BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10287_c0_seq1-m.106 5prime_partial 3-884(+) 294 (+)
         (293 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|315049817|ref|XP_003174283.1| hypothetical protein MGYG_04461...   190   4e-46   Microsporum gypseum CBS 118893
gi|384486159|gb|EIE78339.1| hypothetical protein RO3G_03043 [Rhi...   189   1e-45   Rhizopus delemar RA 99-880
gi|242790722|ref|XP_002481611.1| Ser/Thr protein phosphatase fam...   188   1e-45   Talaromyces stipitatus ATCC 10500
gi|326479270|gb|EGE03280.1| hypothetical protein TEQG_02314 [Tri...   187   3e-45   Trichophyton equinum CBS 127.97
gi|296816687|ref|XP_002848680.1| ser/Thr protein phosphatase [Ar...   186   5e-45   Arthroderma otae CBS 113480
gi|511008295|gb|EPB89564.1| hypothetical protein HMPREF1544_0364...   186   9e-45   Mucor circinelloides f. circinelloides 1006PhL
gi|121713158|ref|XP_001274190.1| Ser/Thr protein phosphatase fam...   185   1e-44   Aspergillus clavatus NRRL 1
gi|212534642|ref|XP_002147477.1| Ser/Thr protein phosphatase fam...   184   2e-44   Talaromyces marneffei ATCC 18224
gi|327293756|ref|XP_003231574.1| Ser/Thr protein phosphatase [Tr...   184   2e-44   Trichophyton rubrum CBS 118892
gi|384495390|gb|EIE85881.1| hypothetical protein RO3G_10591 [Rhi...   183   5e-44   Rhizopus delemar RA 99-880
gi|452000673|gb|EMD93134.1| hypothetical protein COCHEDRAFT_1020...   182   1e-43   Bipolaris maydis C5
gi|451850634|gb|EMD63936.1| hypothetical protein COCSADRAFT_3766...   181   3e-43   Bipolaris sorokiniana ND90Pr
gi|302505854|ref|XP_003014884.1| hypothetical protein ARB_06641 ...   179   9e-43   Arthroderma benhamiae CBS 112371
gi|302663605|ref|XP_003023443.1| hypothetical protein TRV_02427 ...   178   1e-42   Trichophyton verrucosum HKI 0517
gi|494827466|gb|EON64416.1| hypothetical protein W97_03647 [Coni...   176   6e-42   Coniosporium apollinis CBS 100218
gi|396479122|ref|XP_003840681.1| similar to ser/Thr protein phos...   175   1e-41   Leptosphaeria maculans JN3
gi|70998088|ref|XP_753775.1| Ser/Thr protein phosphatase family ...   174   3e-41   Aspergillus fumigatus Af293
gi|159126489|gb|EDP51605.1| Ser/Thr protein phosphatase family [...   174   4e-41   Aspergillus fumigatus A1163
gi|295666466|ref|XP_002793783.1| conserved hypothetical protein ...   173   4e-41   
gi|501754849|emb|CCG81839.1| Ser/Thr protein phosphatase family ...   173   5e-41   Taphrina deformans PYCC 5710
gi|225683382|gb|EEH21666.1| conserved hypothetical protein [Para...   173   6e-41   Paracoccidioides brasiliensis Pb03
gi|226286998|gb|EEH42511.1| conserved hypothetical protein [Para...   172   6e-41   Paracoccidioides brasiliensis Pb18
gi|511010631|gb|EPB91851.1| hypothetical protein HMPREF1544_0136...   172   7e-41   Mucor circinelloides f. circinelloides 1006PhL
gi|119479589|ref|XP_001259823.1| Ser/Thr protein phosphatase fam...   172   7e-41   Aspergillus fischeri NRRL 181
gi|296414195|ref|XP_002836788.1| hypothetical protein [Tuber mel...   172   1e-40   Tuber melanosporum Mel28
gi|378728819|gb|EHY55278.1| protein phosphatase [Exophiala derma...   169   8e-40   Exophiala dermatitidis NIH/UT8656
gi|512200601|gb|EPE29433.1| Metallo-dependent phosphatase [Glare...   169   1e-39   Glarea lozoyensis ATCC 20868
gi|482806024|gb|EOA83097.1| hypothetical protein SETTUDRAFT_1645...   168   1e-39   Setosphaeria turcica Et28A
gi|258570757|ref|XP_002544182.1| predicted protein [Uncinocarpus...   168   1e-39   Uncinocarpus reesii 1704
gi|169619483|ref|XP_001803154.1| hypothetical protein SNOG_12940...   168   2e-39   Parastagonospora nodorum SN15
gi|485921059|gb|EOD46869.1| putative ser thr protein phosphatase...   168   2e-39   Neofusicoccum parvum UCRNP2
gi|330906593|ref|XP_003295528.1| hypothetical protein PTT_01503 ...   167   3e-39   Pyrenophora teres f. teres 0-1
gi|347837378|emb|CCD51950.1| similar to Ser/Thr protein phosphat...   167   3e-39   Botrytis cinerea T4
gi|472246082|gb|EMR90630.1| putative ser thr protein phosphatase...   167   4e-39   Botrytis cinerea BcDW1
gi|154309398|ref|XP_001554033.1| hypothetical protein BC1G_07593...   166   5e-39   Botrytis cinerea B05.10
gi|452825823|gb|EME32818.1| serine/threonine protein phosphatase...   166   5e-39   Galdieria sulphuraria
gi|238505270|ref|XP_002383864.1| Ser/Thr protein phosphatase fam...   166   8e-39   Aspergillus flavus NRRL3357
gi|317151556|ref|XP_001824743.2| Ser/Thr protein phosphatase fam...   166   8e-39   Aspergillus oryzae RIB40
gi|156058238|ref|XP_001595042.1| hypothetical protein SS1G_03130...   165   1e-38   Sclerotinia sclerotiorum 1980 UF-70
gi|189206950|ref|XP_001939809.1| serine/threonine protein phosph...   164   2e-38   Pyrenophora tritici-repentis Pt-1C-BFP
gi|407917771|gb|EKG11074.1| Metallo-dependent phosphatase [Macro...   163   4e-38   Macrophomina phaseolina MS6
gi|325093937|gb|EGC47247.1| serine/threonine protein phosphatase...   162   1e-37   Histoplasma capsulatum H88
gi|239612050|gb|EEQ89037.1| Ser/Thr protein phosphatase [Ajellom...   162   1e-37   Blastomyces dermatitidis ER-3
gi|261202056|ref|XP_002628242.1| ser/Thr protein phosphatase [Aj...   161   2e-37   Blastomyces gilchristii SLH14081
gi|255949616|ref|XP_002565575.1| Pc22g16610 [Penicillium chrysog...   161   2e-37   Penicillium rubens Wisconsin 54-1255
gi|449015985|dbj|BAM79387.1| similar to serine/threonine protein...   161   2e-37   Cyanidioschyzon merolae strain 10D
gi|83773483|dbj|BAE63610.1| unnamed protein product [Aspergillus...   160   4e-37   Aspergillus oryzae RIB40
gi|440635064|gb|ELR04983.1| hypothetical protein GMDG_00240 [Geo...   154   2e-35   Pseudogymnoascus destructans 20631-21
gi|310817894|ref|YP_003950252.1| bis(5'-nucleosyl)-tetraphosphat...   154   2e-35   
gi|154285736|ref|XP_001543663.1| predicted protein [Ajellomyces ...   154   3e-35   Histoplasma capsulatum NAm1
gi|392865776|gb|EAS31601.2| hypothetical protein CIMG_11832 [Coc...   153   4e-35   
gi|406863807|gb|EKD16854.1| putative ser/Thr protein phosphatase...   153   5e-35   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|303320007|ref|XP_003070003.1| calcineurin-like phosphoesteras...   150   3e-34   Coccidioides posadasii C735 delta SOWgp
gi|320034342|gb|EFW16287.1| conserved hypothetical protein [Cocc...   150   4e-34   Coccidioides posadasii str. Silveira
gi|346320360|gb|EGX89961.1| protein phosphatase family protein [...   150   4e-34   Cordyceps militaris CM01
gi|121699388|ref|XP_001268005.1| Ser/Thr protein phosphatase fam...   149   7e-34   Aspergillus clavatus NRRL 1
gi|338531772|ref|YP_004665106.1| putative bis(5'-nucleosyl)-tetr...   149   1e-33   
gi|317028185|ref|XP_001390197.2| Ser/Thr protein phosphatase fam...   149   1e-33   Aspergillus niger CBS 513.88
gi|425774481|gb|EKV12787.1| Ser/Thr protein phosphatase family [...   148   2e-33   Penicillium digitatum Pd1
gi|346325542|gb|EGX95139.1| Ser/Thr protein phosphatase family [...   148   2e-33   Cordyceps militaris CM01
gi|340053930|emb|CCC48223.1| putative kinetoplastid-specific pho...   147   2e-33   Trypanosoma vivax Y486
gi|350632754|gb|EHA21121.1| hypothetical protein ASPNIDRAFT_2146...   147   3e-33   Aspergillus niger ATCC 1015
gi|442324690|ref|YP_007364711.1| bis(5'-nucleosyl)-tetraphosphat...   147   3e-33   
gi|149235746|ref|XP_001523751.1| conserved hypothetical protein ...   147   4e-33   Lodderomyces elongisporus NRRL YB-4239
gi|488710038|ref|WP_002633932.1| metallophosphatase [Chondromyce...   147   4e-33   Myxococcus hansupus
gi|108762083|ref|YP_635276.1| bis(5'-nucleosyl)-tetraphosphatase...   146   7e-33   
gi|488705408|ref|WP_002629377.1| Bis(5'-nucleosyl)-tetraphosphat...   145   1e-32   
gi|212537963|ref|XP_002149137.1| conserved hypothetical protein ...   145   2e-32   Talaromyces marneffei ATCC 18224
gi|340055816|emb|CCC50137.1| putative diadenosine tetraphosphata...   145   2e-32   Trypanosoma vivax Y486
gi|119473369|ref|XP_001258584.1| Ser/Thr protein phosphatase fam...   144   2e-32   Aspergillus fischeri NRRL 181
gi|50554771|ref|XP_504794.1| YALI0E34947p [Yarrowia lipolytica] ...   144   2e-32   Yarrowia lipolytica CLIB122
gi|322707778|gb|EFY99356.1| Ser/Thr protein phosphatase family p...   144   2e-32   Metarhizium robertsii ARSEF 23
gi|358375833|dbj|GAA92409.1| Ser/Thr protein phosphatase family ...   144   4e-32   Aspergillus kawachii IFO 4308
gi|322700426|gb|EFY92181.1| Ser/Thr protein phosphatase family p...   143   5e-32   Metarhizium acridum CQMa 102
gi|397628792|gb|EJK69055.1| hypothetical protein THAOC_09729 [Th...   143   6e-32   Thalassiosira oceanica
gi|238497371|ref|XP_002379921.1| aflYe/ orf/ Ser -Thr protein ph...   142   1e-31   Aspergillus flavus NRRL3357
gi|169774141|ref|XP_001821538.1| Ser/Thr protein phosphatase fam...   141   2e-31   Aspergillus oryzae RIB40
gi|449303246|gb|EMC99254.1| hypothetical protein BAUCODRAFT_5735...   141   2e-31   Baudoinia panamericana UAMH 10762
gi|422295477|gb|EKU22776.1| serine threonine protein, partial [N...   141   3e-31   Nannochloropsis gaditana CCMP526
gi|291242239|ref|XP_002741006.1| PREDICTED: hypothetical protein...   140   3e-31   
gi|219111785|ref|XP_002177644.1| predicted protein [Phaeodactylu...   140   3e-31   Phaeodactylum tricornutum CCAP 1055/1
gi|322712192|gb|EFZ03765.1| Ser/Thr protein phosphatase family [...   140   4e-31   Metarhizium robertsii ARSEF 23
gi|459369051|gb|EMG47562.1| hypothetical protein G210_2039 [Cand...   140   4e-31   Candida maltosa Xu316
gi|452842959|gb|EME44894.1| hypothetical protein DOTSEDRAFT_7081...   139   7e-31   Dothistroma septosporum NZE10
gi|459186440|ref|XP_004227501.1| PREDICTED: bis(5'-nucleosyl)-te...   139   7e-31   Ciona intestinalis [sea vase]
gi|383452262|ref|YP_005366251.1| putative bis(5-nucleosyl)-tetra...   139   8e-31   
gi|400600648|gb|EJP68316.1| Ser/Thr protein phosphatase family p...   139   9e-31   Beauveria bassiana ARSEF 2860
gi|340371257|ref|XP_003384162.1| PREDICTED: bis(5'-nucleosyl)-te...   139   9e-31   Amphimedon queenslandica
gi|344233816|gb|EGV65686.1| Metallo-dependent phosphatase [Candi...   139   1e-30   Candida tenuis ATCC 10573
gi|407852504|gb|EKG05971.1| serine/threonine protein kinase, put...   138   1e-30   Trypanosoma cruzi
gi|134057876|emb|CAK44600.1| unnamed protein product [Aspergillu...   138   2e-30   Aspergillus niger
gi|452984923|gb|EME84680.1| hypothetical protein MYCFIDRAFT_1956...   138   2e-30   Cercospora fijiensis CIRAD86
gi|323449798|gb|EGB05683.1| hypothetical protein AURANDRAFT_3037...   137   2e-30   Aureococcus anophagefferens
gi|45477403|gb|AAS66026.1| hypothetical protein [Aspergillus par...   137   3e-30   Aspergillus parasiticus
gi|294656011|ref|XP_458242.2| DEHA2C13024p [Debaryomyces hanseni...   137   5e-30   Debaryomyces hansenii CBS767
gi|322697296|gb|EFY89077.1| Ser/Thr protein phosphatase family [...   136   8e-30   Metarhizium acridum CQMa 102
gi|260822173|ref|XP_002606477.1| hypothetical protein BRAFLDRAFT...   135   9e-30   Branchiostoma floridae
gi|402224506|gb|EJU04568.1| Metallo-dependent phosphatase [Dacry...   135   1e-29   Dacryopinax primogenitus
gi|162455375|ref|YP_001617742.1| bis(5'-nucleosyl)-tetraphosphat...   135   1e-29   
gi|71404924|ref|XP_805123.1| serine/threonine protein kinase [Tr...   134   2e-29   Trypanosoma cruzi strain CL Brener
gi|255932113|ref|XP_002557613.1| Pc12g07790 [Penicillium chrysog...   134   2e-29   Penicillium rubens Wisconsin 54-1255
gi|448107032|ref|XP_004200890.1| Piso0_003500 [Millerozyma farin...   134   3e-29   Millerozyma farinosa CBS 7064
gi|302847735|ref|XP_002955401.1| hypothetical protein VOLCADRAFT...   134   4e-29   Volvox carteri f. nagariensis
gi|407417925|gb|EKF38141.1| serine/threonine protein kinase, put...   133   6e-29   Trypanosoma cruzi marinkellei
gi|477534488|gb|ENH86026.1| ser thr protein phosphatase family [...   133   7e-29   Colletotrichum orbiculare MAFF 240422
gi|71403622|ref|XP_804594.1| serine/threonine protein kinase [Tr...   132   9e-29   Trypanosoma cruzi strain CL Brener
gi|71411488|ref|XP_807991.1| serine/threonine protein phosphatas...   132   9e-29   Trypanosoma cruzi strain CL Brener
gi|71416329|ref|XP_810200.1| serine/threonine protein phosphatas...   132   1e-28   Trypanosoma cruzi strain CL Brener
gi|72388318|ref|XP_844583.1| serine/threonine protein phosphatas...   132   1e-28   Trypanosoma brucei brucei TREU927
gi|407859298|gb|EKG06978.1| serine/threonine protein phosphatase...   132   1e-28   Trypanosoma cruzi
gi|485625904|gb|EOD21704.1| hypothetical protein EMIHUDRAFT_3548...   132   1e-28   Emiliania huxleyi CCMP1516
gi|224001434|ref|XP_002290389.1| hypothetical protein THAPSDRAFT...   132   1e-28   Thalassiosira pseudonana CCMP1335
gi|425774182|gb|EKV12499.1| Ser/Thr protein phosphatase family p...   132   1e-28   Penicillium digitatum PHI26
gi|343472761|emb|CCD15165.1| unnamed protein product [Trypanosom...   131   2e-28   Trypanosoma congolense IL3000
gi|354548617|emb|CCE45354.1| hypothetical protein CPAR2_703670 [...   131   2e-28   Candida parapsilosis
gi|358398085|gb|EHK47443.1| hypothetical protein TRIATDRAFT_2629...   130   3e-28   Trichoderma atroviride IMI 206040
gi|407425701|gb|EKF39502.1| serine/threonine protein phosphatase...   130   4e-28   Trypanosoma cruzi marinkellei
gi|261327766|emb|CBH10743.1| serine/threonine protein phosphatas...   130   4e-28   Trypanosoma brucei gambiense DAL972
gi|448536769|ref|XP_003871190.1| hypothetical protein CORT_0G038...   130   4e-28   Candida orthopsilosis Co 90-125
gi|119183744|ref|XP_001242870.1| hypothetical protein CIMG_06766...   129   8e-28   
gi|72393657|ref|XP_847629.1| diadenosine tetraphosphatase [Trypa...   128   2e-27   Trypanosoma brucei brucei TREU927
gi|261330908|emb|CBH13893.1| diadenosine tetraphosphatase, putat...   128   2e-27   Trypanosoma brucei gambiense DAL972
gi|260946455|ref|XP_002617525.1| hypothetical protein CLUG_02969...   128   2e-27   Clavispora lusitaniae ATCC 42720
gi|443719866|gb|ELU09818.1| hypothetical protein CAPTEDRAFT_5553...   127   4e-27   Capitella teleta
gi|298709758|emb|CBJ31560.1| conserved unknown protein [Ectocarp...   127   4e-27   Ectocarpus siliculosus
gi|261328575|emb|CBH11553.1| serine/threonine protein phosphatas...   127   4e-27   Trypanosoma brucei gambiense DAL972
gi|72389785|ref|XP_845187.1| serine/threonine protein phosphatas...   127   4e-27   Trypanosoma brucei brucei TREU927
gi|240277851|gb|EER41359.1| serine/threonine protein phosphatase...   126   6e-27   Histoplasma capsulatum H143
gi|453085236|gb|EMF13279.1| Metallo-dependent phosphatase [Mycos...   126   6e-27   Sphaerulina musiva SO2202
gi|331245387|ref|XP_003335330.1| hypothetical protein PGTG_17183...   126   6e-27   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|342180789|emb|CCC90265.1| unnamed protein product [Trypanosom...   126   6e-27   Trypanosoma congolense IL3000
gi|488686074|ref|WP_002610293.1| metallophosphatase [Stigmatella...   126   7e-27   
gi|388579569|gb|EIM19891.1| Metallo-dependent phosphatase [Walle...   126   7e-27   Wallemia mellicola CBS 633.66
gi|310819558|ref|YP_003951916.1| ser/thr protein phosphatase fam...   126   7e-27   
gi|485625953|gb|EOD21753.1| hypothetical protein EMIHUDRAFT_4516...   126   8e-27   Emiliania huxleyi CCMP1516
gi|342183111|emb|CCC92591.1| putative diadenosine tetraphosphata...   126   8e-27   Trypanosoma congolense IL3000
gi|342879241|gb|EGU80496.1| hypothetical protein FOXB_08956 [Fus...   125   9e-27   Fusarium oxysporum Fo5176
gi|68488001|ref|XP_712159.1| hypothetical protein CaO19.6707 [Ca...   125   1e-26   Candida albicans SC5314
gi|225554541|gb|EEH02838.1| serine/threonine phosphatase [Ajello...   125   1e-26   Histoplasma capsulatum G186AR
gi|384250237|gb|EIE23717.1| Metallo-dependent phosphatase [Cocco...   125   1e-26   Coccomyxa subellipsoidea C-169
gi|157835946|pdb|2QJC|A Chain A, Crystal Structure Of A Putative...   125   1e-26   Trypanosoma brucei
gi|328852249|gb|EGG01396.1| hypothetical protein MELLADRAFT_7561...   125   2e-26   Melampsora larici-populina 98AG31
gi|190347218|gb|EDK39453.2| hypothetical protein PGUG_03551 [Mey...   124   2e-26   Meyerozyma guilliermondii ATCC 6260
gi|342183098|emb|CCC92578.1| unnamed protein product [Trypanosom...   124   2e-26   Trypanosoma congolense IL3000
gi|390347097|ref|XP_001199366.2| PREDICTED: bis(5'-nucleosyl)-te...   124   3e-26   Strongylocentrotus purpuratus [purple urchin]
gi|344299540|gb|EGW29893.1| hypothetical protein SPAPADRAFT_5274...   124   3e-26   Spathaspora passalidarum NRRL Y-27907
gi|115398746|ref|XP_001214962.1| conserved hypothetical protein ...   124   4e-26   Aspergillus terreus NIH2624
gi|146416401|ref|XP_001484170.1| hypothetical protein PGUG_03551...   123   5e-26   Meyerozyma guilliermondii ATCC 6260
gi|428177123|gb|EKX46004.1| hypothetical protein GUITHDRAFT_5611...   123   5e-26   Guillardia theta CCMP2712
gi|241957611|ref|XP_002421525.1| calcineurin-like phosphoesteras...   123   7e-26   Candida dubliniensis CD36
gi|255731924|ref|XP_002550886.1| conserved hypothetical protein ...   122   9e-26   Candida tropicalis MYA-3404
gi|384245243|gb|EIE18738.1| Metallo-dependent phosphatase [Cocco...   122   1e-25   Coccomyxa subellipsoidea C-169
gi|313237824|emb|CBY12957.1| unnamed protein product [Oikopleura...   122   1e-25   Oikopleura dioica
gi|336383024|gb|EGO24173.1| hypothetical protein SERLADRAFT_4670...   121   2e-25   Serpula lacrymans var. lacrymans S7.9
gi|307102913|gb|EFN51179.1| hypothetical protein CHLNCDRAFT_1413...   120   5e-25   Chlorella variabilis
gi|50292017|ref|XP_448441.1| hypothetical protein [Candida glabr...   120   6e-25   Candida glabrata CBS 138
gi|338529922|ref|YP_004663256.1| serine/threonine protein phosph...   119   1e-24   
gi|154337671|ref|XP_001565068.1| putative ser/thr protein phosph...   119   1e-24   Leishmania braziliensis MHOM/BR/75/M2904
gi|126138882|ref|XP_001385964.1| Serine/threonine protein phosph...   119   1e-24   Scheffersomyces stipitis CBS 6054
gi|477523476|gb|ENH75474.1| Bis(5'-nucleosyl)-tetraphosphatase, ...   118   1e-24   Fusarium oxysporum f. sp. cubense race 1
gi|336463349|gb|EGO51589.1| hypothetical protein NEUTE1DRAFT_548...   118   1e-24   Neurospora tetrasperma FGSC 2508
gi|350297440|gb|EGZ78417.1| Metallo-dependent phosphatase [Neuro...   118   2e-24   Neurospora tetrasperma FGSC 2509
gi|197123203|ref|YP_002135154.1| metallophosphoesterase [Anaerom...   118   2e-24   
gi|220917992|ref|YP_002493296.1| metallophosphoesterase [Anaerom...   117   3e-24   
gi|477508692|gb|ENH61985.1| Bis(5'-nucleosyl)-tetraphosphatase, ...   117   3e-24   Fusarium oxysporum f. sp. cubense race 1
gi|340055803|emb|CCC50124.1| putative diadenosine tetraphosphata...   117   4e-24   Trypanosoma vivax Y486
gi|405966379|gb|EKC31672.1| Serine/threonine-protein phosphatase...   117   4e-24   Crassostrea gigas
gi|488714448|ref|WP_002638324.1| metallophosphatase [Chondromyce...   117   4e-24   Myxococcus hansupus
gi|85113370|ref|XP_964509.1| hypothetical protein NCU02150 [Neur...   117   4e-24   
gi|146086846|ref|XP_001465660.1| putative ser/thr protein phosph...   116   6e-24   Leishmania infantum JPCM5
gi|398015403|ref|XP_003860891.1| ser/thr protein phosphatase, pu...   116   7e-24   Leishmania donovani
gi|393242078|gb|EJD49597.1| Metallo-dependent phosphatase [Auric...   115   9e-24   Auricularia subglabra TFB-10046 SS5
gi|336370266|gb|EGN98606.1| hypothetical protein SERLA73DRAFT_18...   115   1e-23   Serpula lacrymans var. lacrymans S7.3
gi|108759347|ref|YP_629761.1| serine/threonine protein phosphata...   115   2e-23   
gi|401422252|ref|XP_003875614.1| putative ser/thr protein phosph...   114   4e-23   Leishmania mexicana MHOM/GT/2001/U1103
gi|299749834|ref|XP_001836366.2| calcineurin-like phosphoesteras...   113   7e-23   Coprinopsis cinerea okayama7#130
gi|325185712|emb|CCA20193.1| conserved hypothetical protein [Alb...   113   7e-23   Albugo laibachii Nc14
gi|254564975|ref|XP_002489598.1| hypothetical protein [Komagatae...   112   8e-23   Komagataella phaffii GS115
gi|336258528|ref|XP_003344076.1| hypothetical protein SMAC_09059...   112   8e-23   Sordaria macrospora k-hell
gi|157869519|ref|XP_001683311.1| putative ser/thr protein phosph...   112   1e-22   Leishmania major strain Friedlin
gi|46128693|ref|XP_388900.1| hypothetical protein FG08724.1 [Fus...   112   1e-22   
gi|403216266|emb|CCK70763.1| hypothetical protein KNAG_0F00940 [...   112   2e-22   Kazachstania naganishii CBS 8797
gi|408392764|gb|EKJ72084.1| hypothetical protein FPSE_07709 [Fus...   112   2e-22   Fusarium pseudograminearum CS3096
gi|367008228|ref|XP_003678614.1| hypothetical protein TDEL_0A007...   111   2e-22   Torulaspora delbrueckii
gi|340975750|gb|EGS22865.1| phosphatase-like protein [Chaetomium...   111   3e-22   Chaetomium thermophilum var. thermophilum DSM 1495
gi|442318632|ref|YP_007358653.1| bis(5'-nucleosyl)-tetraphosphat...   108   1e-21   
gi|485640178|gb|EOD34437.1| hypothetical protein EMIHUDRAFT_2286...   108   1e-21   Emiliania huxleyi CCMP1516
gi|345562999|gb|EGX46005.1| hypothetical protein AOL_s00112g22 [...   107   4e-21   Arthrobotrys oligospora ATCC 24927
gi|320582739|gb|EFW96956.1| Serine/threonine protein phosphatase...   106   6e-21   
gi|406604505|emb|CCH44043.1| hypothetical protein BN7_3602 [Wick...   106   6e-21   Wickerhamomyces ciferrii
gi|497197421|ref|WP_009511683.1| metallophosphoesterase [Opituta...   106   7e-21   Opitutaceae bacterium TAV5
gi|116193371|ref|XP_001222498.1| hypothetical protein CHGG_06403...   105   1e-20   Chaetomium globosum CBS 148.51
gi|58267334|ref|XP_570823.1| phosphoric monoester hydrolase [Cry...   105   2e-20   Cryptococcus neoformans var. neoformans JEC21
gi|224010187|ref|XP_002294051.1| predicted protein [Thalassiosir...   103   6e-20   Thalassiosira pseudonana CCMP1335
gi|405120595|gb|AFR95365.1| phosphoric monoester hydrolase [Cryp...   103   7e-20   Cryptococcus neoformans var. grubii H99
gi|494487848|ref|WP_007277321.1| putative bis(5'-nucleosyl)-tetr...   102   1e-19   Lentisphaera araneosa
gi|340516297|gb|EGR46546.1| predicted protein [Trichoderma reese...   102   1e-19   Trichoderma reesei QM6a
gi|348677286|gb|EGZ17103.1| hypothetical protein PHYSODRAFT_2642...   102   1e-19   Phytophthora sojae
gi|321258911|ref|XP_003194176.1| phosphoric monoester hydrolase ...   102   2e-19   Cryptococcus gattii WM276
gi|358379323|gb|EHK17003.1| hypothetical protein TRIVIDRAFT_6596...   101   3e-19   Trichoderma virens Gv29-8
gi|67537086|ref|XP_662317.1| hypothetical protein AN4713.2 [Aspe...   100   3e-19   Aspergillus nidulans FGSC A4
gi|358060624|dbj|GAA93665.1| hypothetical protein E5Q_00310 [Mix...   100   3e-19   Mixia osmundae IAM 14324
gi|367021514|ref|XP_003660042.1| hypothetical protein MYCTH_2297...   100   4e-19   Myceliophthora thermophila ATCC 42464
gi|494604542|ref|WP_007362790.1| metallophosphoesterase [Opituta...   100   4e-19   Opitutaceae bacterium TAV1
gi|392572659|gb|EIW65804.1| hypothetical protein TREMEDRAFT_3599...   100   5e-19   Tremella mesenterica DSM 1558
gi|410075547|ref|XP_003955356.1| hypothetical protein KAFR_0A078...   100   6e-19   Kazachstania africana CBS 2517
gi|310799192|gb|EFQ34085.1| calcineurin-like phosphoesterase [Gl...    99   9e-19   Colletotrichum graminicola M1.001
gi|342889143|gb|EGU88311.1| hypothetical protein FOXB_01206 [Fus...    99   1e-18   Fusarium oxysporum Fo5176
gi|367042292|ref|XP_003651526.1| hypothetical protein THITE_2111...    99   1e-18   Thielavia terrestris NRRL 8126
gi|471563292|gb|EMR64580.1| putative ser thr protein phosphatase...    99   1e-18   Eutypa lata UCREL1
gi|294056547|ref|YP_003550205.1| metallophosphoesterase [Coralio...    99   2e-18   
gi|182414904|ref|YP_001819970.1| metallophosphoesterase [Opitutu...    98   2e-18   
gi|488859789|ref|WP_002772029.1| metallophosphoesterase [Leptone...    98   2e-18   Leptonema illini
gi|399165576|emb|CCE33510.1| uncharacterized protein CPUR_07435 ...    98   3e-18   Claviceps purpurea 20.1
gi|380484989|emb|CCF39646.1| calcineurin-like phosphoesterase [C...    98   3e-18   Colletotrichum higginsianum
gi|495777443|ref|WP_008502022.1| diadenosine tetraphosphatase [E...    97   4e-18   Enterobacter cloacae complex
gi|490309474|ref|WP_004204272.1| diadenosine tetraphosphatase [K...    97   5e-18   Klebsiella
gi|495737137|ref|WP_008461716.1| diadenosine tetraphosphatase [E...    97   6e-18   Enterobacter sp. Ag1
gi|238893022|ref|YP_002917756.1| diadenosine tetraphosphatase [K...    97   7e-18   
gi|255711706|ref|XP_002552136.1| KLTH0B08008p [Lachancea thermot...    97   8e-18   Lachancea thermotolerans CBS 6340
gi|444321687|ref|XP_004181499.1| hypothetical protein TBLA_0G003...    96   8e-18   Tetrapisispora blattae CBS 6284
