
          Length = 552

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 116/222 (52%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D+ TY IK++      N     +E +ALA+L+H N+V 
Sbjct: 268 FKEIKLIGSGGFGQVFKAKHRIDEKTYVIKRVKY----NSDKAEREVKALAELDHVNIVH 323

Query: 78  YFSSW----IQSCNSDW----TDLTP---------VKLTIFIQMELCS-TSLKRVLEKRD 119
           Y   W        +SD+     D  P             +FIQME C   +L++ +E R 
Sbjct: 324 YNGCWDGFDYDPESSDYDPESGDYDPENSKNNSRSTTKCLFIQMEFCDKGTLEQWIEDRR 383

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV--- 175
           G+ +D + +++ F  I  G++Y+H K L+HRDLK  NIFL  ++T+ I KIGDFGLV   
Sbjct: 384 GKKLDKVLSLEFFEQITTGVDYIHSKNLIHRDLKPSNIFL--VDTKQI-KIGDFGLVTSL 440

Query: 176 KSEEPTHLEANT---------------KENDIYCLGVVLKDL 202
           K++E       T               KE D+Y LG++  +L
Sbjct: 441 KNDEKRTRNTGTLRYMSPEQISSQEYGKEVDLYALGLIFAEL 482



>gi|118405094|ref|NP_001072537.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Xenopus
           (Silurana) tropicalis]
 gi|112418622|gb|AAI22034.1| double-stranded RNA activated protein kinase 1 [Xenopus (Silurana)
           tropicalis]
 gi|168984501|emb|CAO98764.1| double-stranded RNA activated protein kinase 1 [Xenopus (Silurana)
           tropicalis]
          Length = 552

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/226 (33%), Positives = 114/226 (50%), Gaps = 41/226 (18%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIY-MVFQEAQALAK 69
           +ET+ + F+++  LG G FG+V  A  K     YAIK++       +Y    +E +ALA 
Sbjct: 269 DETFLRNFTEISRLGSGGFGTVLKAKCKLANKYYAIKRV------KLYDKCVKEVEALAH 322

Query: 70  LEHPNVVRYFSSWI-QSC-------NSDWTDLTPVKLT-IFIQMELCSTSLKRVLEKRDG 120
           L+HPN+VRY  SW  + C       NSD++     K   +FIQME C     +   K   
Sbjct: 323 LDHPNIVRYNHSWTGEDCCSESTYSNSDFSSSPGSKDDYLFIQMEWCEKGTLKSWIKHMN 382

Query: 121 QIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV----- 175
           +++   ++ IF  I++G+ Y+H K L+HRDLK  NIF  E   +   KIGDFGLV     
Sbjct: 383 KVEKFKSLVIFRQIIEGVRYIHSKGLIHRDLKPANIFFAE---DMKIKIGDFGLVTQMTG 439

Query: 176 ------------KSEEP-----THLEANTKENDIYCLGVVLKDLYF 204
                       +  +P      + E    E DI+ LG++L +L++
Sbjct: 440 EADRQALERTKGRGTKPYMAPEQYEETYESEVDIFPLGLILVELFY 485



>gi|56675108|emb|CAH68531.1| Z-DNA binding protein kinase [Danio rerio]
          Length = 446

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 92/173 (53%), Gaps = 22/173 (12%)

Query: 16  KTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI-IVSKVENIYMVFQEAQALAKLEHPN 74
           +TF  ++ LG G +G V    HK D   YA+K++   S+ E       E +ALA+L+HPN
Sbjct: 166 QTFDVIEELGDGGYGFVCKVKHKIDDKIYAVKRVEFNSEAE------PEVKALARLDHPN 219

Query: 75  VVRYFSSWIQSCNSDW-----TDLTPVKLTIFIQMELCS----TSLKRVLEKRDGQIDPL 125
           +VRYF+ W  S N  W     T+    +  +FIQME C     TS       R  Q  PL
Sbjct: 220 IVRYFTCWPDSDN--WMSNQETNEKSNRTYLFIQMEFCEGGTLTSWIGERNYRGKQRIPL 277

Query: 126 FNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSE 178
              +IF+ I  G+EY+H   L+HRDLK DNI   +       KIGDFGLV ++
Sbjct: 278 EIHRIFYEISSGVEYIHSNNLIHRDLKPDNILFNDGKV----KIGDFGLVAAQ 326



>gi|470634653|ref|XP_004322869.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Tursiops truncatus]
          Length = 505

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 113/214 (52%), Gaps = 38/214 (17%)

Query: 16  KTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNV 75
           + F+++  +G+G FG V+ A HK D+ TY IK +      N   V +E +ALA L+H N+
Sbjct: 233 RDFTEITPIGEGGFGQVFKAKHKIDEKTYVIKCVKY----NNEKVEREVKALAMLDHANI 288

Query: 76  VRYFSSWI-------QSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDG-QIDPLF 126
           V Y S W        QS NS  +        +FIQME C   +LK+ +  R G + D   
Sbjct: 289 VHYHSCWDGLDYDPEQSINSSRSKTR----CLFIQMEYCDKGTLKQWINSRRGKEQDKRL 344

Query: 127 NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV---------KS 177
            +  F  I +G+ Y+H K+L+HRDLK  NIFL  + T  I KIGDFGLV          S
Sbjct: 345 ALVFFEQITEGVHYIHSKQLIHRDLKPHNIFL--VGTNQI-KIGDFGLVTYLKNDEARTS 401

Query: 178 EEPTHL----EANTKEN-----DIYCLGVVLKDL 202
           ++ T L    E  T E+     DI+ LG++L +L
Sbjct: 402 KQGTRLYMSPEQATSEDYGNEVDIFALGLILAEL 435



>gi|54289574|gb|AAV32090.1| interferon-induced dsRNA-dependent protein kinase [Chlorocebus
           aethiops]
          Length = 550

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 112/222 (50%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALA+L+H N+V 
Sbjct: 266 FEEIEFISVGGFGQVFKAKHRIDGKTYVIKRVKY----NSKKAEREVKALAELDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL---------TIFIQMELCS-TSLKRVLEKRD 119
           Y   W        I + + +  D  P             +FIQME C   +L+  +E R 
Sbjct: 322 YNGCWDGLDYDPEISAYDPESPDFDPENKKNSLRSKTKCLFIQMEFCEKGTLEEWIEDRK 381

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-- 176
           G+ +D +  +++F  I KG++Y+H K ++HRDLK  NIFL  ++T+ I KIGDFGL    
Sbjct: 382 GKKLDKVLALELFEQITKGLDYIHSKNIIHRDLKPSNIFL--VDTKQI-KIGDFGLATSL 438

Query: 177 ----------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                           S E   L+   KE D+Y LG++L +L
Sbjct: 439 KNDGKRTRNTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 480



>gi|208690885|gb|ACI31218.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Erythrocebus patas]
          Length = 550

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 112/222 (50%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALA+L+H N+V 
Sbjct: 266 FEEIEFISVGGFGQVFKAKHRIDGKTYVIKRVKY----NSKKAEREVKALAELDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL---------TIFIQMELCS-TSLKRVLEKRD 119
           Y   W        I + + +  D  P             +FIQME C   +L+  +E R 
Sbjct: 322 YNGCWDGLDYDPEISAYDPESPDFDPENKKNSLRSKTKCLFIQMEFCEKGTLEEWIEDRK 381

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-- 176
           G+ +D +  +++F  I KG++Y+H K ++HRDLK  NIFL  ++T+ I KIGDFGL    
Sbjct: 382 GKKLDKVLALELFEQITKGLDYIHSKNIIHRDLKPSNIFL--VDTKQI-KIGDFGLATSL 438

Query: 177 ----------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                           S E   L+   KE D+Y LG++L +L
Sbjct: 439 KNDGKRTRNTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 480



>gi|145301625|ref|NP_001077417.1| interferon-induced, double-stranded RNA-activated protein kinase
           [Macaca mulatta]
 gi|134105963|gb|ABO60958.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Macaca
           mulatta]
          Length = 554

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 115/229 (50%), Gaps = 49/229 (21%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 266 FKEIEFISVGGFGQVFKAKHRIDGKTYVIKRVKY----NSKKAEREVKALAKLDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL--------------TIFIQMELC-STSLKRV 114
           Y   W        I +   + TD  P                  +FIQME C   +L+  
Sbjct: 322 YNGCWDGLDYDPEISAYEPESTDFDPENQKNSLRNFIPRSKTKCLFIQMEFCEDGTLEDW 381

Query: 115 LEKRDG-QIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFG 173
           L++R G ++D +  +++F  I KG++Y+H K ++HRDLK  NIFL  ++T+ I KIGDFG
Sbjct: 382 LDRRKGKELDKVLALELFEQITKGLDYIHSKNIIHRDLKPSNIFL--VDTKQI-KIGDFG 438

Query: 174 LVKS-EEPTHLEANT-----------------KENDIYCLGVVLKDLYF 204
           L  S +      +NT                 KE D+Y LG++L +L +
Sbjct: 439 LATSLKNDVKRTSNTGTLRYMSPEQISSQDYGKEVDLYALGLILAELLY 487



>gi|208690903|gb|ACI31227.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Miopithecus talapoin talapoin]
          Length = 550

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 112/222 (50%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALA+L+H N+V 
Sbjct: 266 FEEIEFISVGGFGQVFKAKHRIDGKTYVIKRVKY----NSKKAEREVKALAELDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL---------TIFIQMELCS-TSLKRVLEKRD 119
           Y   W        I + + +  D  P             +FIQME C   +L+  +E R 
Sbjct: 322 YNGCWDGLDYDPEISAYDPESPDFDPENKKNSLRSKTKCLFIQMEFCEKGTLEEWIEDRK 381

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-- 176
           G+ +D +  +++F  I KG++Y+H K ++HRDLK  NIFL  ++T+ I KIGDFGL    
Sbjct: 382 GKKLDKVLALELFEQITKGLDYIHSKNIIHRDLKPSNIFL--VDTKQI-KIGDFGLATSL 438

Query: 177 ----------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                           S E   L+   KE D+Y LG++L +L
Sbjct: 439 KNDGKRTRNTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 480



>gi|208690887|gb|ACI31219.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Macaca
           mulatta]
          Length = 554

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 115/229 (50%), Gaps = 49/229 (21%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 266 FKEIEFISVGGFGQVFKAKHRIDGKTYVIKRVKY----NSKKAEREVKALAKLDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL--------------TIFIQMELC-STSLKRV 114
           Y   W        I +   + TD  P                  +FIQME C   +L+  
Sbjct: 322 YNGCWDGLDYDPEISAYEPESTDFDPENQKNSLRNFIPRSKTKCLFIQMEFCEDGTLEDW 381

Query: 115 LEKRDG-QIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFG 173
           L++R G ++D +  +++F  I KG++Y+H K ++HRDLK  NIFL  ++T+ I KIGDFG
Sbjct: 382 LDRRKGKELDKVLALELFEQITKGLDYIHSKNIIHRDLKPSNIFL--VDTKQI-KIGDFG 438

Query: 174 LVKS-EEPTHLEANT-----------------KENDIYCLGVVLKDLYF 204
           L  S +      +NT                 KE D+Y LG++L +L +
Sbjct: 439 LATSLKNDVKRTSNTGTLRYMSPEQISSQDYGKEVDLYALGLILAELLY 487



>gi|208690891|gb|ACI31221.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Ateles
           geoffroyi]
          Length = 552

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 114/222 (51%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALA+L+H N+V 
Sbjct: 268 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NSDKAEREVKALAELDHVNIVH 323

Query: 78  YFSSW--------IQSCNSDWTDLTP---------VKLTIFIQMELCS-TSLKRVLEKRD 119
           Y   W            + + +D  P             +FIQME C   +L++ +E R 
Sbjct: 324 YNGCWDGFDYDPESDDYDPESSDYDPENSKNNSRSTTKCLFIQMEFCDKGTLEQWIEDRR 383

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV--- 175
           G+ +D + +++ F  I  G++Y+H K L+HRDLK  NIFL  ++T+ I KIGDFGLV   
Sbjct: 384 GKKLDKILSLEFFEQITTGVDYIHSKNLIHRDLKPSNIFL--VDTKQI-KIGDFGLVTSL 440

Query: 176 KSEEPTHLEANT---------------KENDIYCLGVVLKDL 202
           K++E       T               KE D+Y LG++  +L
Sbjct: 441 KNDEKRTRNTGTLRYMSPEQISSQEYGKEVDLYALGLIFAEL 482



>gi|208690873|gb|ACI31212.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Chlorocebus aethiops]
          Length = 550

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 112/222 (50%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALA+L+H N+V 
Sbjct: 266 FEEIKFISVGGFGQVFKAKHRIDGKTYVIKRVKY----NSKKAEREVKALAELDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL---------TIFIQMELCS-TSLKRVLEKRD 119
           Y   W        I + + +  D  P             +FIQME C   +L+  +E R 
Sbjct: 322 YNGCWDGLDYDPEISAYDPESPDFDPENKKNSLRSKTKCLFIQMEFCEKGTLEEWIEDRK 381

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-- 176
           G+ +D +  +++F  I KG++Y+H K ++HRDLK  NIFL  ++T+ I KIGDFGL    
Sbjct: 382 GKKLDKVLALELFEQITKGLDYIHSKNIIHRDLKPSNIFL--VDTKQI-KIGDFGLATSL 438

Query: 177 ----------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                           S E   L+   KE D+Y LG++L +L
Sbjct: 439 KNDGKRTRNTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 480



>gi|108802827|gb|ABG21364.1| eukaryotic translation initiation factor 2 alpha kinase 2
           [Mesocricetus auratus]
          Length = 473

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 136/285 (47%), Gaps = 66/285 (23%)

Query: 10  SNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAK 69
           ++  + + F  ++ +G G FG V+ A H+ D  TYAIK++  +  + +    +E +ALA 
Sbjct: 190 TDSRFNEDFEDIEEIGSGGFGQVFKAKHRIDGKTYAIKRVKYNSEKEV----REVKALAA 245

Query: 70  LEHPNVVRYFSSWIQSCNSDW--------TDLTPVKLT--IFIQMELCSTSLKRVLEK-- 117
           L H N+V+Y   W+     DW           TP   T  +FIQME C    K  LE+  
Sbjct: 246 LSHVNIVQYHFCWL---GQDWEYDTEQSMNSATPRSKTECLFIQMEFCD---KGTLEQWM 299

Query: 118 ---RDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGL 174
              +  ++D    +++   I  G++Y+H K L+HRDLK  NIFL  ++ + I KIGDFGL
Sbjct: 300 TSVKQRKVDNDLFLELAEQITTGVDYIHSKGLIHRDLKPSNIFL--VDEKHI-KIGDFGL 356

Query: 175 VK------------------SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMV 216
           V                   S E   L+   KE DI+ LG++L +L      L   + ++
Sbjct: 357 VTALENDGNRTKNTGSLLYMSPEQLSLQEYGKEVDIFALGLILAEL------LHICITII 410

Query: 217 EQQGDFNNIIELIFK-----------MTKMTGSDP---PQATKIL 247
           E+   F ++ + IF            +TK+    P   P A++IL
Sbjct: 411 EKSKFFTDLRDGIFHDDIFGSKEKRLLTKLLSKKPTDRPSASEIL 455



>gi|334303194|gb|AEG75818.1| eukaryotic translation initiation factor 2 alpha kinase 2 variant 2
           [Mesocricetus auratus]
          Length = 527

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 136/285 (47%), Gaps = 66/285 (23%)

Query: 10  SNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAK 69
           ++  + + F  ++ +G G FG V+ A H+ D  TYAIK++  +  + +    +E +ALA 
Sbjct: 244 TDSRFNEDFEDIEEIGSGGFGQVFKAKHRIDGKTYAIKRVKYNSEKEV----REVKALAA 299

Query: 70  LEHPNVVRYFSSWIQSCNSDW--------TDLTPVKLT--IFIQMELCSTSLKRVLEK-- 117
           L H N+V+Y   W+     DW           TP   T  +FIQME C    K  LE+  
Sbjct: 300 LSHVNIVQYHFCWL---GQDWEYDTEQSMNSATPRSKTECLFIQMEFCD---KGTLEQWM 353

Query: 118 ---RDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGL 174
              +  ++D    +++   I  G++Y+H K L+HRDLK  NIFL  ++ + I KIGDFGL
Sbjct: 354 TSVKQRKVDNDLFLELAEQITTGVDYIHSKGLIHRDLKPSNIFL--VDEKHI-KIGDFGL 410

Query: 175 VK------------------SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMV 216
           V                   S E   L+   KE DI+ LG++L +L      L   + ++
Sbjct: 411 VTALENDGNRTKNTGSLLYMSPEQLSLQEYGKEVDIFALGLILAEL------LHICITII 464

Query: 217 EQQGDFNNIIELIFK-----------MTKMTGSDP---PQATKIL 247
           E+   F ++ + IF            +TK+    P   P A++IL
Sbjct: 465 EKSKFFTDLRDGIFHDDIFGSKEKRLLTKLLSKKPTDRPSASEIL 509



>gi|323451492|gb|EGB07369.1| hypothetical protein AURANDRAFT_13271 [Aureococcus anophagefferens]
          Length = 258

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 117/249 (46%), Gaps = 59/249 (23%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVE----NIYMVFQEAQALAK 69
           YE  F + + LG G FG+V  A ++ D   YAIKKI +S        +  + +E + LA 
Sbjct: 2   YELEFEEHEALGGGGFGTVTRATNRLDDTEYAIKKIRLSSAPAWRPRLEKMLREVKILAL 61

Query: 70  LEHPNVVRYFSSWIQSC-----NSDWTD-----LTPVKLTIFIQMELCST-SLKRVLEKR 118
           L+HPN+VRY+ +W++        +D  D               +M+ CS+ +L+  LE R
Sbjct: 62  LDHPNIVRYYQAWLEQGEAADPRADLEDETTATAAAPAARAAARMQYCSSRTLRDYLEAR 121

Query: 119 D----GQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGL 174
                G +D    ++IF  + +G++YVHE  LVHRDLK  N+FL    T    KIGDFGL
Sbjct: 122 PPQSVGDVDATTALRIFAQVARGLKYVHECGLVHRDLKPANVFLTADGTV---KIGDFGL 178

Query: 175 --------------------VKSEE---------------PTHLEAN--TKENDIYCLGV 197
                                +SE+               P  L ++   ++ D+Y LGV
Sbjct: 179 SRHVRGPDEGDDDEVEVAAVARSEDDDDITVGVGTRLYAAPEQLASDDYDEKADVYSLGV 238

Query: 198 VLKDLYFPR 206
           VL ++  PR
Sbjct: 239 VLYEMLRPR 247



>gi|223993419|ref|XP_002286393.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220977708|gb|EED96034.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 301

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 104/188 (55%), Gaps = 28/188 (14%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIV-------SKV-----ENIYMVF 61
           Y   F +L  LG+G FG+V+   +  D   YAIKKI +        KV     + ++ V 
Sbjct: 2   YRSEFKELSPLGRGGFGTVFRCENALDSREYAIKKIWIKSQLGLDGKVTKHFSQKLHRVL 61

Query: 62  QEAQALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLTI-FIQMELCST-SLKRVLEKRD 119
           +E + LA L+HPN+VRY+++W++  + +   LT  +  I FIQM+LCS  +L   L  R 
Sbjct: 62  REVKILALLDHPNIVRYYTAWLEVDDDEAKLLTTEERHILFIQMQLCSVQTLADFLGNRQ 121

Query: 120 GQI-----------DPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPK 168
            ++           D  F +++F  I+KG++YVH++ L+HRDLK  N F+ +       K
Sbjct: 122 LRVGNVASTDSYAVDIPFALRLFGQIVKGVKYVHKQGLIHRDLKPQNCFIDDGGNV---K 178

Query: 169 IGDFGLVK 176
           +GDFGL +
Sbjct: 179 VGDFGLSR 186



>gi|208690893|gb|ACI31222.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Saguinus
           labiatus]
          Length = 552

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 116/222 (52%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALA+L+H N+V 
Sbjct: 268 FKEIKLIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NSDKAEREVKALAELDHVNIVH 323

Query: 78  YFSSW------IQSCNSD--WTDLTP---------VKLTIFIQMELCS-TSLKRVLEKRD 119
           Y   W       +S + D   +D  P             +FIQME C   +L++ +E R 
Sbjct: 324 YNGCWDGFDYDPESGDYDPESSDYDPENSKNNSRSTTKCLFIQMEFCDKGTLEQWIEDRR 383

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV--- 175
           G+ +D + +++ F  I  G++Y+H K L+HRDLK  NIFL  ++T+ I KIGDFGLV   
Sbjct: 384 GKKLDKVLSLEFFEQITTGVDYIHSKNLIHRDLKPSNIFL--VDTKQI-KIGDFGLVTSL 440

Query: 176 KSEEPTHLEANT---------------KENDIYCLGVVLKDL 202
           K++E       T               KE D+Y LG++  +L
Sbjct: 441 KNDEKRTRNTGTLRYMSPEQISSQEYGKEVDLYALGLIFAEL 482



>gi|410925411|ref|XP_003976174.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Takifugu rubripes]
          Length = 522

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 131/267 (49%), Gaps = 44/267 (16%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F+ + +L +GSFG V+ A  K      A+K   +   ++     +E QAL++L HPN+VR
Sbjct: 247 FNSIDLLAQGSFGYVYKARSKLLGKEMAVK---IVHCDDFRKALREVQALSELNHPNIVR 303

Query: 78  YFSSWIQSCNSDWTDLTPVKLTI---FIQMELCST-SLKRVLEKRD---GQIDPLFNIKI 130
           Y++ W++    +    +    T+   +IQMELCST +L++ + K++    Q     ++ +
Sbjct: 304 YYTCWLEDAGYEGRLRSAQDSTLKYLYIQMELCSTETLRKWINKKNRNQNQWQKEESLSV 363

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE----------- 179
           F  I+ G+EYVH +K +HRDLK +NI     N E   KIGDFGLV +E            
Sbjct: 364 FTQIVSGVEYVHSRKFIHRDLKPENIMFSS-NKEV--KIGDFGLVTAEADDAADLVKRTV 420

Query: 180 ----PTHLEANTKEN-------DIYCLGVVLKDLY--FPRKSLDDLLIMVEQQ------- 219
               P ++    KE        DI+ LG++  +L   F  +   ++   ++ Q       
Sbjct: 421 YKGTPRYMAPEQKEKETYDRKVDIFALGLIYFELLWNFSHEERREVWKNIKTQKTPAAFS 480

Query: 220 GDFNNIIELIFKMTKMTGSDPPQATKI 246
           G +    +LI +M  M   D P+A  +
Sbjct: 481 GSYPFEDQLIKRMLSMKPEDRPEAEAV 507



>gi|200210|gb|AAA39885.1| 65 kD protein kinase [Mus musculus]
          Length = 515

 Score =  107 bits (268), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 122/237 (51%), Gaps = 36/237 (15%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  ++ +G G FG V+ A H+ D   YAIK++      N     +E QALA+L H N+V+
Sbjct: 242 FEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKY----NTEKADREVQALAELNHVNIVQ 297

Query: 78  YFSSWIQSCNSD----WTDLTPVKL-TIFIQMELCS-TSLKRVLEKRD-GQIDPLFNIKI 130
           Y S W +  + D     +D +  K   +FIQME C   +L++ +  R+  ++D    + +
Sbjct: 298 YHSCW-EGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDL 356

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-------------- 176
           +  I+ G+EY+H K L+HRDLK  NIFL  ++   I KIGDFGL                
Sbjct: 357 YEQIVTGVEYIHSKGLIHRDLKPGNIFL--VDERHI-KIGDFGLATALENDGKSRTRRTG 413

Query: 177 -----SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMVE--QQGDFNNII 226
                S E   L+   KE DI+ LG++L +L     +  + +   E  ++GDF+N I
Sbjct: 414 TLQYMSPEQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDI 470



>gi|302756755|ref|XP_002961801.1| hypothetical protein SELMODRAFT_75952 [Selaginella moellendorffii]
 gi|300170460|gb|EFJ37061.1| hypothetical protein SELMODRAFT_75952 [Selaginella moellendorffii]
          Length = 918

 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/314 (26%), Positives = 134/314 (42%), Gaps = 77/314 (24%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N  Y   F +L +LGKG FG V    +K D   YA+KK+ +        + +E   L++L
Sbjct: 87  NSRYLSDFEELCLLGKGGFGHVVLCKNKLDGRRYAMKKVKLKDENPSDKILREVATLSRL 146

Query: 71  EHPNVVRYFSSWIQSC---------------NSDWTDLTP---------VKLTIFIQMEL 106
           +H +VVRY+ +W ++                +S W D TP         V   ++IQME 
Sbjct: 147 QHQHVVRYYQAWFETAAGGSSGTPYGEESEISSSWVD-TPGSSSNDVNTVSTFLYIQMEY 205

Query: 107 CSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFI 166
           C  +L+ V + R   +D      IF  I++G+ ++H + ++HRDL   NIF    N    
Sbjct: 206 CPRTLREVFDTRS-VLDKELTWGIFRQIVEGLSHIHGQGIIHRDLTPSNIFFDTRNDV-- 262

Query: 167 PKIGDFGLVKSEE----------PTHLEANTK---------------------------E 189
            KIGDFGL K  +          P   EAN K                           +
Sbjct: 263 -KIGDFGLAKFADLQNPDQDHRVPVKFEANVKSLEGTGQVGTYFYRAPEIEQAWPHIDEK 321

Query: 190 NDIYCLGVVLKDLYFPRK-------SLDDL----LIMVEQQGDFNNIIELIFKMTKMTGS 238
            D+Y LGV+L +L+ P         +L++L    ++       F +   L+  +      
Sbjct: 322 VDMYSLGVILFELWHPFSTGMERYVTLNELKQQNILPSNWAAKFPHQAALVHLLVSPHPQ 381

Query: 239 DPPQATKILESDIF 252
           D P A ++L+S++ 
Sbjct: 382 DRPSAREVLQSELL 395



>gi|6755160|ref|NP_035293.1| interferon-induced, double-stranded RNA-activated protein kinase
           [Mus musculus]
 gi|2507204|sp|Q03963.2|E2AK2_MOUSE RecName: Full=Interferon-induced, double-stranded RNA-activated
           protein kinase; AltName: Full=Eukaryotic translation
           initiation factor 2-alpha kinase 2; Short=eIF-2A protein
           kinase 2; AltName: Full=Interferon-inducible
           RNA-dependent protein kinase; AltName: Full=P1/eIF-2A
           protein kinase; AltName: Full=Protein kinase
           RNA-activated; Short=PKR; AltName:
           Full=Serine/threonine-protein kinase TIK; AltName:
           Full=Tyrosine-protein kinase EIF2AK2; AltName: Full=p68
           kinase
 gi|536918|gb|AAC24729.1| interferon-inducible RNA-dependent protein kinase [Mus musculus]
 gi|26324546|dbj|BAC26027.1| unnamed protein product [Mus musculus]
          Length = 515