gi|493064814|ref|WP_006117644.1| diadenosine tetraphosphatase [P...    96   9e-18   Pantoea stewartii
gi|363754873|ref|XP_003647652.1| hypothetical protein Ecym_6464 ...    96   9e-18   Eremothecium cymbalariae DBVPG#7215
gi|157147531|ref|YP_001454851.1| diadenosine tetraphosphatase [C...    96   1e-17   
gi|392977556|ref|YP_006476144.1| diadenosine tetraphosphatase [E...    96   2e-17   
gi|206579673|ref|YP_002240487.1| diadenosine tetraphosphatase [K...    96   2e-17   
gi|509563330|gb|EOY62224.1| bis(5'-nucleosyl)-tetraphosphatase (...    95   2e-17   Klebsiella pneumoniae KP-7
gi|296101213|ref|YP_003611359.1| diadenosine tetraphosphatase [E...    95   2e-17   Enterobacter cloacae subsp. cloacae ATCC 13047
gi|494951159|ref|WP_007677187.1| Bis(5'-nucleosyl)-tetraphosphat...    95   3e-17   Cronobacter condimenti
gi|260596473|ref|YP_003209044.1| diadenosine tetraphosphatase [C...    95   3e-17   
gi|152968627|ref|YP_001333736.1| diadenosine tetraphosphatase [K...    95   3e-17   
gi|490296592|ref|WP_004192052.1| diadenosine tetraphosphatase [K...    95   3e-17   Klebsiella pneumoniae
gi|366995247|ref|XP_003677387.1| hypothetical protein NCAS_0G014...    94   3e-17   Naumovozyma castellii CBS 4309
gi|494977045|ref|WP_007703069.1| Bis(5'-nucleosyl)-tetraphosphat...    94   3e-17   Cronobacter universalis
gi|495057758|ref|WP_007782592.1| Bis(5'-nucleosyl)-tetraphosphat...    94   4e-17   Cronobacter
gi|495065807|ref|WP_007790632.1| Bis(5'-nucleosyl)-tetraphosphat...    94   4e-17   Cronobacter malonaticus
gi|94676672|ref|YP_588991.1| diadenosine tetraphosphatase [Bauma...    94   5e-17   
gi|494983907|ref|WP_007709930.1| Bis(5'-nucleosyl)-tetraphosphat...    94   6e-17   Cronobacter dublinensis
gi|491093832|ref|WP_004955439.1| diadenosine tetraphosphatase [S...    94   6e-17   Serratia odorifera
gi|301120558|ref|XP_002908006.1| conserved hypothetical protein ...    93   8e-17   Phytophthora infestans T30-4
gi|491335046|ref|WP_005193005.1| diadenosine tetraphosphatase [Y...    92   1e-16   Yersinia intermedia
gi|152990030|ref|YP_001355752.1| hypothetical protein NIS_0281 [...    92   1e-16   
gi|498977644|ref|XP_004528646.1| PREDICTED: bis(5'-nucleosyl)-te...    92   1e-16   
gi|449309552|ref|YP_007441908.1| diadenosine tetraphosphatase [C...    92   1e-16   
gi|491443659|ref|WP_005301447.1| diadenosine tetraphosphatase [P...    92   2e-16   Photobacterium damselae
gi|493737475|ref|WP_006686665.1| diadenosine tetraphosphatase [C...    92   2e-16   Citrobacter youngae
gi|495139407|ref|WP_007864214.1| Bis(5'-nucleosyl)-tetraphosphat...    92   2e-16   Cronobacter sakazakii
gi|365758765|gb|EHN00592.1| YNL217W-like protein [Saccharomyces ...    92   2e-16   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|326474312|gb|EGD98321.1| hypothetical protein TESG_08539 [Tri...    92   2e-16   Trichophyton tonsurans CBS 112818
gi|490840712|ref|WP_004702787.1| diadenosine tetraphosphatase [Y...    92   2e-16   Yersinia aldovae
gi|311280968|ref|YP_003943199.1| bis(5'-nucleosyl)-tetraphosphat...    91   3e-16   
gi|510817387|ref|WP_016190924.1| diadenosine tetraphosphatase [E...    91   3e-16   Erwinia tracheiphila
gi|401839758|gb|EJT42830.1| YNL217W-like protein [Saccharomyces ...    91   3e-16   Saccharomyces kudriavzevii IFO 1802
gi|448240481|ref|YP_007404534.1| diadenosine tetraphosphatase [S...    91   4e-16   
gi|488364954|ref|WP_002434339.1| diadenosine tetraphosphatase [E...    91   4e-16   Enterobacteriaceae
gi|389842271|ref|YP_006344355.1| diadenosine tetraphosphatase [C...    91   4e-16   
gi|375258932|ref|YP_005018102.1| diadenosine tetraphosphatase [K...    91   4e-16   
gi|156935430|ref|YP_001439346.1| diadenosine tetraphosphatase [C...    91   4e-16   
gi|514232208|ref|WP_016534857.1| bis(5'-nucleosyl)-tetraphosphat...    91   5e-16   Cedecea davisae
gi|190409191|gb|EDV12456.1| hypothetical protein SCRG_03343 [Sac...    91   5e-16   Saccharomyces cerevisiae RM11-1a
gi|490200026|ref|WP_004098525.1| diadenosine tetraphosphatase [K...    91   5e-16   Klebsiella
gi|490209826|ref|WP_004108229.1| diadenosine tetraphosphatase [K...    91   5e-16   Klebsiella oxytoca
gi|490520105|ref|WP_004385584.1| diadenosine tetraphosphatase [C...    91   5e-16   Cronobacter sakazakii
gi|481850790|ref|YP_007875230.1| diadenosine tetraphosphatase [R...    91   5e-16   
gi|85858209|ref|YP_460411.1| calcineurin-like phosphoesterase [S...    90   6e-16   
gi|495170932|ref|WP_007895728.1| Bis(5'-nucleosyl)-tetraphosphat...    90   6e-16   Cronobacter sakazakii
gi|491309014|ref|WP_005166999.1| diadenosine tetraphosphatase [Y...    90   9e-16   Yersinia enterocolitica
gi|123440991|ref|YP_001004980.1| diadenosine tetraphosphatase [Y...    89   9e-16   Yersinia enterocolitica subsp. enterocolitica 8081
gi|256272351|gb|EEU07334.1| YNL217W-like protein [Saccharomyces ...    89   9e-16   Saccharomyces cerevisiae JAY291
gi|332160256|ref|YP_004296833.1| diadenosine tetraphosphatase [Y...    89   1e-15   
gi|510414167|emb|CCV62996.1| bis(5'nucleosyl)-tetraphosphatase [...    89   1e-15   Yersinia enterocolitica (type O:2) str. YE3094/96
gi|37524609|ref|NP_927953.1| diadenosine tetraphosphatase [Photo...    89   1e-15   
gi|491088460|ref|WP_004950070.1| diadenosine tetraphosphatase [S...    89   1e-15   Serratia
gi|491013642|ref|WP_004875351.1| diadenosine tetraphosphatase [Y...    89   1e-15   Yersinia mollaretii
gi|507078776|ref|WP_016149534.1| Bis(5'-nucleosyl)-tetraphosphat...    89   1e-15   Citrobacter
gi|333925541|ref|YP_004499120.1| bis(5'-nucleosyl)-tetraphosphat...    89   1e-15   
gi|302896718|ref|XP_003047238.1| hypothetical protein NECHADRAFT...    89   1e-15   Nectria haematococca mpVI 77-13-4
gi|490844043|ref|WP_004706113.1| diadenosine tetraphosphatase [Y...    89   1e-15   Yersinia frederiksenii
gi|82775454|ref|YP_401801.1| diadenosine tetraphosphatase [Shige...    89   1e-15   Shigella dysenteriae Sd197
gi|490853893|ref|WP_004715943.1| diadenosine tetraphosphatase [Y...    89   1e-15   
gi|489109011|ref|WP_003018869.1| diadenosine tetraphosphatase [C...    89   1e-15   
gi|489926274|ref|WP_003829612.1| diadenosine tetraphosphatase [C...    89   1e-15   
gi|408392905|gb|EKJ72192.1| hypothetical protein FPSE_07616 [Fus...    89   2e-15   
gi|491071264|ref|WP_004932888.1| diadenosine tetraphosphatase [S...    89   2e-15   
gi|489942390|ref|WP_003845697.1| diadenosine tetraphosphatase [C...    89   2e-15   
gi|512192269|gb|EPE08028.1| ser thr protein phosphatase family [...    89   2e-15   
gi|40919|emb|CAA28416.1| unnamed protein product [Escherichia coli]    89   2e-15   
gi|6324112|ref|NP_014182.1| putative serine/threonine-protein ph...    89   2e-15   
gi|490230483|ref|WP_004128827.1| diadenosine tetraphosphatase [K...    88   2e-15   
gi|238883484|gb|EEQ47122.1| conserved hypothetical protein [Cand...    88   2e-15   
gi|323352875|gb|EGA85177.1| YNL217W-like protein [Saccharomyces ...    88   2e-15   
gi|323331880|gb|EGA73292.1| YNL217W-like protein [Saccharomyces ...    88   2e-15   
gi|491010534|ref|WP_004872243.1| diadenosine tetraphosphatase [K...    88   3e-15   
gi|353241091|emb|CCA72927.1| hypothetical protein PIIN_06863 [Pi...    88   3e-15   
gi|326791309|ref|YP_004309130.1| bis(5'-nucleosyl)-tetraphosphat...    88   3e-15   
gi|494098989|ref|WP_007039786.1| diadenosine tetraphosphatase [T...    88   3e-15   
gi|406979258|gb|EKE01081.1| Bis(5'-nucleosyl)-tetraphosphatase (...    88   3e-15   
gi|50307851|ref|XP_453919.1| hypothetical protein [Kluyveromyces...    87   4e-15   
gi|513030250|gb|AGO10275.1| AaceriABL181Wp [Saccharomycetaceae s...    87   4e-15   
gi|446179311|ref|WP_000257166.1| diadenosine tetraphosphatase [E...    87   4e-15   
gi|507088682|ref|WP_016159402.1| Bis(5'-nucleosyl)-tetraphosphat...    87   4e-15   
gi|446179310|ref|WP_000257165.1| diadenosine tetraphosphatase [E...    87   4e-15   
gi|146310262|ref|YP_001175336.1| diadenosine tetraphosphatase [E...    87   4e-15   
gi|485761718|ref|WP_001386970.1| ApaH [Escherichia coli] >gi|476...    87   5e-15   
gi|446179320|ref|WP_000257175.1| diadenosine tetraphosphatase [E...    87   5e-15   
gi|485888095|ref|WP_001481305.1| ApaH [Escherichia coli] >gi|476...    87   5e-15   
gi|446179309|ref|WP_000257164.1| diadenosine tetraphosphatase [E...    87   6e-15   
gi|446179350|ref|WP_000257205.1| diadenosine tetraphosphatase [E...    87   6e-15   
gi|487364558|ref|WP_001639028.1| ApaH [Escherichia coli] >gi|477...    87   6e-15   
gi|446179344|ref|WP_000257199.1| diadenosine tetraphosphatase [E...    87   7e-15   
gi|446179343|ref|WP_000257198.1| diadenosine tetraphosphatase [E...    87   7e-15   
gi|446179312|ref|WP_000257167.1| diadenosine tetraphosphatase [E...    87   7e-15   
gi|446179351|ref|WP_000257206.1| diadenosine tetraphosphatase [E...    87   7e-15   
gi|493870565|ref|WP_006817100.1| diadenosine tetraphosphatase [Y...    87   7e-15   
gi|490362407|ref|WP_004242170.1| Bis(5'-nucleosyl)-tetraphosphat...    87   8e-15   
gi|485867138|ref|WP_001465116.1| ApaH [Escherichia coli] >gi|476...    86   8e-15   
gi|24111495|ref|NP_706005.1| diadenosine tetraphosphatase [Shige...    86   8e-15   
gi|485931521|ref|WP_001491705.1| ApaH [Escherichia coli] >gi|477...    86   8e-15   
gi|491823884|ref|WP_005618956.1| diadenosine tetraphosphatase [A...    86   8e-15   
gi|446179339|ref|WP_000257194.1| diadenosine tetraphosphatase [E...    86   8e-15   
gi|15799734|ref|NP_285746.1| diadenosine tetraphosphatase [Esche...    86   8e-15   
gi|446179333|ref|WP_000257188.1| diadenosine tetraphosphatase [E...    86   8e-15   
gi|446179334|ref|WP_000257189.1| diadenosine tetraphosphatase [E...    86   8e-15   
gi|446179348|ref|WP_000257203.1| diadenosine tetraphosphatase [E...    86   8e-15   
gi|446179322|ref|WP_000257177.1| diadenosine tetraphosphatase [E...    86   8e-15   
gi|16128043|ref|NP_414591.1| diadenosine tetraphosphatase [Esche...    86   8e-15   
gi|486377316|ref|WP_001598246.1| Bis(5'-nucleosyl)-tetraphosphat...    86   9e-15   
gi|218547499|ref|YP_002381290.1| diadenosine tetraphosphatase [E...    86   9e-15   
gi|491790021|ref|WP_005600998.1| diadenosine tetraphosphatase [A...    86   9e-15   
gi|486024929|ref|WP_001503811.1| ApaH [Escherichia coli] >gi|477...    86   9e-15   
gi|486051227|ref|WP_001506853.1| ApaH [Escherichia coli] >gi|476...    86   9e-15   
gi|485883329|ref|WP_001477888.1| ApaH [Escherichia coli] >gi|476...    86   9e-15   
gi|446179319|ref|WP_000257174.1| diadenosine tetraphosphatase [E...    86   9e-15   
gi|45185049|ref|NP_982766.1| ABL181Wp [Ashbya gossypii ATCC 1089...    86   9e-15   
gi|260853263|ref|YP_003227154.1| diadenosine tetraphosphatase [E...    86   9e-15   
gi|46114786|ref|XP_383411.1| hypothetical protein FG03235.1 [Fus...    86   9e-15   
gi|446179341|ref|WP_000257196.1| diadenosine tetraphosphatase [E...    86   9e-15   
gi|446179324|ref|WP_000257179.1| diadenosine tetraphosphatase [E...    86   9e-15   
gi|486282033|ref|WP_001570924.1| Bis(5'-nucleosyl)-tetraphosphat...    86   1e-14   
gi|170681134|ref|YP_001742170.1| diadenosine tetraphosphatase [E...    86   1e-14   
gi|487375132|ref|WP_001648375.1| ApaH [Escherichia coli] >gi|476...    86   1e-14   
gi|491809386|ref|WP_005612030.1| diadenosine tetraphosphatase [A...    86   1e-14   
gi|512651484|ref|YP_008109568.1| diadenosine tetraphosphatase [E...    86   1e-14   
gi|486112510|ref|WP_001511402.1| ApaH [Escherichia coli] >gi|476...    86   1e-14   
gi|487544612|ref|WP_001713094.1| ApaH [Escherichia coli] >gi|476...    86   1e-14   
gi|487633069|ref|WP_001740199.1| ApaH [Escherichia coli] >gi|476...    86   1e-14   
gi|485870921|ref|WP_001467899.1| ApaH [Escherichia coli] >gi|476...    86   1e-14   
gi|491748743|ref|WP_005581876.1| diadenosine tetraphosphatase [A...    86   1e-14   
gi|446179321|ref|WP_000257176.1| diadenosine tetraphosphatase [S...    86   1e-14   
gi|261867178|ref|YP_003255100.1| diadenosine tetraphosphatase [A...    86   1e-14   
gi|8134305|sp|O52655.1|APAH_AGGAC RecName: Full=Bis(5'-nucleosyl...    86   1e-14   
gi|485764409|ref|WP_001389244.1| ApaH [Escherichia coli] >gi|476...    86   1e-14   
gi|446179328|ref|WP_000257183.1| diadenosine tetraphosphatase [E...    86   1e-14   
gi|446179314|ref|WP_000257169.1| diadenosine tetraphosphatase [E...    86   1e-14   
gi|446179315|ref|WP_000257170.1| diadenosine tetraphosphatase [E...    86   1e-14   
gi|347840866|emb|CCD55438.1| similar to phosphatase, partial seq...    86   1e-14   
gi|446179316|ref|WP_000257171.1| diadenosine tetraphosphatase [E...    86   1e-14   
gi|446179329|ref|WP_000257184.1| diadenosine tetraphosphatase [E...    86   1e-14   
gi|446179360|ref|WP_000257215.1| diadenosine tetraphosphatase [E...    86   1e-14   
gi|487366855|ref|WP_001641114.1| ApaH [Escherichia coli] >gi|477...    86   1e-14   
gi|110640264|ref|YP_667992.1| diadenosine tetraphosphatase [Esch...    86   1e-14   
gi|487680524|ref|WP_001765384.1| Bis(5'-nucleosyl)-tetraphosphat...    86   1e-14   
gi|387605532|ref|YP_006094388.1| bis(5'-nucleosyl)-tetraphosphat...    86   1e-14   
gi|91209111|ref|YP_539097.1| diadenosine tetraphosphatase [Esche...    86   1e-14   
gi|218703310|ref|YP_002410829.1| diadenosine tetraphosphatase [E...    86   1e-14   
gi|446179336|ref|WP_000257191.1| diadenosine tetraphosphatase [E...    86   2e-14   
gi|26245974|ref|NP_752013.1| diadenosine tetraphosphatase [Esche...    86   2e-14   
gi|446179335|ref|WP_000257190.1| diadenosine tetraphosphatase [E...    86   2e-14   
gi|265385761|gb|ACY75477.1| diadenosine tetraphosphatase [Aggreg...    86   2e-14   
gi|491784421|ref|WP_005597190.1| diadenosine tetraphosphatase [A...    86   2e-14   
gi|114571109|ref|YP_757789.1| metallophosphoesterase [Maricaulis...    86   2e-14   
gi|387120861|ref|YP_006286744.1| diadenosine tetraphosphatase [A...    86   2e-14   
gi|126208238|ref|YP_001053463.1| diadenosine tetraphosphatase [A...    86   2e-14   
gi|491828877|ref|WP_005620826.1| diadenosine tetraphosphatase [A...    85   2e-14   
gi|491801350|ref|WP_005607652.1| diadenosine tetraphosphatase [A...    85   2e-14   
gi|491795957|ref|WP_005604290.1| diadenosine tetraphosphatase [A...    85   2e-14   
gi|386703258|ref|YP_006167105.1| bis(5'-nucleosyl)-tetraphosphat...    85   2e-14   
gi|165976176|ref|YP_001651769.1| diadenosine tetraphosphatase [A...    85   2e-14   
gi|446179318|ref|WP_000257173.1| diadenosine tetraphosphatase [E...    85   2e-14   
gi|446179317|ref|WP_000257172.1| diadenosine tetraphosphatase [S...    85   2e-14   
gi|494614863|ref|WP_007373108.1| diadenosine tetraphosphatase [K...    84   3e-14   
gi|472245646|gb|EMR90207.1| putative ser thr protein phosphatase...    84   3e-14   
gi|361131824|gb|EHL03459.1| hypothetical protein M7I_0400 [Glare...    84   3e-14   
gi|491743755|ref|WP_005576888.1| diadenosine tetraphosphatase [A...    84   3e-14   
gi|498142641|ref|WP_010456797.1| diadenosine tetraphosphatase [S...    84   3e-14   
gi|154303436|ref|XP_001552125.1| hypothetical protein BC1G_09289...    84   4e-14   
gi|446179345|ref|WP_000257200.1| diadenosine tetraphosphatase [E...    84   5e-14   
gi|488830545|ref|WP_002742951.1| calcineurin-like phosphoesteras...    84   5e-14   
gi|119944804|ref|YP_942484.1| diadenosine tetraphosphatase [Psyc...    84   6e-14   
gi|491815273|ref|WP_005615052.1| diadenosine tetraphosphatase [A...    84   6e-14   
gi|446179342|ref|WP_000257197.1| diadenosine tetraphosphatase [E...    83   8e-14   
gi|386080704|ref|YP_005994229.1| diadenosine tetraphosphatase Ap...    83   1e-13   
gi|291616234|ref|YP_003518976.1| ApaH [Pantoea ananatis LMG 2010...    83   1e-13   
gi|15615408|ref|NP_243711.1| diadenosine tetraphosphatase [Bacil...    83   1e-13   
gi|496102807|ref|WP_008827314.1| metallophosphoesterase [Halopla...    82   1e-13   
gi|495468079|ref|WP_008192769.1| metallophosphatase [Thermotoga ...    82   1e-13   
gi|493582944|ref|WP_006535979.1| diadenosine tetraphosphatase [P...    82   2e-13   
gi|22299964|ref|NP_683211.1| serine/threonine protein phosphatas...    82   2e-13   
gi|500256376|gb|EON99647.1| putative ser thr protein phosphatase...    82   2e-13   
gi|398405604|ref|XP_003854268.1| hypothetical protein MYCGRDRAFT...    82   2e-13   
gi|261416559|ref|YP_003250242.1| metallophosphoesterase [Fibroba...    82   2e-13   
gi|496191362|ref|WP_008914813.1| diadenosine tetraphosphatase [P...    82   2e-13   
gi|378768587|ref|YP_005197060.1| bis(5'-nucleosyl)-tetraphosphat...    82   2e-13   
gi|495759169|ref|WP_008483748.1| diadenosine tetraphosphatase [G...    82   2e-13   
gi|308051070|ref|YP_003914636.1| Bis(5'nucleosyl)-tetraphosphata...    82   2e-13   
gi|491488085|ref|WP_005345826.1| diadenosine tetraphosphatase [A...    81   3e-13   
gi|56752172|ref|YP_172873.1| serine/threonine protein phosphatas...    81   3e-13   
gi|259482448|tpe|CBF76942.1| TPA: Ser/Thr protein phosphatase fa...    81   3e-13   
gi|406903264|gb|EKD45402.1| Bis(5'-nucleosyl)-tetraphosphatase (...    81   3e-13   
gi|498302488|ref|WP_010616644.1| diadenosine tetraphosphatase [P...    81   4e-13   
gi|320589407|gb|EFX01868.1| serine/threonine-protein phosphatase...    81   4e-13   
gi|251795023|ref|YP_003009754.1| metallophosphoesterase [Paeniba...    81   4e-13   
gi|492899559|ref|WP_006029965.1| diadenosine tetraphosphatase [M...    80   5e-13   
gi|154706260|ref|YP_001425391.1| diadenosine tetraphosphatase [C...    80   5e-13   
gi|495254063|ref|WP_007978818.1| metallophosphoesterase [Haladap...    80   5e-13   
gi|89256871|ref|YP_514233.1| diadenosine tetraphosphatase [Franc...    80   5e-13   
gi|220906617|ref|YP_002481928.1| metallophosphoesterase [Cyanoth...    80   6e-13   
gi|15643505|ref|NP_228551.1| serine/threonine protein phosphatas...    80   6e-13   
gi|495062198|ref|WP_007787028.1| phosphohydrolase [Brevibacillus...    80   6e-13   
gi|320335267|ref|YP_004171978.1| bis(5'-nucleosyl)-tetraphosphat...    80   6e-13   
gi|120599975|ref|YP_964549.1| diadenosine tetraphosphatase [Shew...    80   6e-13   
gi|157960688|ref|YP_001500722.1| diadenosine tetraphosphatase [S...    80   6e-13   
gi|146292091|ref|YP_001182515.1| diadenosine tetraphosphatase [S...    80   7e-13   
gi|119775953|ref|YP_928693.1| diadenosine tetraphosphatase [Shew...    80   9e-13   
gi|187932058|ref|YP_001892043.1| diadenosine tetraphosphatase [F...    80   9e-13   
gi|496552229|ref|WP_009258304.1| hypothetical protein [Lachnospi...    80   9e-13   
gi|492768492|ref|WP_005958643.1| diadenosine tetraphosphatase [e...    79   1e-12   
gi|56707612|ref|YP_169508.1| diadenosine tetraphosphatase [Franc...    79   1e-12   
gi|497710502|ref|WP_010024686.1| metallophosphatase [Sporolactob...    79   1e-12   
gi|492182869|ref|WP_005772440.1| biotin transporter BioY [Coxiel...    79   1e-12   
gi|300724853|ref|YP_003714178.1| diadenosine tetraphosphatase [X...    79   1e-12   
gi|494935052|ref|WP_007661083.1| protein phosphatase [Pontibacte...    79   1e-12   
gi|311067654|ref|YP_003972577.1| bis(5'-nucleosyl)-tetraphosphat...    79   1e-12   
gi|212213445|ref|YP_002304381.1| diadenosine tetraphosphatase [C...    79   1e-12   
gi|475674380|gb|EMT71486.1| Bis(5'-nucleosyl)-tetraphosphatase, ...    79   2e-12   
gi|496174784|ref|WP_008899291.1| 5'-nucleosyltetraphosphatase [R...    79   2e-12   
gi|152978412|ref|YP_001344041.1| diadenosine tetraphosphatase [A...    79   2e-12   
gi|118497160|ref|YP_898210.1| diadenosine tetraphosphatase [Fran...    79   2e-12   
gi|62262210|gb|AAX78052.1| unknown protein [synthetic construct]       79   2e-12   
gi|498233741|ref|WP_010547897.1| diadenosine tetraphosphatase [g...    79   2e-12   
gi|491412799|ref|WP_005270602.1| diadenosine tetraphosphatase [Y...    78   2e-12   
gi|428225032|ref|YP_007109129.1| metallophosphoesterase [Geitler...    78   2e-12   
gi|494997729|ref|WP_007723745.1| putative phosphohydrolase [Brev...    78   3e-12   
gi|497986615|ref|WP_010300771.1| protein phosphatase [Candidatus...    78   3e-12   
gi|332665115|ref|YP_004447903.1| bis(5'-nucleosyl)-tetraphosphat...    78   3e-12   
gi|386325714|ref|YP_006021831.1| bis(5'-nucleosyl)-tetraphosphat...    78   3e-12   
gi|212219495|ref|YP_002306282.1| diadenosine tetraphosphatase [C...    77   4e-12   
gi|491652863|ref|WP_005509584.1| metallophosphoesterase [Coryneb...    77   4e-12   
gi|495567335|ref|WP_008291914.1| diadenosine tetraphosphatase [M...    77   4e-12   
gi|117923953|ref|YP_864570.1| diadenosine tetraphosphatase [Magn...    77   5e-12   
gi|317046864|ref|YP_004114512.1| bis(5'-nucleosyl)-tetraphosphat...    77   5e-12   
gi|265385797|gb|ACY75478.1| diadenosine tetraphosphatase [Aggreg...    77   5e-12   
gi|495383942|ref|WP_008108649.1| diadenosine tetraphosphatase [P...    77   5e-12   
gi|510810771|ref|WP_016185517.1| serine/threonine protein phosph...    77   6e-12   
gi|488892119|ref|WP_002803281.1| serine/threonine protein phosph...    77   6e-12   
gi|22127559|ref|NP_670982.1| diadenosine tetraphosphatase [Yersi...    77   6e-12   
gi|170025790|ref|YP_001722295.1| diadenosine tetraphosphatase [Y...    77   7e-12   
gi|51594982|ref|YP_069173.1| diadenosine tetraphosphatase [Yersi...    77   7e-12   
gi|153949872|ref|YP_001402401.1| diadenosine tetraphosphatase [Y...    77   7e-12   
gi|485620256|gb|EOD16913.1| hypothetical protein EMIHUDRAFT_2560...    77   7e-12   
gi|510938878|ref|WP_016256618.1| diadenosine tetraphosphatase, p...    77   7e-12   
gi|511824919|ref|WP_016403736.1| bis(5'-nucleosyl)-tetraphosphat...    77   7e-12   
gi|386265061|ref|YP_005828553.1| Diadenosine tetraphosphatase (A...    77   7e-12   
gi|494450338|ref|WP_007241766.1| diadenosine tetraphosphatase [H...    76   9e-12   
gi|333996228|ref|YP_004528841.1| metallophosphoesterase [Trepone...    76   9e-12   
gi|490261811|ref|WP_004159029.1| serine/threonine protein phosph...    76   9e-12   
gi|295702870|ref|YP_003595945.1| phsophatase [Bacillus megateriu...    76   9e-12   
gi|510942943|ref|WP_016260683.1| diadenosine tetraphosphatase, p...    76   9e-12   
gi|491955925|ref|WP_005690228.1| diadenosine tetraphosphatase [H...    76   1e-11   
gi|494246791|ref|WP_007146039.1| diadenosine tetraphosphatase [M...    76   1e-11   
gi|497779395|ref|WP_010093579.1| metallophosphatase [Ornithiniba...    76   1e-11   
gi|512464381|ref|WP_016422530.1| polynucleotide kinase-phosphata...    76   1e-11   
gi|491958607|ref|WP_005692050.1| diadenosine tetraphosphatase [H...    76   1e-11   
gi|496188226|ref|WP_008912733.1| diadenosine tetraphosphatase [P...    76   1e-11   
gi|496283472|ref|WP_008995510.1| metallophosphoesterase [Novosph...    76   1e-11   
gi|197286182|ref|YP_002152054.1| diadenosine tetraphosphatase [P...    76   1e-11   
gi|495160172|ref|WP_007884973.1| diadenosine tetraphosphatase [P...    75   1e-11   
gi|386744294|ref|YP_006217473.1| diadenosine tetraphosphatase [P...    75   1e-11   
gi|387824086|ref|YP_005823557.1| bis(5'-nucleosyl)-tetraphosphat...    75   1e-11   
gi|491949596|ref|WP_005687054.1| diadenosine tetraphosphatase [H...    75   2e-11   
gi|294497499|ref|YP_003561199.1| phsophatase [Bacillus megateriu...    75   2e-11   
gi|114564243|ref|YP_751757.1| diadenosine tetraphosphatase [Shew...    75   2e-11   
gi|68249148|ref|YP_248260.1| diadenosine tetraphosphatase [Haemo...    75   2e-11   
gi|188532869|ref|YP_001906666.1| diadenosine tetraphosphatase [E...    75   2e-11   
gi|498486565|ref|WP_010788253.1| Bis 5'-nucleosyl-tetraphosphata...    75   2e-11   
gi|485802550|ref|WP_001423296.1| bis, partial [Escherichia coli]...    75   2e-11   
gi|488019671|ref|WP_002091070.1| serine/threonine protein phosph...    75   2e-11   
gi|446179325|ref|WP_000257180.1| diadenosine tetraphosphatase, p...    75   2e-11   
gi|507017202|ref|WP_016089379.1| serine/threonine protein phosph...    75   3e-11   
gi|378696749|ref|YP_005178707.1| diadenosine tetraphosphatase [H...    75   3e-11   
gi|384048693|ref|YP_005496710.1| Bis(5'nucleosyl)-tetraphosphata...    74   4e-11   
gi|511062180|ref|YP_008077498.1| bis(5'-nucleosyl)-tetraphosphat...    74   4e-11   
gi|157867516|ref|XP_001682312.1| bis(5'-nucleosyl)-tetraphosphat...    74   4e-11   
gi|148825172|ref|YP_001289925.1| diadenosine tetraphosphatase [H...    74   4e-11   
gi|491981297|ref|WP_005704454.1| diadenosine tetraphosphatase [A...    74   4e-11   
gi|498019607|ref|WP_010333763.1| metallophosphatase [Bacillus mo...    74   5e-11   
gi|253988046|ref|YP_003039402.1| bis(5'-nucleosyl)-tetraphosphat...    74   5e-11   
gi|16272495|ref|NP_438709.1| diadenosine tetraphosphatase [Haemo...    74   5e-11   
gi|491870650|ref|WP_005643989.1| diadenosine tetraphosphatase [H...    74   5e-11   
gi|345429512|ref|YP_004822630.1| diadenosine tetraphosphatase [H...    74   5e-11   