 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 121/237 (51%), Gaps = 36/237 (15%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  ++ +G G FG V+ A H+ D   YAIK++      N      E QALA+L H N+V+
Sbjct: 242 FEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKY----NTEKAEHEVQALAELNHVNIVQ 297

Query: 78  YFSSWIQSCNSD----WTDLTPVKL-TIFIQMELCS-TSLKRVLEKRD-GQIDPLFNIKI 130
           Y S W +  + D     +D +  K   +FIQME C   +L++ +  R+  ++D    + +
Sbjct: 298 YHSCW-EGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDL 356

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-------------- 176
           +  I+ G+EY+H K L+HRDLK  NIFL  ++   I KIGDFGL                
Sbjct: 357 YEQIVTGVEYIHSKGLIHRDLKPGNIFL--VDERHI-KIGDFGLATALENDGKSRTRRTG 413

Query: 177 -----SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMVE--QQGDFNNII 226
                S E   L+   KE DI+ LG++L +L     +  + +   E  ++GDF+N I
Sbjct: 414 TLQYMSPEQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDI 470



>gi|16741143|gb|AAH16422.1| Eif2ak2 protein [Mus musculus]
 gi|117616338|gb|ABK42187.1| Prkr [synthetic construct]
 gi|148706522|gb|EDL38469.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Mus
           musculus]
          Length = 515

 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 121/237 (51%), Gaps = 36/237 (15%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  ++ +G G FG V+ A H+ D   YAIK++      N      E QALA+L H N+V+
Sbjct: 242 FEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKY----NTEKAEHEVQALAELNHVNIVQ 297

Query: 78  YFSSWIQSCNSD----WTDLTPVKL-TIFIQMELCS-TSLKRVLEKRD-GQIDPLFNIKI 130
           Y S W +  + D     +D +  K   +FIQME C   +L++ +  R+  ++D    + +
Sbjct: 298 YHSCW-EGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDL 356

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-------------- 176
           +  I+ G+EY+H K L+HRDLK  NIFL  ++   I KIGDFGL                
Sbjct: 357 YEQIVTGVEYIHSKGLIHRDLKPGNIFL--VDERHI-KIGDFGLATALENDGKSRTRRTG 413

Query: 177 -----SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMVE--QQGDFNNII 226
                S E   L+   KE DI+ LG++L +L     +  + +   E  ++GDF+N I
Sbjct: 414 TLQYMSPEQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDI 470



>gi|208690897|gb|ACI31224.1| eukaryotic translation initiation factor 2-alpha kinase 2
           [Lagothrix lagotricha]
          Length = 552

 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 113/222 (50%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G FG V+ A H+ D  TY IK++      N     +E +ALA+L+H N+V 
Sbjct: 268 FKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY----NSDKAEREVKALAELDHVNIVH 323

Query: 78  YFSSW--------IQSCNSDWTDLTP---------VKLTIFIQMELCS-TSLKRVLEKRD 119
           Y   W            + + +D  P             +FIQME C   +L++ +E R 
Sbjct: 324 YNGCWDGFDYDPESDDYDPESSDYDPENSKNNSRSTTKCLFIQMEFCDKGTLEQWIEDRR 383

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV--- 175
           G+ +D   +++ F  I  G++Y+H K L+HRDLK  NIFL  ++T+ I KIGDFGLV   
Sbjct: 384 GKKLDKALSLEFFEQITTGVDYIHSKNLIHRDLKPSNIFL--VDTKQI-KIGDFGLVTSL 440

Query: 176 KSEEPTHLEANT---------------KENDIYCLGVVLKDL 202
           K++E       T               KE D+Y LG++  +L
Sbjct: 441 KNDEKRTRNTGTLRYMSPEQISSQEYGKEVDLYALGLIFAEL 482



>gi|201068|gb|AAA40150.1| serine/threonine-specific protein kinase [Mus musculus]
          Length = 518

 Score =  107 bits (267), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 121/237 (51%), Gaps = 36/237 (15%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  ++ +G G FG V+ A H+ D   YAIK++      N      E QALA+L H N+V+
Sbjct: 242 FEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKY----NTEKAEHEVQALAELNHVNIVQ 297

Query: 78  YFSSWIQSCNSD----WTDLTPVKL-TIFIQMELCS-TSLKRVLEKRD-GQIDPLFNIKI 130
           Y S W +  + D     +D +  K   +FIQME C   +L++ +  R+  ++D    + +
Sbjct: 298 YHSCW-EGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDL 356

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-------------- 176
           +  I+ G+EY+H K L+HRDLK  NIFL  ++   I KIGDFGL                
Sbjct: 357 YEQIVTGVEYIHSKGLIHRDLKPGNIFL--VDERHI-KIGDFGLATALENDGKSRTRRTG 413

Query: 177 -----SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIMVE--QQGDFNNII 226
                S E   L+   KE DI+ LG++L +L     +  + +   E  ++GDF+N I
Sbjct: 414 TLQYMSPEQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDI 470



>gi|134105965|gb|ABO60959.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Macaca
           mulatta]
          Length = 554

 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 114/229 (49%), Gaps = 49/229 (21%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 266 FKEIEFISVGGFGQVFKAKHRIDGKTYVIKRVKY----NSKKAEREVKALAKLDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL--------------TIFIQMELC-STSLKRV 114
           Y   W        I +   + TD  P                  +FIQME C   +L+  
Sbjct: 322 YNGCWDGLDYDPEISAYEPESTDFDPENQKNSLRNFIPRSKTKCLFIQMEFCEDGTLEDW 381

Query: 115 LEKRDG-QIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFG 173
           L+ R G ++D +  +++F  I KG++Y+H K ++HRDLK  NIFL  ++T+ I KIGDFG
Sbjct: 382 LDNRKGKELDKVLALELFEQITKGLDYIHSKNIIHRDLKPSNIFL--VDTKQI-KIGDFG 438

Query: 174 LVKS-EEPTHLEANT-----------------KENDIYCLGVVLKDLYF 204
           L  S +      +NT                 KE D+Y LG++L +L +
Sbjct: 439 LATSLKNDVKRTSNTGTLRYMSPEQISSQDYGKEVDLYALGLILAELLY 487



>gi|302762907|ref|XP_002964875.1| hypothetical protein SELMODRAFT_83492 [Selaginella moellendorffii]
 gi|300167108|gb|EFJ33713.1| hypothetical protein SELMODRAFT_83492 [Selaginella moellendorffii]
          Length = 881

 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/313 (26%), Positives = 131/313 (41%), Gaps = 75/313 (23%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N  Y   F +L +LGKG FG V    +K D   YA+KK+ +        + +E   L++L
Sbjct: 87  NSRYLSDFEELCLLGKGGFGHVVLCKNKLDGRRYAMKKVKLKDENPSDKILREVATLSRL 146

Query: 71  EHPNVVRYF-----------------------SSWIQSCNSDWTDLTPVKLTIFIQMELC 107
           +H +VVRY+                       SSW+ +  S   D+  V   ++IQME C
Sbjct: 147 QHQHVVRYYQAWFETAAGGSSGTPYGEESEISSSWVDTAGSSSNDVNTVSTFLYIQMEYC 206

Query: 108 STSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIP 167
             +L+ V + R   +D      IF  I++G+ ++H + ++HRDL   NIF    N     
Sbjct: 207 PRTLREVFDTRS-VLDKELTWGIFRQIVEGLSHIHGQGIIHRDLTPSNIFFDTRNDV--- 262

Query: 168 KIGDFGLVKSEE----------PTHLEANTK---------------------------EN 190
           KIGDFGL K  +          P   EAN K                           + 
Sbjct: 263 KIGDFGLAKFADLQNPDQDHRVPVKFEANVKSLEGTGQVGTYFYRAPEIEQAWPHIDEKV 322

Query: 191 DIYCLGVVLKDLYFPRK-------SLDDL----LIMVEQQGDFNNIIELIFKMTKMTGSD 239
           D+Y LGV+L +L+ P         +L++L    ++       F +   L+  +      D
Sbjct: 323 DMYSLGVILFELWHPFSTGMERYVTLNELKQQNILPSNWAAKFPHQAALVHLLVSPHPQD 382

Query: 240 PPQATKILESDIF 252
            P A  +L+S++ 
Sbjct: 383 RPSARDVLQSELL 395



>gi|208690899|gb|ACI31225.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Colobus
           guereza]
          Length = 550

 Score =  107 bits (266), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 112/222 (50%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++ +  G FG V+ A H+ D  TY IK++      N     +E +ALAKL+H N+V 
Sbjct: 266 FKEIEFISLGGFGQVFKAKHRIDGKTYVIKRVKY----NGEKAEREVKALAKLDHVNIVH 321

Query: 78  YFSSW--------IQSCNSDWTDLTPVKL---------TIFIQMELCS-TSLKRVLEKRD 119
           Y   W        I + + +  D  P             +FIQME C   +L+  +E R 
Sbjct: 322 YNGCWDGLDYDPDISAYDPESPDYDPENSKNSSRSKTKCLFIQMEFCEKGTLEEWIEDRR 381

Query: 120 GQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS- 177
           G+ +D +  +++F  I KG++Y+H K ++HRDLK  NIFL  ++T+ I KIGDFGL  S 
Sbjct: 382 GKKLDKVLALELFEQITKGVDYIHSKNIIHRDLKPSNIFL--VDTKQI-KIGDFGLATSL 438

Query: 178 ---------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
                            P  + +    KE D+Y LG++L +L
Sbjct: 439 KNDGKRTRSTGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 480



>gi|147906536|ref|NP_001091256.1| eukaryotic translation initiation factor 2-alpha kinase 2 [Xenopus
           laevis]
 gi|121308150|emb|CAM07152.1| double stranded RNA activated protein kinase 1 [Xenopus laevis]
          Length = 578

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 106/225 (47%), Gaps = 38/225 (16%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           NE + + F+++  LG G FG+V+ A  K     YAIK++ +   + I    +E +ALA L
Sbjct: 294 NEAFRQNFTEISRLGSGGFGTVFKAKSKLANKYYAIKRVKLHSNKCI----KEVEALAHL 349

Query: 71  EHPNVVRYFSSWI--QSCNSDWTDLT----PVKLT---IFIQMELCSTSLKRVLEKRDGQ 121
           +HPN+VRY  SW     C+           P  L    +FI ME C          R  +
Sbjct: 350 DHPNIVRYHHSWTGEDGCSDSSYSSRDYSSPAGLKEEYLFIGMEWCEKGTLESWIARMNK 409

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS---- 177
           ++   ++ IF  +++G+ Y+H K L+HRDLK  NIF  E   +   KIGDFGLV      
Sbjct: 410 VEKFKSLVIFRQVIEGVVYIHSKGLIHRDLKPANIFFAE---DLKIKIGDFGLVTQMTGE 466

Query: 178 ------------------EEPTHLEANTKENDIYCLGVVLKDLYF 204
                                 H E    E DI+ LG++L +L++
Sbjct: 467 ADRQALQRTKGRGTRSYMAPEQHEETYESEVDIFPLGLILVELFY 511



>gi|326915415|ref|XP_003204013.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Meleagris gallopavo]
          Length = 545

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 110/207 (53%), Gaps = 33/207 (15%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI-IVSKVENIYMVFQEAQALAK 69
           +E + + +  ++ +GKG FG+V+ A  + D+ TYA+K++ ++++      V +E + LA 
Sbjct: 272 DERFCQEYKNIEPIGKGGFGNVFKATSRIDERTYAVKRVELINR-----NVKREVKELAN 326

Query: 70  LEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEK-RDGQIDPLFN 127
           LEH N+VRY+ SW  + +  + +L+      FIQMELC    L++ +E  R  Q      
Sbjct: 327 LEHENIVRYYCSWEGTDHMIYPELS------FIQMELCEQGPLEKWIENNRQNQNYHEMA 380

Query: 128 IKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLEANT 187
              F  ++KG+ Y+H K L+HRDLK  NIFL     E   KIGDFGLV S     L  N 
Sbjct: 381 QDKFSQVLKGVRYIHSKNLIHRDLKPQNIFLSH---EGKIKIGDFGLVTSVTYDPLTKNR 437

Query: 188 ----------------KENDIYCLGVV 198
                           KE DIY LG++
Sbjct: 438 GTQSYMAPEQSGDRYGKEVDIYALGLI 464



>gi|163916108|gb|AAI57422.1| Double stranded RNA activated protein kinase 1 [Xenopus laevis]
          Length = 578

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 106/225 (47%), Gaps = 38/225 (16%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           NE + + F+++  LG G FG+V+ A  K     YAIK++ +   + I    +E +ALA L
Sbjct: 294 NEAFRQNFTEISRLGSGGFGTVFKAKSKLANKYYAIKRVKLHSNKCI----KEVEALAHL 349

Query: 71  EHPNVVRYFSSWI--QSCNSDWTDLT----PVKLT---IFIQMELCSTSLKRVLEKRDGQ 121
           +HPN+VRY  SW     C+           P  L    +FI ME C          R  +
Sbjct: 350 DHPNIVRYHHSWTGEDGCSDSSYSSRDYSSPAGLKEEYLFIGMEWCEKGTLESWIARMNK 409

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS---- 177
           ++   ++ IF  +++G+ Y+H K L+HRDLK  NIF  E   +   KIGDFGLV      
Sbjct: 410 VEKFKSLVIFRQVIEGVVYIHSKGLIHRDLKPANIFFAE---DLKIKIGDFGLVTQMTGE 466

Query: 178 ------------------EEPTHLEANTKENDIYCLGVVLKDLYF 204
                                 H E    E DI+ LG++L +L++
Sbjct: 467 ADRQALQRTKGRGTRSYMAPEQHEETYESEVDIFPLGLILVELFY 511



>gi|123437775|ref|XP_001309680.1| STE family protein kinase [Trichomonas vaginalis G3]
 gi|121891417|gb|EAX96750.1| STE family protein kinase [Trichomonas vaginalis G3]
          Length = 364

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 141/290 (48%), Gaps = 54/290 (18%)

Query: 6   SENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVS-KVENIYMVFQEA 64
           +  F    +++ +  L+ +G+G    V+S +H  DK+ YA+KKI +    E    +F E 
Sbjct: 74  TSGFFPSRFQREYQILEKIGEGLNCEVYSVLHLVDKHIYAVKKITIDYDPEECDSLFNET 133

Query: 65  QALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVK------------------LTIFIQMEL 106
           + +AK+ H NVVRY++ W++   SD +++ P++                   + +IQMEL
Sbjct: 134 KIMAKINHKNVVRYYAPWVEFDISD-SNILPIEYSEDHKGKISKRKGGKIHCSFYIQMEL 192

Query: 107 CSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFI 166
           CS   K  + K    I+P+  +     + +G+ Y+H+  +VHRD+K  NI    I  +  
Sbjct: 193 CS---KMPVSKLCQSIEPISVLAKARDVAEGLAYIHQMGIVHRDIKPSNIL---IGMDGE 246

Query: 167 PKIGDFGL---------VKSEEPTHLEAN---------TKENDIYCLGVVLKDLYF-PRK 207
           PKI DFG+         +  E  T L A+         + ++DIY LG+ + DL+  P+ 
Sbjct: 247 PKIADFGISINTDSINEIAMESSTELYASPEHYDSTKISDKSDIYSLGLTMFDLFVRPKT 306

Query: 208 SLDDLLIMVEQQ------GDFNNII---ELIFKMTKMTGSDPPQATKILE 248
            ++ +  MV  +       DF +I    ELI  M +    D P A ++++
Sbjct: 307 KMEHIKTMVNLRKNRVFPDDFPDIPKLKELICHMIEEEPEDRPSAEEVID 356



>gi|403269719|ref|XP_003926863.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Saimiri boliviensis boliviensis]
          Length = 552

 Score =  106 bits (264), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 109/222 (49%), Gaps = 44/222 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F +++++G G+FG V+   H+ D+ TY +K++      N   V +E +ALA+L+H N+V 
Sbjct: 268 FKEIELIGSGAFGQVFKVKHRIDRKTYVVKRVKY----NSEKVEREVKALAELDHVNIVH 323

Query: 78  YFSSW-----------------IQSCNSDWTDLTPVKLTIFIQMELCSTSL--KRVLEKR 118
           Y   W                      +   +L  +   +FIQME C      + + E+R
Sbjct: 324 YNGCWDGFDYDPESSDYDPDSSDYDPENSKNNLRSMTKCLFIQMEFCGKGTLDQWIDERR 383

Query: 119 DGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-- 176
             + D + +++ F  I  G++Y+H K L+HRDLK  NIFL  ++T+ I KIGDFGLV   
Sbjct: 384 GKEQDKVLSLEFFEQITTGVDYIHSKNLIHRDLKPSNIFL--VDTKQI-KIGDFGLVTSL 440

Query: 177 ----------------SEEPTHLEANTKENDIYCLGVVLKDL 202
                           S E    +   KE D+Y LG++  +L
Sbjct: 441 KDDEKRTRNRGTLRYMSPEQISSQEYGKEVDLYALGLIFAEL 482



>gi|224104109|ref|XP_002333983.1| predicted protein [Populus trichocarpa]
 gi|222839460|gb|EEE77797.1| predicted protein [Populus trichocarpa]
          Length = 350

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 100/188 (53%), Gaps = 35/188 (18%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           + K F +++ +GKG++G+V+S MHK D   YA+K +  ++  +   V +E +ALAK  H 
Sbjct: 18  FHKEFYKIKGIGKGAYGTVFSCMHKLDGQAYAVKVVKFNRHNDQDKVLREVKALAKCNHS 77

Query: 74  NVVRYFSSWIQ--------------------SCNSDWTDLTPVKLTIFIQMELCST---- 109
           NVVRYF++WI+                    S +S   D       +FIQME C      
Sbjct: 78  NVVRYFNAWIEWMVVQSSDEDDDYDKEEGDDSASSKSLD-----AMLFIQMEHCHCLLFH 132

Query: 110 -SLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPK 168
            +L  VLE+    I     +K F G++KG++++H KK++H DL   NIF+   N   + K
Sbjct: 133 RNLDNVLEQ--STITEGTALKYFQGMVKGLDHIHGKKIIHGDLSRKNIFIDANN---VIK 187

Query: 169 IGDFGLVK 176
           + DFGL K
Sbjct: 188 VADFGLAK 195



>gi|219114079|ref|XP_002176217.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|219114144|ref|XP_002176246.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217402782|gb|EEC42765.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217402819|gb|EEC42795.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 222

 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 100/181 (55%), Gaps = 15/181 (8%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKV----ENIYMVFQEAQALAK 69
           Y++ F ++ +L  GSFG V+ A +K D   YA+K++  +      +++  V +E   LA 
Sbjct: 2   YKREFDEVGLLSSGSFGQVFRATNKMDGFNYAVKRVPFNATGFSSDSVQQVVREVHCLAV 61

Query: 70  LEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDP---- 124
            +HPNVVRY++SW++            ++ ++IQM+LC   +L   + +R+ ++      
Sbjct: 62  CDHPNVVRYYTSWLEPRKKAAGPSYQYQICLYIQMQLCHPATLADWIRERNRKLHDEHAG 121

Query: 125 ---LFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFL-QEINTEFIPKIGDFGLVKSEEP 180
              +F   IF  +  G+ +VH K +VHRDLK  N+F  Q+   +F  KIGDFGL K  E 
Sbjct: 122 NRLVFAADIFSQLCDGLAHVHSKGIVHRDLKPANVFASQDEKVQF--KIGDFGLSKMIES 179

Query: 181 T 181
           T
Sbjct: 180 T 180



>gi|168984493|emb|CAO98760.1| double-stranded RNA activated protein kinase 1 [Takifugu rubripes]
          Length = 267

 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 131/267 (49%), Gaps = 46/267 (17%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F+ + +L +GSFG V+ A  K      A+K  IV   E      +E QAL++L HPN+VR
Sbjct: 9   FNSIDLLAQGSFGYVYKARSKLLGKEMAVK--IVHCDEK---ALREVQALSELNHPNIVR 63

Query: 78  YFSSWIQSCNSDWTDLTPVKLTI---FIQMELCST-SLKRVLEKRD---GQIDPLFNIKI 130
           Y++ W++    +    +    T+   +IQMELCST +L++ + K++    Q     ++ +
Sbjct: 64  YYTCWLEDAGYEGRLRSAQDSTLKYLYIQMELCSTETLRKWINKKNRNQNQWQKEESLSV 123

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE----------- 179
           F  I+ G+EYVH +K +HRDLK +NI     N E   KIGDFGLV +E            
Sbjct: 124 FTQIVSGVEYVHSRKFIHRDLKPENIMFSS-NKEV--KIGDFGLVTAEADDAADLVKRTV 180

Query: 180 ----PTHLEANTKEN-------DIYCLGVVLKDLY--FPRKSLDDLLIMVEQQ------- 219
               P ++    KE        DI+ LG++  +L   F  +   ++   ++ Q       
Sbjct: 181 YKGTPRYMAPEQKEKETYDRKVDIFALGLIYFELLWNFSHEERREVWKNIKTQKTPAAFS 240

Query: 220 GDFNNIIELIFKMTKMTGSDPPQATKI 246
           G +    +LI +M  M   D P+A  +
Sbjct: 241 GSYPFEDQLIKRMLSMKPEDRPEAEAV 267



>gi|395509391|ref|XP_003758981.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase, partial [Sarcophilus harrisii]
          Length = 497

 Score =  103 bits (257), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 99/175 (56%), Gaps = 12/175 (6%)

Query: 10  SNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAK 69
            NE +   F  +++L +G +G V+  +HK D  +YAIK++   K +N   V +E + LAK
Sbjct: 223 CNERFLNDFYDIEILSRGGYGQVFKGIHKLDNKSYAIKRV---KFDN-EKVRREVKVLAK 278

Query: 70  LEHPNVVRYFSSW-IQSCNSDWTD-LTPVKL-TIFIQMELCSTSLKR--VLEKRDGQIDP 124
           L+H N+++Y   W    C+++ +   +  K+  +FI MELC     R  +  +R  ++D 
Sbjct: 279 LDHENIIKYNLCWDGDDCDTEESGHFSRSKIKCLFIVMELCERGTLRDWIDCRRGSELDK 338

Query: 125 LFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE 179
              + +F  I  G++Y+H   L+HRDLK  NIFL +   E   KIGDFGLV S E
Sbjct: 339 ALPLNLFQQITAGVDYIHSNNLIHRDLKPSNIFLVD---ETKIKIGDFGLVTSLE 390



>gi|443726212|gb|ELU13457.1| hypothetical protein CAPTEDRAFT_216341 [Capitella teleta]
          Length = 553

 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 102/192 (53%), Gaps = 32/192 (16%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           YE  F+ L+ LG+     V+S  H  D   YA+KK+ ++K      V +EA+ LAKLEH 
Sbjct: 243 YEGEFTVLEKLGEED-QDVYSVEHNLDGGRYALKKVSLTKNAVPDEVLKEAKNLAKLEHV 301

Query: 74  NVVRYFSSWIQS------------CNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDG- 120
           NVVRY ++W++             C  +W  L+P    ++IQMELCS +L  +L+ R+  
Sbjct: 302 NVVRYHTAWLEDEAEIRTPRCCEFCLINWIKLSP---KLYIQMELCSETLHHMLKGRNED 358

Query: 121 --QIDPLFNI--------KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQ-----EINTEF 165
              + P             I   I++G++Y+H K +VH DLK+ NIF++     +  TE 
Sbjct: 359 LVSVSPKERYDQVEKDADSILEQILQGVKYIHSKNIVHGDLKSLNIFIKITKDDDDKTEI 418

Query: 166 IPKIGDFGLVKS 177
             KIGDFGL  S
Sbjct: 419 TVKIGDFGLTGS 430



>gi|499018016|ref|XP_004559804.1| PREDICTED: eukaryotic translation initiation factor 2-alpha kinase
           3-like [Maylandia zebra]
          Length = 481

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 90/291 (30%), Positives = 133/291 (45%), Gaps = 63/291 (21%)

Query: 6   SENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQ 65
           SE FSN      F  ++ LGKG+FG V     K  +  YAIK I  ++        +EA 
Sbjct: 182 SEIFSN----SQFDYVEELGKGAFGRVVKVKDKLVEKYYAIKIIRWNE-----KALREAM 232

Query: 66  ALAKLEHPNVVRYFSSWI-----------QSCNSDWTDLTPVKLTIFIQMELCSTS---- 110
           AL+ LEHPN++RYFS W            +SC++     +P K  ++IQMELC T     
Sbjct: 233 ALSDLEHPNIIRYFSCWTGYSGYQSDSTDESCSTQSFTGSPKKY-LYIQMELCDTRTLLD 291

Query: 111 -LKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNI-FLQEINTEFIPK 168
            ++    K+        ++ I   ++ GIEY+H KKL+HRDLK  NI F Q+       K
Sbjct: 292 WIEDWYTKKSNSKRREESLTIAQQMVGGIEYIHSKKLIHRDLKPANILFGQDTKV----K 347

Query: 169 IGDFGLVKSEE----------------PTHLEANTKEN------DIYCLGVV-------L 199
           IGDFGLV +E                 P+++    K        DI+ LG++       +
Sbjct: 348 IGDFGLVTAENDDDDKSPIKRTEEKGTPSYMAPEQKGKNYGRKVDIFALGLIYFELLWKI 407

Query: 200 KDLYFPRKSLDDLL---IMVEQQGDFNNIIELIFKMTKMTGSDPPQATKIL 247
              Y   K+ +D+    +  E    F +    I  M  M   D P+A+K++
Sbjct: 408 SSCYEKYKTWEDIRKQELPQEFASTFISEYITIRSMLSMNPEDRPEASKVI 458



>gi|327262381|ref|XP_003216003.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Anolis carolinensis]
          Length = 439

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 105/186 (56%), Gaps = 19/186 (10%)

Query: 2   SKLMSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVF 61
           SK+++  F +E     F+ ++ L  G +G+V+ A HK D  TYA+K++ + K +     +
Sbjct: 210 SKMVTRKFLSE-----FTDIEKLDSGGYGNVFKAKHKIDNKTYAVKRVKLMKGKE-EKTY 263

Query: 62  QEAQALAKLEHPNVVRYFSSWIQ----SCNSDWTDLTPVKL----TIFIQMELCS-TSLK 112
           +E + LA+L H N+VRYF  WI     +      D++ V++     +FIQM+ C   +LK
Sbjct: 264 KEVKVLAELAHENIVRYFGCWIGEDTFASEESIVDISSVRVRLHNCLFIQMDYCEKGTLK 323

Query: 113 RVLEKRDGQIDPLFNIKI-FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGD 171
           + +E+  G+     ++ + F  IM G+E++H++  +HRDLK  NIF+   N     KIGD
Sbjct: 324 KWMEEDGGKEGYYEDVLLKFQQIMNGVEFIHKQDYIHRDLKPLNIFISGDNN---IKIGD 380