>gi|315049817|ref|XP_003174283.1| hypothetical protein MGYG_04461 [Arthroderma gypseum CBS 118893]
 gi|311342250|gb|EFR01453.1| hypothetical protein MGYG_04461 [Arthroderma gypseum CBS 118893]
          Length = 260

 Score =  190 bits (483), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 103/255 (40%), Positives = 159/255 (62%), Gaps = 31/255 (12%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           S++ L+ +GDVHG  DEL  L+++++++   DHLIFVGD++ KGPKS+EVV+L R   AS
Sbjct: 23  SRRRLVIVGDVHGCKDELDKLLSRVSFNRENDHLIFVGDVITKGPKSVEVVRLAREYNAS 82

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYL 170
           CVRGNH+D++L  +                 +E  +  D ++++  +LA++L  +  ++L
Sbjct: 83  CVRGNHEDRILLTR-----------------REMSVSNDKLETKAHVLARQLSDDDVDWL 125

Query: 171 LSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMR--NIKNGKPTSKKDVGH 224
            SCP+IL +       D+ VVH GL+P VPL  QDPS +M+MR  ++ +  P+S K VG 
Sbjct: 126 ESCPVILKVGYVRGMGDVVVVHGGLVPGVPLERQDPSSVMTMRTLDVDSHTPSSGK-VGI 184

Query: 225 AWSKHWNAAQ-----QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWND 279
           AWSK ++  Q     ++ + P T+IYGHDA +   I+ Y+ GLD+ CV GG L+AL+  D
Sbjct: 185 AWSKAFDDYQRRMVKEKGAQPTTVIYGHDAKQLPVIREYTKGLDTSCVRGGRLTALVIGD 244

Query: 280 N--REIINVKCNKYV 292
              + + +VKC  YV
Sbjct: 245 GGKQSLKHVKCKGYV 259



>gi|384486159|gb|EIE78339.1| hypothetical protein RO3G_03043 [Rhizopus delemar RA 99-880]
          Length = 341

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/254 (42%), Positives = 156/254 (61%), Gaps = 8/254 (3%)

Query: 42  LINKLEAPLSQKNLIFI-GDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEV 100
           +++  +  L QK  IF+ GDVHG  DE  +L++ I Y+   D +I  GDI +KGP S+ V
Sbjct: 77  IVSNNDTSLQQKERIFVVGDVHGCIDEFNSLLDTIKYNTTTDQIILAGDITSKGPDSLGV 136

Query: 101 VQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKI-PLDEFIKEHDIPKDI-VKSEHGLL 158
           ++  + LGA CVRGNHDDKV++ K   +      + PL+  + E ++P  +  K+ H  L
Sbjct: 137 IRRAKELGALCVRGNHDDKVIRFKTFENEKGQNSMYPLNAVMPEGNVPDPLKFKNYHEPL 196

Query: 159 AKELDVELYNYLLSCPIILDIPEY-DLYVVHAGLLPDVP-LFEQDPSDIMSMRNIKNGK- 215
           A  +  E Y+YL+SCP IL IP   +  +VHAGL P +P L +Q P  +M+MR+I + K 
Sbjct: 197 ALNMSQEDYDYLVSCPAILHIPFLNNTIIVHAGLDPSIPSLKDQVPYLVMNMRDIDSQKE 256

Query: 216 PTSKKDVGHAWSKHWNAAQQESSSPKTII-YGHDASRRLKIKPYSFGLDSGCVYGGELSA 274
           PT +  VG  W+  WN+ QQ  +   T+I YGHDA R L I+ Y+FGLD+GCVYGG+L+A
Sbjct: 257 PTRESGVGTQWAVEWNSYQQSLTLNNTMIYYGHDAGRGLNIQQYTFGLDTGCVYGGKLTA 316

Query: 275 LIWNDNREIINVKC 288
           +      E+  V C
Sbjct: 317 MNIK-THELAQVNC 329



>gi|242790722|ref|XP_002481611.1| Ser/Thr protein phosphatase family [Talaromyces stipitatus ATCC
           10500]
 gi|218718199|gb|EED17619.1| Ser/Thr protein phosphatase family [Talaromyces stipitatus ATCC
           10500]
          Length = 439

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 160/280 (57%), Gaps = 31/280 (11%)

Query: 35  FKPLNYTLINKLEAP--LSQKNLIFIGDVHGSYDELLNLINKINYDP-LKDHLIFVGDIV 91
            + LN  L+   E     S + L+ +GDVHG  DEL  L+ K+++DP   DHLI  GD++
Sbjct: 167 MRTLNPALLPSFEEKKGRSSRRLVIVGDVHGCQDELEKLLEKVSFDPDAGDHLILTGDMI 226

Query: 92  AKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIV 151
            KGPKS  VV L R LGASCVRGNH+D++L  ++ +    S+        +EH +  D  
Sbjct: 227 NKGPKSGGVVDLARGLGASCVRGNHEDRILLERSDMKVHHSESSN-----QEHTVVADTA 281

Query: 152 KSEHGLLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMS 207
           +     +AK L  E   YL  CP+IL + +     ++ VVH GL+P VPL  Q+ S +MS
Sbjct: 282 ERR---VAKSLTDEQVAYLQDCPVILKVGQIKDMGEVAVVHGGLVPGVPLERQELSSVMS 338

Query: 208 MRNI--KNGKPTSKKDVGHAWSKHWN---------AAQQESSSPK--TIIYGHDASRRLK 254
           MR I      P++ KD G  W K +N           Q  + SP+  T+IYGHDA++ L 
Sbjct: 339 MRTIDLDTHVPSASKD-GVPWFKLYNQYHKLLVAGQGQAGTVSPQTMTVIYGHDAAKSLN 397

Query: 255 IKPYSFGLDSGCVYGGELSALIWNDN--REIINVKCNKYV 292
           I+ Y+ GLDSGCVYG +LSA +  D    EI+ VKCN+YV
Sbjct: 398 IRQYTKGLDSGCVYGRKLSAFVIEDGGKNEIVQVKCNEYV 437



>gi|326479270|gb|EGE03280.1| hypothetical protein TEQG_02314 [Trichophyton equinum CBS 127.97]
          Length = 352

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/256 (41%), Positives = 160/256 (62%), Gaps = 25/256 (9%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           S++ LI +GDVHG  DEL  L+ +++++  K DHLIF GD+++KGP+S+EVV+L R  G+
Sbjct: 108 SKRRLIIVGDVHGCKDELEKLLARVSFNREKGDHLIFTGDLISKGPESVEVVRLAREYGS 167

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
           SCVRGNH+DKVL  +   +  DS + P     K         +++  +LA++L  +  N+
Sbjct: 168 SCVRGNHEDKVLLTRR--EISDSSRSPGSNATKR--------ETKAHVLARQLSDDDANW 217

Query: 170 LLSCPIILDI----PEYDLYVVHAGLLPDVPLFEQDPSDIMSMR--NIKNGKPTSKKDVG 223
           L SCP+IL +       D+ VVH GL+P VPL  QDPS +M+MR  ++ +  P+S K+ G
Sbjct: 218 LESCPVILKVGYIRAMGDVVVVHGGLVPGVPLERQDPSSVMTMRTLDVDSHTPSSLKE-G 276

Query: 224 HAWSKHWNAAQ-----QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
             WSK ++  Q     +++  P T+IYGHDA +   I+ Y+ GLD+ CV GG+L+ALI  
Sbjct: 277 TGWSKVFDEYQRRMVKEKNEQPTTVIYGHDAKQLPVIRLYTKGLDTSCVRGGKLTALIIG 336

Query: 279 D--NREIINVKCNKYV 292
           D   + +  VKC  YV
Sbjct: 337 DGGRQRLKQVKCKGYV 352



>gi|296816687|ref|XP_002848680.1| ser/Thr protein phosphatase [Arthroderma otae CBS 113480]
 gi|238839133|gb|EEQ28795.1| ser/Thr protein phosphatase [Arthroderma otae CBS 113480]
          Length = 366

 Score =  186 bits (473), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 151/242 (62%), Gaps = 19/242 (7%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           S+K L+ +GDVHG  DEL  L+ +++++  K DHLIF GD+++KGPKS+EVVQL R   A
Sbjct: 105 SRKRLVVVGDVHGCKDELEKLLAQVSFNREKGDHLIFTGDLISKGPKSVEVVQLAREYNA 164

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
           SCVRGNH+D+VL  +  +    SQ    D    E  I K   ++E   LA++L  +  N+
Sbjct: 165 SCVRGNHEDRVLLTRRKITSRCSQGFRAD----ESTIGKR--ETEAHALARQLSDDDANW 218

Query: 170 LLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTSKKDVG 223
           L SCP+IL +       D+ VVHAGL+P VPL  QDPS +M+MR I      P+S K+ G
Sbjct: 219 LESCPVILRVGNINGMGDVVVVHAGLVPGVPLERQDPSLVMNMRTIDPDTYTPSSSKE-G 277

Query: 224 HAWSKHWNAAQ-----QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
             WS  ++A Q     ++S  P T+IYGHDA +   I+ Y+ GLD+ CV GGEL+ALI  
Sbjct: 278 TGWSNVFDAYQLRLEREKSLPPTTVIYGHDAKQLPAIRKYTKGLDTSCVRGGELTALIIE 337

Query: 279 DN 280
           D 
Sbjct: 338 DG 339



>gi|511008295|gb|EPB89564.1| hypothetical protein HMPREF1544_03648 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 349

 Score =  186 bits (471), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 157/258 (60%), Gaps = 7/258 (2%)

Query: 41  TLINKLEAPLSQK-NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIE 99
           T++   +  L QK N+  +GDVHG   EL  L+ K+N++   D LI  GD+ AKGP S+ 
Sbjct: 85  TIVTNNDESLQQKENIYVVGDVHGCVSELDKLVTKLNFNQATDQLILAGDLTAKGPDSVG 144

Query: 100 VVQLIRSLGASCVRGNHDDKVLQIKNI-LDFLDSQKIPLDEFIKEHDIPKDI-VKSEHGL 157
           V++  + LGA CVRGNHDDKV+++K   L+  ++   PL   + E ++P  +  K+ H  
Sbjct: 145 VIRRAKELGALCVRGNHDDKVIRLKTYELEKGENAMYPLSATMPEGNVPDPLKFKNYHVA 204

Query: 158 LAKELDVELYNYLLSCPIILDIPEY-DLYVVHAGLLPDV-PLFEQDPSDIMSMRNIKNGK 215
           +AK L  + Y+YL SCP++L +P   +  VVH GL P++  L +Q P  +M+MR+I    
Sbjct: 205 IAKNLTQDDYDYLASCPVMLHMPFLNNAVVVHGGLDPNIKSLQDQIPYLVMNMRDIDKNG 264

Query: 216 PTSKKDVGHAWSKHWNAAQQESSSPKT-IIYGHDASRRLKIKPYSFGLDSGCVYGGELSA 274
           P+ + DVG  W   WN  QQ  +   T I YGHDASR L +K +++GLD+GCVYG +L+A
Sbjct: 265 PSPENDVGTQWGTIWNEKQQNLTMDNTEIFYGHDASRGLNLKNFTYGLDTGCVYGKQLTA 324

Query: 275 LIWNDNREIINVKCNKYV 292
           +     + +  ++C  YV
Sbjct: 325 MNVR-TKVMTQIECPLYV 341



>gi|121713158|ref|XP_001274190.1| Ser/Thr protein phosphatase family [Aspergillus clavatus NRRL 1]
 gi|119402343|gb|EAW12764.1| Ser/Thr protein phosphatase family [Aspergillus clavatus NRRL 1]
          Length = 425

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 159/271 (58%), Gaps = 27/271 (9%)

Query: 43  INKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQ 102
           +  ++   S + LIFIGDVHG  DEL  L++++++D  +DHLIF GD+++KGP S  VV 
Sbjct: 156 VKAVKGEASSRRLIFIGDVHGCRDELELLLDEVSFDHERDHLIFTGDMISKGPDSPGVVD 215

Query: 103 LIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDI---VKSEHGLLA 159
           L R   ASCVRGNH+D++L +++  D   +  +P      + DIP D+   + S+   LA
Sbjct: 216 LARQYAASCVRGNHEDRILLLRH--DMATTNTLPA---ASDGDIPPDLFFGLNSKERALA 270

Query: 160 KELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-NG 214
           ++L  E   +L +CP+ILD+ +      + VVH GL+P V L +QDPS +M+M  I  + 
Sbjct: 271 RQLSDEQVQWLDACPVILDVGQIPAMGQVLVVHGGLVPGVALEKQDPSSVMNMLTIDLDT 330

Query: 215 KPTSKKDVGHAWSKHWNA------AQQESSSP------KTIIYGHDASRRLKIKPYSFGL 262
              S K  G  W+K +N       A Q+   P       T+IYGHDA   L +K Y+ GL
Sbjct: 331 HVPSGKRGGMMWTKLFNKHQSLLYASQKGVVPDPKSKVTTVIYGHDAKTSLSLKTYTKGL 390

Query: 263 DSGCVYGGELSALIWNDNRE--IINVKCNKY 291
           DSGCV GG+L+A+I  D  E  ++ V+C  Y
Sbjct: 391 DSGCVKGGKLTAMIIEDGGEQKVVQVRCRNY 421



>gi|212534642|ref|XP_002147477.1| Ser/Thr protein phosphatase family [Talaromyces marneffei ATCC
           18224]
 gi|210069876|gb|EEA23966.1| Ser/Thr protein phosphatase family [Talaromyces marneffei ATCC
           18224]
          Length = 440

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 166/285 (58%), Gaps = 31/285 (10%)

Query: 30  INTHNFKPLNYTLINKLEAPL--SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFV 87
           ++  + + LN  L+  LE     S + L+ +GDVHG  DEL  L+ K+++DP  DHLI  
Sbjct: 163 VDVVSMRTLNPALLPSLEKKQGKSSRRLVIVGDVHGCKDELEKLLKKVSFDPAGDHLILT 222

Query: 88  GDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIP 147
           GD+++KGPKS  VV L R LGASCVRGNH+D++L  ++ +  L + ++   E+    D  
Sbjct: 223 GDMISKGPKSGGVVDLARELGASCVRGNHEDRILLERSDMK-LHTNEVSDQEYTVVSDTA 281

Query: 148 KDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPS 203
           +  V       AK L  E   +L  CP+IL +       ++ VVH GL+P VPL  Q+ S
Sbjct: 282 ERKV-------AKSLTDEQAAWLQDCPVILKVGVIKDMGEVAVVHGGLVPGVPLERQELS 334

Query: 204 DIMSMRNI--KNGKPTSKKDVGHAWSKHWN-------AAQQESSS---PK--TIIYGHDA 249
            +MSMR I      P+S K  G  W K +N       + Q+E  S   PK  T+IYGHDA
Sbjct: 335 SVMSMRTIDLDTHVPSSNKS-GIPWFKVYNQYHKLLASGQEEVDSSVLPKTMTVIYGHDA 393

Query: 250 SRRLKIKPYSFGLDSGCVYGGELSALIWNDN--REIINVKCNKYV 292
           ++ L I+ Y+ GLDSGCVYG +LSAL+  D    +++ VKC++YV
Sbjct: 394 AKSLNIRQYTKGLDSGCVYGRKLSALVIEDGGKNKVVQVKCDEYV 438



>gi|327293756|ref|XP_003231574.1| Ser/Thr protein phosphatase [Trichophyton rubrum CBS 118892]
 gi|326466202|gb|EGD91655.1| Ser/Thr protein phosphatase [Trichophyton rubrum CBS 118892]
          Length = 349

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/255 (41%), Positives = 158/255 (61%), Gaps = 25/255 (9%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           S++ LI +GDVHG  DEL  L+ +I+++  K DHLIF GD+++KGP+S+EVV+L R   A
Sbjct: 107 SKRRLIIVGDVHGCKDELEKLLARISFNREKRDHLIFTGDLISKGPESVEVVRLAREYSA 166

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
           SCVRGNH+DKVL  +   + LDS +       +E         ++  +LA++L  +   +
Sbjct: 167 SCVRGNHEDKVLLTRR--EMLDSSRSTGSSAERE---------TKAHVLARQLSDDDATW 215

Query: 170 LLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMR--NIKNGKPTSKKDVG 223
           L SCP+IL +       D+ VVH GL+P VPL  QDPS +M+MR  ++ +  P+S K+ G
Sbjct: 216 LESCPVILKVGYIRDMGDVVVVHGGLVPGVPLERQDPSSVMTMRTLDVDSHTPSSLKE-G 274

Query: 224 HAWSKHWNAAQQ----ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWND 279
             WSK ++  Q+    ++  P T+IYGHDA +   I+ Y+ GLD+ CV GG+L+ALI  D
Sbjct: 275 TGWSKVFDEYQRRMVKKNERPTTVIYGHDAKQLPVIRLYTKGLDTSCVRGGKLTALIIGD 334

Query: 280 --NREIINVKCNKYV 292
              + +  VKC  YV
Sbjct: 335 GGRQRLKQVKCKGYV 349



>gi|384495390|gb|EIE85881.1| hypothetical protein RO3G_10591 [Rhizopus delemar RA 99-880]
          Length = 340

 Score =  183 bits (465), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 158/262 (60%), Gaps = 12/262 (4%)

Query: 26  NNYSINTHNFKPLN-YTLINKL----EAPLSQKNLIFI-GDVHGSYDELLNLINKINYDP 79
           + Y  N +   PL+ YT + ++    +  L QK  IF+ GD+HG  DE   L+  + YDP
Sbjct: 53  DEYDANNNTKYPLSPYTHLTQIVTHNDTALQQKERIFVTGDLHGCLDEFNALLEAVRYDP 112

Query: 80  LKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKI-PLD 138
            +D +I  GD+ +KGP S+ V+Q  + LG  CVRGNHDDK+++ K         K+ P D
Sbjct: 113 ERDQMILAGDMTSKGPDSLGVIQRAKELGLLCVRGNHDDKLIRFKTFEMVNGQDKMQPED 172

Query: 139 EFIKEHDIPKDI-VKSEHGLLAKELDVELYNYLLSCPIILDIPEY-DLYVVHAGLLPDV- 195
           E + E D+P  +  K+ H  LA  +  + Y+YL+SCP+IL IP   +  VVH GL P++ 
Sbjct: 173 ETMPEGDVPDPLKFKNYHEPLALNMTQDQYDYLVSCPVILHIPFLNNTIVVHGGLDPNIL 232

Query: 196 PLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNAAQQESSSPKTII-YGHDASRRL 253
            L +Q P  +M+MR+I ++ +PT K   G  W   WN+ Q+  SS  T++ YGHDA R L
Sbjct: 233 ALKDQVPYLVMNMRDIDEHQEPTPKSGKGTQWGVEWNSNQKSLSSDNTVVYYGHDAGRGL 292

Query: 254 KIKPYSFGLDSGCVYGGELSAL 275
            ++ Y+FGLD+GCVYG +L+ +
Sbjct: 293 NLQQYTFGLDTGCVYGRQLTTM 314



>gi|452000673|gb|EMD93134.1| hypothetical protein COCHEDRAFT_1020904 [Bipolaris maydis C5]
 gi|477583170|gb|ENI00271.1| hypothetical protein COCC4DRAFT_206290 [Bipolaris maydis ATCC
           48331]
          Length = 396

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 156/270 (57%), Gaps = 22/270 (8%)

Query: 38  LNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKS 97
           +  T +++   P   K LIFIGDVHG   EL +L+NK+ +D  +DH++  GD++AKGP S
Sbjct: 123 IQVTDMDEQHLPKENKRLIFIGDVHGCRAELEHLLNKVAFDQSRDHIVMTGDMIAKGPDS 182

Query: 98  IEVVQLIRSLGASCVRGNHDDKVL------QIKNILDF--LDSQKIPLDEFIKEHDIPKD 149
             V++L R  GASCVRGN +DK+L      Q +++L     D+ +  LD F+      + 
Sbjct: 183 AGVIKLARKYGASCVRGNWEDKLLLSIAEAQDRHVLVMPTADNDEAKLD-FVGAPTASQG 241

Query: 150 IVKSEHGLLAKELDVELYNYLLSCPIILDIPEYD----LYVVHAGLLPDVPLFEQDPSDI 205
             K     LAK+   +  +YL  CP+IL +        L  VHAGL+PD+PL  QDP  +
Sbjct: 242 NAKLRK--LAKQFSKKDIDYLRQCPVILRVGTVTNLGALVTVHAGLVPDIPLEHQDPFHV 299

Query: 206 MSMRNI--KNGKPTSKKDVGHAWSKHWNAAQQ--ESSSPKTIIYGHDASRRLKIKPYSFG 261
           M+MR+I  K   PTSK   G  W K WN  QQ  ++    T IYGH+  + L +  YSFG
Sbjct: 300 MNMRSIDLKTRIPTSKHG-GTPWEKFWNHRQQKLKAKERTTAIYGHNRKKGLNVHEYSFG 358

Query: 262 LDSGCVYGGELSALIWNDN--REIINVKCN 289
           LD+GCV GG+L+AL+ +     EI+ VKC 
Sbjct: 359 LDTGCVSGGKLTALVVDGEGKAEIVQVKCG 388



>gi|451850634|gb|EMD63936.1| hypothetical protein COCSADRAFT_37662 [Bipolaris sorokiniana
           ND90Pr]
          Length = 397

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 158/271 (58%), Gaps = 23/271 (8%)

Query: 38  LNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKS 97
           +  T +++   P   K LIFIGDVHG   EL +L+NK+ +D  +DH++  GD++AKGP S
Sbjct: 123 IQVTDMDEQHLPKENKRLIFIGDVHGCRAELEHLLNKVAFDQSRDHIVMTGDMIAKGPDS 182

Query: 98  IEVVQLIRSLGASCVRGNHDDKVL------QIKNIL---DFLDSQKIPLDEFIKEHDIPK 148
             V++L R  GASCVRGN +DK+L      Q +++L      DS +  L EF+      +
Sbjct: 183 AGVIKLARKYGASCVRGNWEDKLLLSIAEAQDRHVLVMPTAADSDESKL-EFLGAATASQ 241

Query: 149 DIVKSEHGLLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSD 204
              K     LAK+   +  +YL  CP+IL +        L  VHAGL+PD+PL  QDP  
Sbjct: 242 GNAKLRK--LAKQFSKKDIDYLRQCPVILRVGTVPTLGTLVTVHAGLVPDIPLEHQDPFH 299

Query: 205 IMSMRNI--KNGKPTSKKDVGHAWSKHWNAAQQESSSPK--TIIYGHDASRRLKIKPYSF 260
           +M+MR+I  K   P+SK + G  W K WN  QQ+  + +  T +YGH+  + L +  YS+
Sbjct: 300 VMNMRSIDLKTRIPSSKHN-GTPWEKFWNHRQQKMKAKERTTAVYGHNRKKGLNVHEYSY 358

Query: 261 GLDSGCVYGGELSALIWNDN--REIINVKCN 289
           GLD+GCV GG+L+AL+ +     EI+ VKC 
Sbjct: 359 GLDTGCVSGGKLTALVVDGEGKAEIVQVKCG 389



>gi|302505854|ref|XP_003014884.1| hypothetical protein ARB_06641 [Arthroderma benhamiae CBS 112371]
 gi|291178455|gb|EFE34244.1| hypothetical protein ARB_06641 [Arthroderma benhamiae CBS 112371]
          Length = 911

 Score =  179 bits (453), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 104/256 (40%), Positives = 156/256 (60%), Gaps = 26/256 (10%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           S++ LI +GDVHG  DEL  L+ +++++  K DHLIF GD+++KGP+S+EVV+L R   A
Sbjct: 668 SKRRLIIVGDVHGCKDELEKLLARVSFNREKGDHLIFTGDLISKGPESVEVVRLARKYSA 727

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
           SCVRGNH+DKVL        L  ++I            ++   ++  +LA++L  +   +
Sbjct: 728 SCVRGNHEDKVL--------LTRREISGSSRSTGSSAKRE---TKAHVLARQLSDDDATW 776

Query: 170 LLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMR--NIKNGKPTSKKDVG 223
           L SCP+IL +       D+ VVH GL+P VPL  QDPS +M+MR  ++ +  P+S K+ G
Sbjct: 777 LESCPVILKVGYIRGMGDVVVVHGGLVPGVPLERQDPSSVMTMRTLDVDSHTPSSLKE-G 835

Query: 224 HAWSKHWNAAQ-----QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
             WSK ++  Q     +++  P T+IYGHDA +   I+ Y+ GLD+ CV GG+L+ALI  
Sbjct: 836 TGWSKVFDEYQHRMVKEKNERPTTVIYGHDAKQLPVIRLYTKGLDTSCVRGGKLTALIIG 895

Query: 279 D--NREIINVKCNKYV 292
           D   + +  VKC  YV
Sbjct: 896 DGGRQRLKQVKCKGYV 911



>gi|302663605|ref|XP_003023443.1| hypothetical protein TRV_02427 [Trichophyton verrucosum HKI 0517]
 gi|291187440|gb|EFE42825.1| hypothetical protein TRV_02427 [Trichophyton verrucosum HKI 0517]
          Length = 919

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 104/256 (40%), Positives = 155/256 (60%), Gaps = 26/256 (10%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           S++ LI +GDVHG  DEL  L+ +++++  K DHLIF GD+++KGP+S+EVV+L R   A
Sbjct: 676 SKRRLIIVGDVHGCKDELEKLLARVSFNREKGDHLIFTGDLISKGPESVEVVRLARKYSA 735

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
           SCVRGNH+DKVL        L  ++I            ++   ++  +LA++L  +   +
Sbjct: 736 SCVRGNHEDKVL--------LTRREISGSSQSTGSSAKRE---TKAHVLARQLSDDDATW 784

Query: 170 LLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMR--NIKNGKPTSKKDVG 223
           L SCP+IL +       D+ VVH GL+P VPL  QDPS +M+MR  ++ +  P+S K+ G
Sbjct: 785 LESCPVILKVGYIRGMGDVVVVHGGLVPGVPLERQDPSSVMTMRTLDVDSHTPSSLKE-G 843

Query: 224 HAWSKHWNAAQ-----QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
             WSK ++  Q     +++  P T+IYGHDA     I+ Y+ GLD+ CV GG+L+ALI  
Sbjct: 844 TGWSKVFDEYQRRMVKEKNERPTTVIYGHDAKELPVIRLYTKGLDTSCVRGGKLTALIIG 903

Query: 279 D--NREIINVKCNKYV 292
           D   + +  VKC  YV
Sbjct: 904 DGGRQRLKQVKCKGYV 919



>gi|494827466|gb|EON64416.1| hypothetical protein W97_03647 [Coniosporium apollinis CBS 100218]
          Length = 402

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 158/285 (55%), Gaps = 37/285 (12%)

Query: 27  NYSINTHNFKP--LNYTLINKLEAPL-----SQKNLIFIGDVHGSYDELLNLINKINYDP 79
           N  +   N +P   +  ++ K+++ L      ++ LIF+GDVHG  DEL+ L+ K+++  
Sbjct: 129 NKGMFGSNLRPDFTDMVMVKKMDSDLLPGAGERRRLIFVGDVHGCKDELVTLLAKVDFQR 188

Query: 80  LKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDE 139
            +DHLI  GDIVAKGP S  VV L R LGASCVRGNHDD+VL        L + +     
Sbjct: 189 TRDHLILTGDIVAKGPDSAGVVSLARDLGASCVRGNHDDRVL--------LSAAQ----- 235

Query: 140 FIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPIIL---DIPEY-DLYVVHAGLLPDV 195
               H  P   ++ E   +A  L      +L  CP+IL   D+P   ++ V HAGL+P V
Sbjct: 236 -AASHSQPS--IEQEKSAVAAALGKHNLRWLRECPVILNVGDVPGMGEILVAHAGLVPGV 292

Query: 196 PLFEQDPSDIMSMRNI--KNGKPTSKKDVGH----AWSKHWNAAQQESSSPK--TIIYGH 247
           PL  QDP + M+MR+I  +   P+ +  V       W   WN  Q+   S K  T++YGH
Sbjct: 293 PLERQDPFETMNMRSIDLETRVPSEEHPVKEKGTIGWEMLWNYYQKSQPSKKRQTVVYGH 352

Query: 248 DASRRLKIKPYSFGLDSGCVYGGELSALIWND--NREIINVKCNK 290
           ++ R L I+ YS GLD+GCV GG+L+AL+ +    +  ++V C K
Sbjct: 353 NSKRGLNIQEYSKGLDTGCVKGGKLTALVVDSGGRQSYVSVACKK 397



>gi|396479122|ref|XP_003840681.1| similar to ser/Thr protein phosphatase family [Leptosphaeria
           maculans JN3]
 gi|312217254|emb|CBX97202.1| similar to ser/Thr protein phosphatase family [Leptosphaeria
           maculans JN3]
          Length = 399

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 154/260 (59%), Gaps = 22/260 (8%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
            K L+F+GDVHG   EL +L++KI +D  +DHL+  GD++AKGP S  V++L + +GASC
Sbjct: 134 HKRLVFVGDVHGCRKELEHLLDKIEFDDERDHLVLTGDMIAKGPDSPGVIKLAQKMGASC 193

Query: 112 VRGNHDDKVL-----QIKNIL----DFLDSQKIPLDEFIKEHDIPKDIVKSEHGL--LAK 160
           VRGN +DK+L       +NIL       DS   P++    +   P     +   L  LAK
Sbjct: 194 VRGNWEDKLLLSIAEAKENILVTANTATDSGTSPVNPDHPDAVAPSQNAHASSSLHKLAK 253

Query: 161 ELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKP 216
           +   +   YL SCP+IL +        L  VHAGL+P++PL  QDP  +M+MR I + KP
Sbjct: 254 KFTKKEIAYLQSCPVILRVGTVPNLGTLVAVHAGLVPEIPLERQDPFHVMNMRTI-DLKP 312

Query: 217 T--SKKDVGHAWSKHWNAAQQESSSPK--TIIYGHDASRRLKIKPYSFGLDSGCVYGGEL 272
              S K  G  W K WN  Q++    +  +I+YGH+  + L I+ Y++GLD+GCV GG L
Sbjct: 313 RIPSSKHSGTPWEKLWNHHQKKLHKKERVSIVYGHNRKKGLNIRKYTYGLDTGCVSGGRL 372

Query: 273 SALIWNDN--REIINVKCNK 290
           +AL+ + N  +E+++VKC K
Sbjct: 373 TALVVDGNGEKELVHVKCGK 392



>gi|70998088|ref|XP_753775.1| Ser/Thr protein phosphatase family [Aspergillus fumigatus Af293]
 gi|66851411|gb|EAL91737.1| Ser/Thr protein phosphatase family [Aspergillus fumigatus Af293]
          Length = 430

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 110/283 (38%), Positives = 163/283 (57%), Gaps = 33/283 (11%)

Query: 34  NFKPLNYTLINKLEAPL----SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGD 89
             + LN +L+  ++A      S + LIF+GDVHG  DEL  L++++++D  +DHLIF GD
Sbjct: 149 QLRDLNASLLPAVKAQTDGQPSSRRLIFVGDVHGCKDELELLLDEVSFDHERDHLIFAGD 208

Query: 90  IVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKD 149
           ++ KGP S+ VV L+R   ASCVRGNH+D+VL +++  D   S  +  D    +  I  D
Sbjct: 209 MINKGPDSLGVVDLVRKYNASCVRGNHEDRVLLLRH--DMEASNTLSPD---SDDGISPD 263

Query: 150 I---VKSEHGLLAKELDVELYNYLLSCPIILD---IPEY-DLYVVHAGLLPDVPLFEQDP 202
           +   +K E   LA++L  E   +L +CP+IL+   IPE   + VVH GL+P V L +QDP
Sbjct: 264 LFFGLKKEERALARQLSNEQVQWLDACPVILNVGQIPEMGQVVVVHGGLVPGVELDKQDP 323

Query: 203 SDIMSMRNI--KNGKPTSKKDVGHAWSKHWNAAQQE------------SSSPKTIIYGHD 248
           S +M+M  I      P+S +  G  W+K +N  Q               S   T+IYGHD
Sbjct: 324 SSVMNMLTIDLDTHVPSSTRH-GTQWTKLFNKHQSLLYSSLKSSMPDPESQVMTVIYGHD 382

Query: 249 ASRRLKIKPYSFGLDSGCVYGGELSALIWNDN--REIINVKCN 289
           +   L +K Y+ GLDSGCV GG+L+A++  D   + I+ V+C 
Sbjct: 383 SKNSLSLKTYTKGLDSGCVKGGKLTAMVVEDGGKQSIVQVRCR 425



>gi|159126489|gb|EDP51605.1| Ser/Thr protein phosphatase family [Aspergillus fumigatus A1163]
          Length = 430

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 110/283 (38%), Positives = 163/283 (57%), Gaps = 33/283 (11%)

Query: 34  NFKPLNYTLINKLEAPL----SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGD 89
             + LN +L+  ++A      S + LIF+GDVHG  DEL  L++++++D  +DHLIF GD
Sbjct: 149 QLRDLNASLLPAVKAQTDGQPSSRRLIFVGDVHGCKDELELLLDEVSFDHERDHLIFAGD 208

Query: 90  IVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKD 149
           ++ KGP S+ VV L+R   ASCVRGNH+D+VL +++  D   S  +  D    +  I  D
Sbjct: 209 MINKGPDSLGVVDLVRKYNASCVRGNHEDRVLLLRH--DMEASNTLSPD---SDDGISPD 263

Query: 150 I---VKSEHGLLAKELDVELYNYLLSCPIILD---IPEY-DLYVVHAGLLPDVPLFEQDP 202
           +   +K E   LA++L  E   +L +CP+IL+   IPE   + VVH GL+P V L +QDP
Sbjct: 264 LFFGLKKEERALARQLSNEQVQWLDACPVILNVGQIPEMGQVVVVHGGLVPGVELDKQDP 323

Query: 203 SDIMSMRNI--KNGKPTSKKDVGHAWSKHWNAAQQE------------SSSPKTIIYGHD 248
           S +M+M  I      P+S +  G  W+K +N  Q               S   T+IYGHD
Sbjct: 324 SSVMNMLTIDLDTHVPSSTRH-GTQWTKLFNKHQSLLYSSLKSSMPDPESQVMTVIYGHD 382

Query: 249 ASRRLKIKPYSFGLDSGCVYGGELSALIWNDN--REIINVKCN 289
           +   L +K Y+ GLDSGCV GG+L+A++  D   + I+ V+C 
Sbjct: 383 SKNSLSLKTYTKGLDSGCVKGGKLTAMVVEDGGKQSIVQVRCR 425



>gi|295666466|ref|XP_002793783.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226277436|gb|EEH33002.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 414

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 109/269 (40%), Positives = 155/269 (57%), Gaps = 32/269 (11%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           +K LI +GDVHG  DEL NL+ K+ +DP + DHLIF GD++A+GPKSI VV L R  G+S
Sbjct: 118 RKRLIVLGDVHGCLDELENLLRKVAFDPKQGDHLIFTGDLIARGPKSIGVVDLARKYGSS 177

Query: 111 CVRGNHDDKVL----QIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVEL 166
           CVRGN++D+ L     IK +     S+ +  +E  K  +   DI  S++  LA EL  E 
Sbjct: 178 CVRGNNEDRTLLTRRDIKGVSSNRKSRSMSNNELGKASE---DINSSKNRALAAELSDEQ 234

Query: 167 YNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK--NGKPTSKK 220
             +L +CP+IL +       D+ VVH GL+P + L +QDP+ +MSMR I   +  P+S  
Sbjct: 235 AEWLDTCPVILKVGSIKGMDDVVVVHGGLVPGLELEKQDPTAVMSMRTIDFLSHAPSSSS 294

Query: 221 DVGHAWSKHWNAAQ------------QES---SSPKTIIYGHDASRRLKIKPYSFGLDSG 265
           D G  W+K +N  Q            +ES   + P T++YGH       +K Y+ GLD+ 
Sbjct: 295 D-GVPWTKLFNKYQTMLARARNLAPPEESLRYARPTTVLYGHQPHSSPLLKKYTKGLDTN 353

Query: 266 CVYGGELSALIWNDN--REIINVKCNKYV 292
           CV GG+LSA+I  D     I +V+C  Y+
Sbjct: 354 CVRGGKLSAMIIEDGGITSIQSVRCKNYM 382



>gi|501754849|emb|CCG81839.1| Ser/Thr protein phosphatase family [Taphrina deformans PYCC 5710]
          Length = 298

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 155/265 (58%), Gaps = 14/265 (5%)

Query: 38  LNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKS 97
           L  +LI  +E   + + L+ IGDVHG  +EL +L+ K +++P  DH+IFVGD+VAKGP S
Sbjct: 39  LQESLIPTVE---NARRLLVIGDVHGCLEELKHLLKKCDFNPRHDHIIFVGDLVAKGPFS 95

Query: 98  IEVVQLIRSLG--ASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKS-E 154
           ++ +  +  LG  A+CVRGNHDDK++Q    L      +   D  + +  +P+ + +  E
Sbjct: 96  LDTLSFVDDLGSAATCVRGNHDDKLMQWNTYL--TSKTRTDPDGDLNDEKLPEGLSRRDE 153

Query: 155 HGLLAKELDVELYNYLLSCPIILDIPEY--DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK 212
           H  LAK +  +  N+L S P I+  P +     VVHAG+LP + L  Q   D+ +MRNIK
Sbjct: 154 HRFLAKNMTTDHVNFLESLPYIIQFPLHGQQYIVVHAGVLPRIALNCQKCWDVTNMRNIK 213

Query: 213 NGKPTSKKDVGHAWSKHWNAAQQESSSPK--TIIYGHDASRRLKIKPYSFGLDSGCVYGG 270
             K    ++ G  W + W  AQ++ +  +   ++YGHDA R L ++ YS GLDS CV GG
Sbjct: 214 KKKALDHREDGDGWFEVWERAQRKVAKQERCVVLYGHDAGRDLNLRKYSKGLDSRCVRGG 273

Query: 271 ELSALI--WNDNREIINVKCNKYVD 293
           +L+A+I    ++   ++VK  +  D
Sbjct: 274 QLTAMIISGRESERYVHVKAKRRYD 298



>gi|225683382|gb|EEH21666.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 453

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 108/269 (40%), Positives = 154/269 (57%), Gaps = 32/269 (11%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           +K LI +GDVHG  DEL NL+ K+ +DP + DHLIF GD++AKGPKSI VV L R   +S
Sbjct: 172 RKRLIVLGDVHGCLDELENLLRKVAFDPKQGDHLIFTGDLIAKGPKSIGVVDLARKYRSS 231

Query: 111 CVRGNHDDKVL----QIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVEL 166
           CVRGN++D+ L     IK +     S+ +  +E  K  +   D+  S++  LA EL  E 
Sbjct: 232 CVRGNNEDRTLLARRNIKGVSSNRKSRSMSNNELDKASE---DVTSSKNSALAAELSDEQ 288

Query: 167 YNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK--NGKPTSKK 220
             +L +CP+IL +       D+ VVH GL+P + L +QDP+ +MSMR I   +  P+S  
Sbjct: 289 AEWLDTCPVILKVGSIKGMDDVVVVHGGLVPGLELEKQDPTAVMSMRTIDLLSHAPSSSS 348

Query: 221 DVGHAWSKHWNAAQ------------QES---SSPKTIIYGHDASRRLKIKPYSFGLDSG 265
           D G  W+K +N  Q            +ES   + P T++YGH       +K Y+ GLD+ 
Sbjct: 349 D-GVPWTKLFNKYQTMLARAQNLAPPEESLRYARPTTVLYGHQPHSSPLLKKYTKGLDTN 407

Query: 266 CVYGGELSALIWNDN--REIINVKCNKYV 292
           CV GG+LSA+I  D     I +V+C  Y+
Sbjct: 408 CVRGGKLSAMIIEDGGITSIQSVRCKNYM 436



>gi|226286998|gb|EEH42511.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18]
          Length = 453

 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 108/269 (40%), Positives = 154/269 (57%), Gaps = 32/269 (11%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           +K LI +GDVHG  DEL NL+ K+ +DP + DHLIF GD++AKGPKSI VV L R   +S
Sbjct: 172 RKRLIVLGDVHGCLDELENLLRKVAFDPKQGDHLIFTGDLIAKGPKSIGVVDLARKYRSS 231

Query: 111 CVRGNHDDKVL----QIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVEL 166
           CVRGN++D+ L     IK +     S+ +  +E  K  +   D+  S++  LA EL  E 
Sbjct: 232 CVRGNNEDRTLLARRNIKGVSSNRKSRSMSNNELDKASE---DVTSSKNSALAAELSDEQ 288

Query: 167 YNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK--NGKPTSKK 220
             +L +CP+IL +       D+ VVH GL+P + L +QDP+ +MSMR I   +  P+S  
Sbjct: 289 AEWLDTCPVILKVGSIKGMDDVVVVHGGLVPGLELEKQDPTAVMSMRTIDLLSHAPSSSS 348

Query: 221 DVGHAWSKHWNAAQ------------QES---SSPKTIIYGHDASRRLKIKPYSFGLDSG 265
           D G  W+K +N  Q            +ES   + P T++YGH       +K Y+ GLD+ 
Sbjct: 349 D-GVPWTKLFNKYQTILARAQNLAPPEESLRYARPTTVLYGHQPHSSPLLKKYTKGLDTN 407

Query: 266 CVYGGELSALIWNDN--REIINVKCNKYV 292
           CV GG+LSA+I  D     I +V+C  Y+
Sbjct: 408 CVRGGKLSAMIIEDGGITSIQSVRCKNYM 436



>gi|511010631|gb|EPB91851.1| hypothetical protein HMPREF1544_01360 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 408

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 100/270 (37%), Positives = 155/270 (57%), Gaps = 13/270 (4%)

Query: 30  INTHNFKPLNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGD 89
           +  H   P +     K+ +P  Q  +  +GD+HG  +E+  L+ KI + P +D LI  GD
Sbjct: 129 VYAHAVSPWSNLTRIKVYSPSDQGRIFVMGDIHGCLEEMNQLLEKIQFKPNQDALILAGD 188

Query: 90  IVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNI-LDFLDSQKIPLDEFIKEHDIPK 148
           +V +G  SI V+Q  R L A CVRGNHDDKV+++K        +   P DE + E ++  
Sbjct: 189 LVFRGQDSIGVIQRARQLNALCVRGNHDDKVIRLKTYEYQHGSASMSPADEIMPEGEVGD 248

Query: 149 DI-VKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVP-LFEQDPSDIM 206
            +   ++H  ++K L+VE YNYL  CP+ILDIP+ +  VVH GL P +  L + DP  +M
Sbjct: 249 PLKFGNKHVEISKNLNVEDYNYLAGCPLILDIPDLNTRVVHGGLDPFITNLVDNDPWSVM 308

Query: 207 SMRNI-KNGKPTSKK-------DVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPY 258
           +MR++  N +P+  K       D+ H W+  +     ++ +P T+ YGHDASR + I   
Sbjct: 309 NMRDMDDNNQPSKLKLNKKPGNDIQH-WTSAYQTNAAKTHNPVTVYYGHDASRGIVIDNQ 367

Query: 259 SFGLDSGCVYGGELSALIWNDNREIINVKC 288
           + G+DSGCVYG +LS ++   +R++  V C
Sbjct: 368 TVGVDSGCVYGRKLS-VVEMRSRQLTQVDC 396



>gi|119479589|ref|XP_001259823.1| Ser/Thr protein phosphatase family [Neosartorya fischeri NRRL 181]
 gi|119407977|gb|EAW17926.1| Ser/Thr protein phosphatase family [Neosartorya fischeri NRRL 181]
          Length = 430

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 39/291 (13%)

Query: 31  NTHNFKPLNYTLINKLEAPL----SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIF 86
           N    + L+ +L+  ++A      S + LIFIGDVHG  DEL  L++++++D  +DHLIF
Sbjct: 146 NITQLRDLDASLLPAVKAQKDEQPSSRRLIFIGDVHGCKDELELLLDEVSFDHERDHLIF 205

Query: 87  VGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIK------NILDFLDSQKIPLDEF 140
            GD++ KGP S+ VV L+R   ASCVRGNH+D+VL ++      N L       I  D F
Sbjct: 206 AGDMINKGPDSLGVVDLVRKYNASCVRGNHEDRVLLLRHDMEASNTLSPDSDGGISPDHF 265

Query: 141 IKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPIILD---IPEY-DLYVVHAGLLPDVP 196
                     +K E   LA++L  E   +L +CP+IL+   IPE   + VVH GL+P V 
Sbjct: 266 FG--------LKKEERALARQLSKEQVQWLDACPVILNVGQIPEMGQVVVVHGGLVPGVE 317

Query: 197 LFEQDPSDIMSMRNI--KNGKPTSKKDVGHAWSKHWNAAQQE------------SSSPKT 242
           L +QDPS +M+M  I      P+S +  G  W+K +N  Q               S   T
Sbjct: 318 LDKQDPSSVMNMLTIDLDTHVPSSTRH-GTKWTKLFNKHQSLLYSSLKSSVPDPKSQVMT 376

Query: 243 IIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN--REIINVKCNKY 291
           +IYGHD+   L +K Y+ GLDSGCV GG+L+A++  D   + I+ V+C  +
Sbjct: 377 VIYGHDSKNSLSLKTYTKGLDSGCVKGGKLTAMVVEDGGKQSIVQVRCRDH 427



>gi|296414195|ref|XP_002836788.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295631627|emb|CAZ80979.1| unnamed protein product [Tuber melanosporum]
          Length = 356

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/252 (36%), Positives = 148/252 (58%), Gaps = 25/252 (9%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           K LI +GD+HG +DE  +L++K++YD   D+L+  GDI++KGP S+ V+   R +GA CV
Sbjct: 119 KRLIIVGDIHGMFDEFQSLLDKVSYDSESDYLVLAGDIISKGPDSLAVLDFARKIGAHCV 178

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
           RGNH+D++L     L + D Q+       ++H +   + +     LAK L  +   +L +
Sbjct: 179 RGNHEDRIL-----LHYHDIQRRK-----RKHHLALSVERK----LAKSLSKKQAEWLDA 224

Query: 173 CPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVGHAWSK 228
           CP+++   +       Y+VHAGL+  + L  QDP  IM+MR + +    S K  G  W+K
Sbjct: 225 CPLVVRAEKVPGLGQYYIVHAGLVHGIGLRRQDPVAIMTMRTLNHHLVPSPKQNGMHWAK 284

Query: 229 HWNAAQ-QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNR------ 281
           +WN  + +E+    T++YGH A+  L I+ Y+ GLDSGC+ G  LSA I   N+      
Sbjct: 285 YWNKMERRETHGHTTVVYGHYAAEGLDIRRYTKGLDSGCIRGRRLSAYILKANKGGRVEE 344

Query: 282 EIINVKCNKYVD 293
           +I++VKC +Y+D
Sbjct: 345 DIVSVKCREYLD 356



>gi|378728819|gb|EHY55278.1| protein phosphatase [Exophiala dermatitidis NIH/UT8656]
          Length = 446

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 150/272 (55%), Gaps = 34/272 (12%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           +K L+FIGD+HG  +EL  L+ KI ++P  DHLI  GDIV KGP +  V+ L+R   ASC
Sbjct: 149 KKRLVFIGDIHGCREELEELLQKIKFNPTTDHLIATGDIVNKGPDTPGVIDLLRRYNASC 208

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGL---LAKELDVELYN 168
           VRGNH+D++L + +  +   +      +  K+ D P+      H     LA+ L  +   
Sbjct: 209 VRGNHEDRLLLVAD--EVQSTSLTSKGKSPKDPDQPQGTSSKAHDAELKLAQTLTADQLA 266

Query: 169 YLLSCPIILDIPEY-----DLYVVHAGLLPDVPLFEQDPSDIMSMR--NIKNGKPTSK-- 219
           +L SCP+IL +        D  VVHAGL+P +PL  QDP+ +M+MR  ++    P+ K  
Sbjct: 267 WLKSCPVILRVGRLKAFPGDAVVVHAGLVPGLPLENQDPASVMNMRIVDLSTHVPSKKHE 326

Query: 220 KDVGHAWSKHWNAAQQ------------ESSSPK------TIIYGHDASRRLKIKPYSFG 261
           ++    W K WN  QQ              S P+      T+IYGHDA   L+++ YS G
Sbjct: 327 REGSVPWYKLWNKYQQLLPTQQRLARLKNGSKPQSDETQMTVIYGHDAKMGLRMRKYSKG 386

Query: 262 LDSGCVYGGELSALIWNDN--REIINVKCNKY 291
           LD+GC  GG+L+AL+ +D+  + ++ V C  +
Sbjct: 387 LDTGCAAGGKLTALVVDDSGRQRVVQVNCKDH 418



>gi|512200601|gb|EPE29433.1| Metallo-dependent phosphatase [Glarea lozoyensis ATCC 20868]
          Length = 355

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 145/244 (59%), Gaps = 30/244 (12%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI +GDVHG  + L+ L++K+ ++  +DHLI  GD+++KGP S  VV L   LGA+ +R
Sbjct: 98  RLIVVGDVHGMKESLVALLDKVKFNEKRDHLILAGDMISKGPDSKGVVDLAMKLGATGIR 157

Query: 114 GNHDDKVLQIKNILDF-------------LDSQKIPLDEFIKEHDIPKDIVKSEHGLLAK 160
           GNH+D+++     ++              +D Q+  L+E    H   KD        L K
Sbjct: 158 GNHEDRIILAHADMEAEHRDTGLPGPTEPMDKQQDTLEEESFNHGDYKDR------RLVK 211

Query: 161 ELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKP 216
           +L  +   +L  CP+IL + +     ++ VVHAGL P V L +QDP  +M+MR IK+G P
Sbjct: 212 QLGEKRIKWLKKCPVILRVGDLGDMGEVVVVHAGLTPGVSLHKQDPVQVMNMRTIKHGVP 271

Query: 217 TSKKDVGHAWSKHWNAAQQESSSPK----TIIYGHDASRRLKIKPYSFGLDSGCVYGGEL 272
           + K++ G  W+K WN  Q+  S PK    T+IYGHD+ R L++K YS G+D+GC+ GG+L
Sbjct: 272 SDKRE-GTVWTKEWNKYQK--SVPKKHRQTVIYGHDSKRGLQMKKYSMGIDTGCLKGGKL 328

Query: 273 SALI 276
           +A++
Sbjct: 329 TAVV 332



>gi|482806024|gb|EOA83097.1| hypothetical protein SETTUDRAFT_164569 [Setosphaeria turcica Et28A]
          Length = 395

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 151/274 (55%), Gaps = 28/274 (10%)

Query: 38  LNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKS 97
           +  T +++   P  +  L+F+GDVHG   EL  L+ K+ +D  +DHL+  GD++AKGP S
Sbjct: 122 IQVTDLDEKHLPTKENRLVFVGDVHGCLTELEELLEKVGFDQKRDHLVMTGDMIAKGPDS 181

Query: 98  IEVVQLIRSLGASCVRGNHDDKVL----QIKNILDFLDSQKIPLD---EFIKEHDIPKDI 150
             V++L + +GASCVRGN +DK+L    Q  +    L +   P D   +FI E       
Sbjct: 182 AGVIKLAQDIGASCVRGNWEDKLLLSIDQAADRHILLPAADAPPDAKIDFIGE------- 234

Query: 151 VKSEHG-----LLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQD 201
             + HG      LAK+   +   Y+  CP+IL I       +L  VHAGL+PD PL  QD
Sbjct: 235 ATATHGKGKLRKLAKQFTKKDIEYMRQCPVILRIGSVPKLGNLVTVHAGLVPDTPLEHQD 294

Query: 202 PSDIMSMRNIK-NGKPTSKKDVGHAWSKHWNAAQQ--ESSSPKTIIYGHDASRRLKIKPY 258
           P  +M+MR+I    +  S K  G AW   WN  Q   +     T+IYGH+  + L I  Y
Sbjct: 295 PFHVMNMRSIDLETRIPSSKHGGTAWETFWNHRQGKLKPRERATVIYGHNRKKGLNIHKY 354

Query: 259 SFGLDSGCVYGGELSALIWNDN--REIINVKCNK 290
           S+GLD+GC  GG+L+AL+ +     E ++VKCNK
Sbjct: 355 SYGLDTGCASGGKLTALVIDSQGKTEFVHVKCNK 388



>gi|258570757|ref|XP_002544182.1| predicted protein [Uncinocarpus reesii 1704]
 gi|237904452|gb|EEP78853.1| predicted protein [Uncinocarpus reesii 1704]
          Length = 371

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 104/277 (37%), Positives = 154/277 (55%), Gaps = 36/277 (12%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           PL ++ L+ +GDVHG  DEL +L++KI++D   DHLIF GD++ KGPKS+EVVQL R   
Sbjct: 94  PLDRRRLVVVGDVHGCKDELDDLLDKISFDGQTDHLIFAGDLITKGPKSLEVVQLAREYN 153

Query: 109 ASCVRGNHDDKVLQIKNILDFLDS---------QKIPLDEFIKEHDIPKDIV----KSEH 155
           ASCVRGN++D++L      + L S          K+  D+         +I+    + EH
Sbjct: 154 ASCVRGNNEDRILLYHR--ELLASGVLSVPGPNTKLSSDDAADTGKFQPEILPYGNRKEH 211

Query: 156 GLLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI 211
            LLA+ L  E   +L  CP+IL +       ++ VVH GL+P V L  QDP  +M+MR++
Sbjct: 212 -LLAQALGDEDAAWLHKCPVILKVGRIGDLGEVVVVHGGLVPGVELESQDPFAVMTMRSL 270

Query: 212 K-NGKPTSKKDVGHAWSKHWNAAQQ-------------ESSSPKTIIYGHDASRRLKIKP 257
             +    S K  G  W+K +N  Q              ++S P T+IYGH   R   I+ 
Sbjct: 271 DLDTHVPSSKASGMHWAKIFNKYQSLLASRLASEPSSVDASLPTTVIYGHTPHRSAAIRK 330

Query: 258 YSFGLDSGCVYGGELSALIWNDN--REIINVKCNKYV 292
           Y+ G+D+GCV GG+L+AL+  +     + +V+C  YV
Sbjct: 331 YTKGIDTGCVRGGKLTALVLENGGKTRVEHVRCKDYV 367



>gi|169619483|ref|XP_001803154.1| hypothetical protein SNOG_12940 [Phaeosphaeria nodorum SN15]
 gi|111058620|gb|EAT79740.1| hypothetical protein SNOG_12940 [Phaeosphaeria nodorum SN15]
          Length = 386

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 104/260 (40%), Positives = 147/260 (56%), Gaps = 26/260 (10%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           P   K LIF+GDVHG  +EL +L+NK+++    DHL+  GD++ KGP S  V++++R LG
Sbjct: 128 PKKGKRLIFVGDVHGCKEELQHLLNKVDFRHKHDHLVLAGDMITKGPDSPGVIKMVRQLG 187

Query: 109 ASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKS---EHGLLAKELDVE 165
           ASCVRGN +DK+L     L    +++I       EH  P D V S    +G        +
Sbjct: 188 ASCVRGNWEDKLL-----LTIAGAEQIHPSSADDEH--PLDFVDSASHSNGDKKLLKLAK 240

Query: 166 LYN-----YLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNG 214
             +     +L  CP+IL +       +L  VHAGL+PD PL +QDP  +M+MR I  K  
Sbjct: 241 KLSRKDLVFLQQCPVILRVGHVPNLGNLVSVHAGLVPDTPLEKQDPVHVMNMRTIDLKTR 300

Query: 215 KPTSKKDVGHAWSKHWNAAQQ--ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGEL 272
            P+SK   G  W K WN  Q+  +     T+IYGH+  R L I  Y+ GLD+GC  GG L
Sbjct: 301 IPSSKHS-GTPWEKFWNHQQEKLKEHQRTTVIYGHNRKRGLNIHKYTKGLDTGCASGGHL 359

Query: 273 SALIWND--NREIINVKCNK 290
           +AL+ +D    E+++VKC K
Sbjct: 360 TALVVDDKGETELVSVKCEK 379



>gi|485921059|gb|EOD46869.1| putative ser thr protein phosphatase family protein [Neofusicoccum
           parvum UCRNP2]
          Length = 422

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 152/258 (58%), Gaps = 22/258 (8%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           ++ L+ +GDVHG   EL+ L++KI++ P  DHL+  GDI++KGP S  VV   R L ASC
Sbjct: 162 RQRLVVVGDVHGCKPELVELLHKIDFRPASDHLVLTGDIISKGPDSTGVVDFARDLHASC 221

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLL 171
           VRGNH+D+VL  +  +   ++  +  ++ + E D  ++    +   LAK+ + +   +L 
Sbjct: 222 VRGNHEDRVLLSRKAMKVAEAD-MSSNKQLGE-DEARNGGNKKDKALAKKFNAKQIEWLE 279

Query: 172 SCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTSKKDVGHA 225
            CP+IL + +     ++ V H GL+P V L  QDP  +M+MR I      P++ +D G  
Sbjct: 280 QCPVILRVGQIKGMGEVLVAHGGLVPGVDLDRQDPFQVMNMRTIDLDTKVPSADRD-GAP 338

Query: 226 WSKHWNAAQQESSSPK----TIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN- 280
           W K WN   +  S PK    T+IYGHDA   L IK YS GLDSGCV GG+L+AL+   + 
Sbjct: 339 WYKFWNYYMK--SLPKEERATVIYGHDAKVGLNIKKYSKGLDSGCVRGGKLTALVIEADH 396

Query: 281 ------REIINVKCNKYV 292
                 + +++VKC++Y+
Sbjct: 397 KGGPAKQSLVHVKCSEYI 414



>gi|330906593|ref|XP_003295528.1| hypothetical protein PTT_01503 [Pyrenophora teres f. teres 0-1]
 gi|311333108|gb|EFQ96372.1| hypothetical protein PTT_01503 [Pyrenophora teres f. teres 0-1]
          Length = 424

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 156/285 (54%), Gaps = 50/285 (17%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           P     LIF+GDVHG   EL +L+ K++++P  DH++ VGD++AKGP S  V++L + +G
Sbjct: 141 PKHNNRLIFVGDVHGCKHELEHLLKKVDFNPKHDHVVLVGDMIAKGPDSAGVIKLAQKIG 200

Query: 109 ASCVRGNHDDKVLQIKNILDFLDSQK-----IPLDE-----FIKEHDIPKDIVKSEHG-- 156
           ASCVRGN +DK+L     L   ++Q      IP DE     F+ + D  +    S H   
Sbjct: 201 ASCVRGNWEDKLL-----LSIAEAQDRHMLVIPEDEDATISFLDDSD-HESATASAHANP 254

Query: 157 ---LLAKELDVELYNYLLSCPIILDI-------PEY---------DLYVVHAGLLPDVPL 197
               LAK+   +   Y+  CP+IL +       P++          L  VHAGL+PD PL
Sbjct: 255 ALRRLAKQFTKKQIKYISQCPVILRVGPIPIPDPKHHSTTSSTTTTLVAVHAGLVPDTPL 314

Query: 198 FEQDPSDIMSMRNI--KNGKPTSKKDVGHAWSKHWNAAQQE--------SSSPKTIIYGH 247
            +QDP  +M+MR+I  K   P+SK   G  W K WN  Q++         S   T++YGH
Sbjct: 315 EDQDPFHVMNMRSIDLKTRIPSSKHG-GTPWEKFWNHRQEKLAHKAKHGESVTTTVVYGH 373

Query: 248 DASRRLKIKPYSFGLDSGCVYGGELSALIWNDN--REIINVKCNK 290
           +  + L +  YS+GLD+GC  GG+L+A + +    R I++VKC K
Sbjct: 374 NRKKGLNLHEYSWGLDTGCASGGKLTAAVVDGRGERAIVHVKCGK 418



>gi|347837378|emb|CCD51950.1| similar to Ser/Thr protein phosphatase family protein [Botryotinia
           fuckeliana T4]
          Length = 305

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 149/256 (58%), Gaps = 23/256 (8%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI +GDVHG  D L++L++K+N+D   DHLI  GD+++KGP S  VV L   +GAS VR
Sbjct: 46  RLIIVGDVHGMKDALVSLLDKVNFDEKHDHLILAGDMISKGPDSPGVVDLAMRIGASAVR 105

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDI-----VKSEHG-----LLAKELD 163
           GNH+D+++ + +       +++ +DE     D  K I     V   HG      L + L 
Sbjct: 106 GNHEDRII-LAHADMIAQHKEMEMDEPGPSEDPEKVIDGLEEVSFNHGDYKDRALVRALG 164

Query: 164 VELYNYLLSCPIILDIPEYD----LYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSK 219
            +   +L  CP+IL +   D    + VVHAGL P V L  QDPS +M+MR + +G P+ +
Sbjct: 165 EKRIKWLKKCPVILRVGHLDGMEQVVVVHAGLAPGVELERQDPSMVMNMRTLIHGVPSDE 224

Query: 220 KDVGHAWSKHWNAAQQE--SSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIW 277
           +D G  W+K WN  Q++       T+IYGHD+ R L+++ YS GLD+GC+ GG+L+A++ 
Sbjct: 225 RD-GKHWNKVWNQHQKKLPKKERTTVIYGHDSKRGLQLEKYSMGLDTGCLKGGKLTAVVI 283

Query: 278 NDN-----REIINVKC 288
                    ++++V C
Sbjct: 284 EGGNSSPKHKVVHVNC 299



>gi|472246082|gb|EMR90630.1| putative ser thr protein phosphatase family protein [Botryotinia
           fuckeliana BcDW1]
          Length = 363

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 149/256 (58%), Gaps = 23/256 (8%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI +GDVHG  D L++L++K+N+D   DHLI  GD+++KGP S  VV L   +GAS VR
Sbjct: 104 RLIIVGDVHGMKDALVSLLDKVNFDEKHDHLILAGDMISKGPDSPGVVDLAMRIGASAVR 163

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDI-----VKSEHG-----LLAKELD 163
           GNH+D+++ + +       +++ +DE     D  K I     V   HG      L + L 
Sbjct: 164 GNHEDRII-LAHADMIAQHKEMEMDEPGPSEDPEKVIDGLEEVSFNHGDYKDRALVRALG 222

Query: 164 VELYNYLLSCPIILDIPEYD----LYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSK 219
            +   +L  CP+IL +   D    + VVHAGL P V L  QDPS +M+MR + +G P+ +
Sbjct: 223 EKRIKWLKKCPVILRVGHLDGMEQVVVVHAGLAPGVELERQDPSMVMNMRTLIHGVPSDE 282

Query: 220 KDVGHAWSKHWNAAQQE--SSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIW 277
           +D G  W+K WN  Q++       T+IYGHD+ R L+++ YS GLD+GC+ GG+L+A++ 
Sbjct: 283 RD-GKHWNKVWNQHQKKLPKKERTTVIYGHDSKRGLQLEKYSMGLDTGCLKGGKLTAVVI 341

Query: 278 NDN-----REIINVKC 288
                    ++++V C
Sbjct: 342 EGGNSSPKHKVVHVNC 357



>gi|154309398|ref|XP_001554033.1| hypothetical protein BC1G_07593 [Botryotinia fuckeliana B05.10]
          Length = 410

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 95/239 (39%), Positives = 143/239 (59%), Gaps = 18/239 (7%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI +GDVHG  D L++L++K+N+D   DHLI  GD+++KGP S  VV L   +GAS VR
Sbjct: 104 RLIIVGDVHGMKDALVSLLDKVNFDEKHDHLILAGDMISKGPDSPGVVDLAMRIGASAVR 163