Query: 172 FGLVKS 177
            GL  S
Sbjct: 381 LGLATS 386



>gi|505845357|ref|XP_004616160.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Sorex araneus]
          Length = 483

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 103/210 (49%), Gaps = 33/210 (15%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F+ +  +G G +G V+ A H  D+ TY IK++      + +   +E +ALA L HPN+V 
Sbjct: 204 FTDITPIGSGGYGQVFKARHNIDRKTYVIKRVKY----DSWKAEREVKALAALRHPNIVS 259

Query: 78  YFSSWIQS--CNSDWTDLTPVKLT---IFIQMELCS-TSLKRVLEKRDGQIDP-LFNIKI 130
           Y   W  S  C  D  D +P   T   +FI+ME C   +L++ ++ R  Q       ++ 
Sbjct: 260 YHDCWSGSDRCFRD-PDSSPTSQTTKCLFIKMEFCDKGTLEQWIDSRRSQTPSKALALQF 318

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV--------------- 175
           F  I++G+ Y+H +  +HRDLK  NIFL     E   KIGDFGLV               
Sbjct: 319 FEQIVEGVNYIHGRGFIHRDLKPSNIFLV---GETQVKIGDFGLVTYLRNDSKRTTGMGT 375

Query: 176 -KSEEPTHLEANTKEN--DIYCLGVVLKDL 202
            +   P  L +    N  DI+ LG++  +L
Sbjct: 376 RRYMSPEQLSSTDYGNKVDIFALGIIFVEL 405



>gi|428170935|gb|EKX39856.1| hypothetical protein GUITHDRAFT_76103, partial [Guillardia theta
           CCMP2712]
          Length = 325

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 99/174 (56%), Gaps = 17/174 (9%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI-IVSKVENI-YMVFQEAQALAKLE 71
           Y + F +++ LGKG FG VW   ++ D   YAIKKI + S  E +   + +E + L+ L 
Sbjct: 2   YRQEFEEVKQLGKGGFGEVWMCRNRLDGQCYAIKKIQLDSSNETLNRKMLREVKTLSGLH 61

Query: 72  HPNVVRYFSSWIQSCNSDWT-------DLTPVKLTIFIQMELCSTSLKRVL--EKRDGQI 122
           H ++VRY+ +WI+S   +          L  V++ ++IQME C  +L  V+  E+     
Sbjct: 62  HQSIVRYYQAWIESRQGECGIEEDRDKQLLEVQV-LYIQMEYCEKTLSEVIAYERLYEAP 120

Query: 123 DPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           + L+N  +F  I+ G+ Y+H K +VHRDLK  NIFL + + +   KIGD GL +
Sbjct: 121 ERLWN--LFRQIVSGVAYIHSKGIVHRDLKPKNIFL-DFSGDI--KIGDLGLAR 169



>gi|428185038|gb|EKX53892.1| hypothetical protein GUITHDRAFT_84326 [Guillardia theta CCMP2712]
          Length = 566

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 99/178 (55%), Gaps = 15/178 (8%)

Query: 5   MSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIV--SKVENIYMVFQ 62
           M  + S + +   F ++  +GKG FG V+   H      YAIKKI +  S  E++  V +
Sbjct: 89  MGSHASQQRFRSEFKEVDFIGKGGFGKVYKVYHYLSDREYAIKKIEINDSNAEHVQSVIR 148

Query: 63  EAQALAKLE-HPNVVRYFSSWI-QSCNSDWTDLTPVKLTIFIQME--LCSTSLKRVLEKR 118
           E + LAKL+ H NVVRY+++WI +  ++ W      K T+++QME  +C T  + +  + 
Sbjct: 149 EVRMLAKLDNHGNVVRYYNAWIEEDFSARW------KYTLYLQMEYVMCRTLEEWLSSEN 202

Query: 119 DGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
             ++D   +  I   +   +E++H   +VHRDLK  N+F   I+ + + K+GDFGL +
Sbjct: 203 RKEVDYAESFSIVRQVTCALEWIHSHGVVHRDLKPSNLF---ISIDGVIKLGDFGLAR 257



>gi|512953961|ref|XP_004839354.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Heterocephalus glaber]
          Length = 536

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 104/218 (47%), Gaps = 34/218 (15%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N+ +   +  ++ +G G +G V+ A HK D+    IK++  +  +    V +E  ALA L
Sbjct: 257 NDRFASEYEDIEPIGDGGYGQVFKAKHKLDEKISVIKRVRCTNEK----VLREVHALAAL 312

Query: 71  EHPNVVRYFSSWI-----QSCNSDWTDLTPVKLTIFIQMELC--STSLKRVLEKRDGQID 123
            H N+VRY+  W        C++  T+       +FI ME C   T  K + ++     D
Sbjct: 313 NHTNIVRYYHCWKGIDYDPECSTS-TNPRSRSCCLFISMEFCDKGTLEKWIYQREKSNPD 371

Query: 124 PLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE---- 179
               ++ F  I  G++Y+H K ++HRDLK  NIFL +   E   KIGDFGL  + E    
Sbjct: 372 KALALEFFEQITTGVQYIHSKSIIHRDLKPVNIFLVD---EKQVKIGDFGLATTLENDEK 428

Query: 180 ------------PTHL---EANTKENDIYCLGVVLKDL 202
                       P  L   E   KE DI+ LG++L +L
Sbjct: 429 RTRDKGTMRYMSPEQLASAEDYGKEVDIFALGLILGEL 466



>gi|351711673|gb|EHB14592.1| Interferon-induced, double-stranded RNA-activated protein kinase
           [Heterocephalus glaber]
          Length = 525

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 104/218 (47%), Gaps = 34/218 (15%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N+ +   +  ++ +G G +G V+ A HK D+    IK++  +  +    V +E  ALA L
Sbjct: 246 NDRFASEYEDIEPIGDGGYGQVFKAKHKLDEKISVIKRVRCTNEK----VLREVHALAAL 301

Query: 71  EHPNVVRYFSSWI-----QSCNSDWTDLTPVKLTIFIQMELC--STSLKRVLEKRDGQID 123
            H N+VRY+  W        C++  T+       +FI ME C   T  K + ++     D
Sbjct: 302 NHTNIVRYYHCWKGIDYDPECSTS-TNPRSRSCCLFISMEFCDKGTLEKWIYQREKSNPD 360

Query: 124 PLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE---- 179
               ++ F  I  G++Y+H K ++HRDLK  NIFL +   E   KIGDFGL  + E    
Sbjct: 361 KALALEFFEQITTGVQYIHSKSIIHRDLKPVNIFLVD---EKQVKIGDFGLATTLENDEK 417

Query: 180 ------------PTHL---EANTKENDIYCLGVVLKDL 202
                       P  L   E   KE DI+ LG++L +L
Sbjct: 418 RTRDKGTMRYMSPEQLASAEDYGKEVDIFALGLILGEL 455



>gi|512916093|ref|XP_004903211.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Heterocephalus glaber]
          Length = 536

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 104/218 (47%), Gaps = 34/218 (15%)

Query: 11  NETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL 70
           N+ +   +  ++ +G G +G V+ A HK D+    IK++  +  +    V +E  ALA L
Sbjct: 257 NDRFASEYEDIEPIGDGGYGQVFKAKHKLDEKISVIKRVRCTNEK----VLREVHALAAL 312

Query: 71  EHPNVVRYFSSWI-----QSCNSDWTDLTPVKLTIFIQMELC--STSLKRVLEKRDGQID 123
            H N+VRY+  W        C++  T+       +FI ME C   T  K + ++     D
Sbjct: 313 NHTNIVRYYHCWKGIDYDPECSTS-TNPRSRSCCLFISMEFCDKGTLEKWIYQREKSNPD 371

Query: 124 PLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE---- 179
               ++ F  I  G++Y+H K ++HRDLK  NIFL +   E   KIGDFGL  + E    
Sbjct: 372 KALALEFFEQITTGVQYIHSKSIIHRDLKPVNIFLVD---EKQVKIGDFGLATTLENDEK 428

Query: 180 ------------PTHL---EANTKENDIYCLGVVLKDL 202
                       P  L   E   KE DI+ LG++L +L
Sbjct: 429 RTRDKGTMRYMSPEQLASAEDYGKEVDIFALGLILGEL 466



>gi|225543243|ref|NP_001139363.1| dsRNA-activated protein kinase R [Oncorhynchus mykiss]
 gi|155573866|gb|ABU24345.1| dsRNA-activated protein kinase R [Oncorhynchus mykiss]
          Length = 758

 Score =  100 bits (249), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 102/179 (56%), Gaps = 22/179 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  ++ +GKG FG+V+ A  + ++  +A+K I++SK +      +E  ALA L+HPN+VR
Sbjct: 462 FDSIEKIGKGGFGNVYKARRELEQKYFAVK-IVLSKGK----AKREVGALADLQHPNIVR 516

Query: 78  YFSSWIQ----SCNSDWTDLTPVKLT-------IFIQMELCS-TSLKRVLEKRDGQIDPL 125
           Y+++W++     C++     T            ++IQMELC   +LK  +++R+    P 
Sbjct: 517 YYTAWLEDTAYRCDTTSESDTTSDSGSSSSSEFLYIQMELCDKRTLKVWIDERNAHRKPK 576

Query: 126 F---NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIP--KIGDFGLVKSEE 179
               ++ I   I+ G+EY+H KKL+HRDLK  NI     + E     KIGDFGLV +E+
Sbjct: 577 RREESLHITQQIVNGVEYIHSKKLLHRDLKPANIMFGMSDGEGKGEVKIGDFGLVTAED 635



>gi|348507393|ref|XP_003441240.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Oreochromis niloticus]
          Length = 487

 Score =  100 bits (248), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 86/281 (30%), Positives = 134/281 (47%), Gaps = 60/281 (21%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  ++ LG+G++G V     K  +  YAIK II  K +      +EA+AL+ L HPN+VR
Sbjct: 193 FDYVEELGEGAYGRVLKVKDKLVERYYAIK-IIRWKEK----ALREAKALSDLNHPNIVR 247

Query: 78  YFSSWI-----------QSCNSDWTDLTPVKLTIFIQMELCST-SLKRVLEKRDGQIDP- 124
           Y S W            +SC++  +     K  ++IQMELC T +L+  +++R+ +    
Sbjct: 248 YHSCWPGDSGYQLDSTDESCSASQSSTGSPKKCLYIQMELCDTKTLRHWIDERNKKKSSQ 307

Query: 125 -----LFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNI-FLQEINTEFIPKIGDFGLVKSE 178
                L ++ I   ++ GIEY+H K L+HRDLK  NI F Q+       KIGDFGLV +E
Sbjct: 308 NSKRRLESLNIVQQMVSGIEYIHSKNLIHRDLKPANILFGQDTKV----KIGDFGLVTAE 363

Query: 179 ---------------------EPTHLEAN-TKENDIYCLGVVLKDLYFPRKSL------- 209
                                 P   E N  ++ DI+ LG++  +L +   ++       
Sbjct: 364 NNDDDKTPMERTLDKGTPHYMAPEQSETNYGRKVDIFALGLIYFELLWKISTVHEKCEIW 423

Query: 210 DDLL---IMVEQQGDFNNIIELIFKMTKMTGSDPPQATKIL 247
           DD+    +  E    F +   +I  M  M   D P+A+KI+
Sbjct: 424 DDIRKQKLPREFAFSFTSEYIIIRSMLSMKPEDRPEASKII 464



>gi|155573864|gb|ABU24344.1| dsRNA-activated protein kinase R [Salmo salar]
          Length = 713

 Score =  100 bits (248), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 64/183 (34%), Positives = 101/183 (55%), Gaps = 22/183 (12%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           +   F  ++ +GKG FG V+ A  K ++  +A+K I+ SK +      +E  ALA L+HP
Sbjct: 413 FSSEFDSIENIGKGGFGHVYKARRKLEQKYFAVK-IVRSKGK----AKREVGALADLQHP 467

Query: 74  NVVRYFSSWIQ----SCNSDWTDLTPVKLT-------IFIQMELCS-TSLKRVLEKRDGQ 121
           N+VRY+++W++     C++     T            ++IQMELC   +LK  +++R+  
Sbjct: 468 NIVRYYTAWLEDTAYRCDTASESDTTSDSGSSSSSEFLYIQMELCDKRTLKVWIDERNAH 527

Query: 122 IDPLF---NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIP--KIGDFGLVK 176
             P     ++ I   I+ G+EY+H KKL+HRDLK  NI     + E     KIGDFGLV 
Sbjct: 528 RKPKRREESLSITQQIVNGVEYIHSKKLLHRDLKPANIMFGMSDGEGKGEVKIGDFGLVT 587

Query: 177 SEE 179
           +E+
Sbjct: 588 AED 590



>gi|219968357|emb|CAO98758.1| double-stranded RNA activated protein kinase 1 [Tetraodon
           nigroviridis]
          Length = 667

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 95/166 (57%), Gaps = 15/166 (9%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  +  LG G +G V+ A +K   +  A+K ++  +        +EAQAL+ L+H N++R
Sbjct: 392 FDSISRLGSGGYGHVFKARNKLLGSEMAVKIVLCDE-----KALREAQALSDLDHCNIIR 446

Query: 78  YFSSWIQSCNSDWTDLTPVKLT----IFIQMELCST-SLKRVLEKRD---GQIDPLFNIK 129
           Y++ W++    D     P + +    ++IQMELCST +LK  +EK +    Q     ++ 
Sbjct: 447 YYTCWLEDSGYD-RRSPPYQDSSLKYLYIQMELCSTENLKLWIEKMNHNQNQERKKKSLS 505

Query: 130 IFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV 175
           IF  I+ G+EY+H + L+HRDLK +NI   +   E + KIGDFGLV
Sbjct: 506 IFRQIVSGVEYIHSRNLIHRDLKPENIMFSKKEKEKV-KIGDFGLV 550



>gi|164508744|emb|CAM07147.1| double stranded RNA activated protein kinase 1 [Tetraodon
           nigroviridis]
          Length = 667

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 94/166 (56%), Gaps = 15/166 (9%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  +  LG G FG V+ A +K   +  A+K +   +        +EAQAL+ L+H N++R
Sbjct: 392 FDSISRLGSGGFGHVFKARNKLLGSEMAVKIVPCDE-----KALREAQALSDLDHCNIIR 446

Query: 78  YFSSWIQSCNSDWTDLTPVKLT----IFIQMELCST-SLKRVLEKRD---GQIDPLFNIK 129
           Y++ W++    D     P + +    ++IQMELCST +LK  +EK +    Q     ++ 
Sbjct: 447 YYTCWLEDSGYD-RRSPPYQDSSLKYLYIQMELCSTENLKLWIEKMNHNQNQERKKKSLS 505

Query: 130 IFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV 175
           IF  I+ G+EY+H + L+HRDLK +NI   +   E + KIGDFGLV
Sbjct: 506 IFRQIVSGVEYIHSRNLIHRDLKPENIMFSKKEKEKV-KIGDFGLV 550



>gi|29125872|emb|CAD67790.1| double stranded RNA-activated protein kinase 1 [Tetraodon
           nigroviridis]
          Length = 208

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 94/166 (56%), Gaps = 15/166 (9%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  +  LG G +G V+ A +K   +  A+K +   K        +EAQAL+ L+H N++R
Sbjct: 23  FDSISRLGSGGYGHVFKARNKLLGSEMAVKIVPCDK-----KALREAQALSDLDHCNIIR 77

Query: 78  YFSSWIQSCNSDWTDLTPVKLT----IFIQMELCST-SLKRVLEKRD---GQIDPLFNIK 129
           Y++ W++    D     P + +    ++IQMELCST +LK  +EK +    Q     ++ 
Sbjct: 78  YYTCWLEDSGYDRRS-PPYQDSSLKYLYIQMELCSTENLKLWIEKMNHNQNQERKKKSLS 136

Query: 130 IFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV 175
           IF  I+ G+EY+H + L+HRDLK +NI   +   E + KIGDFGLV
Sbjct: 137 IFRQIVSGVEYIHSRNLIHRDLKPENIMFSKKEKEKV-KIGDFGLV 181



>gi|71042556|pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g
           Hyperactivating Mutant In Apo Form.
 gi|71042557|pdb|1ZY4|B Chain B, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g
           Hyperactivating Mutant In Apo Form.
 gi|71042558|pdb|1ZY5|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g
           Hyperactivating Mutant Complexed With Amppnp.
 gi|71042559|pdb|1ZY5|B Chain B, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g
           Hyperactivating Mutant Complexed With Amppnp.
          Length = 303

 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 93/169 (55%), Gaps = 12/169 (7%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           Y   F ++ +LG+G+FG V  A +  D   YAIKKI  ++ E +  +  E   LA L H 
Sbjct: 4   YASDFEEIAVLGQGAFGQVVKARNALDSRYYAIKKIRHTE-EKLSTILSEVMLLASLNHQ 62

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVK--LTIFIQMELCSTSLKRVL---EKRDGQIDPLFNI 128
            VVRY+++W++  N     +T VK   T+FIQME C       L   E  + Q D  +  
Sbjct: 63  YVVRYYAAWLERRNF-VKPMTAVKKKSTLFIQMEYCENGTLYDLIHSENLNQQRDEYW-- 119

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
           ++F  I++ + Y+H + ++HRDLK  NIF+ E       KIGDFGL K+
Sbjct: 120 RLFRQILEALSYIHSQGIIHRDLKPMNIFIDESRN---VKIGDFGLAKN 165



>gi|71042560|pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild-
           Type In Apo Form.
 gi|71042561|pdb|1ZYC|B Chain B, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild-
           Type In Apo Form.
 gi|71042562|pdb|1ZYC|C Chain C, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild-
           Type In Apo Form.
 gi|71042563|pdb|1ZYC|D Chain D, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild-
           Type In Apo Form.
 gi|71042564|pdb|1ZYD|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild-
           Type Complexed With Atp.
 gi|71042565|pdb|1ZYD|B Chain B, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild-
           Type Complexed With Atp.
          Length = 303

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 93/169 (55%), Gaps = 12/169 (7%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           Y   F ++ +LG+G+FG V  A +  D   YAIKKI  ++ E +  +  E   LA L H 
Sbjct: 4   YASDFEEIAVLGQGAFGQVVKARNALDSRYYAIKKIRHTE-EKLSTILSEVMLLASLNHQ 62

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVK--LTIFIQMELCSTSLKRVL---EKRDGQIDPLFNI 128
            VVRY+++W++  N     +T VK   T+FIQME C       L   E  + Q D  +  
Sbjct: 63  YVVRYYAAWLERRNF-VKPMTAVKKKSTLFIQMEYCENRTLYDLIHSENLNQQRDEYW-- 119

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
           ++F  I++ + Y+H + ++HRDLK  NIF+ E       KIGDFGL K+
Sbjct: 120 RLFRQILEALSYIHSQGIIHRDLKPMNIFIDESRN---VKIGDFGLAKN 165



>gi|168984503|emb|CAO98765.1| double-stranded RNA activated protein kinase 2 [Xenopus (Silurana)
           tropicalis]
          Length = 273

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 105/223 (47%), Gaps = 46/223 (20%)

Query: 16  KTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNV 75
           + F  +  L  G FG V+ A    D N YA+KK+ +   +       E QALA+L+HPN+
Sbjct: 7   REFENVTELSSGGFGIVYKAWKPMDLNYYAVKKVKMYNEK----CKSEVQALARLDHPNI 62

Query: 76  VRYFSSWIQSCNSDWTDLTPVKLT------------IFIQMELCSTSLKRVLEKRDGQID 123
           VRYF+SW      D+   T    +            ++IQME C     R   +   ++D
Sbjct: 63  VRYFNSWT---GMDYFLDTSSLSSSSSSDTDGRNEYLYIQMEFCENGDLRNWIREMKEVD 119

Query: 124 PLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK------- 176
              ++ IF  I+KG+ Y+H +KL+HRDLK +NIF  +       KIGDFGLV        
Sbjct: 120 KKNSLDIFWQIVKGVAYIHSQKLIHRDLKPENIFFSKDKK---VKIGDFGLVTQIFSEGS 176

Query: 177 ----------------SEEPTHLEAN-TKENDIYCLGVVLKDL 202
                           + E  H + N   E DI+ LG++L +L
Sbjct: 177 TKALLRTHGTGTYPYMAPEQQHKKTNYNSEVDIFALGLILVEL 219



>gi|307190380|gb|EFN74439.1| Serine/threonine-protein kinase Nek5 [Camponotus floridanus]
          Length = 1182

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 76/268 (28%), Positives = 126/268 (47%), Gaps = 45/268 (16%)

Query: 12  ETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIK--KIIVSKVENIYMVFQEAQALAK 69
           + Y   ++   +LGKG+FG+V+    K D   + IK   +   K         E + L +
Sbjct: 2   DPYIDDYTFESILGKGTFGTVYLVRRKKDLKLFVIKAQDLDAIKYSPSKRALAEIRCLKR 61

Query: 70  LEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPLFNI 128
           L HPN+V Y+ +W ++  S            FI ME  +  +LK +LEKR+  +     +
Sbjct: 62  LRHPNIVFYYGAWKKNNQS------------FILMEYATRCTLKDLLEKREKPLKEEDAL 109

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS--EEPTHLEAN 186
            +F  +  G+ ++H  K++HRDLK +NI L     + + KIGDFGL KS  E+P    A 
Sbjct: 110 YLFSQVTLGVHHIHSNKILHRDLKPENIMLTGSRGDIV-KIGDFGLAKSIQEDPITCHAG 168

Query: 187 TK---------------ENDIYCLGVVL-----KDLYFPRKSLDDLLIMVEQ-------Q 219
           +                + DI+ +GV+L     K L FP  +L+++  +V         Q
Sbjct: 169 SYYYMAPEMFTVQSYELKCDIWSMGVILYEMITKRLPFPATNLEEITKLVFNSPPRPLPQ 228

Query: 220 GDFNNIIELIFKMTKMTGSDPPQATKIL 247
               +I+ LI KM +   S  P+  +++
Sbjct: 229 QTSASIVNLISKMLRKQSSSRPRTDQLV 256



>gi|359478149|ref|XP_002264839.2| PREDICTED: probable serine/threonine-protein kinase GCN2-like
           [Vitis vinifera]
          Length = 1244

 Score = 97.4 bits (241), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 97/201 (48%), Gaps = 34/201 (16%)

Query: 6   SENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI-IVSKVENIY-MVFQE 63
           S +  +  Y   F +LQ LG G FG V    +K D   YA+KKI +  K   +Y  + +E
Sbjct: 418 STSLPSSRYLNDFEELQPLGHGGFGHVVLCKNKLDGRQYAVKKIRLKDKSPPVYDRILRE 477

Query: 64  AQALAKLEHPNVVRYFSSWIQS------CNSDWTDLTPVKLT------------------ 99
              L++L+H +VVRY+ +W ++       ++ W  +TP   +                  
Sbjct: 478 VATLSRLQHQHVVRYYQAWFETGVSGSFGDTTWGSMTPASSSFSYKGASSADVNVHENKL 537

Query: 100 ----IFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDN 155
               ++IQME C  +L+++ E      D      +F  I++G+ ++H + ++HRDL  +N
Sbjct: 538 ESTYLYIQMEYCPRTLRQMFESYS-HFDKELAWHLFRQIVEGLVHIHGQGIIHRDLTPNN 596

Query: 156 IFLQEINTEFIPKIGDFGLVK 176
           IF    N     KIGDFGL K
Sbjct: 597 IFFDARNDI---KIGDFGLAK 614



>gi|508712990|gb|EOY04887.1| Kinase family protein isoform 2 [Theobroma cacao]
          Length = 1251

 Score = 97.1 bits (240), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 98/201 (48%), Gaps = 35/201 (17%)

Query: 6   SENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYM---VFQ 62
           S +  +  Y   F +LQ LG G FG V    +K D   YA+KKI + K +N+ +   + +
Sbjct: 423 SASLPSSRYLNDFEELQSLGHGGFGHVVLCKNKLDGRQYAVKKICL-KDKNLPVNDRILR 481

Query: 63  EAQALAKLEHPNVVRYFSSWIQ------SCNSDWTDLTPVKLT----------------- 99
           E   L++L+H +VVRY+ +W++      S ++ W   T    T                 
Sbjct: 482 EVATLSRLQHQHVVRYYQAWLETGAASSSGDTAWGSGTATSSTFSKGAGLTDVPVQENKL 541

Query: 100 ----IFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDN 155
               ++IQME C  +L+ V E  +   D      +F  I++G+ ++H + ++HRDL  +N
Sbjct: 542 ESTYLYIQMEYCPRTLREVFESYN-HFDKELAWHLFRQIVEGLAHIHGQGIIHRDLTPNN 600

Query: 156 IFLQEINTEFIPKIGDFGLVK 176
           IF    N     KIGDFGL K
Sbjct: 601 IFFDARND---IKIGDFGLAK 618



>gi|508712991|gb|EOY04888.1| Serine/threonine-protein kinase GCN2 isoform 3, partial [Theobroma
           cacao]
          Length = 1180

 Score = 97.1 bits (240), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 98/201 (48%), Gaps = 35/201 (17%)

Query: 6   SENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYM---VFQ 62
           S +  +  Y   F +LQ LG G FG V    +K D   YA+KKI + K +N+ +   + +
Sbjct: 423 SASLPSSRYLNDFEELQSLGHGGFGHVVLCKNKLDGRQYAVKKICL-KDKNLPVNDRILR 481

Query: 63  EAQALAKLEHPNVVRYFSSWIQ------SCNSDWTDLTPVKLT----------------- 99
           E   L++L+H +VVRY+ +W++      S ++ W   T    T                 
Sbjct: 482 EVATLSRLQHQHVVRYYQAWLETGAASSSGDTAWGSGTATSSTFSKGAGLTDVPVQENKL 541

Query: 100 ----IFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDN 155
               ++IQME C  +L+ V E  +   D      +F  I++G+ ++H + ++HRDL  +N
Sbjct: 542 ESTYLYIQMEYCPRTLREVFESYN-HFDKELAWHLFRQIVEGLAHIHGQGIIHRDLTPNN 600

Query: 156 IFLQEINTEFIPKIGDFGLVK 176
           IF    N     KIGDFGL K
Sbjct: 601 IFFDARND---IKIGDFGLAK 618



>gi|345307793|ref|XP_001508965.2| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Ornithorhynchus anatinus]
          Length = 552

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 106/220 (48%), Gaps = 40/220 (18%)

Query: 10  SNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAK 69
           +++ +  T+  + ++  G FG V+      D + YA+K++   +      V +E +ALAK
Sbjct: 272 ADKHFNSTYDDISLINSGGFGKVFKVRCILDGHHYAVKRVKFDEES----VVREVKALAK 327

Query: 70  LEHPNVVRYFSSWIQSCNSDWTDLTP--------VKLTIFIQMELC--STSLKRVLEKRD 119
           L H ++VRY+S W      +  D  P            ++I MELC   T    + ++R+
Sbjct: 328 LSHVHIVRYYSCW------EGLDFDPENSNSNSSSTRCLYIVMELCEKGTLSNWIDQRRN 381

Query: 120 GQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE 179
            + D   ++ IF  I  G+EY+H +KL+HRDLK  NIF+   N     KIGDFGL  S +
Sbjct: 382 KESDKALSLNIFQQITSGVEYIHSQKLIHRDLKPANIFVVGENN---IKIGDFGLATSLK 438

Query: 180 PTH-----------------LEANTKENDIYCLGVVLKDL 202
            T                    A   E DI+ LG++L +L
Sbjct: 439 TTEKTIGKGTERYMSPEQYLSSAYGTEVDIFALGLILFEL 478



>gi|354491534|ref|XP_003507910.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like, partial [Cricetulus griseus]
          Length = 452

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 102/182 (56%), Gaps = 19/182 (10%)

Query: 5   MSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEA 64
           M   F+N+     F  ++ +G G FG V+ A H+ D  TYAIK++  +  + +    +E 
Sbjct: 264 MDSRFNND-----FEDIEEIGSGGFGQVFKAKHRIDGKTYAIKRVSCNTEKEV----REV 314

Query: 65  QALAKLEHPNVVRYFSSWI-QSCNSDWT-DLTPVK---LTIFIQMELC--STSLKRVLEK 117
           +ALA L H N+V+Y S W+ Q  + + + D  P +     +FIQME     T  + +L  
Sbjct: 315 KALAALSHINIVQYHSCWLGQDYDPEHSPDRNPRRSKTQCLFIQMEFYDKGTLEQWMLNC 374

Query: 118 RDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
           +  ++D    +++   I  G++Y+H K L+HRDLK  NIFL  ++ + I KIGDFGLV S
Sbjct: 375 KQRKVDNDLFLELSEQITTGVDYIHSKGLIHRDLKPCNIFL--VDEKHI-KIGDFGLVTS 431

Query: 178 EE 179
            E
Sbjct: 432 ME 433



>gi|212291457|gb|ACJ23858.1| double-stranded RNA-dependent protein kinase [Oplegnathus
           fasciatus]
          Length = 704

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 112/239 (46%), Gaps = 45/239 (18%)

Query: 2   SKLMSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVF 61
            K  +E  +   +   F  ++ LG G++G V+   HK  +  YA+K +   +        
Sbjct: 400 GKTQTETLAQSRFTSDFYPMECLGSGAYGCVYKVKHKLLEKYYAVKIVCCEE-----KSL 454

Query: 62  QEAQALAKLEHPNVVRYFSSWIQSCNSDW------------TDLTPVKLTIFIQMELCST 109
           +E   L+ L H N+VRY++ W++     W            TD  P+   ++IQMELC T
Sbjct: 455 REVGTLSDLHHDNIVRYYTFWMEDSGYQWDISADSCSSSQSTD-NPLAKFLYIQMELCDT 513

Query: 110 -SLKRVLEKRDGQIDPLF----NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTE 164
            +LK  ++K++  +        ++ I   I+ G+EY+H KK +HRDLK  NI       +
Sbjct: 514 KTLKHWIKKKNKTLQDSKRREESLSIAQQIVSGVEYIHSKKHIHRDLKPANILF---GLD 570

Query: 165 FIPKIGDFGLVKSEE------------PTHLEANTKEN-------DIYCLGVVLKDLYF 204
            + KIGDFGLV  ++            PT++    K         DI+ LG++  +L +
Sbjct: 571 KVVKIGDFGLVTRDDDALMDRTVNKGTPTYMAPEQKSEKNYDRKVDIFPLGLIYFELLW 629



>gi|356544520|ref|XP_003540698.1| PREDICTED: probable serine/threonine-protein kinase GCN2-like
           [Glycine max]
          Length = 1222

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 91/191 (47%), Gaps = 32/191 (16%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           Y   F +L+ LG G FG V    +K D   YA+KKI +        + +E   L++L+H 
Sbjct: 413 YLNDFEELRPLGHGGFGHVVLCKNKLDGRQYAVKKIRLKDKSMPDRILREVATLSRLQHQ 472

Query: 74  NVVRYFSSWIQSCNSD------WTDLTPVKLT----------------------IFIQME 105
           +VVRY+ +W ++  SD      W   T V  T                      ++IQME
Sbjct: 473 HVVRYYQAWFETGVSDSYGDSTWGSKTTVSSTFSYKAATSNDALGHENQLESTYLYIQME 532

Query: 106 LCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEF 165
            C  +L++V E  +   D      +F  I++G+ ++H + ++HRDL  +NIF    N   
Sbjct: 533 YCPRTLRQVFESYN-HFDKELAWHLFRQIVEGLAHIHGQGIIHRDLTPNNIFFDARND-- 589

Query: 166 IPKIGDFGLVK 176
             KIGDFGL K
Sbjct: 590 -IKIGDFGLAK 599



>gi|167517643|ref|XP_001743162.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778261|gb|EDQ91876.1| predicted protein [Monosiga brevicollis MX1]
          Length = 308

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 92/175 (52%), Gaps = 19/175 (10%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKII--VSKVENIYMVFQEAQALAKLE 71
           Y   F +++MLG+G FGSV  A ++ D +TYAIK I   VS       V +E   L  L 
Sbjct: 3   YRSDFEEIEMLGEGGFGSVVKARNRLDGSTYAIKIIPFDVSFPSYSAKVVREVTLLGSLN 62

Query: 72  HPNVVRYFSSWI--------QSCNSDWTDLTPVKL---TIFIQMELCS-TSLKRVLEKRD 119
           HP++VRY+ +W         QS N+  T     +     ++IQME C   SL+ ++  RD
Sbjct: 63  HPHIVRYYQAWTEHETKKTRQSQNNQSTTDASTETGDHVLYIQMEYCPRASLRHLI--RD 120

Query: 120 GQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGL 174
           G +      +I   I+  + Y+H+  ++HRDLK +NI L   + +   K+ DFGL
Sbjct: 121 GSLRIQMIWRILREILDALAYIHQNGIIHRDLKPENILL---DKDLQVKLADFGL 172



>gi|432906952|ref|XP_004077608.1| PREDICTED: LOW QUALITY PROTEIN: interferon-induced, double-stranded
           RNA-activated protein kinase [Oryzias latipes]
          Length = 900

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 101/192 (52%), Gaps = 26/192 (13%)

Query: 3   KLMSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQ 62
           K+ + N S   +E+ +  L  +GKG FG V+   ++     YA+K  IVS  E      Q
Sbjct: 598 KVGNRNVSKSRFEREYDILGRIGKGGFGRVYKVRNRLINREYAVK--IVSGTEK---AKQ 652

Query: 63  EAQALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLT----------IFIQMELC-STSL 111
           EA  LAKL+H N+VRY+ +W++  +S + D      T          ++IQMELC S +L
Sbjct: 653 EASTLAKLQHDNIVRYYIAWME--DSRYLDDVSQTTTDSSSILCEEFLYIQMELCRSETL 710

Query: 112 KRVLEKRDGQIDPLF-----NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFI 166
           K  ++ ++ +    +     ++ I   I+ G+EY+H   L+HRDLK  NI     N    
Sbjct: 711 KDWIKDKNRKDLQAYQRRGESLPIALQIISGVEYIHSNGLIHRDLKPANIMFGMDNK--- 767

Query: 167 PKIGDFGLVKSE 178
            KIGDFGLV +E
Sbjct: 768 VKIGDFGLVTTE 779



>gi|452820850|gb|EME27887.1| ATP-dependent RNA helicase [Galdieria sulphuraria]
          Length = 1885

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 94/172 (54%), Gaps = 14/172 (8%)

Query: 14   YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVS-KVENIYMVFQEAQALAKLEH 72
            Y + F  L++LG+G FGSV    +K D   YA+K++ ++ ++     + +E   L++L H
Sbjct: 983  YREDFEYLRLLGRGGFGSVMKVRNKLDGRIYALKRVALTEELLQERHILREVTTLSRLSH 1042

Query: 73   PNVVRYFSSWIQ--------SCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDP 124
            P+VVRY  +W++        S   +  +   V   ++IQME C  +L+  ++    + + 
Sbjct: 1043 PHVVRYHHAWLEYNESLESSSEQEESPESAKVVAYLYIQMEYCRRTLREFIDHVVDKNED 1102

Query: 125  LFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            L+   +F  I++G+ ++H   ++HRDLK  NIF     T    KIGDFGL K
Sbjct: 1103 LWG--LFRQIVEGLHHIHHCGILHRDLKPTNIFFDAQGT---IKIGDFGLAK 1149



>gi|383863376|ref|XP_003707157.1| PREDICTED: uncharacterized protein LOC100875355 [Megachile
           rotundata]
          Length = 1220

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 72/278 (25%), Positives = 136/278 (48%), Gaps = 54/278 (19%)

Query: 5   MSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYM--VFQ 62
           MS + ++ ++E       +LG+G+FGSV+    K D   + IK+ I++    +    + +
Sbjct: 1   MSMHINDYSFET------LLGQGTFGSVYLVRRKKDLKPFVIKEQILNAANALPFKNILE 54

Query: 63  EAQALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQ 121
           E Q L +L HPN+V Y+ +WI++ +S            +I ME  +  +LK +LEK    
Sbjct: 55  EVQCLYRLRHPNIVAYYGAWIENNHS------------YILMEYATRCTLKDLLEKYHSP 102

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPT 181
           +     + +F  I+ G+ ++H KK++HRDLK +NI L     + + KIGDFG+ K+ +  
Sbjct: 103 LKEQDALYLFSQIVLGVHHIHFKKILHRDLKPENIMLTGSRGDVV-KIGDFGVSKNFKEL 161

Query: 182 H------------------LEANTKE--NDIYCLGVVLKDLY-----FPRKSLDDLLIMV 216
           H                  L   + +   DI+ +G++L ++      FP  +L+++  M+
Sbjct: 162 HNPLTVCRAGSFNYMAPEMLNGQSYDFKCDIWSMGIILYEMVTKRHPFPATTLEEITKMI 221

Query: 217 -------EQQGDFNNIIELIFKMTKMTGSDPPQATKIL 247
                    +G   +I+ +I KM +      P+  +++
Sbjct: 222 CTADPQPLHRGASESIVNIISKMLRKQPRYRPKTDQLV 259



>gi|468181285|gb|AGH29116.1| RNA-dependent protein kinase, partial [Anser cygnoides]
          Length = 206

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 98/178 (55%), Gaps = 14/178 (7%)

Query: 6   SENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQ 65
           +E  ++E + K +  ++ +G+G FG+V+ A  K D+ TYA+K++ + K E      +E Q
Sbjct: 4   NEYTADERFLKDYKNIEPIGQGGFGNVFKATAKTDEITYAVKRVELKKKEK-----REVQ 58

Query: 66  ALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLT----IFIQMELC-STSLKRVLE-KRD 119
            LA L+H N+VRY+ SW       + D      T    +FIQ+E C   +L+  +E  R 
Sbjct: 59  GLAGLQHENIVRYYCSWEGLDYVTYPDSRQRSQTKRPCLFIQIEFCEQGTLEDWIENNRQ 118

Query: 120 GQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
                    K F  I++G+ Y+H K L+HRDLK  NIF   I+ +   KIGDFGLV S
Sbjct: 119 NWGYHERAQKKFLQILEGVNYIHSKGLIHRDLKPQNIF---ISRDDKIKIGDFGLVTS 173



>gi|307194540|gb|EFN76832.1| Serine/threonine-protein kinase Nek5 [Harpegnathos saltator]
          Length = 310

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 123/256 (48%), Gaps = 45/256 (17%)

Query: 24  LGKGSFGSVWSAMHKYDKNTYAIKKIIVSKV--ENIYMVFQEAQALAKLEHPNVVRYFSS 81
           LG G+FG+V+    K D   + IK+  ++ V   +  +V +E Q L K+ HPN+V Y  +
Sbjct: 14  LGNGTFGTVYLVRRKKDSKPFVIKEQDLNTVNYSSSKIVLEEVQCLRKMRHPNIVSYHGA 73

Query: 82  WIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEY 140
           WI   +S            +I ME  +  +LK +LEKR   +     + +F  +  G+ +
Sbjct: 74  WIAHNHS------------YILMEYATRCTLKDLLEKRKLPLKEKDALYLFSQVTLGVHH 121

Query: 141 VHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE---------------PTHLEA 185
           +H KK++HRDLK +NI L     + + KIGDFG+ KS +               P  L A
Sbjct: 122 IHSKKILHRDLKPENIMLTGSRGDIV-KIGDFGVSKSLQKKCITCRAGSYYYMAPEMLTA 180

Query: 186 NTKE--NDIYCLGVVL-----KDLYFPRKSLDDLLIMV-------EQQGDFNNIIELIFK 231
              +   D++ +GVVL     K L FP  SL ++  +V         +G   +I+ LI K
Sbjct: 181 QPYDFKCDVWSMGVVLYEMITKRLPFPATSLIEITKLVFDYPPQPLPRGTPASIVNLISK 240

Query: 232 MTKMTGSDPPQATKIL 247
           M +    + P   +++
Sbjct: 241 MLRKQSPNRPHTDQLV 256



>gi|348507385|ref|XP_003441236.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Oreochromis niloticus]
          Length = 497

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 96/180 (53%), Gaps = 31/180 (17%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F+ ++ LGKG FG V+ A     KN    +   V  V +     +E  AL++L H N+VR
Sbjct: 206 FNSIERLGKGGFGRVYRA-----KNILLDQYRAVKIVHSTEKALREVTALSELHHRNIVR 260

Query: 78  YFSSWIQSC----------NSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLF 126
           Y+S W + C          +S +   +P +  ++I+MELC S +L++ +E+++    P  
Sbjct: 261 YYSCWREDCRYEDDMSTSTDSYYQSNSPPQY-LYIEMELCDSKTLRKWIEEKNENTPPDS 319

Query: 127 NIK-----IFHGIMKGIEYVHEKKLVHRDLKTDNIFL---QEINTEFIPKIGDFGLVKSE 178
             +     I   I+ G+EY+H K L+HRDLK +NI     +E+      KIGDFGLV SE
Sbjct: 320 QRRQKSLIIAQEIVSGVEYIHSKGLIHRDLKPENIMFGKDKEV------KIGDFGLVTSE 373



>gi|499018022|ref|XP_004559807.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Maylandia zebra]
          Length = 695

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 132/290 (45%), Gaps = 72/290 (24%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  ++ LGKG+FG V+ A HK     YAIK I+  K +++    +E  AL+ L H N+VR
Sbjct: 397 FDSIERLGKGAFGRVYKAKHKLLNKYYAIK-IVRCKEKSL----REVVALSDLHHTNIVR 451

Query: 78  YFSSWIQSC--NSDWTDLT---------PVKLTIFIQMELCSTSLKRV-LEKRDGQIDPL 125
           Y++ WIQ      D T  T           +  ++IQMELC T   RV +++++ Q    
Sbjct: 452 YYTCWIQDLEYQMDSTGDTYSTSQSASDSSEKCLYIQMELCDTKTLRVWIDEKNTQ---- 507

Query: 126 FNIK--------------IFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGD 171
            N+K              I   I  G+EY+H K L+HRDLK  NI       +   KIGD
Sbjct: 508 -NVKKSLRDSRRKEESLIIAQQIASGVEYIHSKMLIHRDLKPANIMF---GRDGEVKIGD 563

Query: 172 FGLVKSE----------------EPTHLEANTKEN-------DIYCLGVVLKDLYF---- 204
           FGLV +E                 P+++    K         DI+ LG++  +L +    
Sbjct: 564 FGLVTAEIDNDAENLLERSAYKGTPSYMAPEQKSKSHYDRKVDIFALGLIYFELLWNLPV 623

Query: 205 --PRKSL-DDLLIMVEQQGDFNNII---ELIFKMTKMTGSDPPQATKILE 248
              RK++ D+       QG  NN     ++I  M      + P+A+K+ E
Sbjct: 624 GPERKAVWDNARSQKLPQGFLNNFPQEHQIIKAMLCAKPENRPEASKLKE 673



>gi|224105789|ref|XP_002333765.1| predicted protein [Populus trichocarpa]
 gi|222838452|gb|EEE76817.1| predicted protein [Populus trichocarpa]
          Length = 425

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 110/227 (48%), Gaps = 32/227 (14%)

Query: 23  MLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVRYFSSW 82
           ++GKG++G+V+S MHK D   YA+K +  ++  +   V +E +ALAK  H NV       
Sbjct: 121 LVGKGAYGTVFSCMHKLDGQAYAVKVVKFNRHNDQDKVLREVKALAKCNHSNVSSDEDDD 180

Query: 83  IQSCNSDWTDLT-PVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYV 141
                 D +  +  +   +FIQME C  +L  VLE+    I     +K F G++KG++++
Sbjct: 181 YDKEEGDDSASSKSLDAMLFIQMEHCHWNLDNVLEQ--STITEGTALKYFQGMVKGLDHI 238

Query: 142 HEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-------------SEEPTHLEANTK 188
           H KK++H DL   NIF+   N   + K+ DFGL K             S   ++L   T+
Sbjct: 239 HGKKIIHGDLSRKNIFIDANN---VIKVADFGLAKLLGNSATAIKSGSSGTKSYLAPETE 295

Query: 189 EN-------DIYCLGVVLKDLYFPRKSLDDLLIMVEQQGDFNNIIEL 228
           +        DIY LG++  +L      L     M  +    NN+ E+
Sbjct: 296 KGAPIDQKVDIYSLGILFLEL------LGSFTTMSARAHAINNLREM 336



>gi|260829345|ref|XP_002609622.1| hypothetical protein BRAFLDRAFT_87843 [Branchiostoma floridae]
 gi|229294984|gb|EEN65632.1| hypothetical protein BRAFLDRAFT_87843 [Branchiostoma floridae]
          Length = 310

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 99/185 (53%), Gaps = 16/185 (8%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKL-EHPNVV 76
           +  L  LG GSFG V+SA+   +   YAIKKI  +  ENI +  QE   L +L +HPN+V
Sbjct: 8   YQVLDELGSGSFGVVYSAVSLKNSKHYAIKKIKCTNPENIEIALQEMWTLTRLTDHPNIV 67

Query: 77  RYFSSWIQSCN--------SDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPLFN 127
           +    ++Q+           D+  L  V+L +++ ME C+  ++   L +RD   DP  N
Sbjct: 68  KMIECYLQNGGIHRVKHGEDDY--LCLVELNLWLVMEYCNGGTMNDYLLERDP--DPETN 123

Query: 128 IKIFHGIMKGIEYVHEKKLVHRDLKTDNIFL-QEINTE-FIPKIGDFGLVKSEEPTHLEA 185
            +    +   + ++H   +VHRDLK DN+ + Q +N +  + KIGDFGL K    ++L  
Sbjct: 124 ARFMTQLSGAVSFLHNNNVVHRDLKPDNVLVCQPVNGDPPLVKIGDFGLSKICNASNLSH 183

Query: 186 NTKEN 190
           NT  N
Sbjct: 184 NTDIN 188



>gi|504138282|ref|XP_004581596.1| PREDICTED: serine/threonine-protein kinase Nek4 [Ochotona princeps]
          Length = 781

 Score = 94.0 bits (232), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L++R GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKERKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|71042541|pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n
           Inactivating Mutant In Apo Form
 gi|71042542|pdb|1ZXE|B Chain B, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n
           Inactivating Mutant In Apo Form
 gi|71042543|pdb|1ZXE|C Chain C, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n
           Inactivating Mutant In Apo Form
 gi|71042544|pdb|1ZXE|D Chain D, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n
           Inactivating Mutant In Apo Form
 gi|71042545|pdb|1ZXE|E Chain E, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n
           Inactivating Mutant In Apo Form
 gi|71042546|pdb|1ZXE|F Chain F, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n
           Inactivating Mutant In Apo Form
          Length = 303

 Score = 94.0 bits (232), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 91/169 (53%), Gaps = 12/169 (7%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           Y   F ++ +LG+G+FG V  A +  D   YAIKKI  ++ E +  +  E   LA L H 
Sbjct: 4   YASDFEEIAVLGQGAFGQVVKARNALDSRYYAIKKIRHTE-EKLSTILSEVXLLASLNHQ 62

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVK--LTIFIQMELCSTSLKRVL---EKRDGQIDPLFNI 128
            VVRY+++W++  N      T VK   T+FIQ E C       L   E  + Q D  +  
Sbjct: 63  YVVRYYAAWLERRNF-VKPXTAVKKKSTLFIQXEYCENRTLYDLIHSENLNQQRDEYW-- 119

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
           ++F  I++ + Y+H + ++HR+LK  NIF+ E       KIGDFGL K+
Sbjct: 120 RLFRQILEALSYIHSQGIIHRNLKPXNIFIDESRN---VKIGDFGLAKN 165



>gi|345786694|ref|XP_533795.3| PREDICTED: serine/threonine-protein kinase Nek4 [Canis lupus
           familiaris]
          Length = 787

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 92/175 (52%), Gaps = 18/175 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L++R GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKERKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLEANT 187
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +  E     ANT
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIARVLENNGDMANT 165



>gi|462399598|gb|EMJ05266.1| hypothetical protein PRUPE_ppb013779mg [Prunus persica]
          Length = 335

 Score = 93.2 bits (230), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 93/176 (52%), Gaps = 23/176 (13%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYM--VFQEAQALAKLEHPNV 75
           + +++ LG G+FG V S   K D+ +YA+KKI +   E      V +E   +++L+HP +
Sbjct: 61  YDEIKALGSGAFGVVVSCKSKIDETSYAVKKIAIGDEEEFKFDRVRREVLIMSQLQHPYI 120

Query: 76  VRYFSSWIQS--------------CNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQ 121
           VRY + W++                NS  +++    L  +IQMELC ++LK + E     
Sbjct: 121 VRYHTVWLEPFLAGLNNIADDDDEGNSSVSNINLPHL--YIQMELCDSTLKDIFESDKIM 178

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
            +PL   +IF  +M G+ Y+H + ++H DL   NIF        + KIGDFGL ++
Sbjct: 179 TEPLC-WRIFGDVMNGLTYMHAQGIMHGDLSPANIF----RCGDVWKIGDFGLARN 229



>gi|348545937|ref|XP_003460435.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like, partial [Oreochromis niloticus]
          Length = 420

 Score = 93.2 bits (230), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 96/182 (52%), Gaps = 33/182 (18%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F+ ++ LGKG FG V+ A     KN    +   V  V +     +E  AL++L H N+VR
Sbjct: 127 FNSIERLGKGGFGRVYRA-----KNILLDQYRAVKIVHSTEKALREVTALSELHHRNIVR 181

Query: 78  YFSSWIQSCN-----SDWTDL-------TPVKLTIFIQMELC-STSLKRVLEKRDGQIDP 124
           Y+S W + C      S  TD        +P +  ++I+MELC S +L++ +E+++    P
Sbjct: 182 YYSCWREDCRYEDDMSTSTDSYYQYRSNSPPQY-LYIEMELCDSKTLRKWIEEKNENTPP 240

Query: 125 LFNIK-----IFHGIMKGIEYVHEKKLVHRDLKTDNIFL---QEINTEFIPKIGDFGLVK 176
               +     I   I+ G+EY+H K L+HRDLK +NI     +E+      KIGDFGLV 
Sbjct: 241 DSQRRQKSLIIAQEIVSGVEYIHSKGLIHRDLKPENIMFGKDKEV------KIGDFGLVT 294

Query: 177 SE 178
           SE
Sbjct: 295 SE 296



>gi|334338572|ref|XP_001367535.2| PREDICTED: serine/threonine-protein kinase Nek4-like isoform 1
           [Monodelphis domestica]
          Length = 771

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 89/164 (54%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +S LQ +GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYSFLQAVGKGSYGEVTLVRHRQDGKQYVIKKLNLRNASSRERKAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ G++ P   + + F 
Sbjct: 65  IVTYRESW------EGEDGL-----LYIVMGFCEGGDLYRKLKEQKGKLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK+++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKRILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|159464559|ref|XP_001690509.1| NimA-related protein kinase 5 [Chlamydomonas reinhardtii]
 gi|34334399|gb|AAQ64686.1| NIMA-related kinase 5 [Chlamydomonas reinhardtii]
 gi|158280009|gb|EDP05768.1| NimA-related protein kinase 5 [Chlamydomonas reinhardtii]
          Length = 812

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 129/264 (48%), Gaps = 43/264 (16%)

Query: 21  LQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVRYFS 80
           L  +G+G +G+ + A  KYD   Y IK+I +S  ++     +EAQ L  L+HPN++RY  
Sbjct: 7   LTAIGQGQYGTAYRAKDKYDNQLYCIKRIPMSAKDDHAGALREAQLLDSLDHPNIIRYRE 66

Query: 81  SWIQSCNSDWTDLTPVKLTIFI-QMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIE 139
           S++        D +   +T F  + +L +   K+   K     D + N  +F  I   I 
Sbjct: 67  SFVDK------DGSLCIVTSFCEEGDLFNRIRKKAAAKEYFTEDEVMN--MFVQIASAIS 118

Query: 140 YVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK------------SEEPTHL---- 183
           Y+H K+++HRDLKT NIF+ +     I K+GDFG+ K            +  P ++    
Sbjct: 119 YIHSKRVLHRDLKTQNIFIAKGG---IIKLGDFGISKVLERTDSFATTVTGTPYYMAPEI 175

Query: 184 ---EANTKENDIYCLGVVLKDLYFPRKSL--DDLLIMVEQ--QGDFNNIIELIFK----- 231
              +  T ++DI+ LG VL +L   R +   D LL +V Q  +G+F  I    F      
Sbjct: 176 CTNQPYTYKSDIWSLGCVLYELCTLRHAFAADSLLSLVYQIVRGNFPPIPTDQFSNGLSD 235

Query: 232 -MTKMTGSDPPQATKILESDIFNM 254
            + ++   DP  AT+   S++F +
Sbjct: 236 LVNRLLWRDP--ATRPSLSEVFKL 257



>gi|301608714|ref|XP_002933926.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Xenopus (Silurana) tropicalis]
          Length = 534

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 111/216 (51%), Gaps = 39/216 (18%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  +  L  G FG V+ A+   DK  YA+KK+ + + E   +   E QALA L+HPN+VR
Sbjct: 258 FEDITKLSTGGFGKVFKALKTMDKKYYAVKKVKM-RNEKCKL---EVQALASLDHPNIVR 313

Query: 78  YFSSWIQ---------SCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFNI 128
           YF SW           SC++  ++   +   +FIQME C     +   ++   +D + ++
Sbjct: 314 YFHSWTGMDYSLDTSYSCSTS-SNTDGMNEYLFIQMEFCENGDLKNWIRKMKIVDKVKSL 372

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV---KSEE------ 179
            IF  I++G+ Y+H +KL+HRDLK  NIF  +   +   KIGD GLV    SEE      
Sbjct: 373 NIFRQIVEGVLYIHSEKLIHRDLKPANIFFAK---DMRVKIGDLGLVTQMASEESTEALL 429