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDI-----VKSEHG-----LLAKELD 163
           GNH+D+++ + +       +++ +DE     D  K I     V   HG      L + L 
Sbjct: 164 GNHEDRII-LAHADMIAQHKEMEMDEPGPSEDPEKVIDGLEEVSFNHGDYKDRALVRALG 222

Query: 164 VELYNYLLSCPIILDIPEYD----LYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSK 219
            +   +L  CP+IL +   D    + VVHAGL P V L  QDPS +M+MR + +G P+ +
Sbjct: 223 EKRIKWLKKCPVILRVGHLDGMEQVVVVHAGLAPGVELERQDPSMVMNMRTLIHGVPSDE 282

Query: 220 KDVGHAWSKHWNAAQQE--SSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
           +D G  W+K WN  Q++       T+IYGHD+ R L+++ YS GLD+GC+ GG+L+A++
Sbjct: 283 RD-GKHWNKVWNQHQKKLPKKERTTVIYGHDSKRGLQLEKYSMGLDTGCLKGGKLTAVV 340



>gi|452825823|gb|EME32818.1| serine/threonine protein phosphatase [Galdieria sulphuraria]
          Length = 504

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 144/238 (60%), Gaps = 24/238 (10%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            +I +GDVHG  DEL +L+   ++ P  D +IF+GD+VAKGP S+ VV++ R +GA  VR
Sbjct: 282 RVIVVGDVHGCVDELRDLLKLADFRP-GDQVIFLGDLVAKGPDSVAVVKIAREIGARSVR 340

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNHD +V++      + ++Q   L   I         V  EH  +A++LD E + +L  C
Sbjct: 341 GNHDFEVIR------WWNAQMNGLSGSIS--------VNMEHLRIAQDLDREDHEWLFHC 386

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNA 232
           P  + IPE    +VHAG +P V L++Q+P  +M+MR++  NG  T++      W+ +W  
Sbjct: 387 PWFIRIPEMKYLLVHAGFVPGVDLYQQNPRLMMNMRSVLPNGIITNRYVADSPWASYWKG 446

Query: 233 AQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNK 290
                  P+T++YGHDA R L+   ++ G+D+GCVYGG L+AL+  +NR +I+V+  +
Sbjct: 447 -------PETVVYGHDAYRGLQQFEFAQGIDTGCVYGGRLTALLLPENR-LISVRARR 496



>gi|238505270|ref|XP_002383864.1| Ser/Thr protein phosphatase family [Aspergillus flavus NRRL3357]
 gi|220689978|gb|EED46328.1| Ser/Thr protein phosphatase family [Aspergillus flavus NRRL3357]
 gi|391872074|gb|EIT81217.1| hypothetical protein Ao3042_02225 [Aspergillus oryzae 3.042]
          Length = 424

 Score =  166 bits (419), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 151/260 (58%), Gaps = 25/260 (9%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           + LIFIGDVHG  DEL  L+ + +++P  DHLIF GD++ KGP S+ VV L R   ASCV
Sbjct: 170 RRLIFIGDVHGCKDELERLLEETSFNPDTDHLIFTGDMINKGPDSLGVVDLAREYSASCV 229

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
           RG+H+D+VL +++ +   ++     DEF+ + ++ +     E   LA++L  E  ++L +
Sbjct: 230 RGDHEDRVLSLRHNMIAANTMN---DEFLDDANMHRGQYTKERQ-LARQLSEEQADWLDT 285

Query: 173 CPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTSKKDVGHAW 226
           CP++L++ +      + V HAGL+P V L +QDP  +M+M  +      P+S +  G  W
Sbjct: 286 CPVVLNVGQIKDMGQVVVAHAGLVPGVDLDKQDPYSVMNMLTVDLDTHVPSSSRK-GIKW 344

Query: 227 SKHWNAAQQ------------ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSA 274
           +K +N  Q               S   T+IYGHD+   L +K Y+ G+D+GC  GG+L+A
Sbjct: 345 TKLFNKHQSLLSDSLHETFENPESMLTTVIYGHDSKSSLSLKTYTKGIDTGCFKGGKLTA 404

Query: 275 LIWNDN--REIINVKCNKYV 292
           L+  D   ++ + V+CN + 
Sbjct: 405 LVVGDGGKQKTVQVRCNNHT 424



>gi|317151556|ref|XP_001824743.2| Ser/Thr protein phosphatase family [Aspergillus oryzae RIB40]
          Length = 424

 Score =  166 bits (419), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 151/260 (58%), Gaps = 25/260 (9%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           + LIFIGDVHG  DEL  L+ + +++P  DHLIF GD++ KGP S+ VV L R   ASCV
Sbjct: 170 RRLIFIGDVHGCKDELERLLEETSFNPDTDHLIFTGDMINKGPDSLGVVDLAREYSASCV 229

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
           RG+H+D+VL +++ +   ++     DEF+ + ++ +     E   LA++L  E  ++L +
Sbjct: 230 RGDHEDRVLSLRHNMIAANTMN---DEFLDDANMHRGQYTKERQ-LARQLSEEQADWLDT 285

Query: 173 CPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTSKKDVGHAW 226
           CP++L++ +      + V HAGL+P V L +QDP  +M+M  +      P+S +  G  W
Sbjct: 286 CPVVLNVGQIKDMGQVVVAHAGLVPGVDLDKQDPYSVMNMLTVDLDTHVPSSSRK-GIKW 344

Query: 227 SKHWNAAQQ------------ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSA 274
           +K +N  Q               S   T+IYGHD+   L +K Y+ G+D+GC  GG+L+A
Sbjct: 345 TKLFNKHQSLLSDSLHETFENPESMLTTVIYGHDSKSSLSLKTYTKGIDTGCFKGGKLTA 404

Query: 275 LIWNDN--REIINVKCNKYV 292
           L+  D   ++ + V+CN + 
Sbjct: 405 LVVGDGGKQKTVQVRCNNHT 424



>gi|156058238|ref|XP_001595042.1| hypothetical protein SS1G_03130 [Sclerotinia sclerotiorum 1980]
 gi|154700918|gb|EDO00657.1| hypothetical protein SS1G_03130 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 305

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 147/256 (57%), Gaps = 23/256 (8%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI +GDVHG    L++L+ K+N+D   DHLI  GD+++KGP S  VV     LGA+ VR
Sbjct: 46  RLIIVGDVHGMKHALVSLLAKVNFDGEHDHLILAGDMISKGPDSPGVVDFAMKLGATAVR 105

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDI-----VKSEHG-----LLAKELD 163
           GNH+D+++ + +       ++  +D      D  K I     V   HG      L +EL 
Sbjct: 106 GNHEDRII-LAHADMVAQHKEAEMDAPGPSEDPEKVIDGLEEVSFSHGDYKDRALVRELG 164

Query: 164 VELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSK 219
            +   +L  CP+IL +       ++ VVHAGL P V L  QDPS +M+MR + +G P+ +
Sbjct: 165 EKRIKWLKKCPVILRVGHLEGMEEVVVVHAGLAPGVELERQDPSMVMNMRTMIDGIPSDE 224

Query: 220 KDVGHAWSKHWNAAQQESSSPK--TIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIW 277
           +D G  W+K WN  Q++ S  +  T+IYGHD+ R L++K YS GLD+GC+ GG+L+A++ 
Sbjct: 225 RD-GKHWNKVWNKYQKKLSKKERTTVIYGHDSKRGLQLKKYSMGLDTGCIKGGKLTAVVI 283

Query: 278 NDN-----REIINVKC 288
                    +++ VKC
Sbjct: 284 EGGNSAPKHKVVQVKC 299



>gi|189206950|ref|XP_001939809.1| serine/threonine protein phosphatase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187975902|gb|EDU42528.1| serine/threonine protein phosphatase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 418

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 103/280 (36%), Positives = 153/280 (54%), Gaps = 45/280 (16%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           P     LIFIGDVHG   EL +L+ K++++   DH++ VGD++AKGP S  V+++ + +G
Sbjct: 140 PKHNNRLIFIGDVHGCKQELEHLLKKVDFNSKHDHVVLVGDMIAKGPDSAGVIKVAQKVG 199

Query: 109 ASCVRGNHDDKVLQIKNILDFLDSQK-----IPLDE-----FIKEHDIPKDIVKSEHG-- 156
           ASCVRGN +DK+L     L   ++Q      +P DE     F+ + D  +    S H   
Sbjct: 200 ASCVRGNWEDKLL-----LSIAEAQDRHMLVMPEDEDATISFLDDAD-HESATASAHANP 253

Query: 157 ---LLAKELDVELYNYLLSCPIILDIPE-----------------YDLYVVHAGLLPDVP 196
               LAK+   +  +YL  CP+IL + +                   L  VHAGL+PD P
Sbjct: 254 ALRRLAKQFSKKQISYLSHCPVILRVGQIPIPSKHHSTSTSSSSTTTLVAVHAGLVPDTP 313

Query: 197 LFEQDPSDIMSMRNI--KNGKPTSKKDVGHAWSKHWNAAQQ--ESSSPKTIIYGHDASRR 252
           L +QDP  +M+MR+I  K   P+SK   G  W K WN  Q+  +     T++YGH+  + 
Sbjct: 314 LEDQDPFHVMNMRSIDLKTRIPSSKHG-GTPWEKFWNHRQEKMKHGETTTVVYGHNRKKG 372

Query: 253 LKIKPYSFGLDSGCVYGGELSALIWN--DNREIINVKCNK 290
           L +  YS+GLD+GC  GG+L+A + +    R I++VKC K
Sbjct: 373 LNLHEYSWGLDTGCASGGKLTAAVVDGKGERRIVHVKCGK 412



>gi|407917771|gb|EKG11074.1| Metallo-dependent phosphatase [Macrophomina phaseolina MS6]
          Length = 419

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 145/255 (56%), Gaps = 16/255 (6%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           ++ L+ +GDVHG   EL+ L+NKI++ P  DHLI  GDI+AKGP S  VV   R + ASC
Sbjct: 161 RQRLVVVGDVHGCKSELVELLNKIDFRPAADHLILTGDIIAKGPDSPGVVDFARDVRASC 220

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLL 171
           VRGNH+D++L  +  +   + Q +  ++ + E D  ++   ++   LAK+ + +   +L 
Sbjct: 221 VRGNHEDRILLTRKAMRVAE-QDMGDNKHLGE-DEGRNAGSNKDKELAKKFNAKQIEWLE 278

Query: 172 SCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-NGKPTSKKDVGHAW 226
            CP+IL + +     ++ V H GL+P V L   DP  +M+MR I  + K  S    G  W
Sbjct: 279 QCPVILKVGQIKGMGEVVVAHGGLIPGVDLDRHDPFQVMNMRTIDLDTKVPSAGRHGTPW 338

Query: 227 SKHWNAAQQESSSPK--TIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN---- 280
            K+WN   +     K  T+IYGHDA   LKIK  S GLDS CV GG+L+AL+   +    
Sbjct: 339 YKYWNYYMKHIPEEKRSTVIYGHDAKTGLKIKKCSKGLDSNCVKGGKLTALVIEADPKGG 398

Query: 281 ---REIINVKCNKYV 292
              + +++V C  YV
Sbjct: 399 PAKQSLVHVNCGGYV 413



>gi|325093937|gb|EGC47247.1| serine/threonine protein phosphatase [Ajellomyces capsulatus H88]
          Length = 480

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 137/251 (54%), Gaps = 22/251 (8%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           +K LI IGDVHG  DEL  L+  +N++P + DHLIF GD++AKGPKS  VV L R   AS
Sbjct: 221 KKRLIVIGDVHGCLDELETLLQNVNFEPRQGDHLIFTGDLIAKGPKSTGVVDLARKFHAS 280

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKS-EHGLLAKELDVELYNY 169
           CVRGNH+D+VL  +  +    S K       +   I  DI  +     LA EL  E   +
Sbjct: 281 CVRGNHEDRVLLTRRHIQAEASTKSERSAAEEPDQIDDDIEPANRERALANELTDEQAKW 340

Query: 170 LLSCPIILDIP----EYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-NGKPTSKKDVGH 224
           L +CP++L +       ++ VVH GL+P + L  QDPS +MSMR I       S    G 
Sbjct: 341 LDACPVMLKVGFIKHMGEVVVVHGGLIPGIDLESQDPSTVMSMRTIDIFSHVPSASSKGV 400

Query: 225 AWSKHWNAAQ-----QESSSP----------KTIIYGHDASRRLKIKPYSFGLDSGCVYG 269
           +W+K +N  Q        S+P           T++YGHD  R   +K Y+ GLD+GCV G
Sbjct: 401 SWTKLFNKHQTMLAVSRQSAPLGERTQYPAATTVLYGHDPHRSPVLKKYTKGLDTGCVKG 460

Query: 270 GELSALIWNDN 280
           G+LSA++  D 
Sbjct: 461 GKLSAMVIGDG 471



>gi|239612050|gb|EEQ89037.1| Ser/Thr protein phosphatase [Ajellomyces dermatitidis ER-3]
 gi|327352792|gb|EGE81649.1| Ser/Thr protein phosphatase [Ajellomyces dermatitidis ATCC 18188]
          Length = 414

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 107/268 (39%), Positives = 146/268 (54%), Gaps = 30/268 (11%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           ++ LI IGDVHG  DEL +L+ K  +DP   DHLIF G+++AKGPKS  VV L R   AS
Sbjct: 143 KRRLIVIGDVHGCLDELESLLQKAEFDPKNGDHLIFTGNLIAKGPKSTGVVDLARKYRAS 202

Query: 111 CVRGNHDDKVL----QIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVEL 166
           CVRGNH+D+VL     IK      + +    +    +HDI      +    LA+EL  E 
Sbjct: 203 CVRGNHEDRVLLTRRDIKATGPSRNERSSNNEPDQADHDIEPG---NRERALARELSDEQ 259

Query: 167 YNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-NGKPTSKKD 221
             +L +CP+IL +       ++ VVH GL+  V L  QDPS +MSMR I  +    S   
Sbjct: 260 AGWLDACPVILKVGSIKGMGEVVVVHGGLVAGVELESQDPSTVMSMRTIDLSSHIPSASS 319

Query: 222 VGHAWSKHWN------AAQQESSSP---------KTIIYGHDASRRLKIKPYSFGLDSGC 266
            G +W+K +N      A  +ES+S           T+IYG+D  R   ++ Y+ GLD+GC
Sbjct: 320 KGVSWTKLFNKHQSILAVSRESASAGEKDRYSPSTTVIYGNDPRRSPALEKYTKGLDTGC 379

Query: 267 VYGGELSALIWNDN--REIINVKCNKYV 292
           V GG+LSA+I  D     I +VKC  Y 
Sbjct: 380 VKGGKLSAMIIGDGGITRIESVKCKDYT 407



>gi|261202056|ref|XP_002628242.1| ser/Thr protein phosphatase [Ajellomyces dermatitidis SLH14081]
 gi|239590339|gb|EEQ72920.1| ser/Thr protein phosphatase [Ajellomyces dermatitidis SLH14081]
          Length = 408

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 146/265 (55%), Gaps = 30/265 (11%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           ++ LI IGDVHG  DEL +L+ K  +DP   DHLIF G+++AKGPKS  VV L R   AS
Sbjct: 143 KRRLIVIGDVHGCLDELESLLQKAEFDPKNGDHLIFTGNLIAKGPKSTGVVDLARKYRAS 202

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIV-KSEHGLLAKELDVELYNY 169
           CVRGNH+D+VL  +  +      +   +E    +D   DI   +    LA+EL  E   +
Sbjct: 203 CVRGNHEDRVLLTRRDIKATGPSR---NERSSNND---DIEPGNRERALARELSDEQAGW 256

Query: 170 LLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-NGKPTSKKDVGH 224
           L +CP+IL +       ++ VVH GL+  V L  QDPS +MSMR I  +    S    G 
Sbjct: 257 LDACPVILKVGSIKGMGEVVVVHGGLVAGVELESQDPSTVMSMRTIDLSSHIPSASSKGV 316

Query: 225 AWSKHWN------AAQQESSSP---------KTIIYGHDASRRLKIKPYSFGLDSGCVYG 269
           +W+K +N      A  +ES+S           T+IYG+D  R   ++ Y+ GLD+GCV G
Sbjct: 317 SWTKLFNKHQSILAVSRESASAGEKDRYSPSTTVIYGNDPRRSPALEKYTKGLDTGCVKG 376

Query: 270 GELSALIWNDN--REIINVKCNKYV 292
           G+LSA+I  D     I +VKC  Y 
Sbjct: 377 GKLSAMIIGDGGITRIESVKCKDYT 401



>gi|255949616|ref|XP_002565575.1| Pc22g16610 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592592|emb|CAP98949.1| Pc22g16610 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 419

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 152/266 (57%), Gaps = 32/266 (12%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINK--INYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           S+K LI +GDVHG  +EL  L+ K  +N +   DHLIFVGD++ KGP S  VV L R   
Sbjct: 160 SRKRLIIVGDVHGCKEELEQLLEKAAVNQEG-GDHLIFVGDMINKGPDSTGVVDLARQHS 218

Query: 109 ASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHG--LLAKELDVEL 166
           AS VRGNH+D++L ++  +   ++   P D      DI       E G   LA+ L  E 
Sbjct: 219 ASSVRGNHEDRILLLRQEMVKTNTLANPDD------DIDSGFSAKELGERALARSLSDEQ 272

Query: 167 YNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTSKK 220
             +L +CP+IL++ +      + VVHAGL+P + L +QDPS +M+MR I      P+ KK
Sbjct: 273 AQWLENCPVILNVGQVPGMGQVVVVHAGLIPGIELEKQDPSSVMTMRTIDLDTHVPSPKK 332

Query: 221 DVGHAWSKHWNAAQQ------ESSS------PKTIIYGHDASRRLKIKPYSFGLDSGCVY 268
           + G  W+K ++  Q       E+S+        T++YGHDAS  L I+ ++ GLDSGCV 
Sbjct: 333 N-GMNWAKMFDKHQSKLYSSLETSTEDPLADTMTVVYGHDASTSLSIRTFTKGLDSGCVK 391

Query: 269 GGELSALIWNDN--REIINVKCNKYV 292
           GG+L+AL+  D   + ++ V C  Y+
Sbjct: 392 GGKLTALVIEDGGKQSLVQVSCRGYL 417



>gi|449015985|dbj|BAM79387.1| similar to serine/threonine protein phosphatase [Cyanidioschyzon
           merolae strain 10D]
          Length = 577

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 135/238 (56%), Gaps = 25/238 (10%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            +I IGDVHG   EL +L+   +Y P  D LI +GD+VAKGP S  VVQ+ R +GA  VR
Sbjct: 355 RVIAIGDVHGCITELQDLLRVCDYRP-GDELILLGDLVAKGPDSQAVVQMAREIGARAVR 413

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNHD +V++ +  +             ++ HD        +H  +A++L  + + +L SC
Sbjct: 414 GNHDHEVIRCREAM-------------MRGHD--PSYASVDHQRIARQLSQQEHEWLRSC 458

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNA 232
           P  +   + +   VHAG  PDVP  EQ P  +M++R++ +NG P+++   G AW++ W  
Sbjct: 459 PWYIRSEDLETVFVHAGFQPDVPFEEQLPRHMMNLRSVLENGAPSARHSNGMAWARLWKG 518

Query: 233 AQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNK 290
                  P  +++GHDA   L++     GLD+GCVYGG L+AL+  +NR +I+V   K
Sbjct: 519 -------PLRVVFGHDAYMGLQLWDKCIGLDTGCVYGGRLTALLLPENR-LISVPARK 568



>gi|83773483|dbj|BAE63610.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 426

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 150/263 (57%), Gaps = 29/263 (11%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           + LIFIGDVHG  DEL  L+ + +++P  DHLIF GD++ KGP S+ VV L R   ASCV
Sbjct: 170 RRLIFIGDVHGCKDELERLLEETSFNPDTDHLIFTGDMINKGPDSLGVVDLAREYSASCV 229

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
           RG+H+D+VL +++ +   ++     DEF+ + ++ +     E   LA++L  E  ++L +
Sbjct: 230 RGDHEDRVLSLRHNMIAANTMN---DEFLDDANMHRGQYTKERQ-LARQLSEEQADWLDT 285

Query: 173 CPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTSKKDVGHAW 226
           CP++L++ +      + V HAGL+P V L +QDP  +M+M  +      P+S +  G  W
Sbjct: 286 CPVVLNVGQIKDMGQVVVAHAGLVPGVDLDKQDPYSVMNMLTVDLDTHVPSSSRK-GIKW 344

Query: 227 SK---------------HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGE 271
           +K               H    +   S   T+IYGHD+   L +K Y+ G+D+GC  GG+
Sbjct: 345 TKVSYTLCFLRVCNRRLH-ETFENPESMLTTVIYGHDSKSSLSLKTYTKGIDTGCFKGGK 403

Query: 272 LSALIWNDN--REIINVKCNKYV 292
           L+AL+  D   ++ + V+CN + 
Sbjct: 404 LTALVVGDGGKQKTVQVRCNNHT 426



>gi|440635064|gb|ELR04983.1| hypothetical protein GMDG_00240 [Geomyces destructans 20631-21]
          Length = 427

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 161/305 (52%), Gaps = 54/305 (17%)

Query: 36  KPLNYTLINKLEAPLS-----QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDI 90
           K L+++L+ ++  P +     Q  LI IGD+HG   +L  L+ K+++D  +DHL+  GD+
Sbjct: 126 KTLDHSLVPQVGRPGNSNSGLQGRLIVIGDIHGMKSDLERLLAKLDFDSTRDHLVCAGDM 185

Query: 91  VAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQI-----------------------KNIL 127
           ++KGP SI V++L+  LGAS VRGNH+D VL+                        ++  
Sbjct: 186 ISKGPDSIGVLKLLMQLGASAVRGNHEDGVLKAWKKLHAKPGSGAHNSPSRRMVSGRSDA 245

Query: 128 DFLDSQKIPLDEFIKEHDIPKDIV----------KSEHGLLAKELDVELYNYLLSCPIIL 177
           D  D  K P+D  +   D  K ++          K +H  LAK+L  E   +L   P+IL
Sbjct: 246 DLDDKAKGPIDADLD--DKAKGLIEGRRKKHPERKQKHKELAKQLTKEHVKWLKDLPLIL 303

Query: 178 DIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMR--NIKNGKPTSKKDVGHAWSKHWN 231
            + +      L VVHAGL+P + L  QDP  +M++R  N+K  KP S++  G  W+K WN
Sbjct: 304 KVGDIKGMGSLVVVHAGLMPGMKLRRQDPFMVMNIRTINLKKLKP-SERHKGSVWTKLWN 362

Query: 232 AAQQE--SSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNRE-----II 284
             Q     +   T+IYGHD+ R L +  ++ G+D+GC+ GG+L+A +    +      ++
Sbjct: 363 QFQSHLPENERTTVIYGHDSRRGLSLGEFTKGIDTGCLKGGKLTAFVLERGKREVKTSLV 422

Query: 285 NVKCN 289
           +V C 
Sbjct: 423 HVNCR 427



>gi|310817894|ref|YP_003950252.1| bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Stigmatella
           aurantiaca DW4/3-1]
 gi|488688237|ref|WP_002612445.1| metallophosphatase [Stigmatella aurantiaca]
 gi|115369055|gb|EAU67999.1| Ser/Thr protein phosphatase family protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|309390966|gb|ADO68425.1| Bis(5'-nucleosyl)-tetraphosphatase (Asymmetrical) [Stigmatella
           aurantiaca DW4/3-1]
          Length = 220

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 130/239 (54%), Gaps = 26/239 (10%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           +FIGDVHG  +EL  L+    + P  D ++ VGD+VAKGP S  V+   R  G   VRGN
Sbjct: 4   LFIGDVHGCAEELDALLAVCGWQP-GDRVVLVGDLVAKGPDSAGVLARARERGLLAVRGN 62

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD+ VL+                 ++K    P   +K +H  +   L  E + YL S P+
Sbjct: 63  HDEHVLRWHQ-------------GYVK----PGKKLKPQHQQVMDTLAPEDWAYLASLPL 105

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNAAQ 234
            L +PE+++  VHAG+LP VPL  Q    ++++R+I ++G P+ + D G  W+ HW    
Sbjct: 106 YLRLPEFNVVAVHAGMLPGVPLESQHREHLLNLRSITRDGTPSKRVDGGEPWASHWRG-- 163

Query: 235 QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
                P+ +++GHDA R ++  P++ GLDSGCVYGG L+A +  + R         Y+D
Sbjct: 164 -----PELVLFGHDAMRGIQRYPHALGLDSGCVYGGRLTAYVLPEGRFYSVPARRAYMD 217



>gi|154285736|ref|XP_001543663.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150407304|gb|EDN02845.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 505

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 139/251 (55%), Gaps = 32/251 (12%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           +K LI IGDVHG  DEL  L+  +N+DP + DHLIF GD++AKGPKS  VV L R   AS
Sbjct: 248 KKRLIVIGDVHGCLDELETLLQNVNFDPGQGDHLIFTGDLIAKGPKSTGVVDLARKFHAS 307

Query: 111 CVRGNHDDKVLQIKNILDF---LDSQKIPLDEFIK-EHDI-PKDIVKSEHGLLAKELDVE 165
           CVRGNH+D+VL  +  +       S++ P +E  + ++DI P + V++    LA EL  E
Sbjct: 308 CVRGNHEDRVLLTRRHIQAEASTKSERSPAEEPDQIDNDIEPANTVRA----LANELTDE 363

Query: 166 LYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-NGKPTSKKDVGH 224
                   P  +++      VVH GL+P + L  QDPS +MSMR I       S    G 
Sbjct: 364 QETMAGRMPCDVEM------VVHGGLVPGIDLESQDPSTVMSMRTIDIFSHVPSASSKGV 417

Query: 225 AWSKHWNAAQ-----QESSSP----------KTIIYGHDASRRLKIKPYSFGLDSGCVYG 269
           +W+K +N  Q        S+P           T++YGHD  R   +K Y+ GLD+GCV G
Sbjct: 418 SWTKLFNKHQSMLAVSRQSAPLGERAQFPAATTVLYGHDPHRSPVLKKYTKGLDTGCVKG 477

Query: 270 GELSALIWNDN 280
           G+LSA++  D 
Sbjct: 478 GKLSAMVIGDG 488



>gi|392865776|gb|EAS31601.2| hypothetical protein CIMG_11832 [Coccidioides immitis RS]
          Length = 444

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 145/285 (50%), Gaps = 52/285 (18%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           Q+ LIF+GDVHG  DEL +L++K +++   DHLIF G+I+  GPKS+E VQL R   ASC
Sbjct: 166 QRRLIFVGDVHGCKDELDSLLDKASFNRQTDHLIFTGNIITNGPKSVETVQLARKYNASC 225

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHG--------------- 156
           VRGN++D++L  ++ L         L   +     P+   K E G               
Sbjct: 226 VRGNNEDRILLYRHEL---------LTTGVLTGPNPRPNAKFESGGSAFEAGKTKPPEGD 276

Query: 157 ------------LLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQ 200
                       +LA++L  +   +L  CP+IL + +     ++ VVH GL+P V L  Q
Sbjct: 277 QEILPYGDYKEHVLAQKLSDDDAAWLHKCPVILKVGQINDLGEVVVVHGGLVPGVELENQ 336

Query: 201 DPSDIMSMRNIK-NGKPTSKKDVGHAWSKHWNAAQQ---------ESSSPKTIIYGHDAS 250
           DP  +M+MR +  +    S +  G  W+K +N  Q           SS   T+IYGH   
Sbjct: 337 DPLAVMTMRTLDVDTHVPSPRAKGMDWAKIFNKQQSLTVSTSKNPPSSQLTTVIYGHTPH 396

Query: 251 RRLKIKPYSFGLDSGCVYGGELSALIWND--NREIINVKCNKYVD 293
           R   I+ ++ GLD+GCV GG+L+ALI  +     I  V+C  YV 
Sbjct: 397 RSPAIRRFTKGLDTGCVRGGKLTALIITEGGTTRIEQVRCKNYVS 441



>gi|406863807|gb|EKD16854.1| putative ser/Thr protein phosphatase family [Marssonina brunnea f.
           sp. 'multigermtubi' MB_m1]
          Length = 364

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 136/245 (55%), Gaps = 31/245 (12%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            L+ +GDVHG  +EL  L++K+ ++   DHL+  GD+V+KGP S  VV L  SLGA+ VR
Sbjct: 106 RLVVVGDVHGMKEELQALLHKVGFNKKHDHLVLAGDMVSKGPDSPGVVDLAMSLGATGVR 165

Query: 114 GNHDDKVL---------QIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHG-----LLA 159
           GNH+D+++         Q++  L          D+ ++E           HG      L 
Sbjct: 166 GNHEDRIILAAADMKREQVETELPGPSEDSAKKDDALEEESF-------SHGDYNDRRLV 218

Query: 160 KELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGK 215
           K L  +   +L  CP+IL + +     ++ VVHAGL P V L +QDPS +MSMR I  G 
Sbjct: 219 KALGHKRMKWLKECPVILRVGKLGSMGEVVVVHAGLAPGVRLEKQDPSFVMSMRTIGKGG 278

Query: 216 PTSKKDVGHAWSKHWNAAQQESSSPK----TIIYGHDASRRLKIKPYSFGLDSGCVYGGE 271
             S+   G AW+K WN  Q+  + PK    T+I+GHD+ + L++  YS GLD+ C+ G  
Sbjct: 279 VPSEGRKGKAWTKVWNKYQK--TLPKHERTTVIFGHDSKKGLQVDKYSLGLDTSCLKGHR 336

Query: 272 LSALI 276
           L+A++
Sbjct: 337 LTAVV 341



>gi|303320007|ref|XP_003070003.1| calcineurin-like phosphoesterase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240109689|gb|EER27858.1| calcineurin-like phosphoesterase, putative [Coccidioides posadasii
           C735 delta SOWgp]
          Length = 444

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 141/276 (51%), Gaps = 34/276 (12%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           Q+ LIF+GDVHG  DEL +L++K +++   DHLIF G+I+  GPKS+E VQL R   ASC
Sbjct: 166 QRRLIFVGDVHGCKDELDSLLDKASFNRQTDHLIFTGNIITNGPKSVETVQLARKYNASC 225

Query: 112 VRGNHDDKVLQIKNIL----DFLDSQKIPLDEFIKEHD-IPKDIVKSEHG---------- 156
           VRGN++D++L  +  L            P  +F  E         K   G          
Sbjct: 226 VRGNNEDRILLYRRELLTTGVLTGPNPRPNAKFESEGSAFEAGKTKPPEGDQEILPYGDY 285

Query: 157 ---LLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMR 209
              +LA++L  +   +L  CP+IL + +     ++ VVH GL+P V L  QDP  +M+MR
Sbjct: 286 KEHVLAQKLSDDDAAWLHKCPVILKVGQINDLGEVVVVHGGLVPGVELENQDPLAVMTMR 345

Query: 210 NIK-NGKPTSKKDVGHAWSKHWNAAQQ---------ESSSPKTIIYGHDASRRLKIKPYS 259
            +  +    S +  G  W+K +N  Q           SS   T+IYGH   R   I+ ++
Sbjct: 346 TLDVDTHVPSPRAKGMDWAKIFNKQQSLTVSTSKNPPSSQLTTVIYGHTPHRSPAIRRFT 405

Query: 260 FGLDSGCVYGGELSALIWNDN--REIINVKCNKYVD 293
            GLD+GCV GG+L+A I  +     I  V C  YV 
Sbjct: 406 KGLDTGCVRGGKLTAFIITEGGKTRIEQVGCKNYVS 441