Query: 180 -------PTHLEANTKEN------DIYCLGVVLKDL 202
                  P+++     EN      DI+ LG++L +L
Sbjct: 430 RTHDIGTPSYMAPEQHENIYNCEVDIFALGLILVEL 465



>gi|332227208|ref|XP_003262783.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Nomascus leucogenys]
          Length = 510

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 94/180 (52%), Gaps = 40/180 (22%)

Query: 60  VFQEAQALAKLEHPNVVRYFSSW--------IQSCNSDWTDLTPVKL---------TIFI 102
           V +E +ALAKL+H N+V+Y   W          S + +  D  P             +FI
Sbjct: 264 VEREVKALAKLDHVNIVKYNGCWDGFDYDPETSSYDPESDDYDPENSKNSSRSKTKCLFI 323

Query: 103 QMELCS-TSLKRVLEKRDGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQE 160
           QME C   +L++ ++ R G+ +D +  ++ F  I KG++Y+H KKL+HRDLK  NIFL  
Sbjct: 324 QMEFCDKGTLEQWIDNRRGKKLDKVLALEFFEQITKGVDYIHSKKLIHRDLKPSNIFL-- 381

Query: 161 INTEFIPKIGDFGLVK------------------SEEPTHLEANTKENDIYCLGVVLKDL 202
           ++T+ I KIGDFGLV                   S E   L+   KE D+Y LG++L +L
Sbjct: 382 VDTKQI-KIGDFGLVTSLKNDGKRSRSTGTLRYMSPEQISLQDYGKEVDLYALGLILAEL 440



>gi|499018020|ref|XP_004559806.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Maylandia zebra]
          Length = 600

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 97/181 (53%), Gaps = 27/181 (14%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  L  LGKG+FGSV+   HK  K  YA+K +   K +++    +E + L+ L H N+VR
Sbjct: 309 FEPLDHLGKGAFGSVYKVRHKQLKIEYAVK-VGCYKEKSL----REVRTLSDLFHRNIVR 363

Query: 78  YFSSWIQSCNSDW-------------TDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQID 123
           Y++ W+Q    +W             T   P    ++IQMELC+  +L+  +++++ + +
Sbjct: 364 YYTFWMQDTGYEWDLRDSYDSYASSHTADNPETKFLYIQMELCAKNTLRDWIDEKNKESE 423

Query: 124 PLF-----NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSE 178
                   +++I   I+ G+EY+H K  +HRDLK  NI       E   KIGDFGLV S+
Sbjct: 424 QDSKRREESLRIAQEIVCGVEYIHSKNHIHRDLKPANIMF---GVEGEVKIGDFGLVTSD 480

Query: 179 E 179
           +
Sbjct: 481 D 481



>gi|431899876|gb|ELK07823.1| Serine/threonine-protein kinase Nek4 [Pteropus alecto]
          Length = 726

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 86/164 (52%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFN-IKIFH 132
           +V Y  SW                 ++I M  C    L R L+++ GQ+ P    ++ F 
Sbjct: 65  IVTYKESWEGGDGR-----------LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|167520308|ref|XP_001744493.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776824|gb|EDQ90442.1| predicted protein [Monosiga brevicollis MX1]
          Length = 447

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 89/171 (52%), Gaps = 36/171 (21%)

Query: 21  LQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVRYFS 80
           L ++GK    SV  A ++ D+  YAIKK+ +        +FQE   LA+LEHP +VRY +
Sbjct: 201 LDLIGKAQ--SVVRARNRVDQREYAIKKVPLQHWHEGKKIFQEVHVLARLEHPRIVRYHA 258

Query: 81  SWI---------------QSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPL 125
           +W                Q+ + +   + P  + +FIQM+L   +LK  L          
Sbjct: 259 AWYEVGTAQHHADLMDASQASSVNDASVDPPAVVLFIQMQL---TLKLCL---------- 305

Query: 126 FNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
             + +F     G+EY+H + ++HRD+K  NIFL+  +++   K+GDFGLVK
Sbjct: 306 -FVCVF-----GVEYLHAQGIIHRDIKPHNIFLRRASSQLEVKLGDFGLVK 350



>gi|168984497|emb|CAO98762.1| double-stranded RNA activated protein kinase [Oryzias latipes]
          Length = 273

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/190 (35%), Positives = 96/190 (50%), Gaps = 36/190 (18%)

Query: 10  SNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAK 69
           S   +E+ +  L  +GKG FG V+   ++     YA+K  IVS  E      QEA  LAK
Sbjct: 1   SKSRFEREYDILGRIGKGGFGRVYKVRNRLINREYAVK--IVSGTEK---AKQEASTLAK 55

Query: 70  LEHPNVVRYFSSWIQSCNSDWTDLTPVKLT----------IFIQMELC-STSLKRVLE-- 116
           L+H N+VRY+ +W++  +S + D      T          ++IQMELC S +LK  ++  
Sbjct: 56  LQHDNIVRYYIAWME--DSRYLDDVSQTTTDSSSILCEEFLYIQMELCRSETLKDWIKDK 113

Query: 117 --------KRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPK 168
                   +R G+  P     I   I+ G+EY+H   L+HRDLK  NI     N     K
Sbjct: 114 NRKDLQAYQRRGESLP-----IALQIISGVEYIHSNGLIHRDLKPANIMFGMDNK---VK 165

Query: 169 IGDFGLVKSE 178
           IGDFGLV +E
Sbjct: 166 IGDFGLVTTE 175



>gi|410037063|ref|XP_516519.4| PREDICTED: serine/threonine-protein kinase Nek4 isoform 2 [Pan
           troglodytes]
          Length = 781

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTHVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|31747519|gb|AAP57628.1| interferon-inducible double-stranded RNA-dependent protein kinase
           [Homo sapiens]
          Length = 510

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 97/179 (54%), Gaps = 42/179 (23%)

Query: 62  QEAQALAKLEHPNVVRYFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQ 103
           +E +ALAKL+H N+V Y   W             ++S      NS  +  +  K  +FIQ
Sbjct: 266 REVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKC-LFIQ 324

Query: 104 MELCS-TSLKRVLEKRDGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEI 161
           ME C   +L++ +EKR G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  +
Sbjct: 325 MEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--V 382

Query: 162 NTEFIPKIGDFGLVKS----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
           +T+ + KIGDFGLV S                  P  + +    KE D+Y LG++L +L
Sbjct: 383 DTKQV-KIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 440



>gi|41055987|ref|NP_957306.1| serine/threonine-protein kinase Nek4 [Danio rerio]
 gi|32451926|gb|AAH54633.1| NIMA (never in mitosis gene a)-related kinase 4 [Danio rerio]
          Length = 849

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 87/161 (54%), Gaps = 20/161 (12%)

Query: 21  LQMLGKGSFGSVWSAMHKYDKNTYAIKKI--IVSKVENIYMVFQEAQALAKLEHPNVVRY 78
           ++++GKGS+G V    HK D+  Y IKK+    S         QEAQ L++L+HPN+V Y
Sbjct: 7   VRVVGKGSYGEVNLVRHKSDRKQYVIKKLNLRTSSRRERRAAEQEAQLLSQLKHPNIVMY 66

Query: 79  FSSW-IQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFN-IKIFHGIM 135
             SW  + C             ++I M  C    L   L+++ G++ P    ++ F  I 
Sbjct: 67  RESWEGEDCQ------------LYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFVQIA 114

Query: 136 KGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
             ++Y+HEK ++HRDLKT NIFL + N   I K+GD G+ +
Sbjct: 115 MALQYLHEKHILHRDLKTQNIFLTKTN---IIKVGDLGIAR 152



>gi|410920417|ref|XP_003973680.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase
           Nek4-like [Takifugu rubripes]
          Length = 795

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (53%), Gaps = 20/164 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI--IVSKVENIYMVFQEAQALAKLEHPNV 75
           +  ++++GKGS+G V    HK D+  Y IKK+  I S         QEAQ L++L HPN+
Sbjct: 4   YISIRVVGKGSYGEVNLVKHKTDRQQYVIKKLNLITSSKRERRAAEQEAQLLSQLRHPNI 63

Query: 76  VRYFSSW-IQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNI-KIFH 132
           V Y  SW  + C             ++I M  C    +   L+++ G++ P   + + F 
Sbjct: 64  VTYRESWEGEDCQ------------LYIVMGFCEGGDVYHRLKQQKGELLPERQVVEWFV 111

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   +EY+H + ++HRDLKT NIFL ++N   I K+GD G+ +
Sbjct: 112 QIAMALEYLHGRNILHRDLKTQNIFLTKLN---IIKVGDLGIAR 152



>gi|168984505|emb|CAO98766.1| double-stranded RNA activated protein kinase 3 [Xenopus (Silurana)
           tropicalis]
          Length = 270

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 111/216 (51%), Gaps = 39/216 (18%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  +  L  G FG V+ A+   DK  YA+KK+ + + E   +   E QALA L+HPN+VR
Sbjct: 9   FEDITKLSTGGFGKVFKALKTMDKKYYAVKKVKM-RNEKCKL---EVQALASLDHPNIVR 64

Query: 78  YFSSWI---------QSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFNI 128
           YF SW           SC++  ++   +   +FIQME C     +   ++   +D + ++
Sbjct: 65  YFHSWTGMDYSLDTSYSCSTS-SNTDGMNEYLFIQMEFCENGDLKNWIRKMKIVDKVKSL 123

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV---KSEE------ 179
            IF  I++G+ Y+H +KL+HRDLK  NIF  +   +   KIGD GLV    SEE      
Sbjct: 124 NIFRQIVEGVLYIHSEKLIHRDLKPANIFFAK---DMRVKIGDLGLVTQMASEESTEALL 180

Query: 180 -------PTHLEANTKEN------DIYCLGVVLKDL 202
                  P+++     EN      DI+ LG++L +L
Sbjct: 181 RTHDIGTPSYMAPEQHENIYNCEVDIFALGLILVEL 216



>gi|208431829|ref|NP_001129124.1| interferon-induced, double-stranded RNA-activated protein kinase
           isoform b [Homo sapiens]
          Length = 510

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 97/179 (54%), Gaps = 42/179 (23%)

Query: 62  QEAQALAKLEHPNVVRYFSSW-------------IQSC-----NSDWTDLTPVKLTIFIQ 103
           +E +ALAKL+H N+V Y   W             ++S      NS  +  +  K  +FIQ
Sbjct: 266 REVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKC-LFIQ 324

Query: 104 MELCS-TSLKRVLEKRDGQ-IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEI 161
           ME C   +L++ +EKR G+ +D +  +++F  I KG++Y+H KKL+HRDLK  NIFL  +
Sbjct: 325 MEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL--V 382

Query: 162 NTEFIPKIGDFGLVKS----------------EEPTHLEAN--TKENDIYCLGVVLKDL 202
           +T+ + KIGDFGLV S                  P  + +    KE D+Y LG++L +L
Sbjct: 383 DTKQV-KIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAEL 440



>gi|511826912|ref|XP_004738221.1| PREDICTED: serine/threonine-protein kinase Nek4 isoform X2 [Mustela
           putorius furo]
 gi|512001004|ref|XP_004818035.1| PREDICTED: serine/threonine-protein kinase Nek4 isoform X2 [Mustela
           putorius furo]
          Length = 796

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|432859957|ref|XP_004069320.1| PREDICTED: serine/threonine-protein kinase Nek4-like [Oryzias
           latipes]
          Length = 864

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 88/161 (54%), Gaps = 20/161 (12%)

Query: 21  LQMLGKGSFGSVWSAMHKYDKNTYAIKKI---IVSKVENIYMVFQEAQALAKLEHPNVVR 77
           ++++GKGS+G V    HK D+  Y IKK+     SK E      QEAQ L++L HPN+V 
Sbjct: 7   IRVVGKGSYGEVNLVKHKTDRKQYVIKKLNLSTSSKRER-RSAEQEAQLLSQLRHPNIVT 65

Query: 78  YFSSWIQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNI-KIFHGIM 135
           Y  SW      +  D       ++I M  C    L   L++R G++ P   + + F  I 
Sbjct: 66  YRESW------EGDDRQ-----LYIVMGFCEGGDLYHRLKQRKGELLPERQVVEWFVQIA 114

Query: 136 KGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
             ++Y+HE+ ++HRDLKT NIFL + N   I K+GD G+ +
Sbjct: 115 MALQYLHERNILHRDLKTQNIFLTKTN---IIKVGDLGIAR 152



>gi|472384301|ref|XP_004411522.1| PREDICTED: serine/threonine-protein kinase Nek4 [Odobenus rosmarus
           divergens]
          Length = 797

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|167555192|ref|NP_001107942.1| interferon-induced, double-stranded RNA-activated protein kinase
           [Danio rerio]
 gi|163879058|gb|ABY47905.1| IFN-stimulated dsRNA-activated eIF2-alpha kinase 2 [Danio rerio]
 gi|164508750|emb|CAM07150.1| double-stranded RNA activated protein kinase [Danio rerio]
          Length = 682

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 90/174 (51%), Gaps = 22/174 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  +  +GKG FG V+ A  K +   YA+K  IV   E      +E  ALA   +PN+VR
Sbjct: 395 FDSINPIGKGGFGRVFKARRKLEDKYYAVK--IVKSTEK---ARREVGALADFNNPNIVR 449

Query: 78  YFSSWIQSC--------NSDWTDLTPVKLTIFIQMELCSTSLKRV-LEKRDG--QIDPLF 126
           YFSSW +          +   +   P    ++IQME C  +  RV +++R+   +  P  
Sbjct: 450 YFSSWEEDTAYKHESSESFSDSGSGPGTKFLYIQMEFCEGNTLRVWIKERNSSNKQSPER 509

Query: 127 NI---KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
                +I+  ++K +EY+H K L+HRDLK  NI     ++E   K+GDFGLV +
Sbjct: 510 RTEAAQIYRQVLKAVEYIHSKLLIHRDLKPPNIMF---SSEGRVKVGDFGLVTA 560



>gi|390475090|ref|XP_002807636.2| PREDICTED: serine/threonine-protein kinase Nek4 [Callithrix
           jacchus]
          Length = 787

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
           ++  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   SYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERQAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L ++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLREQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|164508752|emb|CAM07151.1| double-stranded RNA activated protein kinase [Danio rerio]
          Length = 682

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 89/172 (51%), Gaps = 22/172 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  +  +GKG FG V+ A  K +   YA+K  IV   E      +E  ALA   +PN+VR
Sbjct: 395 FDSINPIGKGGFGRVFKARRKLEDKYYAVK--IVKSTEK---ARREVGALADFNNPNIVR 449

Query: 78  YFSSWIQSC--------NSDWTDLTPVKLTIFIQMELCSTSLKRV-LEKRDG--QIDPLF 126
           YFSSW +          +   +   P    ++IQME C  +  RV +++R+   +  P  
Sbjct: 450 YFSSWEEDTAYKHESSESFSDSGSGPGTKFLYIQMEFCEGNTLRVWIKERNSSNKQSPER 509

Query: 127 NI---KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV 175
                +I+  ++K +EY+H K L+HRDLK  NI     ++E   K+GDFGLV
Sbjct: 510 RTEAAQIYRQVLKAVEYIHSKLLIHRDLKPPNIMF---SSEGRVKVGDFGLV 558



>gi|432090833|gb|ELK24132.1| Serine/threonine-protein kinase Nek4 [Myotis davidii]
          Length = 782

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 86/164 (52%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW                 ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESWEGGDG-----------LLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|386267042|gb|AFJ00092.1| PKR-like protein [Cynoglossus semilaevis]
          Length = 652

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 93/176 (52%), Gaps = 24/176 (13%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  +  LGKG FG V+ A        YA+K I+  K +      +E  AL+ L H N+VR
Sbjct: 362 FDSIVHLGKGGFGRVYKAREILINKDYAVK-IVRGKKK----ALREVVALSDLSHHNIVR 416

Query: 78  YFSSWIQSCNSDWTDLT---------PVKLTIFIQMELCST-SLKRVLEKRD---GQIDP 124
           YF+ W++         +         P +  ++I+MELCST +LK  +EKR+   GQ   
Sbjct: 417 YFNCWMEDSGYSDDSSSDDSRSHSNSPQQF-LYIKMELCSTETLKNWIEKRNEKNGQDSE 475

Query: 125 LFN--IKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSE 178
                + +   I+ G+EY+H+KKL+HRDLK  NI   +   +   KIGDFGLV +E
Sbjct: 476 RGEEALNLAEQIVAGVEYIHQKKLIHRDLKPPNIMFGQ---DKKVKIGDFGLVTTE 528



>gi|397495933|ref|XP_003818798.1| PREDICTED: serine/threonine-protein kinase Nek4 isoform 1 [Pan
           paniscus]
          Length = 841

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|354465727|ref|XP_003495328.1| PREDICTED: serine/threonine-protein kinase Nek4 [Cricetulus
           griseus]
          Length = 796

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 90/166 (54%), Gaps = 18/166 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           + T+  ++++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 3   QATYCYVRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKH 62

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 63  PNIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 111

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           F  I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 112 FVQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|441610120|ref|XP_003257229.2| PREDICTED: serine/threonine-protein kinase Nek4 [Nomascus
           leucogenys]
          Length = 788

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|194221227|ref|XP_001492502.2| PREDICTED: serine/threonine-protein kinase Nek4 isoform 1 [Equus
           caballus]
          Length = 787

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+ +G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRFVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|148839316|ref|NP_003148.2| serine/threonine-protein kinase Nek4 isoform 1 [Homo sapiens]
 gi|229462924|sp|P51957.2|NEK4_HUMAN RecName: Full=Serine/threonine-protein kinase Nek4; AltName:
           Full=Never in mitosis A-related kinase 4;
           Short=NimA-related protein kinase 4; AltName:
           Full=Serine/threonine-protein kinase 2; AltName:
           Full=Serine/threonine-protein kinase NRK2
 gi|119585662|gb|EAW65258.1| NIMA (never in mitosis gene a)-related kinase 4 [Homo sapiens]
          Length = 841

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|197102246|ref|NP_001126729.1| serine/threonine-protein kinase Nek4 [Pongo abelii]
 gi|55732473|emb|CAH92937.1| hypothetical protein [Pongo abelii]
          Length = 788

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|348245|gb|AAA36658.1| protein serine/threonine kinase [Homo sapiens]
          Length = 841

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|402859855|ref|XP_003894352.1| PREDICTED: serine/threonine-protein kinase Nek4 [Papio anubis]
          Length = 781

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLQNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|297285606|ref|XP_002802834.1| PREDICTED: serine/threonine-protein kinase Nek4-like [Macaca
           mulatta]
          Length = 742

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|198442857|ref|NP_001013152.2| serine/threonine-protein kinase Nek4 [Rattus norvegicus]
 gi|149034203|gb|EDL88973.1| NIMA (never in mitosis gene a)-related expressed kinase 4 [Rattus
           norvegicus]
          Length = 793

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 89/166 (53%), Gaps = 18/166 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           +  +  L+++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 3   QAAYCYLRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKH 62

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 63  PNIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 111

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           F  I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 112 FVQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|38648684|gb|AAH63044.1| NEK4 protein [Homo sapiens]
          Length = 781

 Score = 90.9 bits (224), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|395832772|ref|XP_003789429.1| PREDICTED: serine/threonine-protein kinase Nek4 [Otolemur
           garnettii]
          Length = 786

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 89/164 (54%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++G+GS+G V    H+ D   Y IKK+ + K  +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGRGSYGEVTLVKHRRDGRQYVIKKLNLRKASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L + L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYQKLKEQKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|507555047|ref|XP_004661295.1| PREDICTED: serine/threonine-protein kinase Nek4 [Jaculus jaculus]
          Length = 806

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 93/177 (52%), Gaps = 18/177 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           +  +  ++++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 3   QAAYCYVRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRSAEQEAQLLSQLKH 62

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 63  PNIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 111

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLEANT 187
           F  I   ++Y+HEK ++HRDLKT NIFL   N   I K+GD G+ +  E     ANT
Sbjct: 112 FVQIAMALQYLHEKHILHRDLKTQNIFLTRTN---IIKVGDLGIARVLENNGDMANT 165



>gi|478491355|ref|XP_004420048.1| PREDICTED: serine/threonine-protein kinase Nek4 [Ceratotherium
           simum simum]
          Length = 800

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+ +G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRAVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|297667845|ref|XP_002812174.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase [Pongo abelii]
          Length = 510

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 91/181 (50%), Gaps = 46/181 (25%)

Query: 62  QEAQALAKLEHPNVVRYFSSW--------IQSCNSDWTDLTP---------VKLTIFIQM 104
           +E +ALAKL H N+VRY   W          + + + +D  P             +FIQM
Sbjct: 266 REVKALAKLNHVNIVRYNGCWDGIDYDPETSAYDPESSDYDPENSKNSSRSRTKCLFIQM 325

Query: 105 ELCSTSLKRVLEK-----RDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQ 159
           E C    K  LE+     R  ++D +  +++F  I KG++Y+H KKL+HRDLK  NIFL 
Sbjct: 326 EFCD---KGTLEQWIDNTRGKKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFL- 381

Query: 160 EINTEFIPKIGDFGLVK------------------SEEPTHLEANTKENDIYCLGVVLKD 201
            ++T+ + KIGDFGLV                   S E   L+   KE D+Y LG++L +
Sbjct: 382 -VDTKQV-KIGDFGLVTSLTNDVKRTRNTGTLRYMSPEQISLQDYGKEVDLYALGLILAE 439

Query: 202 L 202
           L
Sbjct: 440 L 440



>gi|488545942|ref|XP_004464495.1| PREDICTED: serine/threonine-protein kinase Nek4 isoform 2 [Dasypus
           novemcinctus]
          Length = 788

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+ +G+GS+G V    H+ D   Y IK++ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRAVGRGSYGEVTLVRHRRDGRQYVIKRLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQRGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|6754822|ref|NP_035979.1| serine/threonine-protein kinase Nek4 [Mus musculus]
 gi|4323326|gb|AAD16287.1| serine/threonine-protein kinase NEK4 [Mus musculus]
 gi|34786043|gb|AAH57939.1| NIMA (never in mitosis gene a)-related expressed kinase 4 [Mus
           musculus]
 gi|117616544|gb|ABK42290.1| Nek4 [synthetic construct]
          Length = 792

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 89/166 (53%), Gaps = 18/166 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           +  +  ++++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 3   QAAYCYMRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKH 62

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 63  PNIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 111

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           F  I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 112 FVQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|116283241|gb|AAH15515.1| NEK4 protein [Homo sapiens]
          Length = 451

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|47227254|emb|CAF96803.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 394

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 86/163 (52%), Gaps = 18/163 (11%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI--IVSKVENIYMVFQEAQALAKLEHPNV 75
           +  ++++GKGS+G V    HK DK  Y IKK+    S         QEAQ L++L HPN+
Sbjct: 1   YVSIRIVGKGSYGEVNLVKHKTDKQQYVIKKLNLTTSSKRERRAAEQEAQLLSQLRHPNI 60

Query: 76  VRYFSSWIQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNI-KIFHG 133
           V Y  SW      D          ++I M  C    L   L+++ G++ P   + + F  
Sbjct: 61  VTYRESW----EGD-------DCQLYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFVQ 109

Query: 134 IMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           I   +EY+H++ ++HRDLKT NIFL + N   I K+GD G+ +
Sbjct: 110 IAMALEYLHQRNILHRDLKTQNIFLTKCN---IIKVGDLGIAR 149



>gi|29337019|sp|Q9Z1J2.1|NEK4_MOUSE RecName: Full=Serine/threonine-protein kinase Nek4; AltName:
           Full=Never in mitosis A-related kinase 4;
           Short=NimA-related protein kinase 4; AltName:
           Full=Serine/threonine-protein kinase 2
 gi|4138209|emb|CAA11072.1| serine/threonine kinase protein MSTK2L,long-form [Mus musculus]
          Length = 792

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 89/166 (53%), Gaps = 18/166 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           +  +  ++++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 3   QAAYCYMRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKH 62

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 63  PNIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 111

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           F  I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 112 FVQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|488545940|ref|XP_004464494.1| PREDICTED: serine/threonine-protein kinase Nek4 isoform 1 [Dasypus
           novemcinctus]
          Length = 801

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+ +G+GS+G V    H+ D   Y IK++ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRAVGRGSYGEVTLVRHRRDGRQYVIKRLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQRGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|148692831|gb|EDL24778.1| NIMA (never in mitosis gene a)-related expressed kinase 4, isoform
           CRA_a [Mus musculus]
          Length = 797

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 89/166 (53%), Gaps = 18/166 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           +  +  ++++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 8   QAAYCYMRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKH 67

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 68  PNIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 116

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           F  I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 117 FVQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 159



>gi|148692832|gb|EDL24779.1| NIMA (never in mitosis gene a)-related expressed kinase 4, isoform
           CRA_b [Mus musculus]
          Length = 749

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 89/166 (53%), Gaps = 18/166 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           +  +  ++++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 8   QAAYCYMRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKH 67

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 68  PNIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 116

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           F  I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 117 FVQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 159



>gi|2570047|emb|CAA70436.1| MSTK2S kinase-like protein [Mus musculus]
 gi|74146450|dbj|BAE28975.1| unnamed protein product [Mus musculus]
 gi|74215443|dbj|BAE21365.1| unnamed protein product [Mus musculus]
 gi|117616542|gb|ABK42289.1| Nek4 [synthetic construct]
          Length = 744

 Score = 90.1 bits (222), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 89/166 (53%), Gaps = 18/166 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           +  +  ++++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 3   QAAYCYMRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKH 62

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 63  PNIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 111

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           F  I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 112 FVQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|261326823|emb|CBH09796.1| protein kinase, putative [Trypanosoma brucei gambiense DAL972]
          Length = 622

 Score = 90.1 bits (222), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 130/286 (45%), Gaps = 47/286 (16%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDK---NTYAIKKIIVS-KVENIYMVFQEAQALAK 69
           Y++ F ++Q LG G+FG V+   H  +      +A+KKI V      ++ V  E + L +
Sbjct: 209 YKRYFREIQKLGSGTFGGVYLCQHVMEGVGLGYFALKKIPVGDNTSYLHKVLSEVRILEE 268

Query: 70  L-EHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPLFN 127
           + +HPN+V Y  SW+ +  +   D  P    +FI ME  +  SL   LE+    +  +  
Sbjct: 269 VKQHPNMVEYKHSWVDT--AQIADFGPPVRCLFILMEYATIGSLDSYLERHGSALPTIAV 326

Query: 128 IKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPK--IGDFG------------ 173
              F   + G  ++H K ++HRDLK  N+ L    +E +P+  + DFG            
Sbjct: 327 WYFFLSAVAGTAHLHRKNIIHRDLKPQNLLLTG-RSEEVPRVLVSDFGTAALLSEVSYER 385