>gi|320034342|gb|EFW16287.1| conserved hypothetical protein [Coccidioides posadasii str.
           Silveira]
          Length = 410

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 141/275 (51%), Gaps = 34/275 (12%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           Q+ LIF+GDVHG  DEL +L++K +++   DHLIF G+I+  GPKS+E VQL R   ASC
Sbjct: 132 QRRLIFVGDVHGCKDELDSLLDKASFNRQTDHLIFTGNIITNGPKSVETVQLARKYNASC 191

Query: 112 VRGNHDDKVLQIKNIL----DFLDSQKIPLDEFIKEHD-IPKDIVKSEHG---------- 156
           VRGN++D++L  +  L            P  +F  E         K   G          
Sbjct: 192 VRGNNEDRILLYRRELLTTGVLTGPNPRPNAKFESEGSAFEAGKTKPPEGDQEILPYGDY 251

Query: 157 ---LLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMR 209
              +LA++L  +   +L  CP+IL + +     ++ VVH GL+P V L  QDP  +M+MR
Sbjct: 252 KEHVLAQKLSDDDAAWLHKCPVILKVGQINDLGEVVVVHGGLVPGVELENQDPLAVMTMR 311

Query: 210 NIK-NGKPTSKKDVGHAWSKHWNAAQQ---------ESSSPKTIIYGHDASRRLKIKPYS 259
            +  +    S +  G  W+K +N  Q           SS   T+IYGH   R   I+ ++
Sbjct: 312 TLDVDTHVPSPRAKGMDWAKIFNKQQSLTVSTSKNPPSSQLTTVIYGHTPHRSPAIRRFT 371

Query: 260 FGLDSGCVYGGELSALIWNDN--REIINVKCNKYV 292
            GLD+GCV GG+L+A I  +     I  V C  YV
Sbjct: 372 KGLDTGCVRGGKLTAFIITEGGKTRIEQVGCKNYV 406



>gi|346320360|gb|EGX89961.1| protein phosphatase family protein [Cordyceps militaris CM01]
          Length = 334

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 138/267 (51%), Gaps = 48/267 (17%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYD-PLKDHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           + K LIF+GDVHG  + L+ L++ I +D  + DHL+FVGD+V KG  S  V+ L   LGA
Sbjct: 40  AAKRLIFVGDVHGMREPLVRLLDSIKFDRKMGDHLVFVGDMVNKGNDSPGVIDLAMELGA 99

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKD-------------------- 149
           S VRGNHD+ VL       +   +   L E     D P +                    
Sbjct: 100 SAVRGNHDNAVLDAAGARRYRSGEW--LSEAATRADDPVEASPRTPSSVACEQVAGNAAE 157

Query: 150 -------IVKSEHGLLAKELDVELYNYLLSCPIILDI---PEYD-----LYVVHAGLLPD 194
                   +K+   L A++L      +L S P+IL I    E +     + VVHAGL+P 
Sbjct: 158 SAPHSDTTIKTAAALSARQL-----QWLSSLPLILRIDLRAERNSSLARIVVVHAGLVPG 212

Query: 195 VPLFEQDPSDIMSMRN--IKNGKPTSKKDVGH-AWSKHWNAAQQ--ESSSPKTIIYGHDA 249
           VPL +QDP  +M MR+  ++NG   + +D G   W+  W  AQ+  E      +++GHDA
Sbjct: 213 VPLDQQDPHAMMHMRSLVVENGVFAAAEDEGEEGWAAVWERAQEDLEQQQRTMVVFGHDA 272

Query: 250 SRRLKIKPYSFGLDSGCVYGGELSALI 276
            R L+ + YS GLDSG VYG +LSALI
Sbjct: 273 RRGLQARKYSVGLDSGSVYGNQLSALI 299



>gi|121699388|ref|XP_001268005.1| Ser/Thr protein phosphatase family protein [Aspergillus clavatus
           NRRL 1]
 gi|119396147|gb|EAW06579.1| Ser/Thr protein phosphatase family protein [Aspergillus clavatus
           NRRL 1]
          Length = 333

 Score =  149 bits (377), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 145/280 (51%), Gaps = 48/280 (17%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           ++ L+ +GDVHG    L  L++K+ +D    DHLI VGD+  KGP S  VV L   LGAS
Sbjct: 39  KRRLVIVGDVHGMSKSLQALLDKVAFDQSNGDHLILVGDLFNKGPDSPGVVDLAIKLGAS 98

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEH------------GL- 157
            VRGNHD+ VL     +       +P      E D+P DI +               G+ 
Sbjct: 99  AVRGNHDNAVLDAAAEIKASGGSLLP-----SEADVPGDIARGRQIPGKCASATAGSGMR 153

Query: 158 -------LAKELDVELYNYLLSCPIILDI----------PEYD-LYVVHAGLLPDVPLFE 199
                   A+ L  +  ++L + P+I+ +          P  D L VVHAGL+P +PL E
Sbjct: 154 HSATTYSTARALSTDRLDWLAALPLIVRVKLKLPPSPTSPFGDTLVVVHAGLVPGIPLEE 213

Query: 200 QDPSDIMSMRNI------KNGKPTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRL 253
           QDP  IM +R++        G   ++     +W + W+  Q++ +S  T+I+GHDA RRL
Sbjct: 214 QDPHAIMHLRSLVRAPDDAAGFIPAETSGEESWVQEWDRWQEKQASKTTVIFGHDAKRRL 273

Query: 254 KIKPYSFGLDSGCVYGGELSAL-IWNDNR----EIINVKC 288
           ++  Y+ GLDS C+YG +LSA+ I   +R    +I+ ++C
Sbjct: 274 QLGRYAIGLDSACLYGHQLSAIVIMATDRGIEHQIVQIEC 313



>gi|338531772|ref|YP_004665106.1| putative bis(5'-nucleosyl)-tetraphosphatase, symmetrical
           [Myxococcus fulvus HW-1]
 gi|503703113|ref|WP_013937189.1| metallophosphatase [Myxococcus fulvus]
 gi|337257868|gb|AEI64028.1| putative bis(5'-nucleosyl)-tetraphosphatase, symmetrical
           [Myxococcus fulvus HW-1]
          Length = 221

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 130/239 (54%), Gaps = 26/239 (10%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           +FIGDVHG  +EL  L+ +  + P  D ++ VGD+VAKGP S  VV+  R  G   VRGN
Sbjct: 4   LFIGDVHGCAEELDALLTRCGWRP-DDRVVLVGDLVAKGPDSAGVVRRAREQGFLAVRGN 62

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  VL+         + + P  + +          K EH  +   L  E + +L S P+
Sbjct: 63  HDAHVLR-------WHAGRGPRGKKL----------KPEHQHVLDTLTPEDWAWLESQPL 105

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNAAQ 234
               PE ++  VH GL+P VPL  Q   +++++R+I K+G P+ + D G  W+  W    
Sbjct: 106 YRCFPELNVVAVHGGLVPGVPLEAQKEDELLNLRSIMKDGTPSKRVDAGAPWASLWQG-- 163

Query: 235 QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
                P+ +I+GHDA R L+  P++ GLDSGCVYGG+LSA +  + R +  +    YVD
Sbjct: 164 -----PELVIFGHDAMRGLQRYPHAVGLDSGCVYGGKLSAYVMPEGRLVSVLAKRAYVD 217



>gi|317028185|ref|XP_001390197.2| Ser/Thr protein phosphatase family [Aspergillus niger CBS 513.88]
          Length = 416

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 149/270 (55%), Gaps = 30/270 (11%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           P   + LI +GDV G   EL  L+ ++ +DP  DHLIF G+++++GP S +VV   R   
Sbjct: 150 PEGDERLIVVGDVQGCMAELDRLLEELLFDPTNDHLIFTGNMISQGPNSTDVVDFARKYS 209

Query: 109 ASCVRGNHDDKVLQIK-NILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           ASCVRGN++D+VL ++ N+++         D+++      +   K+E   LA+ L  E  
Sbjct: 210 ASCVRGNNEDRVLVMRHNMIEAQTLTDTSSDQYLDGQSTEQ--AKNERN-LARALSEEQS 266

Query: 168 NYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSM--RNIKNGKPTSKKD 221
            +L +CP+IL++ +      + VVH GL+P V L  QDP  +M+M   ++    P+ ++D
Sbjct: 267 EWLDACPVILNVGQIPTMGQVAVVHGGLIPGVDLNHQDPYSVMNMLTLDLDTHMPSPERD 326

Query: 222 VGHAWSKHWNAAQQE-----------------SSSPKTIIYGHDASRRLKIKPYSFGLDS 264
            G  W+K +N  Q                   ++   T+IYGHD+   L I  Y+ G+D+
Sbjct: 327 -GMMWTKFFNKHQSVSYSSSKSSNNDDDEDAGAAKATTVIYGHDSETGLNINTYTKGIDT 385

Query: 265 GCVYGGELSALIWNDNRE--IINVKCNKYV 292
           GCV GG+L+A + + + E  II V+CN Y+
Sbjct: 386 GCVAGGKLTAFVISASGEQNIIQVRCNNYL 415



>gi|425774481|gb|EKV12787.1| Ser/Thr protein phosphatase family [Penicillium digitatum Pd1]
 gi|425776273|gb|EKV14495.1| Ser/Thr protein phosphatase family [Penicillium digitatum PHI26]
          Length = 318

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 104/289 (35%), Positives = 155/289 (53%), Gaps = 59/289 (20%)

Query: 50  LSQKNLIFIGDVHGSYDE-------------------LLNLINKINYDPLK-DHLIFVGD 89
            S+K LIF+GDVHG  +E                   +++L+ K++++    DHLIFVGD
Sbjct: 39  FSRKRLIFVGDVHGCKEECKKFPLKTSGIPLIDEPTTVVHLLEKVSFNQKGGDHLIFVGD 98

Query: 90  IVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKD 149
           ++ KGP S  VV L R   AS VRGNH+D++L ++        QK+   + +     P D
Sbjct: 99  LINKGPDSAGVVDLAREHSASSVRGNHEDRILLLR--------QKMVKTKTLTS---PDD 147

Query: 150 IVKS-----EHG--LLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLF 198
           +V S     E G   LA+ L  E   +L +CP+IL++        + VVHAGL+P + L 
Sbjct: 148 VVYSGFSSRELGERALARSLSDEQAQWLENCPVILNVGHVPGVGQIVVVHAGLVPGIELE 207

Query: 199 EQDPSDIMSMRNI--KNGKPTSKKDVGHAWSKHWNAAQQ------ESSS------PKTII 244
           +QD S +M+MR I      P+ KK  G  W+K ++  Q       E+S+        T++
Sbjct: 208 KQDLSSVMTMRTIDLDTHVPSPKKK-GTNWAKMFDKHQSKLYSSLETSTEDPLANTMTVV 266

Query: 245 YGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN--REIINVKCNKY 291
           YGHDAS  L I+ ++ GLDSGCV GG+L+AL+  D   + +  V C+ Y
Sbjct: 267 YGHDASTSLSIRTFTKGLDSGCVKGGKLTALVIEDGGKQSLTQVSCHDY 315



>gi|346325542|gb|EGX95139.1| Ser/Thr protein phosphatase family [Cordyceps militaris CM01]
          Length = 435

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/319 (31%), Positives = 156/319 (48%), Gaps = 63/319 (19%)

Query: 27  NYSINTHNFKPLNYTLINKLEAPL-----SQKNLIFIGDVHGSYDELLNLINKINYDPLK 81
           N   + H F  L  T+I +L   L     + + L+ IGD+HG    L  L+  +++DP  
Sbjct: 71  NLQGHRHRFDDL--TMIERLPRHLLPTAANGRRLLIIGDIHGMDAALDRLLAHVDFDPAT 128

Query: 82  DHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLD--SQKIPLDE 139
           DH++  GD++ KGP S  VV  +  LGAS VRGNH+D+VL         D  ++ +P  E
Sbjct: 129 DHIVAAGDMINKGPHSARVVARLMDLGASAVRGNHEDRVLLALASEAEQDEAAESVPFPE 188

Query: 140 FIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFE 199
           F +     +D         A++L      +L   P+IL   E  +YVVHAGL+P +   +
Sbjct: 189 FQERRSKKRDRKT------ARQLSPAQLRWLAERPLILTAEELGMYVVHAGLVPGIRPRK 242

Query: 200 QDPSDIMSMRNI---------------------KNGKPTSK--------KDV-------G 223
           QDP  +M+MR++                     ++G    +        KD+       G
Sbjct: 243 QDPWAVMNMRSLIEPPRHHLAYQAPGQDDGYLHEDGDEEGEDAHASFTLKDLIPVDTHEG 302

Query: 224 HAWSKHWNAAQQESSSPK----TIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI--- 276
             W++ W+  +Q++  PK    T++YGHDA R L +  ++FGLDS CV GGEL+AL+   
Sbjct: 303 REWAELWD--RQQAQIPKAARHTVVYGHDAKRGLTLGKHTFGLDSACVNGGELTALVIHV 360

Query: 277 ---WNDNREIINVKCNKYV 292
               +  R+I  V C +Y 
Sbjct: 361 GKKGHVKRKIRQVPCKRYA 379



>gi|340053930|emb|CCC48223.1| putative kinetoplastid-specific phospho-protein phosphatase
           [Trypanosoma vivax Y486]
          Length = 664

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 135/248 (54%), Gaps = 36/248 (14%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
           AP  +   I +GDVHG  ++L  L+ K+N+   +D LI VGD+V KGP S+ VVQL++ L
Sbjct: 192 APPCEHRYIIVGDVHGCPEQLEQLLLKVNFKQGEDCLIHVGDLVNKGPDSLAVVQLVQRL 251

Query: 108 GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           G   V GNHD  +L   N +  +       +   K+ D+   +++     LA     E  
Sbjct: 252 GGIGVLGNHDYTLL---NCIARVR------EGHCKQRDVSDPVMR-----LASTFPRECE 297

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMR-----------NIKNGKP 216
            YL S P IL IP+Y++ VVHAGL   +PL EQ+  +IM +R            ++ GKP
Sbjct: 298 EYLRSLPHILRIPQYNVLVVHAGLNVGLPLEEQNVHEIMHLRRLEQMEEKKHKQLQGGKP 357

Query: 217 TSKKDV----GHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGEL 272
             +  V    G  W   WN        P+ +++GHDA   L+  P+++GLD+GCVYGG+L
Sbjct: 358 RWRAVVKGTRGEPWGTLWNG-------PECVVFGHDARAGLQELPFAYGLDTGCVYGGDL 410

Query: 273 SALIWNDN 280
           +A+++  +
Sbjct: 411 TAVVYGRD 418



>gi|350632754|gb|EHA21121.1| hypothetical protein ASPNIDRAFT_214619 [Aspergillus niger ATCC
           1015]
          Length = 416

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 149/270 (55%), Gaps = 30/270 (11%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           P   + LI +GDV G   EL  L+ ++ +DP  DHLIF G+++++GP S +VV   R   
Sbjct: 150 PEGDERLIVVGDVQGCMAELDRLLEELLFDPTNDHLIFTGNMISQGPNSTDVVDFARKYS 209

Query: 109 ASCVRGNHDDKVLQIK-NILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           ASCVRGN++D+VL ++ N+++         D+++      +   ++E   LA+ L  E  
Sbjct: 210 ASCVRGNNEDRVLVMRHNMIEAQTLTDTSSDQYLDGQSTEQ--ARNERN-LARALSDEQS 266

Query: 168 NYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSM--RNIKNGKPTSKKD 221
            +L +CP+IL++ +      + VVH GL+P V L  QDP  +M+M   ++    P+ ++D
Sbjct: 267 EWLDACPVILNVGQIPTMGQVAVVHGGLIPGVDLNHQDPYSVMNMLTLDLDTHMPSPERD 326

Query: 222 VGHAWSKHWNAAQQE-----------------SSSPKTIIYGHDASRRLKIKPYSFGLDS 264
            G  W+K +N  Q                   ++   T+IYGHD+   L I  Y+ G+D+
Sbjct: 327 -GMMWTKFFNKHQSVSYSSSKSSNNDDDEDAGAAKATTVIYGHDSETGLNINTYTKGIDT 385

Query: 265 GCVYGGELSALIWNDNRE--IINVKCNKYV 292
           GCV GG+L+A + + + E  II V+CN Y+
Sbjct: 386 GCVAGGKLTAFVISASGEQNIIQVRCNNYL 415



>gi|442324690|ref|YP_007364711.1| bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Myxococcus
           stipitatus DSM 14675]
 gi|505166178|ref|WP_015353280.1| bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Myxococcus
           stipitatus]
 gi|441492332|gb|AGC49027.1| bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Myxococcus
           stipitatus DSM 14675]
          Length = 222

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 134/236 (56%), Gaps = 27/236 (11%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           +FIGDVHG   EL  L+   ++ P+ D ++ VGD+VAKGP S  VV+  R  G   VRGN
Sbjct: 4   LFIGDVHGCAAELDALLEACDWRPV-DRVVLVGDLVAKGPDSAGVVRRAREQGMLAVRGN 62

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  VL+  +       Q     +  KEH   + ++++        L  E + YL + P+
Sbjct: 63  HDAHVLRWHH------GQAPEGKKLSKEH---RQVLET--------LTPEDWAYLEAQPL 105

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-NGKPTSKKDVGHAWSKHWNAAQ 234
               PE ++  VH G++P +PL  Q P +++++R+I  +G P+ + D G  W+  W    
Sbjct: 106 FRRFPELNVLAVHGGVVPGIPLAAQRPEELLNLRSIAPDGTPSKRVDGGVPWASCWE--- 162

Query: 235 QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNK 290
                P+ I++GHDA R ++  P++ GLDSGCVYGG+L+AL+  + R +++V+  +
Sbjct: 163 ----GPEFIVFGHDAVRGVQRHPHAMGLDSGCVYGGDLTALVMPERR-LVSVRAKR 213



>gi|149235746|ref|XP_001523751.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452730|gb|EDK46986.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 348

 Score =  147 bits (371), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 136/268 (50%), Gaps = 22/268 (8%)

Query: 41  TLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEV 100
           TL  + + P   K LIF+GD+HG+Y E   L++K+ Y+   D L+ +GD V KGP SI+ 
Sbjct: 83  TLYTEFDDPF--KRLIFVGDIHGNYMEFTKLLHKVKYNSELDKLVVLGDFVTKGPDSIKT 140

Query: 101 VQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEH-----DIPKDIVKSEH 155
           +  +      C+ GNH+ + L+       LD+      +   ++      I +DI  ++ 
Sbjct: 141 LDYLVKHNVQCIMGNHEFETLKFYTQFHHLDAPTFSNTDSANKYKFLPASITQDITFNDD 200

Query: 156 GLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGK 215
             LAK+L  E   Y+ SCP+IL  P+ ++  VH GL PD+ L EQDP D + MR +    
Sbjct: 201 FRLAKKLQPEHVKYINSCPVILHFPKLEIVAVHGGLRPDLTLAEQDPLDNLDMRALIGPF 260

Query: 216 PTSKKDVGHA-----WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGG 270
                D  H      W K +N A     +   + YGHDA + L ++ ++ GLDSGC  G 
Sbjct: 261 FNETTDDPHTPNSVRWYKLYNKADGAVPANNIVYYGHDAGKGLNLRKFTKGLDSGCNKGK 320

Query: 271 ELSALIWNDNR----------EIINVKC 288
           +LSA+I    +          E++ V+C
Sbjct: 321 KLSAMIVTGEKRKNGKIELLEELVQVQC 348



>gi|488710038|ref|WP_002633932.1| metallophosphatase [Chondromyces apiculatus]
 gi|397093113|gb|EJJ23845.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Myxococcus sp.
           (contaminant ex DSM 436)]
          Length = 221

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 131/239 (54%), Gaps = 26/239 (10%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           +FIGDVHG  +EL  L+ + ++ P  D ++ VGD+VAKGP S  VV+  R  G   VRGN
Sbjct: 4   LFIGDVHGCAEELDALLARCDWQP-GDRVVLVGDLVAKGPDSAGVVRRARERGFLAVRGN 62

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  VL+         + + P  + +          K EH  +   L  E + +L + P+
Sbjct: 63  HDAHVLR-------WHAGRAPRGKKL----------KPEHQQVLDTLTPEDWAWLEAQPL 105

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNAAQ 234
               PE ++  VH GL+P VPL  Q   +++++R+I  +G P+ + D G  W+  W    
Sbjct: 106 YRCFPELNVVAVHGGLVPGVPLEAQKEDELLNLRSILPDGTPSKRVDAGAPWASLW---- 161

Query: 235 QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
              + P+ +I+GHDA R ++  P++ GLDSGCVYGG+L+A +  + R +  +    YVD
Sbjct: 162 ---TGPELVIFGHDAMRGIQRHPHAVGLDSGCVYGGKLTAYVMPEGRLVSVLARRAYVD 217



>gi|108762083|ref|YP_635276.1| bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Myxococcus xanthus
           DK 1622]
 gi|499876348|ref|WP_011557082.1| metallophosphatase [Myxococcus xanthus]
 gi|108465963|gb|ABF91148.1| putative bis(5'-nucleosyl)-tetraphosphatase, symmetrical
           [Myxococcus xanthus DK 1622]
          Length = 221

 Score =  146 bits (368), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 129/239 (53%), Gaps = 26/239 (10%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           +FIGDVHG  +EL  L+ +  + P  D ++ VGD+VAKGP S  VV+  R  G   VRGN
Sbjct: 4   LFIGDVHGCAEELDALLTQCAWQP-DDRVVLVGDLVAKGPDSAGVVRRAREQGFLAVRGN 62

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  VL+         + + P  + +          K EH  +   L  E + +L S P+
Sbjct: 63  HDAHVLR-------WHAGRGPRGKKL----------KPEHQQVLDTLTPEDWAWLESQPL 105

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNAAQ 234
               PE ++  VH GL+P VPL  Q   +++++R+I  +G P+ + D G  W+  W    
Sbjct: 106 YRFFPELNVVAVHGGLVPGVPLEAQKEDELLNLRSILPDGTPSKRVDAGAPWASLWQG-- 163

Query: 235 QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
                P+ +I+GHDA R ++  P++ GLDSGCVYGG+LSA +  + R +  +    YVD
Sbjct: 164 -----PELVIFGHDAMRGIQRHPHAVGLDSGCVYGGKLSAYVMPEGRIVSVLAKRAYVD 217



>gi|488705408|ref|WP_002629377.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cystobacter
           fuscus]
 gi|444711558|gb|ELW52497.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cystobacter fuscus
           DSM 2262]
          Length = 221

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 88/240 (36%), Positives = 131/240 (54%), Gaps = 28/240 (11%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           +FIGDVHG  +EL  L+ +  + P  D ++ VGD+VAKGP S  VV+  R  G   VRGN
Sbjct: 5   LFIGDVHGCAEELDALLEECGHRP-GDRVVLVGDLVAKGPDSAGVVRRARERGMLAVRGN 63

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPK-DIVKSEHGLLAKELDVELYNYLLSCP 174
           HD+ VL+                    +  +PK   +K EH  +   L    + YL S P
Sbjct: 64  HDEHVLRWH------------------KGQMPKHKKLKPEHKQVLDTLTDADWAYLESRP 105

Query: 175 IILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKN-GKPTSKKDVGHAWSKHWNAA 233
           + L  PE+++ VVH GL+P VPL +Q+P  ++++R+I + G+P+ K + G  W+  W   
Sbjct: 106 LHLPFPEFNVRVVHGGLVPGVPLEKQEPELMINLRSITSEGEPSKKLEAGVPWASLWRG- 164

Query: 234 QQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
                 P+ II+GHDA R ++  P++ GLDSGCVYG  L+A +  + R         Y+D
Sbjct: 165 ------PEFIIFGHDALRGVQRHPHAIGLDSGCVYGRRLTAYVLPEARFYSVAAKRTYLD 218



>gi|212537963|ref|XP_002149137.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
 gi|210068879|gb|EEA22970.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
          Length = 342

 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 144/261 (55%), Gaps = 34/261 (13%)

Query: 50  LSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
             ++ L+FIGDVHG +DEL  L+ KI+    +DHLIF GD++ KGP+S +VV L R LGA
Sbjct: 98  FRRRRLVFIGDVHGCFDELEELLRKISLTR-RDHLIFTGDMINKGPQSGKVVDLARQLGA 156

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
           SCV+GNH+D++L I+     L S+ I     +  +D+P          LA+ L  +   +
Sbjct: 157 SCVQGNHEDRILLIRTD---LQSRGILDSGSVNAYDLPAYDWNDRQ--LARSLADDQAAW 211

Query: 170 LLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVGHA 225
           L  CP IL I +     ++ VVH GL P VPL +Q+ + +MS       K T  +     
Sbjct: 212 LQECPAILKIGQVKDMGEVVVVHGGLHPAVPLEQQELTSVMST------KTTFYR--AFP 263

Query: 226 WSKHWNAAQ----QESSSP-------KTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSA 274
           W + +N       Q S  P        T+IYG    +  +I+ Y+ GL+SGCV+GG+L+A
Sbjct: 264 WFRVYNQLNMLLLQGSIVPAPPYTNLTTVIYG---GQSFEIRQYTKGLNSGCVHGGDLTA 320

Query: 275 LIWNDN--REIINVKCNKYVD 293
           LI  D    +++ V+C K+V 
Sbjct: 321 LIIEDGGKSQVVQVRCKKHVQ 341



>gi|340055816|emb|CCC50137.1| putative diadenosine tetraphosphatase [Trypanosoma vivax Y486]
          Length = 254

 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 133/258 (51%), Gaps = 42/258 (16%)

Query: 39  NYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSI 98
            Y  +  L AP  +  +I +GD+HG   +L  L+  +++    D L+ VGD+V KGP S 
Sbjct: 5   TYARVQSLNAPAGR--VIIVGDIHGCRAQLEELLRTVSFSRETDTLVAVGDLVNKGPDSF 62

Query: 99  EVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGL- 157
            VV+L+R LGA  V GNHD  ++ +               E +K H  P D+   E    
Sbjct: 63  GVVRLLRHLGAYSVLGNHDCMLMNVA--------------EMLKTHRPPADVSGYELLFS 108

Query: 158 LAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRN-IKNGKP 216
           LA  +  ++  YL   P IL IP Y+L VVHAGL P  PL +Q   ++ +MRN I+ GK 
Sbjct: 109 LAASIPPDVMLYLKELPHILRIPAYNLIVVHAGLHPQRPLEKQLVEEVTTMRNFIEKGKR 168

Query: 217 TSKK---------------DVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIK--PYS 259
           + ++               D G  W+  W         P+ ++YGHDA R L+ K  P++
Sbjct: 169 SGERGVTGAEVTLTTSNETDSGVPWASLWRG-------PEMVVYGHDARRGLQTKFMPHA 221

Query: 260 FGLDSGCVYGGELSALIW 277
            GLDSGC  GG+LSA+++
Sbjct: 222 LGLDSGCAGGGQLSAVVF 239



>gi|119473369|ref|XP_001258584.1| Ser/Thr protein phosphatase family protein [Neosartorya fischeri
           NRRL 181]
 gi|119406736|gb|EAW16687.1| Ser/Thr protein phosphatase family protein [Neosartorya fischeri
           NRRL 181]
          Length = 434

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 147/290 (50%), Gaps = 50/290 (17%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRS 106
            P+S++ L+ +GDVHG    L  L++K+ ++    DHLI  GD+V+KGP S  VV L   
Sbjct: 36  GPVSRR-LVIVGDVHGMRKSLEALLDKVGFEKRNGDHLILAGDLVSKGPDSPGVVDLAMK 94

Query: 107 LGASCVRGNHDDKVL----QIKNILDFL-------DSQKIP-------LDEFIKEHDIPK 148
           LGA+ VRGNHD+ V+    +I+   D L        S  +P       L   +++ ++P 
Sbjct: 95  LGATAVRGNHDNAVINAAAEIRATKDSLLQSGGLTGSPALPETPEADVLGNTVQDPEVPD 154

Query: 149 DIVKSEHG----------LLAKELDVELYNYLLSCPIILDI---PEYD------LYVVHA 189
               +  G            A  L     ++L + P+IL I   P         L VVHA
Sbjct: 155 KDASATTGASRKHSAATYTTASALSTRQLDWLAALPLILRIKLPPNLTSSFGDTLIVVHA 214

Query: 190 GLLPDVPLFEQDPSDIMSMRNI--KNGKPTSKKDVG----HAWSKHWNAAQQESSSPKTI 243
           GL+P +PL  QDP  IM MR++   +G+ +  K         W+  W+  Q + +S  T+
Sbjct: 215 GLVPGIPLEAQDPHAIMHMRSLVRTSGEESEFKPAETFGEEGWAMEWDRWQDKLASKTTV 274

Query: 244 IYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWND-----NREIINVKC 288
           I+GHDA RRL++  Y+ GLDS C+YG  LSAL+          ++I V+C
Sbjct: 275 IFGHDAKRRLQLGRYTIGLDSACLYGHRLSALVITGCDGEIKHQVIQVEC 324



>gi|50554771|ref|XP_504794.1| YALI0E34947p [Yarrowia lipolytica]
 gi|49650663|emb|CAG80401.1| YALI0E34947p [Yarrowia lipolytica CLIB122]
          Length = 341

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 97/258 (37%), Positives = 140/258 (54%), Gaps = 25/258 (9%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI +GD+HGS+ +L +L++K +Y+  KD L F+GD ++KG  S  VV       A CVR
Sbjct: 86  RLILVGDIHGSFKQLKHLLDKADYNKKKDQLFFLGDFISKGKDSEGVVDFAIKHNALCVR 145

Query: 114 GNHDDKVLQIKNILDFLDSQ---KIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYL 170
           GNH+DK++        L  Q   K P    I   D P +I+  E   LA++   E   Y+
Sbjct: 146 GNHEDKLVNAYEKYHHLHHQKTLKTPGGHHITR-DAPANILADEDD-LAEDFTAEQMKYI 203

Query: 171 LSCPIIL---DIPEYD--LYVVHAGLLPDVPLFE-QDPSDIMSMRNIKNGKPT--SKKDV 222
            SCP I+   DI E       VHAGL+ +VP  E QDP  +M MR++   + T  ++ D 
Sbjct: 204 ASCPAIMRLGDIAETGNLAVAVHAGLMWNVPRLEDQDPDAVMRMRSLLPPRDTVYTEDDD 263

Query: 223 GHAWSKHWNAAQQESSSPK----TIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
           G  W + WN   ++   PK    TI YGHDA + L++  Y+ GLDSGCV GG+L+A+I  
Sbjct: 264 GVPWFEVWNDKIED--RPKKDRMTIFYGHDARQGLQLTKYTRGLDSGCVKGGKLNAMIIT 321

Query: 279 DNR------EIINVKCNK 290
             +      E++ V C +
Sbjct: 322 QKKNGKFDEELVRVSCKE 339



>gi|322707778|gb|EFY99356.1| Ser/Thr protein phosphatase family protein [Metarhizium anisopliae
           ARSEF 23]
          Length = 304

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 129/259 (49%), Gaps = 17/259 (6%)

Query: 50  LSQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           +S + LI IGDVHG    L  L+  + +D  + D +IFVGD+V KGP S  V+     +G
Sbjct: 43  ISARRLIIIGDVHGLRKSLEALLTAVGFDKSQGDEVIFVGDLVNKGPDSGAVIDFAARIG 102

Query: 109 ASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYN 168
           A  VRGNHDD VL+    L    +     D         K   +S     A  L     +
Sbjct: 103 ARGVRGNHDDAVLRAAQRLKMGPAGDDDDDGEDGNQKDKKR--RSVSARTAAALSASQLD 160