Query: 174 ----------------LVKSEEPTHLEANTKENDIYCLGVVLKDLYF----P-RKSLDDL 212
                            V   + +++ ++TK  D++ LG++L  L F    P R S  ++
Sbjct: 386 TGGTGTVEYMAPELFECVPGTKESYIYSHTKATDVWSLGMILHYLAFDGTLPLRLSNGEV 445

Query: 213 LIMVEQQGDFNNIIELIFKMTKMTGSDP---PQATKILESDIFNML 255
           ++ VE +  +    E+I  M  M   +P   P   ++LES +   +
Sbjct: 446 VLEVENRSHYARPPEMIQLMRLMLHRNPAKRPTCEELLESTVVRTI 491



>gi|507930759|ref|XP_004676625.1| PREDICTED: serine/threonine-protein kinase Nek4 [Condylura
           cristata]
          Length = 791

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+ +G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCHLRAVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFN-IKIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ G++ P    ++ F 
Sbjct: 65  IVTYKESW------EGGD-----GLLYIVMGFCEGGDLYRKLKEQKGRLLPERRVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|72386653|ref|XP_843751.1| protein kinase [Trypanosoma brucei brucei strain 927/4 GUTat10.1]
 gi|62175387|gb|AAX69529.1| protein kinase, putative [Trypanosoma brucei]
 gi|70800283|gb|AAZ10192.1| protein kinase, putative [Trypanosoma brucei brucei strain 927/4
           GUTat10.1]
          Length = 622

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 130/286 (45%), Gaps = 47/286 (16%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDK---NTYAIKKIIVS-KVENIYMVFQEAQALAK 69
           Y++ F ++Q LG G+FG V+   H  +      +A+KKI V      ++ V  E + L +
Sbjct: 209 YKRYFREIQKLGSGTFGGVYLCQHVMEGVGLGYFALKKIPVGDNTSYLHKVLSEVRILEE 268

Query: 70  L-EHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPLFN 127
           + +HPN+V Y  SW+ +  +   D  P    +FI ME  +  SL   LE+    +  +  
Sbjct: 269 VKQHPNMVEYKHSWVDT--AQIADFGPPVRCLFILMEYATIGSLDSYLERHGSALPTIAV 326

Query: 128 IKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPK--IGDFG------------ 173
              F   + G  ++H K ++HRDLK  N+ L    +E +P+  + DFG            
Sbjct: 327 WYFFLSAVAGTAHLHRKNIIHRDLKPQNLLLTG-RSEEVPRVLVSDFGTATLLSEVSYER 385

Query: 174 ----------------LVKSEEPTHLEANTKENDIYCLGVVLKDLYF----P-RKSLDDL 212
                            V   + +++ ++TK  D++ LG++L  L F    P R S  ++
Sbjct: 386 TGGTGTVEYMAPELFECVPGTKESYIYSHTKATDVWSLGMILHYLAFDGTLPLRLSNGEV 445

Query: 213 LIMVEQQGDFNNIIELIFKMTKMTGSDP---PQATKILESDIFNML 255
           ++ VE +  +    E+I  M  M   +P   P   ++LES +   +
Sbjct: 446 VLEVENRSHYARPPEMIQLMRLMLHRNPAKRPTCEELLESTVVRTI 491



>gi|493559077|ref|WP_006512527.1| protein kinase family protein [Xenococcus sp. PCC 7305]
 gi|442790872|gb|ELS00374.1| protein kinase family protein [Xenococcus sp. PCC 7305]
          Length = 272

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 104/225 (46%), Gaps = 33/225 (14%)

Query: 9   FSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALA 68
           FS E     +  L +LG+G FG V+ A+H+  +   A+KK+   +        +E   L 
Sbjct: 2   FSEEISHSQYQILHLLGQGQFGKVFCAVHRPTEELVALKKLDRKRFPT-KAFLRELGFLV 60

Query: 69  KLEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFNI 128
            L+HPN+V        SC     +  P     ++ M+ C     R L + + Q+D L ++
Sbjct: 61  TLQHPNIV--------SCRG--LEYGPTGR--YLVMDYCQGGTLRELMESEQQLDLLESL 108

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK-SEEPTHLEANT 187
           K+   I+ G+EY H++ +VH DLK +NI L+     +  +I DFG+ + SEE   LE + 
Sbjct: 109 KLIADILAGLEYAHDRGIVHCDLKPENILLEPQAKSWTARISDFGIARLSEEANSLEVSM 168

Query: 188 KE-------------------NDIYCLGVVLKDLYFPRKSLDDLL 213
            +                   +D+Y +GV+L +L    +    L 
Sbjct: 169 GDTGSPAYMAPERFYGRYSFASDLYAIGVILFELVMGERPFSGLF 213



>gi|296044642|gb|ADG85735.1| type 1 double stranded RNA activated protein kinase [Gadus morhua]
          Length = 514

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 95/180 (52%), Gaps = 31/180 (17%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           +  ++ +G+G FG V  A  K+  +TY   KI+ +K EN     +EA+ LAKL+HPN+VR
Sbjct: 217 YDNIECIGQGGFGHVHKARMKH-LDTYCAVKIVPNK-EN---AMREAKILAKLQHPNIVR 271

Query: 78  YFSSWIQSCNSDWTDLTP--------------VKLTIFIQMELCSTS--LKRVLEKRDGQ 121
           Y++SW +    D  ++ P                  ++IQMELC      + + EK    
Sbjct: 272 YYTSWTE----DQENIPPNCKGLSTSQSSSDTSGTFLYIQMELCEMKDLYEWIQEKNSLH 327

Query: 122 IDPLF---NIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSE 178
            DP     ++ I   ++ G+EY+H K L+HRDLK  NI    + ++   KI DFGLV +E
Sbjct: 328 QDPTRRKESLDIMKKMICGVEYIHSKNLMHRDLKPSNIM---VGSDGEVKIVDFGLVTAE 384



>gi|498959851|ref|XP_004545164.1| PREDICTED: serine/threonine-protein kinase Nek4-like isoform X2
           [Maylandia zebra]
          Length = 893

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 20/164 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI--IVSKVENIYMVFQEAQALAKLEHPNV 75
           ++ ++++GKGS+G V    HK D+  Y IK++    S         QEAQ L++L HPN+
Sbjct: 5   YTFIRVVGKGSYGEVNLVKHKTDRKQYVIKRLNLTTSSKRERRAAEQEAQLLSQLRHPNI 64

Query: 76  VRYFSSW-IQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNI-KIFH 132
           V Y  SW    C             ++I M  C    L   L+++ G++ P   + + F 
Sbjct: 65  VTYKESWEGDDCQ------------LYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFV 112

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HE+ ++HRDLKT NIFL + N   I K+GD G+ +
Sbjct: 113 QIAMALQYLHERNILHRDLKTQNIFLTKTN---IIKVGDLGIAR 153



>gi|498959845|ref|XP_004545163.1| PREDICTED: serine/threonine-protein kinase Nek4-like isoform X1
           [Maylandia zebra]
          Length = 894

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 20/164 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI--IVSKVENIYMVFQEAQALAKLEHPNV 75
           ++ ++++GKGS+G V    HK D+  Y IK++    S         QEAQ L++L HPN+
Sbjct: 5   YTFIRVVGKGSYGEVNLVKHKTDRKQYVIKRLNLTTSSKRERRAAEQEAQLLSQLRHPNI 64

Query: 76  VRYFSSW-IQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNI-KIFH 132
           V Y  SW    C             ++I M  C    L   L+++ G++ P   + + F 
Sbjct: 65  VTYKESWEGDDCQ------------LYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFV 112

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HE+ ++HRDLKT NIFL + N   I K+GD G+ +
Sbjct: 113 QIAMALQYLHERNILHRDLKTQNIFLTKTN---IIKVGDLGIAR 153



>gi|498959861|ref|XP_004545166.1| PREDICTED: serine/threonine-protein kinase Nek4-like isoform X4
           [Maylandia zebra]
          Length = 885

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 20/164 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI--IVSKVENIYMVFQEAQALAKLEHPNV 75
           ++ ++++GKGS+G V    HK D+  Y IK++    S         QEAQ L++L HPN+
Sbjct: 5   YTFIRVVGKGSYGEVNLVKHKTDRKQYVIKRLNLTTSSKRERRAAEQEAQLLSQLRHPNI 64

Query: 76  VRYFSSW-IQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNI-KIFH 132
           V Y  SW    C             ++I M  C    L   L+++ G++ P   + + F 
Sbjct: 65  VTYKESWEGDDCQ------------LYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFV 112

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HE+ ++HRDLKT NIFL + N   I K+GD G+ +
Sbjct: 113 QIAMALQYLHERNILHRDLKTQNIFLTKTN---IIKVGDLGIAR 153



>gi|498959855|ref|XP_004545165.1| PREDICTED: serine/threonine-protein kinase Nek4-like isoform X3
           [Maylandia zebra]
          Length = 893

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 20/164 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI--IVSKVENIYMVFQEAQALAKLEHPNV 75
           ++ ++++GKGS+G V    HK D+  Y IK++    S         QEAQ L++L HPN+
Sbjct: 5   YTFIRVVGKGSYGEVNLVKHKTDRKQYVIKRLNLTTSSKRERRAAEQEAQLLSQLRHPNI 64

Query: 76  VRYFSSW-IQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNI-KIFH 132
           V Y  SW    C             ++I M  C    L   L+++ G++ P   + + F 
Sbjct: 65  VTYKESWEGDDCQ------------LYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFV 112

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HE+ ++HRDLKT NIFL + N   I K+GD G+ +
Sbjct: 113 QIAMALQYLHERNILHRDLKTQNIFLTKTN---IIKVGDLGIAR 153



>gi|350424832|ref|XP_003493927.1| PREDICTED: hypothetical protein LOC100747582 [Bombus impatiens]
          Length = 1210

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 124/247 (50%), Gaps = 48/247 (19%)

Query: 23  MLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYM--VFQEAQALAKLEHPNVVRYFS 80
           +LG+GSFGSV+    K D   + +K+ I+  V  +    + +E + L  L H N+V Y+ 
Sbjct: 13  LLGQGSFGSVYLVRRKKDSKPFVVKEQILDNVNALPFKNISEEVKCLHTLRHTNIVAYYG 72

Query: 81  SWIQSCNSDWTDLTPVKLTIFIQMELCST-SLKRVLEKRDGQIDPLFNIKIFHGIMKGIE 139
           +WI+  +S            +I ME  +  +LK +LE  +  +     + +F  ++ G+ 
Sbjct: 73  AWIEDNHS------------YILMEYATRGTLKDLLENNETPLKEEDALYLFSQVVLGVH 120

Query: 140 YVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS----EEPTHL-----------E 184
           ++H KK++HRDLK +NI L     + + KIGDFG+ K+     +P+ +           E
Sbjct: 121 HIHFKKILHRDLKPENIMLTGSRGDIV-KIGDFGVSKNFKELTKPSIICRAGSFCYMAPE 179

Query: 185 ANTKEN-----DIYCLGVVLKDLY-----FPRKSLDDLLIMVEQQ-------GDFNNIIE 227
             T ++     DI+ +GV+L ++      FP  SL +++ M+ ++       G   +++ 
Sbjct: 180 MLTDQSYDFKCDIWSMGVILYEMVSKRHPFPAMSLTEIIKMICEEKPRPLPRGTSTSVVS 239

Query: 228 LIFKMTK 234
           LI KM +
Sbjct: 240 LISKMLR 246



>gi|344276193|ref|XP_003409893.1| PREDICTED: serine/threonine-protein kinase Nek4 [Loxodonta
           africana]
          Length = 784

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 89/164 (54%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+ +G+GS+G V    H+ D   Y IKK+ +    +   +   QEAQ L++L+HPN
Sbjct: 5   AYCYLRAVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERWAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ G++ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGRLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HE+ ++HRDLKT N+FL + N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHERHILHRDLKTQNVFLTKAN---IIKVGDLGIAR 154



>gi|340374012|ref|XP_003385533.1| PREDICTED: membrane-associated tyrosine- and threonine-specific
           cdc2-inhibitory kinase-like [Amphimedon queenslandica]
          Length = 474

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 107/212 (50%), Gaps = 27/212 (12%)

Query: 1   MSKLMSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMV 60
           +S++ +       +E+ F  ++ +G+GSFG V+    + D   YAIK+      +     
Sbjct: 43  LSRVFTSASQEPYFEQGFEIIKKIGEGSFGEVFQVKSREDGQLYAIKR----SRQRFTGS 98

Query: 61  FQEAQALAKLE-------HPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKR 113
           +   + L ++E       HPN +R++ +W ++            L ++IQ ELCS SL +
Sbjct: 99  WDRRKKLDEVEKHECLPPHPNCIRFYKAWEEN------------LHLYIQTELCSMSLSQ 146

Query: 114 VLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFG 173
             +   G++      +I   I KG++++H+ +L H D+K DNIFL +  T +  K+GDFG
Sbjct: 147 YCDAH-GRLPERTVWRILMDIGKGLKHLHDNRLCHLDIKPDNIFLSQSGTTW--KLGDFG 203

Query: 174 LVKSEEPTHLEANTKENDIYCLGVVLKDLYFP 205
           LV S + T  E  ++ +  Y    +++  + P
Sbjct: 204 LVSSMD-TDFEGASEGDACYMAPELMEGRFSP 234



>gi|348507763|ref|XP_003441425.1| PREDICTED: serine/threonine-protein kinase Nek4-like [Oreochromis
           niloticus]
          Length = 891

 Score = 89.7 bits (221), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 20/164 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI--IVSKVENIYMVFQEAQALAKLEHPNV 75
           ++ ++++GKGS+G V    HK D+  Y IK++    S         QEAQ L++L HPN+
Sbjct: 5   YTFIRVVGKGSYGEVNLVKHKTDRKQYVIKRLNLTTSSKRERRAAEQEAQLLSQLRHPNI 64

Query: 76  VRYFSSW-IQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNI-KIFH 132
           V Y  SW    C             ++I M  C    L   L+++ G++ P   + + F 
Sbjct: 65  VTYKESWEGDDCQ------------LYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFV 112

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HE+ ++HRDLKT NIFL + N   I K+GD G+ +
Sbjct: 113 QIAMALQYLHERNILHRDLKTQNIFLTKTN---IIKVGDLGIAR 153



>gi|334330580|ref|XP_003341381.1| PREDICTED: serine/threonine-protein kinase Nek5 [Monodelphis
           domestica]
          Length = 822

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 133/278 (47%), Gaps = 59/278 (21%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQA-------LAKL 70
           +  ++M+GKG+FG  + A  K D     IK+I ++K     M ++E +A       LAK+
Sbjct: 4   YDVIKMIGKGAFGKAFLAKGKADNQQCVIKEINLTK-----MPYREKEASKKEVILLAKM 58

Query: 71  EHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS--LKRVLEKRDGQIDPLFNI 128
           +HPN+V++F+S +Q  N            ++I ME C     +KR+  +     D    +
Sbjct: 59  KHPNIVKFFTS-LQEMNK-----------LYIVMEYCDGGDLMKRINRQHGVLFDEDQIL 106

Query: 129 KIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK------------ 176
             F  I  G++++H++K++HRD+KT NIFL   N E + K+GDFG+ +            
Sbjct: 107 GWFVQISLGLKHIHDRKILHRDIKTQNIFLS--NNEMVAKLGDFGIARVLNNTMELAQTC 164

Query: 177 SEEPTHLEANTKEN-------DIYCLGVVLKDLY-----FPRKSLDDLLIMVEQ------ 218
              P +L     +N       DI+ LG VL +L      F   SL  L++ + +      
Sbjct: 165 VGTPYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLRHPFEGASLHQLVLKICRAHVDPI 224

Query: 219 QGDFNNIIE-LIFKMTKMTGSDPPQATKILESDIFNML 255
              F++ ++ LI ++ K++  D P    IL+      L
Sbjct: 225 SPRFSSDLQTLITQLFKISPRDRPSVNSILKKPFLEKL 262



>gi|410951421|ref|XP_003982395.1| PREDICTED: serine/threonine-protein kinase Nek4 [Felis catus]
          Length = 744

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ G++ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGRLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|348588791|ref|XP_003480148.1| PREDICTED: serine/threonine-protein kinase Nek4 isoform 1 [Cavia
           porcellus]
          Length = 788

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKV--ENIYMVFQEAQALAKLEHPN 74
            +  ++++G+GS+G V    H+ D   Y IKK+ +            QEAQ L++L+HPN
Sbjct: 5   AYCYVRVVGRGSYGEVTLVKHRRDGRQYVIKKLNLRNATSRERQAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L + L++R GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYQKLKERKGQLLPERQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|340725006|ref|XP_003400866.1| PREDICTED: hypothetical protein LOC100647874 [Bombus terrestris]
          Length = 1209

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 124/247 (50%), Gaps = 48/247 (19%)

Query: 23  MLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYM--VFQEAQALAKLEHPNVVRYFS 80
           +LG+GSFGSV+    K D   + +K+ I+  V  +    + +E + L  L H N+V Y+ 
Sbjct: 13  LLGQGSFGSVYLVRRKKDSKPFVVKEQILDNVNALPFKNISEEVKCLHTLRHTNIVAYYG 72

Query: 81  SWIQSCNSDWTDLTPVKLTIFIQMELCST-SLKRVLEKRDGQIDPLFNIKIFHGIMKGIE 139
           +WI+  +S            +I ME  +  +LK +LE  +  +     + +F  ++ G+ 
Sbjct: 73  AWIEDNHS------------YILMEYATRGTLKDLLENNETPLKEEDALYLFSQVVLGVH 120

Query: 140 YVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS----EEPTHL-----------E 184
           ++H KK++HRDLK +NI L     + + KIGDFG+ K+     +P+ +           E
Sbjct: 121 HIHFKKILHRDLKPENIMLTGSRGDIV-KIGDFGVSKNFKELTKPSIVCRAGSFCYMAPE 179

Query: 185 ANTKEN-----DIYCLGVVLKDLY-----FPRKSLDDLLIMVEQQ-------GDFNNIIE 227
             T ++     DI+ +GV+L ++      FP  SL ++  MV ++       G  ++++ 
Sbjct: 180 MLTDQSYDFKCDIWSMGVILYEMVSKRHPFPAMSLTEITKMVCEERPRPLPRGTSSSVVS 239

Query: 228 LIFKMTK 234
           LI KM +
Sbjct: 240 LISKMLR 246



>gi|348588793|ref|XP_003480149.1| PREDICTED: serine/threonine-protein kinase Nek4 isoform 2 [Cavia
           porcellus]
          Length = 798

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKV--ENIYMVFQEAQALAKLEHPN 74
            +  ++++G+GS+G V    H+ D   Y IKK+ +            QEAQ L++L+HPN
Sbjct: 5   AYCYVRVVGRGSYGEVTLVKHRRDGRQYVIKKLNLRNATSRERQAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L + L++R GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYQKLKERKGQLLPERQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|148342563|gb|ABQ59054.1| NEK4 protein [Homo sapiens]
          Length = 841

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HP+
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPD 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|471356412|ref|XP_004368805.1| PREDICTED: serine/threonine-protein kinase Nek4 [Trichechus manatus
           latirostris]
          Length = 801

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+ +G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRAVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ G++ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGRLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|291393839|ref|XP_002713296.1| PREDICTED: NIMA-related kinase 4-like [Oryctolagus cuniculus]
          Length = 788

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKI--IVSKVENIYMVFQEAQALAKLEHPN 74
            +  ++++G+GS+G V    H+ D   Y IKK+    +         QEAQ L++L+HPN
Sbjct: 5   AYCYVRVVGRGSYGEVTLVKHRRDGRQYVIKKLNLRRASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|507646670|ref|XP_004631703.1| PREDICTED: serine/threonine-protein kinase Nek4 [Octodon degus]
          Length = 798

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKV--ENIYMVFQEAQALAKLEHPN 74
            +  ++++G+GS+G V    H+ D   Y IKK+ +            QEAQ L++L+HPN
Sbjct: 5   AYCYVRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNTTSRERQAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPERQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|56789503|gb|AAH88323.1| Nek4 protein [Rattus norvegicus]
          Length = 309

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 87/166 (52%), Gaps = 18/166 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           +  +  L+++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 3   QAAYCYLRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKH 62

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW                 ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 63  PNIVTYKESWEGGDG-----------LLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 111

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           F  I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 112 FVQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|118349085|ref|XP_001033419.1| Protein kinase domain containing protein [Tetrahymena thermophila]
 gi|89287768|gb|EAR85756.1| Protein kinase domain containing protein [Tetrahymena thermophila
           SB210]
          Length = 1177

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/272 (30%), Positives = 128/272 (47%), Gaps = 60/272 (22%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYM--VFQEAQALAKLE 71
           Y+K + +++++G+G+FGS        +K  Y  KKI++S +         QEAQ L  L 
Sbjct: 6   YKKLYKEIEVIGRGNFGSATLVEKLDNKKQYIAKKIVLSSLNPKQQDSALQEAQLLKDLN 65

Query: 72  HPNVVRYFSSW-----------------IQSC--NSDWTDLTPVKLTIFIQM----ELCS 108
           H N+V Y  S+                 IQ C  +    D+   ++ I  Q+    +L S
Sbjct: 66  HKNIVSYIESFKEEDLLIIIMEYCERKQIQICFFSVSKNDIIHKQMQIIEQLLSYYQLHS 125

Query: 109 TSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPK 168
            +LKR  +K++   + L  +  F+ +   I+Y+HEKK++HRD+KT NIF   I  +   K
Sbjct: 126 -ALKRKKQKKEYFPEMLI-VNWFYELALSIKYIHEKKILHRDIKTSNIF---ITRDGTIK 180

Query: 169 IGDFGLVKSEEPTHLEAN-------------------TKENDIYCLGVVLKDLYFPRKSL 209
           IGDFG+ K  E T   AN                   T ++DI+ LG VL +        
Sbjct: 181 IGDFGISKVLENTTSVANTVVGTPYYMSPEVCESKPYTYKSDIWALGCVLYE-------- 232

Query: 210 DDLLIMVEQQGDFNNIIELIFKMTKMTGSDPP 241
              L  +E   + NN++ LIFK+ +   SD P
Sbjct: 233 ---LCALEHAFESNNLLGLIFKIVQQNISDIP 261



>gi|348507383|ref|XP_003441235.1| PREDICTED: interferon-induced, double-stranded RNA-activated
           protein kinase-like [Oreochromis niloticus]
          Length = 665

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 130/293 (44%), Gaps = 71/293 (24%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           +  ++ LGKG+FG V+ A  K  +  YAIK I   +        +E   L++L H N+VR
Sbjct: 365 YDSIERLGKGAFGRVFKAKQKLLQKYYAIKIIRCRE-----KALREVVTLSELHHSNIVR 419

Query: 78  YFSSWIQSCNSDWTDLTPVKLT-------------IFIQMELCSTSLKRVL--EK----- 117
           Y++ W++  +S++   +                  ++IQMELC T   RV   EK     
Sbjct: 420 YYTCWLE--DSEYQPESTADSCSSSHSSTDSSVKYLYIQMELCDTKTLRVWIDEKNVQNV 477

Query: 118 ----RDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFG 173
               RD +     ++ I   I+ GIEY+H +K +HRDLK  NI       E   KIGDFG
Sbjct: 478 KKSLRDSKRREE-SLNIAQQIVTGIEYIHSRKFIHRDLKPANIMF---GREGEVKIGDFG 533

Query: 174 LVKSEE----------------PTHLEANTKEN---------DIYCLGVVLKDLYFPRKS 208
           LV +E+                P+++    K           DI+  G++  +L +   +
Sbjct: 534 LVTTEKDDNAEDLIERTVYKGTPSYMAPEQKSKRSTLYDRKVDIFAFGLIFFELLWNIPA 593

Query: 209 LDDLLIMVEQQGD----------FNNIIELIFKMTKMTGSDPPQATKILESDI 251
            ++   + E   +          F+   ++I  M  M   D P+A+K L+SD+
Sbjct: 594 GEEKTRIWEDARNQKFPHGFSTHFHQESQIIRSMLSMKPEDRPEASK-LKSDV 645



>gi|47087325|ref|NP_998638.1| mitogen-activated protein kinase 4 [Danio rerio]
 gi|27882123|gb|AAH44411.1| Mitogen-activated protein kinase 4 [Danio rerio]
 gi|86279646|gb|ABC94478.1| extracellular signal-regulated kinase 4 [Danio rerio]
 gi|182891460|gb|AAI64564.1| Mapk4 protein [Danio rerio]
          Length = 674

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 90/164 (54%), Gaps = 7/164 (4%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           +  L+ LG G+ G V SA+ +      A+KK+++    ++    +E +   +L+H NVVR
Sbjct: 19  YQDLRPLGTGASGLVLSALDRRSGLRVAVKKLVMRDAVSVKHALREVKITRRLQHENVVR 78

Query: 78  YFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKG 137
            +     S +    DLT V   I+I  E   T L R+LE+  G +       +F+ +++G
Sbjct: 79  VYDVLGSSGHPLPRDLTHVA-AIYIVQECMETDLARLLEQ--GPLPAEHATLLFYQLLRG 135

Query: 138 IEYVHEKKLVHRDLKTDNIFLQEINTE-FIPKIGDFGLVKSEEP 180
           ++++H   ++HRDLK  NIF   INTE  + KIGDFGL +  +P
Sbjct: 136 LKFIHSANVLHRDLKPANIF---INTEQMLLKIGDFGLARIVDP 176



>gi|301767174|ref|XP_002919037.1| PREDICTED: serine/threonine-protein kinase Nek4-like [Ailuropoda
           melanoleuca]
          Length = 791

 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 89/165 (53%), Gaps = 19/165 (11%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYD-KNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHP 73
            +  L+++G+GS+G V    H+ D +  Y IKK+ +    +       QEAQ L++L+HP
Sbjct: 5   AYCYLRVVGRGSYGEVTLVRHRRDGRRGYVIKKLNLRNASSRERRAAEQEAQLLSQLKHP 64

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIF 131
           N+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F
Sbjct: 65  NIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWF 113

Query: 132 HGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
             I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 VQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 155



>gi|355559575|gb|EHH16303.1| hypothetical protein EGK_11567, partial [Macaca mulatta]
          Length = 818

 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFN-IKIFH 132
           +V Y  SW      +  D       ++I M  C    L + L+++ GQ+ P    ++ F 
Sbjct: 65  IVTYKESW------EGGD-----GLLYIVMGFCEGGDLYQKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|297743778|emb|CBI36661.3| unnamed protein product [Vitis vinifera]
          Length = 859

 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 94/197 (47%), Gaps = 36/197 (18%)

Query: 12  ETYEKTFSQLQML--GKGSFGSVWSAMHKYDKNTYAIKKI-IVSKVENIY-MVFQEAQAL 67
           +T   T  Q+  L  G G FG V    +K D   YA+KKI +  K   +Y  + +E   L
Sbjct: 15  QTPSPTLIQILFLLTGHGGFGHVVLCKNKLDGRQYAVKKIRLKDKSPPVYDRILREVATL 74

Query: 68  AKLEHPNVVRYFSSWIQSC------NSDWTDLTPVKLT---------------------- 99
           ++L+H +VVRY+ +W ++       ++ W  +TP   +                      
Sbjct: 75  SRLQHQHVVRYYQAWFETGVSGSFGDTTWGSMTPASSSFSYKGASSADVNVHENKLESTY 134

Query: 100 IFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQ 159
           ++IQME C  +L+++ E      D      +F  I++G+ ++H + ++HRDL  +NIF  
Sbjct: 135 LYIQMEYCPRTLRQMFESYS-HFDKELAWHLFRQIVEGLVHIHGQGIIHRDLTPNNIFFD 193

Query: 160 EINTEFIPKIGDFGLVK 176
             N     KIGDFGL K
Sbjct: 194 ARNDI---KIGDFGLAK 207



>gi|413941907|gb|AFW74556.1| putative DUF26-domain receptor-like protein kinase family protein
           [Zea mays]
          Length = 706

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 119/246 (48%), Gaps = 49/246 (19%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F++ +MLGKG FG V+  +   D    A+K++  S  + I  +  E   +AKL H N+VR
Sbjct: 371 FAESKMLGKGGFGMVYKGVLP-DGQEIAVKRLCQSSRQGIGELKSELVLVAKLHHKNLVR 429

Query: 78  YFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVL--EKRDGQIDPLFNIKIFHGIM 135
                +Q            +  I +   + + SL  +L   +R+ ++D     KI  GI 
Sbjct: 430 LIGVCLQE-----------QEKILVYEYMPNRSLDTILFDSERNRELDWGKRFKIITGIA 478

Query: 136 KGIEYVHEK---KLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK------SEEPTHLEAN 186
           KG++Y+HE    K+VHRDLK  N+ L   + +++PKI DFGL K      S+  TH  A 
Sbjct: 479 KGLQYLHEDSQLKVVHRDLKASNVLL---DLDYVPKISDFGLAKIFGGDESKCVTHRVAG 535

Query: 187 TK---------------ENDIYCLGVVLKDLYFPRKSLD--------DLLIMVEQQGDFN 223
           T                ++D++  GV++ ++   R++          DLL +V +  D  
Sbjct: 536 TYGYMAPEYAMRGLYSIKSDVFSFGVLVLEIVTGRRNGGLYNSDQDVDLLNLVWEHWDRG 595

Query: 224 NIIELI 229
           N+IELI
Sbjct: 596 NVIELI 601



>gi|47217494|emb|CAG10874.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 649

 Score = 87.8 bits (216), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 90/167 (53%), Gaps = 13/167 (7%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           F  L+ LG G  G V SA+ +  +   AIKK+++     +    +EA+   +L H NVVR
Sbjct: 19  FVDLRPLGVGVTGLVLSAVDQRTRQRVAIKKLLMRDAVTVKHALREAKITQRLRHENVVR 78

Query: 78  YF---SSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGI 134
                + + Q    D T L+     +++  E   T L R+LE+  G +D      +F+ +
Sbjct: 79  VHEVAAPFGQPLPRDPTQLS----ALYVVQECMETDLARLLEQ--GPLDTDHATLLFYQL 132

Query: 135 MKGIEYVHEKKLVHRDLKTDNIFLQEINTE-FIPKIGDFGLVKSEEP 180
           ++G++++H   ++HRDLK  NIF   INTE  + KIGDFGL +  +P
Sbjct: 133 LRGLKFIHSANVLHRDLKPANIF---INTEQLLLKIGDFGLARIVDP 176



>gi|443690811|gb|ELT92847.1| hypothetical protein CAPTEDRAFT_224068 [Capitella teleta]
          Length = 796

 Score = 87.8 bits (216), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 88/164 (53%), Gaps = 20/164 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKK---IIVSKVENIYMVFQEAQALAKLEHPN 74
           + +  ++GKGS+G VW   HK DK  Y +KK   +  SK E      QEA+ L+KL+HPN
Sbjct: 6   YDKKNVIGKGSYGEVWLVRHKRDKKQYVLKKMELLNASKRER-KAAEQEAKLLSKLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS--LKRVLEKRDGQIDPLFNIKIFH 132
           +V Y  S+   C + +         ++I M  C       R+ E++   ++    ++ F 
Sbjct: 65  IVSYKDSF--ECENGF---------VYIVMGYCEGGDLYARLKEQKGVPLEERQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HE+ ++HRDLKT NIFL +     I K+GD G+ K
Sbjct: 114 QITMALQYMHERNILHRDLKTQNIFLTKSK---IIKVGDLGIAK 154



>gi|302842401|ref|XP_002952744.1| NimA-related protein kinase 5 [Volvox carteri f. nagariensis]
 gi|300262088|gb|EFJ46297.1| NimA-related protein kinase 5 [Volvox carteri f. nagariensis]
          Length = 796

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 114/235 (48%), Gaps = 41/235 (17%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVR 77
           +  L ++G+G +G+ + A  KYD + Y IK+I +S  ++     +E+Q L  L+HPN++R
Sbjct: 4   YEDLVIIGQGQYGTAFRARDKYDGHLYCIKRIPMSAKDDHAGALRESQLLDSLDHPNIIR 63

Query: 78  YFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFN----IKIFHG 133
           Y  S++        D     +T F +     T +++   +++      F     + +F  
Sbjct: 64  YRESFVDK------DGALCIVTSFCEEGDLFTRIRKKASQKE-----YFTEEEVMNMFVQ 112

Query: 134 IMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLEAN------- 186
           I   + Y+H K+++HRDLKT NIF   I    I K+GDFG+ K  E T   A        
Sbjct: 113 IASALSYIHSKRVLHRDLKTQNIF---IARGGIIKLGDFGISKVLERTDSFATTVTGTPY 169

Query: 187 ------------TKENDIYCLGVVLKDLYFPRKSL--DDLLIMVEQ--QGDFNNI 225
                       T ++DI+ LG VL +L   + +   D LL +V Q  +G+F  I
Sbjct: 170 YMAPEICTNQPYTYKSDIWSLGCVLYELCTLKHAFAADSLLSLVYQIVRGNFPPI 224



>gi|74207641|dbj|BAE40066.1| unnamed protein product [Mus musculus]
          Length = 274

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 87/166 (52%), Gaps = 18/166 (10%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEH 72
           +  +  ++++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H
Sbjct: 3   QAAYCYMRVVGRGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKH 62

Query: 73  PNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KI 130
           PN+V Y  SW                 ++I M  C    L R L+++ GQ+ P   + + 
Sbjct: 63  PNIVTYKESWEGGDG-----------LLYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEW 111

Query: 131 FHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
           F  I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 112 FVQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|281338028|gb|EFB13612.1| hypothetical protein PANDA_007567 [Ailuropoda melanoleuca]
          Length = 866

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 89/165 (53%), Gaps = 19/165 (11%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYD-KNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHP 73
            +  L+++G+GS+G V    H+ D +  Y IKK+ +    +       QEAQ L++L+HP
Sbjct: 5   AYCYLRVVGRGSYGEVTLVRHRRDGRRGYVIKKLNLRNASSRERRAAEQEAQLLSQLKHP 64

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIF 131
           N+V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F
Sbjct: 65  NIVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPESQVVEWF 113

Query: 132 HGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
             I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 VQIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 155



>gi|505843319|ref|XP_004615157.1| PREDICTED: serine/threonine-protein kinase Nek4 [Sorex araneus]
          Length = 737

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 86/164 (52%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+ +G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYLRPVGRGSYGEVTLVRHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFN-IKIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ G+  P    ++ F 
Sbjct: 65  IVTYKESW------EGGD-----GLLYIVMGFCEGGDLYRKLKEQKGRPLPESQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|395520997|ref|XP_003764608.1| PREDICTED: serine/threonine-protein kinase Nek5-like [Sarcophilus
           harrisii]
          Length = 804

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 134/282 (47%), Gaps = 67/282 (23%)

Query: 21  LQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQA-------LAKLEHP 73
           ++M+G+G+FG  + A  K D     IK+I ++K     M ++E +A       LAK++HP
Sbjct: 7   IKMIGEGAFGKAFLAKGKADNQQCVIKEIDLTK-----MPYREKEASKKEVILLAKMKHP 61

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS--LKRVLEKRDGQIDPLFNIKIF 131
           N+V++F+S +Q  N            ++I ME C     +KR+  +     D    +  F
Sbjct: 62  NIVKFFTS-LQEMNK-----------LYIVMEYCDGGDLMKRISRQHGVLFDEDKILGWF 109

Query: 132 HGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK------------SEE 179
             I  G++++H++K++HRD+KT NIFL   N E + K+GDFG+ +               
Sbjct: 110 VQISLGLKHIHDRKILHRDIKTQNIFLS--NNEMVAKLGDFGIARVLNNTMELARTCVGT 167

Query: 180 PTHLEANTKEN-------DIYCLGVVLKDLYFPRKSLDDLLIMVEQQGDFNNIIELIFKM 232
           P +L     +N       DI+ LG VL +L   R   +            +N+ +L+ K+
Sbjct: 168 PYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLRHPFEG-----------SNLHQLVLKI 216

Query: 233 --TKMTGSDPPQAT--KILESDIFNMLSDNHSGALTSKINSL 270
             T+     P  ++  +IL + +FN+   N        INS+
Sbjct: 217 CQTRFEPISPKFSSDLQILVTQLFNIPPRNRPS-----INSI 253



>gi|164508748|emb|CAM07149.1| double stranded RNA activated protein kinase 3 [Tetraodon
           nigroviridis]
          Length = 432

 Score = 87.4 bits (215), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 133/286 (46%), Gaps = 59/286 (20%)

Query: 13  TYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEH 72
           ++ KTF  + +LGKG FG+V+       +  +AIK  IV    N     +E   L+ L H
Sbjct: 132 SFTKTFEVMGLLGKGGFGAVYKVKDNALEKFFAIK--IVRSRRN---ALREVVVLSDLLH 186

Query: 73  PNVVRYFSSWIQ------SCNSDWTDLTPVKLT--------IFIQMELCST-SLKRVLEK 117
            N++RY+S W +      + ++D +D      T        ++IQMELC+  +L R +  
Sbjct: 187 INIIRYYSFWEEETRYQDNSSTDGSDSFSGTSTGSSESDCFLYIQMELCANKTLTRWIHD 246

Query: 118 RDGQID-----PLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDF 172
           ++ +          ++++   I  G+EY+H K  +HRDLK DNI    +  E + KIGDF
Sbjct: 247 KNSEFSEDSKRSQESLRLAQQIASGVEYIHSKGFIHRDLKPDNILFG-LKDEVV-KIGDF 304

Query: 173 GLVKSEE----------------PTHLEANT------KENDIYCLGVVLKDLYFPRKSLD 210
           GLV  +                 P+++          ++ DI+ +G++  +L++   S  
Sbjct: 305 GLVTKDNIDTIDGVEKRTKGVGTPSYMAPEQDGQNYDRKVDIFSMGLIFLELWWKVSSGH 364

Query: 211 D----LLIMVEQ------QGDFNNIIELIFKMTKMTGSDPPQATKI 246
           +    LL    Q      Q  F +  E+I  M + +  D P+A+K+
Sbjct: 365 EKANVLLHARRQEFPQGFQNAFFDEYEIIRPMLRTSPEDRPEASKV 410



>gi|462421868|gb|EMJ26131.1| hypothetical protein PRUPE_ppa021700mg, partial [Prunus persica]
          Length = 985

 Score = 87.4 bits (215), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 81/320 (25%), Positives = 141/320 (44%), Gaps = 82/320 (25%)

Query: 6   SENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYM---VFQ 62
           S +  +  Y   F +LQ LG G FG V    +K D   YA+KKI + K +++ +   + +
Sbjct: 415 STSLPSSRYLSDFEELQSLGHGGFGHVVLCKNKLDGRQYAVKKIRL-KDKSLPVNDRILR 473

Query: 63  EAQALAKLEHPNVVRYFSSWIQS------CNSDWTDLTPVKLT----------------- 99
           E   L++L+H +VVRY+ +W ++       ++ W  +T    T                 
Sbjct: 474 EVATLSRLQHQHVVRYYQAWFETGIVGAHGDTTWGSMTAASSTFSFKGTNSADALGHENK 533

Query: 100 -----IFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTD 154
                ++IQME C  +L++V E    + D      +   I++G+ ++H + ++HRDL   
Sbjct: 534 LESTYLYIQMEYCPRTLRQVFESYS-RFDKELAWHLCRQIVEGLAHIHGQGIIHRDLTPS 592

Query: 155 NIFLQEINTEFIPKIGDFGLVK-------SEEPT------------------------HL 183
           NIF    N     KIGDFGL K        +EP+                         +
Sbjct: 593 NIFFDARND---IKIGDFGLAKFLKLEQLDQEPSFPPDTAGVSLDGTGQVGTYFYTAPEI 649

Query: 184 EAN----TKENDIYCLGVVLKDLYFPRKSLDD---LLIMVEQQG--------DFNNIIEL 228
           E       ++ D+Y LGVV  +L+ P  +  +   +L  ++Q+G        +F     L
Sbjct: 650 EQGWPKIDEKADMYSLGVVFFELWHPFGTAMERHHVLSDLKQKGELPPAWVAEFPEQASL 709

Query: 229 IFKMTKMTGSDPPQATKILE 248
           + ++   + SD P AT++L+
Sbjct: 710 LRRLMSPSPSDRPSATELLK 729



>gi|342180168|emb|CCC89645.1| putative protein kinase [Trypanosoma congolense IL3000]
          Length = 592

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 129/298 (43%), Gaps = 57/298 (19%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDK---NTYAIKKIIVSK-VENIYMVFQEAQALAK 69
           Y++ F ++Q LG G+FG V+ A H  +      +A+KKI V   +  ++ V  E + L +
Sbjct: 180 YKRYFREIQKLGNGTFGGVYLAQHVMEGVGLGYFALKKIPVGNNMSYLHNVLSEVRILEE 239

Query: 70  L-EHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPLFN 127
           + +HPNVV Y  SW+    +   D  P    +FI ME  +  SL+  LE+    +  +  
Sbjct: 240 VKQHPNVVEYKHSWVDVAQT--ADFGPPVRCLFILMEYATMGSLESYLERHGTALPTIAV 297

Query: 128 IKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKI------------------ 169
              F   + G  ++H K ++HRDLK  N+ L     E +P++                  
Sbjct: 298 WYFFLSAVAGTAHLHRKNIIHRDLKPQNLLLTG-RPEELPRVLVSDFGTSTLLSEMTYER 356

Query: 170 -GDFGLVKSEEPTHLE-----------ANTKENDIYCLGVVLK----DLYFPRKSLDDLL 213
            G  G V+   P  LE           ++TK  D++ LG++L     D   P +  +  +
Sbjct: 357 TGGTGTVEYMAPELLECSGGTEGSYIYSHTKATDVWSLGMILHYLACDGTLPLRLANGGV 416

Query: 214 IM-VEQQGDFNNIIELIFKMTKMTGSDP---PQATKILESDIF----------NMLSD 257
           I+ V  +  +    E+I  M  M   DP   P    ILES +           NM SD
Sbjct: 417 ILDVPNRSHYIRPPEMIELMRVMLHHDPTKRPTCDDILESTVVRTIQRSFKKANMFSD 474



>gi|443694315|gb|ELT95488.1| hypothetical protein CAPTEDRAFT_101248 [Capitella teleta]
          Length = 484

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 96/184 (52%), Gaps = 18/184 (9%)

Query: 5   MSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEA 64
           +SE       E+ F  L+ LG+GS+GSV+ A+HK      AIK++ V    ++  + +E 
Sbjct: 24  LSEESLTRPPEEVFDILEKLGEGSYGSVYKALHKESGQVLAIKQVPVDT--DLQEIIKEI 81

Query: 65  QALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCST-SLKRVLEKRDGQID 123
             + + + P++V+Y+ S+ ++     TDL       +I ME C   S+  ++  R+  + 
Sbjct: 82  SIMQQCDSPHIVKYYGSYFKN-----TDL-------WIVMEYCGAGSVSDIMRLRNKTLV 129

Query: 124 PLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHL 183
                 I    +KG+EY+HE++ +HRD+K  NI L   NTE   K+ DFG+      T  
Sbjct: 130 ESEIATILWYTLKGLEYLHERRKIHRDIKAGNILL---NTEGHAKLADFGVAGQLTDTMA 186

Query: 184 EANT 187
           + NT
Sbjct: 187 KRNT 190



>gi|513005954|ref|XP_004864435.1| PREDICTED: serine/threonine-protein kinase Nek4 isoform X1
           [Heterocephalus glaber]
          Length = 794

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  ++++G+GS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN
Sbjct: 5   AYCYVRVVGRGSYGEVTLVKHRRDGRQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+ + GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKDQKGQLLPERQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   +   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTH---IIKVGDLGIAR 154



>gi|123496113|ref|XP_001326893.1| CAMK family protein kinase [Trichomonas vaginalis G3]
 gi|121909814|gb|EAY14670.1| CAMK family protein kinase [Trichomonas vaginalis G3]
          Length = 421

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 102/208 (49%), Gaps = 39/208 (18%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVS--KVENIYMVFQEAQALAKLEHPNV 75
           +  +Q +G GS+G V  A  K     YAIKK+ +S   VE      +E   L KL HPN+
Sbjct: 6   YQVIQTIGTGSYGKVVLAKEKKSGTKYAIKKVKLSGMTVEQRQKALEEVNLLLKLNHPNI 65

Query: 76  VRYFSSWIQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNIKIFHGI 134
           VR + S+I+ C            T+ I M+     +L  V+EK    +  +  +  F  I
Sbjct: 66  VRCYKSFIKKC------------TLHIVMDYVDGGNLDNVIEKTHEYMSEMDVLSFFIQI 113

Query: 135 MKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEE------------PTH 182
           +  + Y+H+K ++HRD+K +N+FL +     I K+GDFG+ K+ E            P +
Sbjct: 114 VIALSYIHKKNIIHRDIKPENVFLMK---NGIAKLGDFGISKTLESSIGLATTVIGTPYY 170

Query: 183 L--------EANTKENDIYCLGVVLKDL 202
           L        + NTK  D++ LG +L ++
Sbjct: 171 LAPEVWSGEQYNTKA-DMWSLGCILYEM 197



>gi|118353227|ref|XP_001009885.1| Protein kinase domain containing protein [Tetrahymena thermophila]
 gi|89291651|gb|EAR89639.1| Protein kinase domain containing protein [Tetrahymena thermophila
           SB210]
          Length = 769

 Score = 86.7 bits (213), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 86/312 (27%), Positives = 146/312 (46%), Gaps = 63/312 (20%)

Query: 7   ENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKV---ENIYMVFQE 63
           E+F +      +  LQ +GKG +GSV+ A H+  K   AIK I  S +   ++I M+F+E
Sbjct: 93  EDFDDSNNFAMYKILQKVGKGGYGSVYEARHRITKERIAIKMINGSSIRSAKDIEMMFKE 152

Query: 64  AQALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQ-I 122
              L  L H N+++     + +C   +T  + +KL I  +  L    L+  L+K+ GQ +
Sbjct: 153 IGLLKNLNHKNIIK-----VLNC---YTLKSEMKLAIVFEY-LEGGDLREYLDKQPGQCV 203

Query: 123 DPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGL-------- 174
           D     KIF  +   I+Y H +K++HRDLK +NI     N + I K+ DFG+        
Sbjct: 204 DEEVARKIFLQLFNAIQYCHREKIIHRDLKLENIMFTSKNYDVI-KVVDFGISAQQSLIN 262

Query: 175 ----------------VKSEEPTHLEANTKENDIYCLG-----VVLKDLYFPRKSLDDLL 213
                           + S+ P H        D++ +G     V++    FP+ + +++ 
Sbjct: 263 IDYTQAGSARYFAPEVLSSKAPAHPSI-----DVWAMGCILFWVIVGKSPFPQSTKEEV- 316

Query: 214 IMVEQQGDFNNIIELIFKMT-----KMTGSDPPQATKILESDIFNMLSDNHSGALTSKIN 268
                   FNNI++  + +      +MT S     TK+L+ D+ + ++ N         N
Sbjct: 317 --------FNNILKGNYSIPVEAKQRMTKSVQDLITKMLQVDVNSRITMNEIAQHQWLKN 368

Query: 269 SLEEKIKSLEQE 280
           S+EE IK +EQ+
Sbjct: 369 SVEE-IKIIEQK 379



>gi|221487881|gb|EEE26113.1| protein kinase domain-containing protein, putative [Toxoplasma
           gondii GT1]
          Length = 1462

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 58/232 (25%), Positives = 101/232 (43%), Gaps = 29/232 (12%)

Query: 22  QMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVRYFSS 81
           + +G+GSF +VW    +  K   A+K I    V     + QE   L +L+HPN+VR+   
Sbjct: 100 ERIGRGSFAAVWKGHIEQTKEIVAVKVISRHTVHEATQLNQEVAVLKQLQHPNIVRFI-- 157

Query: 82  WIQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEY 140
                     DL   +   ++ +E C    +  +L +  G+I   F  ++   +  G+  
Sbjct: 158 ----------DLKKSQFHYYLVLEFCPGGDVSSLLHRHGGRIAEAFARRLLQQMAAGLLE 207

Query: 141 VHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLEANTKENDIYCLGVVLK 200
           +H +  +HRDLK  N+ L   +     KI DFG  +S +P  L A    + +Y    +L+
Sbjct: 208 IHRRSYIHRDLKPQNLLLSSASHAATLKIADFGFARSLQPWDLAATICGSPLYMAPEILQ 267

Query: 201 DLYFPRKSLDDLLIMVEQQGDFNNIIELIFKMTK----MTGSDPPQATKILE 248
             Y+  K+            D  ++  + F+M       +G +P Q  K +E
Sbjct: 268 HQYYDAKA------------DLWSVGAIFFEMLHGRPPFSGQNPLQLLKNIE 307



>gi|237830969|ref|XP_002364782.1| protein kinase domain-containing protein [Toxoplasma gondii ME49]
 gi|211962446|gb|EEA97641.1| protein kinase domain-containing protein [Toxoplasma gondii ME49]
          Length = 1463

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 58/232 (25%), Positives = 101/232 (43%), Gaps = 29/232 (12%)

Query: 22  QMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVRYFSS 81
           + +G+GSF +VW    +  K   A+K I    V     + QE   L +L+HPN+VR+   
Sbjct: 100 ERIGRGSFAAVWKGHIEQTKEIVAVKVISRHTVHEATQLNQEVAVLKQLQHPNIVRFI-- 157

Query: 82  WIQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEY 140
                     DL   +   ++ +E C    +  +L +  G+I   F  ++   +  G+  
Sbjct: 158 ----------DLKKSQFHYYLVLEFCPGGDVSSLLHRHGGRIAEAFARRLLQQMAAGLLE 207

Query: 141 VHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLEANTKENDIYCLGVVLK 200
           +H +  +HRDLK  N+ L   +     KI DFG  +S +P  L A    + +Y    +L+
Sbjct: 208 IHRRSYIHRDLKPQNLLLSSASHAATLKIADFGFARSLQPWDLAATICGSPLYMAPEILQ 267

Query: 201 DLYFPRKSLDDLLIMVEQQGDFNNIIELIFKMTK----MTGSDPPQATKILE 248
             Y+  K+            D  ++  + F+M       +G +P Q  K +E
Sbjct: 268 HQYYDAKA------------DLWSVGAIFFEMLHGRPPFSGQNPLQLLKNIE 307



>gi|195390339|ref|XP_002053826.1| GJ23132 [Drosophila virilis]
 gi|194151912|gb|EDW67346.1| GJ23132 [Drosophila virilis]
          Length = 835

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 120/264 (45%), Gaps = 54/264 (20%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKV--ENIYMVFQEAQALAKLEHPNV 75
           + +++++G+GSFG       K+D +    K+I +S++      +   E +  +KL HPN+
Sbjct: 106 YEKVRVVGQGSFGIAILYRRKFDGHHIVFKQINLSELTPPGRDLAMNEVEVFSKLHHPNI 165

Query: 76  VRYFSSWIQSCNSDWTDLTPVKLTIFIQMELC-STSLKRVLEKRDG--QIDPLFNIKIFH 132
           V Y  S+I+              T+ I+ME     +L +++  R G       + I +F 
Sbjct: 166 VSYLGSFIKDN------------TLLIEMEYADGGTLAQIIADRQGTQHFPERYIIAVFE 213

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSE-------------- 178
            I   I Y+H + ++HRDLKT N+FL   N   I KIGDFG+ K                
Sbjct: 214 QISSAINYMHSENILHRDLKTANVFL---NGRGIVKIGDFGISKIMNAKIHAQTVLGTPY 270

Query: 179 --EPTHLEANTKEN--DIYCLGVVLKDLYFPRKSLDDLLIMVEQQGDFNNIIELIFKMTK 234
              P   E    +N  DI+ LG +L +L   +K+              +N+ EL+ K+  
Sbjct: 271 YFSPEMCEGKEYDNKSDIWALGCILGELCCLKKTFAA-----------SNLSELVTKI-- 317

Query: 235 MTGSD---PPQATKILESDIFNML 255
           M GS    PP  T  L S + N+L
Sbjct: 318 MAGSYTAVPPGYTSGLRSLMANLL 341



>gi|50557052|ref|XP_505934.1| YALI0F27159p [Yarrowia lipolytica]
 gi|49651804|emb|CAG78746.1| YALI0F27159p [Yarrowia lipolytica CLIB122]
          Length = 575

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 89/200 (44%), Gaps = 13/200 (6%)

Query: 5   MSEN-FSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDK---NTYAIKKIIVSKVENIYM- 59
           +SEN F    ++K F     LG+G  G+VW   H  +      +A KK+ V   + +++ 
Sbjct: 144 ISENAFLQGYFDKFFELKHELGRGGRGTVWLVEHVLNGVSLGLFACKKVPVGD-DTVWLT 202

Query: 60  -VFQEAQALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKR 118
               E   L +L HPN++RY   W+++  S W+   P     FI  E CS     V  K+
Sbjct: 203 KALYEVTLLKQLNHPNLIRYNHVWLET--SQWSPFGPAVPCAFILQEYCSGGNLEVYVKK 260

Query: 119 DGQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQ-EINTEFIPK---IGDFGL 174
              + P   +     I+ G+ Y+HE +++HRDLK  N  L+ E N    P    + DFG 
Sbjct: 261 RRTLTPFEVVSFLKDILSGVSYLHEHQIIHRDLKPSNFLLKDEGNGPGTPPQILVSDFGE 320

Query: 175 VKSEEPTHLEANTKENDIYC 194
              E        T     YC
Sbjct: 321 GNVEGQHRSSTGTTGTLEYC 340



>gi|159468884|ref|XP_001692604.1| flagellar autonomy 2 NIMA family kinase [Chlamydomonas reinhardtii]
 gi|19338976|gb|AAL86904.1|AF479588_1 protein kinase Fa2 [Chlamydomonas reinhardtii]
 gi|158278317|gb|EDP04082.1| flagellar autonomy 2 NIMA family kinase [Chlamydomonas reinhardtii]
          Length = 618