Query: 169 YLLSCPIILDIPEY-------DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK---NGKPTS 218
           YL + P++L +          ++ V HAGL+P VPL EQ    +M MR+++    G    
Sbjct: 161 YLAALPLLLRVTVTPSLPGIGEIVVAHAGLVPRVPLEEQPAHAVMHMRSLRAAEGGALVP 220

Query: 219 KKDVG-HAWSKHWNAAQQESSS--PKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSA- 274
            ++ G   W   W+A Q E +      +++GHDA RRL+   Y+ GLD+ CVYGG+LSA 
Sbjct: 221 MEEAGEQGWIAEWDAWQDECAGNVKTMVVFGHDAKRRLQRGRYALGLDTACVYGGKLSAW 280

Query: 275 LIWNDNREIINVKCNKYVD 293
           ++      ++ V C   VD
Sbjct: 281 VVGAGEARVVQVDCADEVD 299



>gi|358375833|dbj|GAA92409.1| Ser/Thr protein phosphatase family [Aspergillus kawachii IFO 4308]
          Length = 421

 Score =  144 bits (362), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 144/262 (54%), Gaps = 32/262 (12%)

Query: 49  PLSQKNLIFIGDVHGSYDELL----NLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLI 104
           P  ++ LI +GDV G   E L     L+ ++ +DP+ DHLIF G+++++GP S +VV   
Sbjct: 150 PEGEERLIVVGDVQGCIAEYLLIVDRLLEELLFDPINDHLIFTGNMISQGPNSTDVVDFA 209

Query: 105 RSLGASCVRGNHDDKVLQIK-NILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELD 163
           R   ASCVRGN++D+VL ++ N+++         D+++      +   K+E   LA+ L 
Sbjct: 210 RKYSASCVRGNNEDRVLVMRHNMIEAQTLTDTSSDQYLDGQSTEQ--AKNERD-LARALS 266

Query: 164 VELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPT 217
            E  ++L +CP+IL++ +      + VVH GL+P V L  QDP  +M+M  I      P+
Sbjct: 267 DEQADWLDACPVILNVGQIPTMGQVAVVHGGLIPGVDLNHQDPYSVMNMLTIDLDTHMPS 326

Query: 218 SKKDVGHAWSKHWNAAQ-----QESSSPK------------TIIYGHDASRRLKIKPYSF 260
            ++D G  W+K +N  Q        SS K            T+IYGHD+   L I  Y+ 
Sbjct: 327 PERD-GMMWTKFFNKHQSVGYASSKSSNKDDDEDAGAVKATTVIYGHDSETALNINTYTK 385

Query: 261 GLDSGCVYGGELSALIWNDNRE 282
           G+D+GCV GG+L+A + + + E
Sbjct: 386 GIDTGCVAGGKLTAFVISSSGE 407



>gi|322700426|gb|EFY92181.1| Ser/Thr protein phosphatase family protein [Metarhizium acridum
           CQMa 102]
          Length = 319

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 92/266 (34%), Positives = 132/266 (49%), Gaps = 22/266 (8%)

Query: 50  LSQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           +S + LI IGDVHG    L  L++ + +D  + D +IFVGD+V+KGP S  V+     +G
Sbjct: 49  ISARRLIIIGDVHGLRKSLEALLDAVGFDKSQGDEVIFVGDLVSKGPDSGAVIDFAGRIG 108

Query: 109 ASCVRGNHDDKVLQIKNILDF--------LDSQKIPLDEFIKE--HDIPKDIVKSEHGLL 158
           A  VRGNHDD VL+    L           D       E   E      +   +S     
Sbjct: 109 ARGVRGNHDDAVLRAAQRLKMGAGHDCHDDDDDNDGAAEGAGEDRGGKKEKKKRSVSART 168

Query: 159 AKELDVELYNYLLSCPIILDIPEY-------DLYVVHAGLLPDVPLFEQDPSDIMSMRNI 211
           A  L      YL S P+++ I           + VVHAGL+P VPL EQ    +M MR++
Sbjct: 169 AAALSDSQLEYLASLPLMVRITATPSLPGIEQIVVVHAGLVPRVPLEEQPAHAVMHMRSL 228

Query: 212 K--NGKPTSKKDVG-HAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVY 268
           +   G     ++ G   W   W+A Q+E +    +++GHDA RRL+   Y+ GLD+ CVY
Sbjct: 229 RAVEGCLVPLEEAGERGWIVEWDAWQEECAGKTMVVFGHDAKRRLQRGKYALGLDTACVY 288

Query: 269 GGELSA-LIWNDNREIINVKCNKYVD 293
           GG+LSA ++      ++ V C   VD
Sbjct: 289 GGKLSAWVVEAGEARVVQVDCADEVD 314



>gi|397628792|gb|EJK69055.1| hypothetical protein THAOC_09729 [Thalassiosira oceanica]
          Length = 971

 Score =  143 bits (360), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 88/242 (36%), Positives = 135/242 (55%), Gaps = 25/242 (10%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
           A  +Q  +I IGDVHG  DEL  L+ K NY P  D ++F+GD+V KGP S+ VV++ R +
Sbjct: 741 AKQTQPRVIVIGDVHGCIDELQELLKKCNYSP-GDLVLFLGDLVCKGPDSLSVVKMAREI 799

Query: 108 GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           GA  VRGNHD +V++      +  ++K   D           ++ SEH  ++  LD    
Sbjct: 800 GAIGVRGNHDFEVVR------WHQARKSGAD---------PPVIGSEHFYVSSSLDTADL 844

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAW 226
            +L S P  +     +   VHAG +  + L +Q+P  +M+MR+I  +G  TSK      W
Sbjct: 845 KWLYSLPWYITSASLNSLFVHAGFVSGIRLAKQNPRLMMNMRSILPDGTVTSKFFNNWPW 904

Query: 227 SKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREI-IN 285
           ++ W+        P+T+ +GHDA R L+   ++ GLD+GCVYGG+L+A I  + R + +N
Sbjct: 905 ARLWDG-------PQTVFFGHDADRGLQQHDHAIGLDTGCVYGGKLTACILPERRLVSVN 957

Query: 286 VK 287
            K
Sbjct: 958 AK 959



>gi|238497371|ref|XP_002379921.1| aflYe/ orf/ Ser -Thr protein phosphatase family protein
           [Aspergillus flavus NRRL3357]
 gi|220694801|gb|EED51145.1| aflYe/ orf/ Ser -Thr protein phosphatase family protein
           [Aspergillus flavus NRRL3357]
          Length = 335

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 148/308 (48%), Gaps = 57/308 (18%)

Query: 34  NFKPLNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVA 92
           N  P  ++   + E   + + L+ +GDVHG    L  L+ K+ +D  K DHLIFVGD+V 
Sbjct: 23  NLTPQLFSSSAENEPTSAGRRLVIVGDVHGMKKSLDALLEKVCFDKGKGDHLIFVGDLVN 82

Query: 93  KGPKSIEVVQLIRSLGASCVRGNHDDKVL----QIKNILDFL--------DSQKIPLDEF 140
           KGP S  V+     LGAS VRGNHD+ VL    +IK   D L         S K+P D  
Sbjct: 83  KGPDSPGVIDRAVELGASAVRGNHDNAVLDAAVEIKARGDNLMHAGGITSGSAKLPEDSG 142

Query: 141 IKEHDIPKDIVK---------------SEHGLL----AKELDVELYNYLLSCPIILDIP- 180
               ++P + V                + H       A+ L     ++L   P+IL I  
Sbjct: 143 A---ELPSETVACDGPETSASPNASPLTRHSATTYSTARALSTRHLDWLAGLPLILRIKL 199

Query: 181 --------EYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDV-------GHA 225
                   +  L VVHAGL P +PL +QDP  +M MR++ +  P  ++ +          
Sbjct: 200 PYHLTSSLDDTLVVVHAGLTPGIPLEKQDPHAVMHMRSLTHA-PGDERTLIPAEASGEEG 258

Query: 226 WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN----- 280
           W   W+  Q + ++  T+I+GHDA RRL++  ++ GLDS C+YG  LSAL+         
Sbjct: 259 WVAQWDQWQDQLTTRTTVIFGHDAKRRLQLGRHTIGLDSACLYGHHLSALVIESTDRGIE 318

Query: 281 REIINVKC 288
             I+ V+C
Sbjct: 319 HRIVQVEC 326



>gi|169774141|ref|XP_001821538.1| Ser/Thr protein phosphatase family protein [Aspergillus oryzae
           RIB40]
 gi|83769401|dbj|BAE59536.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391872201|gb|EIT81337.1| Ser/Thr protein phosphatase family protein [Aspergillus oryzae
           3.042]
          Length = 335

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 148/308 (48%), Gaps = 57/308 (18%)

Query: 34  NFKPLNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVA 92
           N  P  ++   + E   + + L+ +GDVHG    L  L+ K+ +D  K DHLIFVGD+V 
Sbjct: 23  NLTPQLFSSSAENEPRSAGRRLVIVGDVHGMKKSLDALLEKVCFDKGKGDHLIFVGDLVN 82

Query: 93  KGPKSIEVVQLIRSLGASCVRGNHDDKVL----QIKNILDFL--------DSQKIPLDEF 140
           KGP S  V+     LGAS VRGNHD+ VL    +IK   D L         S K+P D  
Sbjct: 83  KGPDSPGVIDRAVELGASAVRGNHDNAVLDAAVEIKARGDNLMHAGGITSGSAKLPEDSG 142

Query: 141 IKEHDIPKDIVK---------------SEHGLL----AKELDVELYNYLLSCPIILDIP- 180
               ++P + V                + H       A+ L     ++L   P+IL I  
Sbjct: 143 A---ELPSETVACDGPETSASPNASPLTRHSATTYSTARALSTRHLDWLAGLPLILRIKL 199

Query: 181 --------EYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDV-------GHA 225
                   +  L VVHAGL P +PL +QDP  +M MR++ +  P  ++ +          
Sbjct: 200 PYHLTSSLDDTLVVVHAGLTPGIPLEKQDPHAVMHMRSLTHA-PGDERTLIPAEASGEEG 258

Query: 226 WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN----- 280
           W   W+  Q + ++  T+I+GHDA RRL++  ++ GLDS C+YG  LSAL+         
Sbjct: 259 WVAQWDQWQDQLTTRTTVIFGHDAKRRLQLGRHTIGLDSACLYGHHLSALVIESTDRGIE 318

Query: 281 REIINVKC 288
             I+ V+C
Sbjct: 319 HRIVQVEC 326



>gi|449303246|gb|EMC99254.1| hypothetical protein BAUCODRAFT_573541 [Baudoinia compniacensis
           UAMH 10762]
          Length = 310

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 143/291 (49%), Gaps = 34/291 (11%)

Query: 34  NFKPLNYTLI-NKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVA 92
            F+ L  +L+   +  P  ++ L+F+GD+HG   EL  L+  + +D  +DHLI  GD+V+
Sbjct: 19  RFRGLAPSLLPGGVSDPNGERRLVFVGDIHGCKGELSALLRAVGFDTRRDHLIATGDVVS 78

Query: 93  KGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVK 152
           KGP S+ V+ L+  LGA  VRGNH+D++L+    L    S+ +P      E         
Sbjct: 79  KGPDSLGVLDLLIQLGAESVRGNHEDRLLETYKTLR-KSSETLPDTASQVESAATTSHGY 137

Query: 153 SEHGLLAKELDVELYNYLLSCPIILDIPE-------------YDLYVVHAGLLPDVPLFE 199
            +  +L +++      YL   P++L IP              + + V HAG++P V L  
Sbjct: 138 HKDAVLLRQMKPAHLKYLREMPLMLRIPSLPQVAASTSEYVNHAVLVAHAGIVPHVSLER 197

Query: 200 QDPSDIMSMRNIKNGK--PTSK-----KDVGHAWSKHWNAAQQE----------SSSPKT 242
           QDP  +M+MR I      P S+     KD    W   W+  Q               P  
Sbjct: 198 QDPYFVMNMRTIDRETHLPCSQPVEGPKDTKVRWFILWDTYQTRLLNANNINVPLVEPMV 257

Query: 243 IIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN--DNREIINVKCNKY 291
           ++YGHD+ + L++  +S GLDS CV GG L+A++ +     ++ +V C +Y
Sbjct: 258 VVYGHDSKQGLQLHQWSRGLDSACVAGGRLTAMVLDAKGKEDMFSVPCQEY 308



>gi|422295477|gb|EKU22776.1| serine threonine protein, partial [Nannochloropsis gaditana
           CCMP526]
          Length = 947

 Score =  141 bits (355), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 85/236 (36%), Positives = 132/236 (55%), Gaps = 26/236 (11%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           +  +I IGDVHG  +EL  LI K+ Y P  D L+F+GD+VAKGP SI V++L R +GA  
Sbjct: 670 EPKIIVIGDVHGCVEELRALIKKVEYSP-GDLLVFLGDMVAKGPDSIPVIRLAREVGALS 728

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLL 171
           VRGNH+++V++    L  L +Q                  KSEH L+A  L+     +L 
Sbjct: 729 VRGNHENEVIRWSRALA-LGAQS---------------NFKSEHYLIAMGLEDADVEWLR 772

Query: 172 SCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHW 230
           + P  +   +  L  VHAG + D  L +Q P  +++MR+I  +G  +++    + W++ W
Sbjct: 773 NLPWYISCSDLQLLFVHAGFVADQRLSKQHPRFMINMRSILADGTVSARYYQDYPWARTW 832

Query: 231 NAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINV 286
                    P+T+++GHDA R ++    + GLD+GCVYGG L+A I    +E++ V
Sbjct: 833 QG-------PQTVLFGHDARRGMQEYEQALGLDTGCVYGGNLTACIL-PGKELVQV 880



>gi|291242239|ref|XP_002741006.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
          Length = 275

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 128/237 (54%), Gaps = 33/237 (13%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL-GASC 111
           K ++ IGDVHG YDEL  +++          ++FVGD+V KGPKS EVV L+RS+  A  
Sbjct: 44  KRIVIIGDVHGCYDELQEMLDLTGARRNDTVVLFVGDLVNKGPKSKEVVNLVRSMKNAQS 103

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLL 171
           VRGNHD+ VL+                E+         +++ ++  +    D    ++L 
Sbjct: 104 VRGNHDEAVLR----------------EYANREKDSNHVLRDKYEWITAS-DKSERDFLT 146

Query: 172 SCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-------KNG-KPTSKKDVG 223
           + P  + +P  ++ +VHAGL+P   L +Q   D+++MRN         NG + TS  DVG
Sbjct: 147 NLPYTITVPSRNILIVHAGLVPGKQLLQQKTQDMVTMRNAFFTDYFDGNGWQGTSSGDVG 206

Query: 224 HAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN 280
           + W+  W       + P  + +GHDA R+L++  Y+ GLD+GCVYGG L+A + + N
Sbjct: 207 YPWASLW-------TGPHHVYFGHDAKRKLQLYDYATGLDTGCVYGGCLTAAVLDPN 256



>gi|219111785|ref|XP_002177644.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217410529|gb|EEC50458.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 1225

 Score =  140 bits (354), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 134/248 (54%), Gaps = 25/248 (10%)

Query: 48   APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
            A   Q  +I IGDVHG  DEL +L+ + +Y P  D ++F+GD+V KGP SI VVQ+ R +
Sbjct: 907  AKQRQPRVIAIGDVHGCIDELQDLLRQCDYRP-GDLVVFLGDLVCKGPDSISVVQMAREI 965

Query: 108  GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
            GA  VRGNHD +V++    +               +  +   +V SEH  +A  L     
Sbjct: 966  GAFGVRGNHDFEVIRWHQAI---------------KSGVDPPVVGSEHFHIASCLSKADM 1010

Query: 168  NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAW 226
             ++ S P  L   E     VHAG +  + L +Q+P  +M+MR+I  +G  TSK      W
Sbjct: 1011 KWMNSLPWYLSSKELGSLFVHAGFVSGIRLAKQNPRLMMNMRSILPDGTVTSKFFNNWPW 1070

Query: 227  SKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREI-IN 285
            ++ W+        P+T+++GHDA R L+   ++ GLD+GCVYGG L+A I  + R + + 
Sbjct: 1071 ARLWDG-------PQTVLFGHDADRGLQQYEHAIGLDTGCVYGGRLTACILPEKRLVSLL 1123

Query: 286  VKCNKYVD 293
            +   +Y D
Sbjct: 1124 INSKRYCD 1131



>gi|322712192|gb|EFZ03765.1| Ser/Thr protein phosphatase family [Metarhizium anisopliae ARSEF
           23]
          Length = 356

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 138/292 (47%), Gaps = 56/292 (19%)

Query: 36  KPLNYTL---INKLEAPLSQ--KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDI 90
           KP N TL   + K   P  +  + L+ IGD+HG   EL NL++   YD   DH+I +GD+
Sbjct: 49  KPPNLTLTASVPKHYVPTVENGRRLLVIGDIHGMNTELGNLLDLAKYDAATDHVITLGDM 108

Query: 91  VAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQ-IKNILDFLDSQKIPLDEFIKEHDIPKD 149
           V KGP S  V+  + SL AS VRGNH+D++LQ ++       S     D  +      K 
Sbjct: 109 VNKGPDSRGVLSRLMSLNASAVRGNHEDRLLQALREHGAQAASATAQEDAVLAARKRDKK 168

Query: 150 IVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMR 209
           I+K     +AK L  E   +L   P+IL  P   LY VH GL+P V L +QDP  +M+MR
Sbjct: 169 ILK-----VAKTLLPEQITWLSGLPVILKSPALRLYFVHGGLVPGVKLDKQDPWAVMNMR 223

Query: 210 NI----------KNGKPTSKKDV--------------------------------GHAWS 227
            +          ++G  +++ +                                 G  W 
Sbjct: 224 TLRYSQDDELRRRDGHSSAQAEPEDEDEYDDDDDDEGSEVTPAQKVVPIPIDDHSGQRWD 283

Query: 228 KHWNAAQQ---ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
           K WN  Q+   + S  +T++YGHDA R      Y+ GLDSGC  GG L+ LI
Sbjct: 284 KAWNKYQRKFVKKSHRRTVMYGHDAKRGFTEGRYTVGLDSGCAAGGHLTGLI 335



>gi|459369051|gb|EMG47562.1| hypothetical protein G210_2039 [Candida maltosa Xu316]
          Length = 344

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 145/271 (53%), Gaps = 28/271 (10%)

Query: 43  INKLEAPLSQKN----LIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSI 98
           I++L++PL   N    +I IGD+HG Y E  NL++K+ Y+  KD L+ +GD + KGP S 
Sbjct: 77  ISELKSPLLPSNPHSRMILIGDIHGHYIEFRNLLSKVKYNSKKDTLVVLGDFITKGPDSF 136

Query: 99  EVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHG-- 156
           ++++ +      C+ GNH+  VLQ   +   LD  +  +      HD P  I  S +   
Sbjct: 137 KMLEFLIDNDVECILGNHEYYVLQNYAMFHRLDQPEFAIPPI---HDHPISIDDSYNDDP 193

Query: 157 --LLAKELDVELYNYLLSCPIILDIPE----YDLYVVHAGLLPDVPLFEQDPSDIMSMRN 210
             LLAK+L      Y+ SC +I  +       +   VHAG+ PD+ L EQDP D + MR+
Sbjct: 194 EFLLAKKLQPRHVRYINSCSVIKKLGRVPGGMEGIAVHAGVRPDLTLSEQDPIDNLEMRS 253

Query: 211 IKN---GKPTSKKDV--GHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSG 265
           +      + TS   +    +WSK +N    E+ +  T+ YGHDA R LK+K ++ GLDS 
Sbjct: 254 LIGPFYNESTSDPTIPGAKSWSKVYNWKNGEAPANYTVYYGHDAGRGLKLKEFTKGLDSR 313

Query: 266 CVYGGELSALIWNDNR--------EIINVKC 288
           C  GG+LSA++ + ++        EI+ V C
Sbjct: 314 CDRGGKLSAMVISTDKKKKDKLVEEIVQVHC 344



>gi|452842959|gb|EME44894.1| hypothetical protein DOTSEDRAFT_70815 [Dothistroma septosporum
           NZE10]
          Length = 461

 Score =  139 bits (351), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 103/325 (31%), Positives = 155/325 (47%), Gaps = 77/325 (23%)

Query: 34  NFKPLNYTLINKLEA-PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVA 92
             K LN+ L+   ++ P  ++ L+F+GDVHG   EL +L++K+++    DHLI VGDI++
Sbjct: 145 RIKDLNHDLLPGGKSDPDGKRRLVFVGDVHGCKKELRHLLDKVDFRKGTDHLILVGDIIS 204

Query: 93  KGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVK 152
           KGP ++ V+  +  L A+ VRGNH+D++L   N+   LD+   P  E +      KD   
Sbjct: 205 KGPDNVGVLDELIRLKATSVRGNHEDRIL---NVARSLDTGSPPPSEKVSSKGYSKDAA- 260

Query: 153 SEHGLLAKELDVELYNYLLSCPIILDIPEYDL----------------YVVHAGLLPDVP 196
                L  EL      YL + P++L IP   +                 VVHAGL+P V 
Sbjct: 261 -----LLHELKPRHLKYLRNMPLMLHIPSLPMALSSTRKHDSPISEHILVVHAGLVPGVT 315

Query: 197 LFEQDPSDIMSMRNI--------------KNGKPT------------SKKDV-------- 222
           L +QDP  +M+MR+I              K  KP              KK +        
Sbjct: 316 LEKQDPYFVMNMRSINRRTHVPSATRAPSKQSKPWFDIWNWYNDHVFRKKSMPGVNIIDS 375

Query: 223 --------------GHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVY 268
                            W   W   ++   SP+ +IYGHD+ + L+I+ +S GLDSGCV 
Sbjct: 376 NAVDPSSQHFDSFLTSLWKNFW-GKKKLHPSPQIVIYGHDSKQGLQIQRWSKGLDSGCVG 434

Query: 269 GGELSALIWN--DNREIINVKCNKY 291
           GGEL+AL+ +    +E+ +V C  Y
Sbjct: 435 GGELTALVLDARGRQEVHSVGCKNY 459



>gi|459186440|ref|XP_004227501.1| PREDICTED: bis(5'-nucleosyl)-tetraphosphatase, symmetrical-like
           [Ciona intestinalis]
          Length = 283

 Score =  139 bits (351), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 132/237 (55%), Gaps = 42/237 (17%)

Query: 53  KNLIFIGDVHGSYDE---LLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG- 108
           KNL+ +GDVHG YDE   LL +  + +  P++  +IFVGD+V KGPKS+E+++ +R+ G 
Sbjct: 46  KNLLIVGDVHGCYDETMALLEIAQQRSSHPVE--VIFVGDVVNKGPKSLEMLEFVRNAGN 103

Query: 109 ASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYN 168
             C+RGNH+  VL     L   +S+ +  D +I       +I  ++            + 
Sbjct: 104 VHCIRGNHEQNVL--CQYLRMKNSRDVTHDHWIA------NITNAQ------------FE 143

Query: 169 YLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI---------KNGKPTSK 219
           Y+ + P  + IP     VVHAGL+P +PL +Q  +++++MRN+         +    TS 
Sbjct: 144 YMRNLPYTITIPSIGCVVVHAGLVPGIPLHQQSTNNMLNMRNLVVDINDFYDEELCGTSD 203

Query: 220 KDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
              G  W++ W         P+ + +GHDA R+L+  P+  GLD+GCVYGG+L+A++
Sbjct: 204 NRRGTCWAESW-------IGPQHVYFGHDALRKLQTHPHCTGLDTGCVYGGKLTAVL 253



>gi|383452262|ref|YP_005366251.1| putative bis(5-nucleosyl)-tetraphosphatase, symmetrical
           [Corallococcus coralloides DSM 2259]
 gi|504205994|ref|WP_014393096.1| metallophosphatase [Corallococcus coralloides]
 gi|380733998|gb|AFE10000.1| putative bis(5-nucleosyl)-tetraphosphatase, symmetrical
           [Corallococcus coralloides DSM 2259]
          Length = 218

 Score =  139 bits (350), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 116/227 (51%), Gaps = 26/227 (11%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           +FIGDVHG   EL  L+   ++ P  D ++ VGD+VAKGP S  VV+  R  G   V+GN
Sbjct: 4   LFIGDVHGCSSELDALLKACDWQP-GDRVVLVGDLVAKGPDSAGVVRRAREHGFQAVKGN 62

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  VL+                     H      +K EH  +   L    + ++   P 
Sbjct: 63  HDAHVLRWHG-----------------GHASKGKKLKPEHRQVLDTLSAADWAWMERLPS 105

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-NGKPTSKKDVGHAWSKHWNAAQ 234
            L  P+ +   VHAGL+P VPL EQ    + ++R+I  +G P+ + + G  W   W    
Sbjct: 106 YLRFPDLNALAVHAGLVPGVPLEEQKEEFLFNLRSIAADGTPSKRLEAGEPWGSLWQG-- 163

Query: 235 QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNR 281
                P+ +I+GHDA R L+  P++ GLDSGCVYGG+L+A +  + R
Sbjct: 164 -----PELVIFGHDAMRGLQKHPFAVGLDSGCVYGGKLTAYVLPEGR 205



>gi|400600648|gb|EJP68316.1| Ser/Thr protein phosphatase family protein [Beauveria bassiana
           ARSEF 2860]
          Length = 395

 Score =  139 bits (350), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 93/298 (31%), Positives = 141/298 (47%), Gaps = 67/298 (22%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           + LI IGD+HG  D L  L+N++ YD   DH++  GD+V KGP S  V+  +  LGAS V
Sbjct: 104 RRLIVIGDIHGMDDALDRLLNRVGYDGTTDHIVAAGDMVNKGPHSSRVLARLMELGASAV 163

Query: 113 RGNHDDKVL----QIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYN 168
           RGNH+D+VL      +   +  +S + P        D  +   K      A++L  E   
Sbjct: 164 RGNHEDRVLLALASAEEQEEASESVEFP--------DFQERRSKKRDRETARQLSKEQIE 215

Query: 169 YLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKN--------------- 213
           +L   P+IL   +  +Y+VHAGL+P +   EQDP  +M MR++                 
Sbjct: 216 WLTERPLILSADDLAMYIVHAGLVPGIHPLEQDPWAVMYMRSLIEPPNHRVHQIPDHYGD 275

Query: 214 -GKPTSKKDV-------------------------------GHAWSKHWNAAQQE--SSS 239
            G+  S +D                                GH W+  W+  Q +   + 
Sbjct: 276 PGEEFSNEDADEHAEEHDDGSDENAHANIAFEDLIPIETHQGHDWADLWDLRQSQIRKAD 335

Query: 240 PKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN------REIINVKCNKY 291
            +T++YGHDA R L+I  +++GLDS C  GG+L+AL+ + +      R+I  V C KY
Sbjct: 336 RRTVVYGHDAKRGLQIGKHTWGLDSACFNGGKLTALVIHVSKKGHLKRKIRQVSCKKY 393



>gi|340371257|ref|XP_003384162.1| PREDICTED: bis(5'-nucleosyl)-tetraphosphatase prpE
           [asymmetrical]-like [Amphimedon queenslandica]
          Length = 293

 Score =  139 bits (350), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 83/247 (33%), Positives = 131/247 (53%), Gaps = 21/247 (8%)

Query: 47  EAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRS 106
           E  L  + L+ +GDVHG YDEL+ L++K         ++FVGD+  KGP ++E ++L+R 
Sbjct: 48  EDELKGRRLLVVGDVHGCYDELVQLLDKAGGRDPGVLVVFVGDVCNKGPLNVESIRLVRE 107

Query: 107 LGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVEL 166
           +G  CVRGNHD+                I L E++K H    + +  +   L++ L  E 
Sbjct: 108 VGGYCVRGNHDE----------------ICLLEWLK-HSEGAEPLSDKFSWLSR-LSKEE 149

Query: 167 YNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPT---SKKDVG 223
            ++    P  +  P  ++ V+HAGL+P VP+ EQ   D++ +RN+     T   S +  G
Sbjct: 150 MDWYFELPFSIHFPSREVLVIHAGLVPGVPIEEQSHHDLLHLRNVTFDLRTLTFSSERGG 209

Query: 224 HAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREI 283
                H     Q    P  + +GHDA R L+  P++ GLD+GCVYGG L+A+  ++  ++
Sbjct: 210 AYQEPHPQPWAQTWIGPDHVYFGHDAIRFLQRYPFATGLDTGCVYGGHLTAVFDDEREKL 269

Query: 284 INVKCNK 290
           I VK  K
Sbjct: 270 IQVKAAK 276



>gi|344233816|gb|EGV65686.1| Metallo-dependent phosphatase [Candida tenuis ATCC 10573]
 gi|344233817|gb|EGV65687.1| hypothetical protein CANTEDRAFT_112553 [Candida tenuis ATCC 10573]
          Length = 415

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 91/263 (34%), Positives = 135/263 (51%), Gaps = 41/263 (15%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           + LI IGD+HG Y EL +L+ K+ Y+  KD+L+ +GD V+KGP S +V++ +      C+
Sbjct: 137 ERLIMIGDIHGHYIELRHLLRKVKYNKKKDYLLVLGDFVSKGPDSQKVIEFLDKNNIDCI 196

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFI---KEHDIPKDIVKSE------HGLLAKELD 163
            GNH+  +LQ     +++    +   +FI       IP DI  S+        LLAK+L 
Sbjct: 197 LGNHEFYILQ-----NYVKFHGLKFPDFIVGNSTESIPLDIHVSDAFNDDPEFLLAKKLQ 251

Query: 164 VELYNYLLSCPIILDIPEYDLY---------------------VVHAGLLPDVPLFEQDP 202
            E   Y+  C +I  + +  +Y                      VH GL  D+ L +Q+P
Sbjct: 252 PEHIRYINKCSLIKKLGQVPVYSKKKSSGIFKHITTTKSSPGIAVHGGLRWDLSLEDQNP 311

Query: 203 SDIMSMRNIKNGKPTSKKDVGH-----AWSKHWNAAQQESSSPKTIIYGHDASRRLKIKP 257
            + + MR++         D  H     +WSK WN  Q+ SS+   + YGHDA R L +KP
Sbjct: 312 IEALEMRSLVGPYFNRSTDDPHEQFSVSWSKVWNKKQKRSSTSSVVYYGHDARRGLNLKP 371

Query: 258 YSFGLDSGCVYGGELSAL-IWND 279
           YS GLD+GC  G +LSAL IWN+
Sbjct: 372 YSRGLDTGCDRGEQLSALVIWNE 394



>gi|407852504|gb|EKG05971.1| serine/threonine protein kinase, putative [Trypanosoma cruzi]
          Length = 243

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 85/245 (34%), Positives = 131/245 (53%), Gaps = 38/245 (15%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            ++ +GD+HG   +L ++++  ++   +D LI  GD+V KGP S  VV+L+RSLGA  V 
Sbjct: 17  RVVIVGDIHGCLAQLEDILSVTDFARGRDQLITAGDMVNKGPDSFGVVRLLRSLGARGVI 76

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDI-VKSEHGLLAKELDVELYNYLLS 172
           GNHD K+L+++              + I++H        +S    LA  L  ++  YLL 
Sbjct: 77  GNHDAKLLKLR--------------KKIRKHGTLHGTNSQSSLAPLAMSLPQDVEEYLLQ 122

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI---KNGKPTSKKDV--GHAWS 227
            P IL IP +++ VVHAGL    PL  Q   ++ +MRN+    +G   + +D   G  W+
Sbjct: 123 LPHILRIPAHNILVVHAGLHVQNPLERQLVKEVTTMRNLILQDDGLYRASEDTTDGVPWA 182