 Score = 86.7 bits (213), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 118/242 (48%), Gaps = 50/242 (20%)

Query: 20  QLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVE------NIYMVFQEAQALAKLEHP 73
           +LQ + KGSFG+V+ A+ K D   YA+K++ +   +      +      EA+ LA+L HP
Sbjct: 19  ELQYIDKGSFGAVFKAVRKSDGRVYALKQVDLRSADFKNPTLDRAAAIDEARMLAQLNHP 78

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPLFNI-KIF 131
           +V+R+F S++             KL I   ME  S  S++++++   G+  P   + +IF
Sbjct: 79  HVIRHFESFVDGEG---------KLNIL--MEYASKGSVRQLVKSYRGRPLPEEGVWRIF 127

Query: 132 HGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLEANT---- 187
              + G+ Y+H KK++HRD+K+ N+F+   +     KIGDFG+ +S   +   A T    
Sbjct: 128 IQTLIGLSYLHSKKIIHRDIKSANLFIDAYDNI---KIGDFGIARSLGASSNLAQTILGT 184

Query: 188 ---------------KENDIYCLGVVLKDLYFPRKSLDDLLIMVEQQGDFNNIIELIFKM 232
                           ++D++ LGVV+ +        D     VE     NN + LI K+
Sbjct: 185 PYYMAPELCQDKPYDAKSDVWALGVVMYECCMGHYPFD-----VEN----NNQVALIRKI 235

Query: 233 TK 234
            +
Sbjct: 236 AR 237



>gi|470467457|ref|XP_004341798.1| protein kinase domain containing protein [Acanthamoeba castellanii
           str. Neff]
 gi|440798639|gb|ELR19706.1| protein kinase domain containing protein [Acanthamoeba castellanii
           str. Neff]
          Length = 545

 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 90/176 (51%), Gaps = 28/176 (15%)

Query: 10  SNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIK--KIIVSKVENIYMVFQEAQAL 67
           +   Y + F +++ +G GSF  V+ A ++ D   YA+K  K   S   +++   +E  AL
Sbjct: 214 AGSRYLEDFEEIEKIGTGSFSEVFKARNRVDGWLYAVKQAKRAFSSPADMHNTLKEVYAL 273

Query: 68  AKL-EHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-----LKRVLEKRDGQ 121
           A L  HP+VVRY+S+W++               ++IQ E CS       LK+ +   + Q
Sbjct: 274 AALGSHPHVVRYYSAWVED-------------RLYIQTEYCSGGSLADHLKKGVRFTEAQ 320

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIF--LQEINTEFIPKIGDFGLV 175
           +     I +   + +G+ ++H K L H D+K +NI+  LQ+     + KIGD GL+
Sbjct: 321 L-----IDVLRQVAQGLSHIHRKGLAHLDVKPENIYVDLQDDGVTPLYKIGDLGLI 371



>gi|213404804|ref|XP_002173174.1| eukaryotic translation initiation factor 2-alpha kinase
           [Schizosaccharomyces japonicus yFS275]
 gi|212001221|gb|EEB06881.1| eukaryotic translation initiation factor 2-alpha kinase
           [Schizosaccharomyces japonicus yFS275]
          Length = 687

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 56/72 (77%), Gaps = 1/72 (1%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVS-KVENIYMVFQEAQALAKLEH 72
           YE  F +L+MLGKG FG+V+ A +K D   YA+KKII+S +  + + VFQEA++LA++ H
Sbjct: 200 YETDFEELEMLGKGGFGTVYRARNKIDGAEYALKKIILSLRSLSRFGVFQEARSLARMNH 259

Query: 73  PNVVRYFSSWIQ 84
           PNV+R++SSW++
Sbjct: 260 PNVIRFYSSWVE 271



>gi|471229273|ref|XP_004035499.1| hypothetical protein IMG5_098490 [Ichthyophthirius multifiliis]
 gi|340505702|gb|EGR32013.1| hypothetical protein IMG5_098490 [Ichthyophthirius multifiliis]
          Length = 627

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 82/164 (50%), Gaps = 17/164 (10%)

Query: 16  KTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKII--VSKVENIYMVFQEAQALAKLEHP 73
           K +  L  LGKG++G VW    K  +  YA+KKI        +    F+E   L +L HP
Sbjct: 14  KQYQILNKLGKGAYGIVWKVQEKKSQKIYALKKIFDAFQNSTDAQRTFREIMFLQELNHP 73

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHG 133
           N+++ F       + D          I++  E   T L  V+  R G ++ +    I + 
Sbjct: 74  NIIKVFDVIRAKNDKD----------IYLLFEYMDTDLHAVI--RAGILEEIHKQYIIYQ 121

Query: 134 IMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS 177
           I K I+Y+H  +L+HRDLK  NI    +N++ + K+ DFGLV+S
Sbjct: 122 IFKSIKYIHSAQLIHRDLKASNIL---VNSDCMVKVADFGLVRS 162



>gi|189065491|dbj|BAG35330.1| unnamed protein product [Homo sapiens]
          Length = 841

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 87/164 (53%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +  L+++GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+H N
Sbjct: 5   AYCYLRVVGKGSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHLN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      +  D       ++I M  C    L R L+++ GQ+ P   + + F 
Sbjct: 65  IVTYKESW------EGGDGL-----LYIVMGFCEGGDLYRKLKEQKGQLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|118382027|ref|XP_001024173.1| Protein kinase domain containing protein [Tetrahymena thermophila]
 gi|89305940|gb|EAS03928.1| Protein kinase domain containing protein [Tetrahymena thermophila
           SB210]
          Length = 842

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 99/180 (55%), Gaps = 21/180 (11%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKV--ENIYMVFQEAQALAKLE 71
           YE+ + +++++G+G+ GS      + DK  Y  KK+I++ +  ++     QE + L +++
Sbjct: 10  YEQKYKEIELIGRGTQGSAMLVECRSDKKRYVSKKVILTNLSEKDQNNAIQELKLLREMK 69

Query: 72  HPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDG---QIDPLFN 127
           HPN+V++  S+ +            K  + I ME C    L ++++++     QI+    
Sbjct: 70  HPNIVKFIESYKE------------KNKVIIIMEYCEYGDLSQLIKQKSAKGEQIEESII 117

Query: 128 IKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLEANT 187
           ++ F  I   + ++H KK++HRD+K+ NIFL + N     KIGDFG+ K  E +  +ANT
Sbjct: 118 LQWFIQICSALSFIHSKKVIHRDIKSSNIFLTKSN---CVKIGDFGISKQLENSMDKANT 174



>gi|345325087|ref|XP_001513277.2| PREDICTED: serine/threonine-protein kinase Nek5 [Ornithorhynchus
           anatinus]
          Length = 873

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 126/276 (45%), Gaps = 61/276 (22%)

Query: 21  LQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQA-------LAKLEHP 73
           ++M+G+G+FG  + A  K D     IK+I ++K     M  QE +A       LAK++HP
Sbjct: 7   IKMIGEGAFGKAFLARGKADNQQCVIKEINLTK-----MPIQEKEASQKEVILLAKMKHP 61

Query: 74  NVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS--LKRVLEKRDGQIDPLFNIKIF 131
           N+V +FSS +Q  N            ++I ME C     ++R+  +R         +  F
Sbjct: 62  NIVAFFSS-LQEKNK-----------LYIVMEYCDGGDLMRRINSQRGVLFSEEQILGWF 109

Query: 132 HGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK------------SEE 179
             I  G++++H++K++HRD+K  NIFL   +   + K+GDFG+ +               
Sbjct: 110 VQISLGLKHIHDRKILHRDIKAQNIFLS--HNGMVAKLGDFGIARVLNNTMELARTCVGT 167

Query: 180 PTHLEANTKEN-------DIYCLGVVLKDLY-----FPRKSLDDLLIMVEQQGDFNNIIE 227
           P +L     +N       DI+ LG VL +L      F   SL  L++ +  Q  FN I  
Sbjct: 168 PYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLRHPFEGNSLHQLVLKI-CQARFNPISP 226

Query: 228 --------LIFKMTKMTGSDPPQATKILESDIFNML 255
                   LI ++ K+T  D P    IL+      L
Sbjct: 227 MFSSDLRLLISQLFKVTPRDRPSVNSILKKPFLEKL 262



>gi|291221185|ref|XP_002730606.1| PREDICTED: NIMA-related kinase 4-like [Saccoglossus kowalevskii]
          Length = 889

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 87/164 (53%), Gaps = 20/164 (12%)

Query: 18  FSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIV---SKVENIYMVFQEAQALAKLEHPN 74
           + +++++GKGS+G VW   HK D+  Y +KK+ +   SK E       EA+ L+KL HPN
Sbjct: 6   YDKIRVVGKGSYGEVWLVKHKKDRKQYVLKKMDLQNASKRERKAAEL-EAKLLSKLRHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS--LKRVLEKRDGQIDPLFNIKIFH 132
           +V Y  S+              +  +FI M  C       R+ E++   +D    ++ F 
Sbjct: 65  IVSYKDSFETE-----------QGFLFIAMGFCDGGDLYTRLKEQKGKALDEKQIVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HE+ ++HRDLKT NIFL +     I K+GD G+ +
Sbjct: 114 QIAMALQYMHERNILHRDLKTQNIFLTKSK---IIKVGDLGIAR 154



>gi|513204248|ref|XP_004944439.1| PREDICTED: serine/threonine-protein kinase Nek4 isoform X3 [Gallus
           gallus]
          Length = 808

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 84/160 (52%), Gaps = 18/160 (11%)

Query: 21  LQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPNVVRY 78
           L+ +GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN+V Y
Sbjct: 9   LRAVGKGSYGEVSLVRHRQDSKQYVIKKLNLKHASSRERKAAEQEAQLLSQLKHPNIVAY 68

Query: 79  FSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFN-IKIFHGIMK 136
             SW      D          ++I M  C    L   L+++ G++ P    ++ F  I  
Sbjct: 69  RESWQ---GEDG--------LLYIVMGFCEGGDLYHRLKEQKGKLLPENQVVEWFVQIAM 117

Query: 137 GIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 118 ALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|118096697|ref|XP_414252.2| PREDICTED: serine/threonine-protein kinase Nek4 isoformX2 [Gallus
           gallus]
          Length = 807

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 84/160 (52%), Gaps = 18/160 (11%)

Query: 21  LQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPNVVRY 78
           L+ +GKGS+G V    H+ D   Y IKK+ +    +       QEAQ L++L+HPN+V Y
Sbjct: 9   LRAVGKGSYGEVSLVRHRQDSKQYVIKKLNLKHASSRERKAAEQEAQLLSQLKHPNIVAY 68

Query: 79  FSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFN-IKIFHGIMK 136
             SW      D          ++I M  C    L   L+++ G++ P    ++ F  I  
Sbjct: 69  RESWQ---GEDG--------LLYIVMGFCEGGDLYHRLKEQKGKLLPENQVVEWFVQIAM 117

Query: 137 GIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            ++Y+HEK ++HRDLKT N+FL   N   I K+GD G+ +
Sbjct: 118 ALQYLHEKHILHRDLKTQNVFLTRTN---IIKVGDLGIAR 154



>gi|452824359|gb|EME31362.1| Wee1-like protein kinase putative tyrosine kinase Wee1 [Galdieria
           sulphuraria]
          Length = 525

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 88/170 (51%), Gaps = 22/170 (12%)

Query: 10  SNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQAL 67
           ++  Y + F ++ +LG+G  G V  A H+ D   YAIK      V N   +   +E Q L
Sbjct: 219 TSSRYWQDFEEIAVLGRGERGVVVKARHRIDGGIYAIKMSRKPLVGNSCQHEALREVQIL 278

Query: 68  AKL-EHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPL 125
             L  HPN+ +YF+SW+++             TI+IQ+E CS  SL  ++      ID L
Sbjct: 279 VALGGHPNITQYFNSWLEN------------ETIYIQLEYCSGGSLSTLMNDIIPSIDEL 326

Query: 126 FNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV 175
           F  +I   I   + ++H K +VH D+K +N+ +    ++ + K+GDFGL 
Sbjct: 327 F--RIMRNITSALCFIHSKGIVHMDVKPENVLI----SKGVHKLGDFGLA 370



>gi|28475311|emb|CAD67778.1| double stranded RNA-activated protein kinase 2 [Tetraodon
           nigroviridis]
 gi|29125874|emb|CAD67791.1| double stranded RNA-activated protein kinase 2 [Tetraodon
           nigroviridis]
          Length = 279

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 92/177 (51%), Gaps = 22/177 (12%)

Query: 14  YEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHP 73
           +   F   + LG G+FG V+    K  +  YA+K I+ SK        +E +AL+ L H 
Sbjct: 34  FRHAFEVKECLGSGAFGDVYRVKDKVMQKFYAVK-IVHSKSN----ALREVEALSDLLHI 88

Query: 74  NVVRYFSSWIQSCN-SDWTDLTPVKLT--------IFIQMELCST-SLKRVLEKRDGQID 123
           N++RYFSSW +     D +D    + T        ++IQMELC+  +L R +  ++ +  
Sbjct: 89  NIIRYFSSWEEETRYQDGSDSFSGRSTGSSESDCFLYIQMELCANKTLTRWIHDKNSESS 148

Query: 124 -----PLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLV 175
                   ++++   I  G++Y+H K  +HRDLK DNI    +  E + KIGDFGLV
Sbjct: 149 GDSKRSQESLRLAQQIASGVKYIHSKGFIHRDLKPDNILFG-LKDEVV-KIGDFGLV 203



>gi|356522466|ref|XP_003529867.1| PREDICTED: serine/threonine-protein kinase ATG1-like [Glycine max]
          Length = 690

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 125/306 (40%), Gaps = 62/306 (20%)

Query: 24  LGKGSFGSVWSAMHKYDKNTYAIKKI----IVSKV-ENIYMVFQEAQALAKLEHPNVVRY 78
           +G GSF  VW A ++     YA+K+I    +  KV EN+    +E   L+ + HPN++R 
Sbjct: 20  IGSGSFAVVWRARNRSSGLEYAVKEIDKRHLSPKVRENL---LKEISILSTIHHPNIIRL 76

Query: 79  FSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGI 138
           F + IQ+ +            I++ +E C+         R G++           +  G+
Sbjct: 77  FEA-IQTNDR-----------IYLVLEYCAGGDLAAYIHRHGKVSEPVAHHFMRQLAAGL 124

Query: 139 EYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS-----------EEPTHLEANT 187
           + + EK L+HRDLK  N+ L       + KIGDFG  +S             P ++    
Sbjct: 125 QVLQEKNLIHRDLKPQNLLLATTAATPVMKIGDFGFARSLTPQGLADTLCGSPYYMAPEI 184

Query: 188 KEN-------DIYCLGVVLKDLYFPRKSLDDLLIMVEQQGDFNNII---ELIFKMTKMTG 237
            EN       D++ +G +L  L   R   D       Q   F NI+   EL F       
Sbjct: 185 IENQKYDAKADLWSVGAILYQLVIGRPPFDG----NSQLQLFQNILASTELHF------- 233

Query: 238 SDPPQATKILESDIF----NMLSDNHSGALTSKI----NSLEEKIKSLEQENADLKQENN 289
             PP A K+L SD      N+L  N    LT K     N L E   ++  E   L Q   
Sbjct: 234 --PPDALKVLHSDCLDLCRNLLRRNPDERLTFKAFFNHNFLREPRPTMNVEQFQLHQSER 291

Query: 290 VKKEKI 295
           +   ++
Sbjct: 292 LTNHQL 297



>gi|507961853|ref|XP_004687467.1| PREDICTED: serine/threonine-protein kinase 4 isoform X1 [Condylura
           cristata]
          Length = 487

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 97/186 (52%), Gaps = 18/186 (9%)

Query: 3   KLMSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQ 62
           K + E+   +  E+ F  L+ LG+GS+GSV+ A+HK      AIK++ V    ++  + +
Sbjct: 15  KKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVES--DLQEIIK 72

Query: 63  EAQALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCST-SLKRVLEKRDGQ 121
           E   + + + P+VV+Y+ S+ ++     TDL       +I ME C T S+  ++  R+  
Sbjct: 73  EISIMQQCDSPHVVKYYGSYFKN-----TDL-------WIVMEYCGTGSVSDIIRLRNKT 120

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPT 181
           +       I    +KG+EY+H  + +HRD+K  NI L   NTE   K+ DFG+      T
Sbjct: 121 LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILL---NTEGHAKLADFGVAGQLTDT 177

Query: 182 HLEANT 187
             + NT
Sbjct: 178 MAKRNT 183



>gi|401412051|ref|XP_003885473.1| CBL-interacting protein kinase 25, related [Neospora caninum
           Liverpool]
 gi|325119892|emb|CBZ55445.1| CBL-interacting protein kinase 25, related [Neospora caninum
           Liverpool]
          Length = 1312

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 59/233 (25%), Positives = 103/233 (44%), Gaps = 30/233 (12%)

Query: 22  QMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPNVVRYFSS 81
           + +G+GSF +VW    +  K   A+K I    V     + QE   L +L+HPN+VR+   
Sbjct: 13  ERIGRGSFAAVWKGHIEQTKEIVAVKVISRHTVHEATQLNQEVAVLKQLQHPNIVRFI-- 70

Query: 82  WIQSCNSDWTDLTPVKLTIFIQMELCS-TSLKRVLEKRDGQIDPLFNIKIFHGIMKGIEY 140
                     DL   +   ++ +E CS   +  +L +  G+I   F  ++   +  G+  
Sbjct: 71  ----------DLKKSQFHYYLVLEFCSGGDVSSLLHQHGGRIAEPFARRLLQQMAAGLLE 120

Query: 141 VHEKKLVHRDLKTDNIFLQEINTEFIP-KIGDFGLVKSEEPTHLEANTKENDIYCLGVVL 199
           +H +  +HRDLK  N+ L   +      KI DFG  ++ +P  L A    + +Y    +L
Sbjct: 121 IHRRSYIHRDLKPQNLLLSSSSPHAATLKIADFGFARTLQPWDLAATVCGSPLYMAPEIL 180

Query: 200 KDLYFPRKSLDDLLIMVEQQGDFNNIIELIFKM----TKMTGSDPPQATKILE 248
           +  Y+  K+            D  ++  + F+M    T  +G +P Q  K +E
Sbjct: 181 QHQYYDAKA------------DLWSVGAIFFEMLHGCTPFSGQNPLQLLKNIE 221



>gi|449473811|ref|XP_002191486.2| PREDICTED: serine/threonine-protein kinase Nek4 [Taeniopygia
           guttata]
          Length = 800

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 86/164 (52%), Gaps = 18/164 (10%)

Query: 17  TFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENI--YMVFQEAQALAKLEHPN 74
            +S L+ +GKGS+G V  A H+ D+  Y IKK+ +    +       QEAQ L++L HPN
Sbjct: 5   AYSFLRAVGKGSYGEVSLARHRQDRKQYVIKKLNLRSASSRERRAAEQEAQLLSQLRHPN 64

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCSTS-LKRVLEKRDGQIDPLFNI-KIFH 132
           +V Y  SW      D   L       +I M  C    L   L++  G++ P   + + F 
Sbjct: 65  IVTYRESW----QGDDGHL-------YIVMGFCEGGDLYHKLKELKGKLLPENQVVEWFV 113

Query: 133 GIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVK 176
            I   ++Y+HEK ++HRDLKT NIFL   N   I K+GD G+ +
Sbjct: 114 QIAMALQYLHEKHILHRDLKTQNIFLTRTN---IIKVGDLGIAR 154



>gi|507961855|ref|XP_004687468.1| PREDICTED: serine/threonine-protein kinase 4 isoform X2 [Condylura
           cristata]
          Length = 462

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 97/186 (52%), Gaps = 18/186 (9%)

Query: 3   KLMSENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQ 62
           K + E+   +  E+ F  L+ LG+GS+GSV+ A+HK      AIK++ V    ++  + +
Sbjct: 15  KKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVES--DLQEIIK 72

Query: 63  EAQALAKLEHPNVVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCST-SLKRVLEKRDGQ 121
           E   + + + P+VV+Y+ S+ ++     TDL       +I ME C T S+  ++  R+  
Sbjct: 73  EISIMQQCDSPHVVKYYGSYFKN-----TDL-------WIVMEYCGTGSVSDIIRLRNKT 120

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPT 181
           +       I    +KG+EY+H  + +HRD+K  NI L   NTE   K+ DFG+      T
Sbjct: 121 LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILL---NTEGHAKLADFGVAGQLTDT 177

Query: 182 HLEANT 187
             + NT
Sbjct: 178 MAKRNT 183



>gi|53776|emb|CAA44427.1| protein kinase [Mus musculus]
 gi|5705942|gb|AAB24245.2| p68 kinase [Mus sp.]
          Length = 238

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/193 (33%), Positives = 101/193 (52%), Gaps = 32/193 (16%)

Query: 62  QEAQALAKLEHPNVVRYFSSWIQSCNSD----WTDLTPVKL-TIFIQMELCS-TSLKRVL 115
           +E QALA+L H N+V+Y S W +  + D     +D +  K   +FIQME C   +L++ +
Sbjct: 5   REVQALAELNHVNIVQYHSCW-EGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWM 63

Query: 116 EKRD-GQIDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGL 174
             R+  ++D    + ++  I+ G+EY+H K L+HRDLK  NIFL  ++   I KIGDFGL
Sbjct: 64  RNRNQSKVDKALILDLYEQIVTGVEYIHSKGLIHRDLKPGNIFL--VDERHI-KIGDFGL 120

Query: 175 VK-------------------SEEPTHLEANTKENDIYCLGVVLKDLYFPRKSLDDLLIM 215
                                S E   L+   KE DI+ LG++L +L     +  + +  
Sbjct: 121 ATALENDGKSRTRRTGTLQYMSPEQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKF 180

Query: 216 VE--QQGDFNNII 226
            E  ++GDF+N I
Sbjct: 181 FESLRKGDFSNDI 193



>gi|403366056|gb|EJY82819.1| Protein kinase domain containing protein [Oxytricha trifallax]
          Length = 1255

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 96/173 (55%), Gaps = 19/173 (10%)

Query: 7   ENFSNETYEKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIK--KIIVSKVENIYMVFQEA 64
           E+F        F ++++LG+G +G V+ A++K  K   AIK  K+   K ++IY V++EA
Sbjct: 72  ESFDGRACLGAFHKIRLLGEGGYGKVYLALNKMTKEEVAIKFLKVREIKADSIYKVYKEA 131

Query: 65  QALAKLEHPNVVRYFSSWIQSCNSDWTDLTPV--KLTIFIQMELCSTS-LKRVLEKRDGQ 121
            AL  L H N+V+   ++            P+  K +I I ME  S   LK  L+KR G+
Sbjct: 132 DALRSLNHQNIVKLKLTF------------PLQEKKSIVIVMEYASGGELKGYLKKR-GR 178

Query: 122 IDPLFNIKIFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGL 174
           +D     +IF  +++ + Y H+K+++HRDLK +NI     N+  I ++ DFG+
Sbjct: 179 LDEEEAKEIFFQLIQCVHYCHQKRIIHRDLKLNNIVFASPNSREI-RVVDFGI 230



>gi|449281936|gb|EMC88879.1| Serine/threonine-protein kinase 4, partial [Columba livia]
          Length = 443

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 95/182 (52%), Gaps = 26/182 (14%)

Query: 15  EKTFSQLQMLGKGSFGSVWSAMHKYDKNTYAIKKIIVSKVENIYMVFQEAQALAKLEHPN 74
           E+ F  L+ LG+GS+GSV+ A+HK      AIK++ V    ++  + +E   + + + P+
Sbjct: 17  EEVFDVLEKLGEGSYGSVFKAIHKETGQVVAIKQVPVES--DLQEIIKEISIMQQCDSPH 74

Query: 75  VVRYFSSWIQSCNSDWTDLTPVKLTIFIQMELCST-SLKRVLEKRDGQIDPLFNIK---- 129
           VV+Y+ S+ ++     TDL       +I ME C   S+  ++  R+  +  LF +K    
Sbjct: 75  VVKYYGSYFKN-----TDL-------WIVMEYCGAGSVSDIIRLRNKTVLTLFFLKLTEE 122

Query: 130 ----IFHGIMKGIEYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKSEEPTHLEA 185
               I    +KG+EY+H  + +HRD+K  NI L   NTE   K+ DFG+      T  + 
Sbjct: 123 EIATIVQSTLKGLEYLHFMRKIHRDIKAGNILL---NTEGHAKLADFGVAGQLTDTMAKR 179

Query: 186 NT 187
           NT
Sbjct: 180 NT 181



>gi|356560221|ref|XP_003548392.1| PREDICTED: serine/threonine-protein kinase ATG1-like [Glycine max]
          Length = 682

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 125/306 (40%), Gaps = 62/306 (20%)

Query: 24  LGKGSFGSVWSAMHKYDKNTYAIKKI----IVSKV-ENIYMVFQEAQALAKLEHPNVVRY 78
           +G GSF  VW A ++     YA+K+I    +  KV EN+    +E   L+ + HPN++R 
Sbjct: 19  IGSGSFAVVWRARNRSSGLEYAVKEIDKRQLSPKVRENL---LKEISILSTIHHPNIIRL 75

Query: 79  FSSWIQSCNSDWTDLTPVKLTIFIQMELCSTSLKRVLEKRDGQIDPLFNIKIFHGIMKGI 138
           F + IQ+ +            I++ +E C+         R G++           +  G+
Sbjct: 76  FEA-IQTNDR-----------IYLVLEYCAGGDLAAYIHRHGKVSEPVARHFMRQLAAGL 123

Query: 139 EYVHEKKLVHRDLKTDNIFLQEINTEFIPKIGDFGLVKS-----------EEPTHLEANT 187
           + + EK L+HRDLK  N+ L       + KIGDFG  +S             P ++    
Sbjct: 124 QVLQEKNLIHRDLKPQNLLLATTAATPVMKIGDFGFARSLTPQGLADTLCGSPYYMAPEI 183

Query: 188 KEN-------DIYCLGVVLKDLYFPRKSLDDLLIMVEQQGDFNNII---ELIFKMTKMTG 237
            EN       D++ +G +L  L   R   D       Q   F NI+   EL F       
Sbjct: 184 IENQKYDAKADLWSVGAILYQLVIGRPPFDG----NSQLQLFQNILASTELHF------- 232

Query: 238 SDPPQATKILESDIF----NMLSDNHSGALTSKI----NSLEEKIKSLEQENADLKQENN 289
             PP A K+L SD      N+L  N    LT K     N L E   ++  E   L Q   
Sbjct: 233 --PPDALKVLHSDCLDLCRNLLRRNPDERLTFKAFFNHNFLREPRPTVNVEQFQLHQSER 290

Query: 290 VKKEKI 295
           +   ++
Sbjct: 291 LTDHQL 296