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI----------- 276
             W         P+T+++GHDA R L+  P++ GLD+ CVYGGEL+AL+           
Sbjct: 183 SLWQG-------PETVVFGHDARRGLQRHPHAIGLDTRCVYGGELTALVCPGEHLVSVPG 235

Query: 277 WNDNR 281
           W  NR
Sbjct: 236 WTSNR 240



>gi|134057876|emb|CAK44600.1| unnamed protein product [Aspergillus niger]
          Length = 519

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 138/252 (54%), Gaps = 28/252 (11%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           P   + LI +GDV G   EL  L+ ++ +DP  DHLIF G+++++GP S +VV   R   
Sbjct: 150 PEGDERLIVVGDVQGCMAELDRLLEELLFDPTNDHLIFTGNMISQGPNSTDVVDFARKYS 209

Query: 109 ASCVRGNHDDKVLQIK-NILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           ASCVRGN++D+VL ++ N+++         D+++      +   K+E   LA+ L  E  
Sbjct: 210 ASCVRGNNEDRVLVMRHNMIEAQTLTDTSSDQYLDGQSTEQ--AKNERN-LARALSEEQS 266

Query: 168 NYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSM--RNIKNGKPTSKKD 221
            +L +CP+IL++ +      + VVH GL+P V L  QDP  +M+M   ++    P+ ++D
Sbjct: 267 EWLDACPVILNVGQIPTMGQVAVVHGGLIPGVDLNHQDPYSVMNMLTLDLDTHMPSPERD 326

Query: 222 VGHAWSKHWNAAQQE-----------------SSSPKTIIYGHDASRRLKIKPYSFGLDS 264
            G  W+K +N  Q                   ++   T+IYGHD+   L I  Y+ G+D+
Sbjct: 327 -GMMWTKFFNKHQSVSYSSSKSSNNDDDEDAGAAKATTVIYGHDSETGLNINTYTKGIDT 385

Query: 265 GCVYGGELSALI 276
           GCV GG+L+A +
Sbjct: 386 GCVAGGKLTAFV 397



>gi|452984923|gb|EME84680.1| hypothetical protein MYCFIDRAFT_195666 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 842

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 96/306 (31%), Positives = 141/306 (46%), Gaps = 72/306 (23%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           P  ++ L+FIGD+HG   ELL L+ K  Y+   DHLI VGD+V KGP ++ V+  +  L 
Sbjct: 544 PNGERRLVFIGDIHGCKKELLELLQKAGYNEETDHLILVGDVVTKGPDNVGVLDELIRLN 603

Query: 109 ASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYN 168
           A+ VRGNH+D++L +   L    +  I   E        KDI       L K+L      
Sbjct: 604 ATSVRGNHEDRLLHVAKKLHMAGAHDI---EATGSKGKAKDIA------LVKQLQPHHLQ 654

Query: 169 YLLSCPIILDIPEY----------------DLYVVHAGLLPDVPLFEQDPSDIMSMRNI- 211
           YL + P++L IP                   + VVHAGL+P V L +QDP  +M+MR+I 
Sbjct: 655 YLQAMPLMLHIPALPMASGSTRKSNSPITEHMLVVHAGLVPGVRLNKQDPYFVMNMRSIN 714

Query: 212 -------------KNGKP-------------------------------TSKKDVGHAWS 227
                        KN KP                               T        + 
Sbjct: 715 RRTHVPSALRAPSKNAKPWYDIWCWYNDRIFKKLSLTGFEAPDSDMLAQTEPDTWFTGFW 774

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN--DNREIIN 285
           K++   ++ S  P+ +IYGHD+   L+I  +S GLDSGCV GG L+A++ +    +++ +
Sbjct: 775 KNFFGQKKNSLHPQVVIYGHDSKAGLQINRWSKGLDSGCVGGGRLTAMVLDARGKQQLFH 834

Query: 286 VKCNKY 291
           V C  Y
Sbjct: 835 VGCENY 840



>gi|323449798|gb|EGB05683.1| hypothetical protein AURANDRAFT_30373 [Aureococcus anophagefferens]
          Length = 236

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 118/228 (51%), Gaps = 26/228 (11%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
           A +  +  + +GDVHG  DEL  L+ K  YD     L+ VGD+V KGP S  VV+  R  
Sbjct: 11  ASVRGRRFLVVGDVHGCRDELELLLAKAAYDETTTQLVLVGDLVNKGPYSAGVVRWCRER 70

Query: 108 GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           GA CVRGNHDD  +                 +  ++H      V  ++  + KEL     
Sbjct: 71  GALCVRGNHDDHAV-----------------DHWQKHFHLGLAVPGKYAYV-KELSAADG 112

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVGHAWS 227
            +L + P  L +P+ D  VVHAGL PDVPL  Q+P  +  MR++ +G P+         +
Sbjct: 113 AWLEALPHTLSLPDVDAIVVHAGLAPDVPLDGQEPKHMTRMRSLSDGAPSDAPG-----A 167

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSAL 275
             W A ++E      +++GHDA R L++   + GLD+GC YG +L+AL
Sbjct: 168 ASWAATRRERP---LVVFGHDAKRGLQVHANAVGLDTGCCYGKKLTAL 212



>gi|45477403|gb|AAS66026.1| hypothetical protein [Aspergillus parasiticus]
          Length = 357

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 141/287 (49%), Gaps = 49/287 (17%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           + + L+ +GDVHG    L  L+ K+N+D    DHLIFVGD+V KGP S  V+     LGA
Sbjct: 62  AGRRLVIVGDVHGMKKSLDALLEKVNFDKGNGDHLIFVGDLVNKGPDSPGVIDRAVELGA 121

Query: 110 SCVRGNHDDKVL----QIKNILD--------FLDSQKIP-------LDEFI-----KEHD 145
           S VRGNHD+ VL    +IK   D           S K+P       L E +     +   
Sbjct: 122 SAVRGNHDNAVLDAAGEIKARGDNPMHAGGITSGSAKLPKGSGAESLSETVACDGPETSA 181

Query: 146 IPKDIVKSEHGLL----AKELDVELYNYLLSCPIILDI--PEYD-------LYVVHAGLL 192
            P     + H       A+ L     ++L + P+IL I  P +        L VVHAGL 
Sbjct: 182 SPNASPLTRHSATTYSTARALSTRHLDWLAALPLILRIKLPHHSTSSLDDTLLVVHAGLT 241

Query: 193 PDVPLFEQDPSDIMSMRNIKN-----GKPTSKKDVGH-AWSKHWNAAQQESSSPKTIIYG 246
           P +PL +QDP  +M MR++ +     G     +  G   W   W+  Q + ++  T+I+G
Sbjct: 242 PGIPLEKQDPHAVMHMRSLTHAPGDEGTLIPAEASGEEGWVAQWDQWQDQLTTRTTVIFG 301

Query: 247 HDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN-----REIINVKC 288
           HDA RRL++  ++ GLDS C+YG  LSAL+           I+ V+C
Sbjct: 302 HDAKRRLQLGRHTIGLDSACLYGHYLSALVIESTDRGIEHRIVQVEC 348



>gi|294656011|ref|XP_458242.2| DEHA2C13024p [Debaryomyces hansenii CBS767]
 gi|199430788|emb|CAG86318.2| DEHA2C13024p [Debaryomyces hansenii CBS767]
          Length = 411

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 135/260 (51%), Gaps = 28/260 (10%)

Query: 45  KLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLI 104
           +L    + + LI IGDVHG Y +L  L+ K+N++   DH++ +GD +AKGP SI+V++  
Sbjct: 135 ELNQKRTVERLILIGDVHGHYTKLRKLLRKLNFNRRTDHVLMLGDFIAKGPDSIKVLEFA 194

Query: 105 RSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDV 164
            +    C+ GNH+  VLQ       LD+ +   ++   +  I     +    LLAK+L  
Sbjct: 195 INNKIDCIFGNHEWYVLQNYAQFHQLDAPRFANEK--PDIGIESSFNEDPEYLLAKKLQP 252

Query: 165 ELYNYLLSCPIILDIPEYDLY--------------VVHAGLLPDVPLFEQDPSDIMSMR- 209
              +Y+ SC +I  + +  L+               VH GL  D+P  EQD    + MR 
Sbjct: 253 HHVDYINSCSVIKKLGKVPLHKRNEDGGSKYSNGVAVHGGLRWDLPFEEQDSEKCLEMRS 312

Query: 210 ------NIKNGKPTSKKDVGHAWSKHWNAAQQESSSPKT--IIYGHDASRRLKIKPYSFG 261
                 N     P  +  V  +WSK WN  Q+E S+  T  + YGHDA R LK+K Y+ G
Sbjct: 313 YIGPDFNESTDDPFEENAV--SWSKIWNKKQKEFSNKDTHVVYYGHDARRGLKLKKYAKG 370

Query: 262 LDSGCVYGGELSALI-WNDN 280
           LD+GC  GG L+A++ WN+N
Sbjct: 371 LDTGCYKGGHLTAMVLWNEN 390



>gi|322697296|gb|EFY89077.1| Ser/Thr protein phosphatase family [Metarhizium acridum CQMa 102]
          Length = 357

 Score =  136 bits (342), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 124/265 (46%), Gaps = 47/265 (17%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           + L+ IGD+HG   EL NL++   YD   DH+I +GD+V KGP S  V+  + S+ AS V
Sbjct: 72  RRLLVIGDIHGMNTELGNLLDLAKYDAATDHVITLGDMVNKGPDSRGVLSRLMSMNASAV 131

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLL--AKELDVELYNYL 170
           RGNH+D++L     L    +Q  P  E   + D      K    +L  AK L  E   +L
Sbjct: 132 RGNHEDRLLL---ALREHSAQAAPAAE---QDDTAHASRKRNRKILKVAKTLLPEQITWL 185

Query: 171 LSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKK---------- 220
              P+IL  P   LY VH GL+P V L +QDP  +M+MR ++  +   ++          
Sbjct: 186 AGLPVILKSPALRLYFVHGGLVPGVKLDKQDPWAVMNMRTLRYSQEELRRHDDHSSAQAE 245

Query: 221 --------------------------DVGHAWSKHWNAAQQ---ESSSPKTIIYGHDASR 251
                                       G  W K WN  Q+   +    +T++YGHDA R
Sbjct: 246 LDDDDDDDEGSEVTPAQKVVAIPIDDHSGERWDKAWNKYQRKFVKKGHRQTVMYGHDAKR 305

Query: 252 RLKIKPYSFGLDSGCVYGGELSALI 276
                 Y+ GLDSGC  GG L+ LI
Sbjct: 306 GFIEGKYTVGLDSGCAAGGHLTGLI 330



>gi|260822173|ref|XP_002606477.1| hypothetical protein BRAFLDRAFT_93268 [Branchiostoma floridae]
 gi|229291819|gb|EEN62487.1| hypothetical protein BRAFLDRAFT_93268 [Branchiostoma floridae]
          Length = 289

 Score =  135 bits (341), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 91/248 (36%), Positives = 134/248 (54%), Gaps = 39/248 (15%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDH--LIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           K + FIGDVHG YDE++ L+NK   D L D   +IFVGD+V KGPKS EV+  +R     
Sbjct: 63  KRVFFIGDVHGCYDEMMQLLNKA--DALSDDTVVIFVGDMVNKGPKSREVIDFLRRSKVY 120

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKD--IVKSEHGLLAKELDVELYN 168
            V+GNH+D VL                    +E+D  +D     S+      +L +E   
Sbjct: 121 AVKGNHEDHVL--------------------REYDNSRDPGYKLSQKYTWVGKLTLEEAQ 160

Query: 169 YLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI---KNGKPTSKKDV-GH 224
           YL   P  + +P Y++  VHAGL+P  PL EQ   ++M+MRN+     G    K+   G 
Sbjct: 161 YLRDLPYTISLPTYNIIAVHAGLVPGRPLEEQSDYEMMTMRNLVKTAEGFEARKRPTEGK 220

Query: 225 AWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIW--NDNRE 282
            W+  W       + P+ +++GHDA RRL++  ++ GLD+GC+YGG L+ L+      RE
Sbjct: 221 PWAAEW-------TGPQHVVFGHDAVRRLQLYDHATGLDTGCLYGGNLTGLLLGKEKERE 273

Query: 283 IINVKCNK 290
           I++VK  +
Sbjct: 274 IVSVKSRQ 281



>gi|402224506|gb|EJU04568.1| Metallo-dependent phosphatase [Dacryopinax sp. DJM-731 SS1]
          Length = 373

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 140/267 (52%), Gaps = 38/267 (14%)

Query: 46  LEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIR 105
           LE P   + +I +GD+HG +     L+NK++Y+  KD L  VGD++AKG  S +V++ + 
Sbjct: 72  LEDP--TRRVIIVGDIHGMWKPFQELMNKVDYNSEKDILFHVGDVIAKGTDSDKVLKWLI 129

Query: 106 SLGASCVRGNHDDKVLQIKNILDFLDS-----------QKIPLDEFI------------- 141
                 VRGNHD KV+  +   D++++           +K    EF              
Sbjct: 130 DHNIRGVRGNHDQKVIGWRIWQDWVEAVPGGKQWLKRVEKFTHSEFTSQQVKHKESKADK 189

Query: 142 ---KEHDIPKD---IVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDV 195
              K+   P D   +  SEH  +A++L  E Y YLL+ P+ +  P    ++VHAG+LP  
Sbjct: 190 MHRKQFAFPDDRDWVWSSEHYGIARKLTHEQYEYLLNLPLTISFPGMKTHLVHAGILPHQ 249

Query: 196 PLFEQ-DPSDIMSMRNIKNGKPTSKKDVGHAWSKHWNAAQQESSSPK-----TIIYGHDA 249
              E+ DP  +++MR++ +    S+K  G  W++ +N  QQ     K      +++GH A
Sbjct: 250 LKEEKPDPWSLLNMRSVLSSGAVSRKFDGTPWTELFNHYQQSGEDAKKEDREAVVFGHAA 309

Query: 250 SRRLKIKPYSFGLDSGCVYGGELSALI 276
              L+++ ++ GLD+GCVYG EL+A++
Sbjct: 310 KLGLQVERWTLGLDTGCVYGRELTAVV 336



>gi|162455375|ref|YP_001617742.1| bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Sorangium
           cellulosum So ce56]
 gi|501196683|ref|WP_012239701.1| bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Sorangium
           cellulosum]
 gi|161165957|emb|CAN97262.1| Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Sorangium
           cellulosum So ce56]
          Length = 231

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 122/229 (53%), Gaps = 25/229 (10%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           I IGDVHG  DEL  LI  +      D ++ VGD++ +GP     + L+R +GA  VRGN
Sbjct: 5   IIIGDVHGCRDELARLIEHVGLVS-GDRVVMVGDLIVRGPDPCGTLDLLREVGAISVRGN 63

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           H+D++L+ +      D +  PL E  KE               A++L    + +L + P 
Sbjct: 64  HEDRLLRWRA--GRSDPRGEPLGELSKE--------------TAQQLRKRDWAWLETLPY 107

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNAAQ 234
            LD+PE+ L VVHAGL+P +P+  QDP  +M +R + + G+P  ++     W        
Sbjct: 108 WLDLPEHGLRVVHAGLIPGLPIERQDPHTLMYVRCLGRYGEPVERRGGKTLWG------- 160

Query: 235 QESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREI 283
           Q    P  +++GH+A    ++  ++ G+D+G VYGG L+A++ +D   +
Sbjct: 161 QTYQGPPHVVFGHNARSEPQMHAWATGIDTGAVYGGRLTAMVLHDGERV 209



>gi|71404924|ref|XP_805123.1| serine/threonine protein kinase [Trypanosoma cruzi strain CL
           Brener]
 gi|70868408|gb|EAN83272.1| serine/threonine protein kinase, putative [Trypanosoma cruzi]
          Length = 294

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/245 (33%), Positives = 129/245 (52%), Gaps = 36/245 (14%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            ++ +GD+HG   +L ++++  ++   +D LI  GD+V KGP S  VV+L++SLGA  V 
Sbjct: 68  RVVIVGDIHGCLAQLEDILSVTDFVRGRDQLITAGDMVNKGPDSFGVVRLLKSLGARGVI 127

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNHD K+L+++              +  K   +     +S    LA  L  ++  YLL  
Sbjct: 128 GNHDAKLLKLRK-------------KIRKHGTLHGKNSQSSLAPLAMSLPQDVEEYLLQL 174

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI---KNGKPTSKKDV--GHAWSK 228
           P IL IP +++ VVHAGL    PL  Q   ++ +MRN+    +G   + +D   G  W+ 
Sbjct: 175 PHILHIPAHNILVVHAGLHVQHPLERQLVKEVTTMRNLILQDDGLYRASEDTTDGVPWAS 234

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI-----------W 277
            W         P+T+++GHDA R L+  P++ GLD+ CVYGGEL+AL+           W
Sbjct: 235 LWQG-------PETVVFGHDARRGLQRYPHAIGLDTRCVYGGELTALVCPGEHLVSVPGW 287

Query: 278 NDNRE 282
             NR 
Sbjct: 288 TSNRS 292



>gi|255932113|ref|XP_002557613.1| Pc12g07790 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582232|emb|CAP80406.1| Pc12g07790 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 337

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 145/288 (50%), Gaps = 52/288 (18%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSL 107
           P+S + L+ +GD+HG    L  L++K++++  K DHLI VGD+V KGP S  V+ L   L
Sbjct: 34  PVSGR-LVIVGDIHGMRKSLEALLDKVSFNKNKGDHLILVGDLVNKGPDSAGVIDLAMKL 92

Query: 108 GASCVRGNHDDKVLQIK-----------NILDFLDSQKIPLDEFIKEHDIPKDIVK---- 152
            AS VRGNH++ VL              +      S  +P +    E ++P D  +    
Sbjct: 93  DASAVRGNHENAVLNAAADIHATKDSPVHPTSLTGSPAVPEN---SEAELPGDNARDAEI 149

Query: 153 ------------SEHGLLAKELDVELYNYLLSCPIILDI--PEY-------DLYVVHAGL 191
                       S     A  L     ++L + P+IL +  P          L VVHAGL
Sbjct: 150 PDKSGRAANTGVSTSRNTASVLSKHQLDWLAALPLILRVKLPRVPTSSLGDTLIVVHAGL 209

Query: 192 LPDVPLFEQDPSDIMSMRNI------KNGKPTSKKDVGHAWSKHWNAAQQESSSPKTIIY 245
           +P V L EQDP  IM MR++      K+G   ++     +W   W+  Q+  +S  T+I+
Sbjct: 210 VPSVVLEEQDPHAIMHMRSLVCGSGDKDGLIPAEASGEESWIVEWDRWQEMQTSRTTVIF 269

Query: 246 GHDASRRLKIKPYSFGLDSGCVYGGELSALIWN-DNREI----INVKC 288
           GHDA RRL+   Y+ GLDSGC+YG +LSA++    ++EI    I V+C
Sbjct: 270 GHDAKRRLQRSKYAIGLDSGCLYGHQLSAVVIGVSDKEIEHHVIQVEC 317



>gi|448107032|ref|XP_004200890.1| Piso0_003500 [Millerozyma farinosa CBS 7064]
 gi|448110038|ref|XP_004201521.1| Piso0_003500 [Millerozyma farinosa CBS 7064]
 gi|359382312|emb|CCE81149.1| Piso0_003500 [Millerozyma farinosa CBS 7064]
 gi|359383077|emb|CCE80384.1| Piso0_003500 [Millerozyma farinosa CBS 7064]
          Length = 409

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 89/255 (34%), Positives = 132/255 (51%), Gaps = 28/255 (10%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           + L+ +GDVHG + +L  L+ KI +D   D L+ +GD +AKGP S +V+        SCV
Sbjct: 135 ERLVMVGDVHGQFKQLKALLRKIRFDSRTDRLLLLGDFIAKGPDSKKVLDFAIQNNVSCV 194

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIP--KDIVKSEHGLLAKELDVELYNYL 170
            GNH+  VLQ  +    +DS            D+P  K ++K     LA+ L+     Y+
Sbjct: 195 LGNHEYYVLQYYSRFHRIDSPGFSNTTQQPSFDMPSSKKLLKDPEYRLARSLEPHHIKYI 254

Query: 171 LSCPIILDIPEYDLY--------------VVHAGLLPDVP--LFEQDPSDIMSMRNIKN- 213
            SCP+I  +    L+               VHAG+  D+   L++QDP + + MR++   
Sbjct: 255 NSCPVIRRLGRVPLHKKSETASHESSEGIAVHAGVRWDLMDNLYDQDPGECLEMRSLLGP 314

Query: 214 --GKPTSKKDVGHA--WSKHWNAAQQE----SSSPKTIIYGHDASRRLKIKPYSFGLDSG 265
              + TS  D   A  WSK +N  Q+E       P T+ YGHDA R LK+K ++ GLDSG
Sbjct: 315 HYNESTSDPDEPGAVSWSKIFNEKQKELYKAGKKPFTVFYGHDARRGLKVKRFTKGLDSG 374

Query: 266 CVYGGELSA-LIWND 279
           CV G EL+A ++W +
Sbjct: 375 CVKGRELTASILWRE 389



>gi|302847735|ref|XP_002955401.1| hypothetical protein VOLCADRAFT_96335 [Volvox carteri f.
           nagariensis]
 gi|300259243|gb|EFJ43472.1| hypothetical protein VOLCADRAFT_96335 [Volvox carteri f.
           nagariensis]
          Length = 346

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 124/279 (44%), Gaps = 83/279 (29%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI +GDVHG+  EL  L++ + Y+   D+LI  GD+V KGP S+ ++  +  LG   VR
Sbjct: 42  RLIIVGDVHGT-PELFRLLDSLRYNAASDNLILAGDLVNKGPVSLAILDAVPKLGCWAVR 100

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNHDD VL     L F   Q  PL+  +K                A+++  E    LL  
Sbjct: 101 GNHDDAVLSA--WLQFRAGQ--PLNPKLK---------------WAQDMTDEQAAVLLGL 141

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI---------------------- 211
           P  + +PEY + VVHAGL+P VP+ +QD   +  MRN+                      
Sbjct: 142 PFTVSVPEYGITVVHAGLVPGVPIEQQDMWAMYKMRNVVELKEDGGEGQRGAGGQGEDAT 201

Query: 212 -----------------------KNGKPTSK-----------KDVGHAWSKHWNAAQQES 237
                                   +G P+             KD G AW   W       
Sbjct: 202 RRYQLSVPNVHTPPGRAGDACKGSSGTPSRSTGQMYRAVEKAKDGGKAWGALWR------ 255

Query: 238 SSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
             P  + +GHDA RRL++ P++ GLD+GCVYGG L+A +
Sbjct: 256 -GPTHVFFGHDAKRRLQLHPHATGLDTGCVYGGALTAAV 293



>gi|407417925|gb|EKF38141.1| serine/threonine protein kinase, putative [Trypanosoma cruzi
           marinkellei]
          Length = 243

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 125/233 (53%), Gaps = 25/233 (10%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            ++ +GD+HG   +L  ++   +++  +D LI  GD+V KGP S  VV+L++SLGA  V 
Sbjct: 17  RIVIVGDIHGCLAQLEEILAVTDFEKGRDQLISAGDMVNKGPDSFGVVRLLKSLGARGVI 76

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNHD K+L+++              +  K   +     +S    LA  L  ++  YL   
Sbjct: 77  GNHDAKLLKLRK-------------KIRKHGALHGKNSQSSLAPLAMSLPQDVEEYLSQL 123

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI---KNGKPTSKKDV--GHAWSK 228
           P IL +P +++ VVHAGL    PL  Q   ++ +MRN+    +G   + +D   G  W+ 
Sbjct: 124 PHILRVPAHNILVVHAGLHVQHPLERQLVEEVTTMRNLIMQDDGLYMASEDTTDGVPWAS 183

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNR 281
            W         P+T+++GHDA R L+  P++ GLD+ CVYGGEL+AL+    R
Sbjct: 184 LWRG-------PETVVFGHDARRGLQRHPHAIGLDTRCVYGGELTALVCPGER 229



>gi|477534488|gb|ENH86026.1| ser thr protein phosphatase family [Colletotrichum orbiculare MAFF
           240422]
          Length = 425

 Score =  133 bits (334), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 98/327 (29%), Positives = 148/327 (45%), Gaps = 95/327 (29%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           + LI +GDVHG    L  L++++++D  K DHL+  GD++ KGP S  V+  +  LGAS 
Sbjct: 91  RRLIIVGDVHGMRASLDALLDELHFDTSKGDHLVLAGDMINKGPDSRGVIDTVMRLGASA 150

Query: 112 VRGNHDDKVL------QIKNILDF-LDSQKIP---------------------LDEFIKE 143
           VRGNH+D+VL      ++ ++ D  +    +P                     L+  I  
Sbjct: 151 VRGNHEDRVLLAHRGMKVNHVADEDIHGNPVPPNESSSSSSSEDNDTSDDADDLEPAIFP 210

Query: 144 HDIPKDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEYD----LYVVHAGLLPDVPLFE 199
           H        S     A+ L  +  ++L + P+ILD+   +    L VVHAGL+P + L +
Sbjct: 211 HG------DSAERATARSLSRKHLDWLATLPVILDVGSVESLGNLVVVHAGLVPGLTLKQ 264

Query: 200 QDPSDIMSMRNI------------KNGK-------------------------------- 215
           QDP  +M+MR +            KN                                  
Sbjct: 265 QDPWAVMNMRGLVYPREDLRRQEAKNALQEYRKEHHQTSPGLTDSMIAEEHERRRKPDDR 324

Query: 216 ----PTSKKDVGHAWSKHWNAAQQESSSPK---TIIYGHDASRRLKIKPYSFGLDSGCVY 268
               PT + +   +W K WNA Q+    P+    ++YGHD+ + L +  YSFGLDSGCV 
Sbjct: 325 AIAIPTDRHEGASSWPKAWNAHQKSLPEPEPRTAVVYGHDSKKGLSLSKYSFGLDSGCVN 384

Query: 269 GGELSALIWNDNRE-----IINVKCNK 290
           GG+L+AL+     E     I +VKC K
Sbjct: 385 GGDLTALVIESTTEGVTHVIKSVKCQK 411



>gi|71403622|ref|XP_804594.1| serine/threonine protein kinase [Trypanosoma cruzi strain CL
           Brener]
 gi|71405381|ref|XP_805314.1| serine/threonine protein kinase [Trypanosoma cruzi strain CL
           Brener]
 gi|70867644|gb|EAN82743.1| serine/threonine protein kinase, putative [Trypanosoma cruzi]
 gi|70868674|gb|EAN83463.1| serine/threonine protein kinase, putative [Trypanosoma cruzi]
          Length = 250

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 127/244 (52%), Gaps = 36/244 (14%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            ++ +GD+HG   +L ++++  ++   +D LI  GD+V KGP S  VV+L++SLGA  V 
Sbjct: 24  RVVIVGDIHGCLAQLEDILSVTDFARGRDQLITAGDMVNKGPDSFGVVRLLKSLGARGVI 83

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNHD K+L+++              +  K   +     +S    LA  L  ++  YL   
Sbjct: 84  GNHDAKLLKLRK-------------KIRKHGALHGKNSQSSLAPLAMSLPQDVEEYLSQL 130

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI---KNGKPTSKKDV--GHAWSK 228
           P IL IP + + VVHAGL    PL  Q   ++ +MRN+    +G   + +D   G  W+ 
Sbjct: 131 PHILRIPAHKILVVHAGLHVQHPLERQLVKEVTTMRNLILQDDGLYRASEDTTDGVPWAS 190

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI-----------W 277
            W         P+T+++GHDA R L+  P++ GLD+ CVYGGEL+AL+           W
Sbjct: 191 LWQG-------PETVVFGHDARRGLQRYPHAIGLDTRCVYGGELTALVCPGEHLVSVPGW 243

Query: 278 NDNR 281
             NR
Sbjct: 244 TSNR 247



>gi|71411488|ref|XP_807991.1| serine/threonine protein phosphatase [Trypanosoma cruzi strain CL
           Brener]
 gi|70872104|gb|EAN86140.1| serine/threonine protein phosphatase, putative [Trypanosoma cruzi]
          Length = 670

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 125/247 (50%), Gaps = 37/247 (14%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
           AP  +   I +GDVHG  ++L  L+ K+NY   KD LI  GD+V KGP SI  V++ + L
Sbjct: 223 APPCEHRYIVVGDVHGCPEQLEQLMLKVNYQKGKDCLILAGDLVNKGPDSIGAVRVAQKL 282

Query: 108 GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           GA  V GNHD  +L   N +      K+ + E +       D V      LA        
Sbjct: 283 GAIGVLGNHDSTLL---NCIARCRKPKLTVQEEL-------DPVMQ----LALSFPQGCQ 328

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK--------------- 212
           +YL S P IL IP+Y++ VVHAGL  +  +  QD  +IM MR ++               
Sbjct: 329 DYLRSLPHILRIPKYNVIVVHAGLNLNNSIENQDVFEIMHMRRLEKIGGSEDKKARTITK 388

Query: 213 -NGKPTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGE 271
              K   K   G  W++HW         P+ +++GHDA   L+  P+++G+D+GCVYG E
Sbjct: 389 AKWKAVVKGTRGEPWAEHWKG-------PEFVVFGHDARSGLQEHPFAYGIDTGCVYGSE 441

Query: 272 LSALIWN 278
           L+ +++ 
Sbjct: 442 LTCVVYG 448



>gi|71416329|ref|XP_810200.1| serine/threonine protein phosphatase [Trypanosoma cruzi strain CL
           Brener]
 gi|70874697|gb|EAN88349.1| serine/threonine protein phosphatase, putative [Trypanosoma cruzi]
          Length = 665

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 125/247 (50%), Gaps = 37/247 (14%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
           AP  +   I +GDVHG  ++L  L+ K+NY   KD LI  GD+V KGP SI  V++ + L
Sbjct: 218 APPCEHRYIVVGDVHGCPEQLEQLMLKVNYQKGKDCLILAGDLVNKGPDSIGAVRVAQKL 277

Query: 108 GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           GA  V GNHD  +L   N +      K+ + E +       D V      LA        
Sbjct: 278 GAIGVLGNHDSTLL---NCIARCRKPKLTVQEEL-------DPVMQ----LALSFPQGCQ 323

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK--------------- 212
           +YL S P IL IP+Y++ VVHAGL  +  +  QD  +IM MR ++               
Sbjct: 324 DYLRSLPHILRIPKYNVIVVHAGLNLNNSIENQDVFEIMHMRRLEKIGGSEDKKARTITK 383

Query: 213 -NGKPTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGE 271
              K   K   G  W++HW         P+ +++GHDA   L+  P+++G+D+GCVYG E
Sbjct: 384 AKWKAVVKGTRGEPWAEHWKG-------PEFVVFGHDARSGLQEHPFAYGIDTGCVYGSE 436

Query: 272 LSALIWN 278
           L+ +++ 
Sbjct: 437 LTCVVYG 443



>gi|72388318|ref|XP_844583.1| serine/threonine protein phosphatase [Trypanosoma brucei TREU927]
 gi|62175342|gb|AAX69485.1| serine/threonine protein phosphatase, putative [Trypanosoma brucei]
 gi|62359703|gb|AAX80135.1| bis(5'-nucleosyl)-tetraphosphatase, symmetrical, putative
           [Trypanosoma brucei]
 gi|70801116|gb|AAZ11024.1| serine/threonine protein phosphatase, putative [Trypanosoma brucei
           brucei strain 927/4 GUTat10.1]
          Length = 250

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 128/237 (54%), Gaps = 34/237 (14%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            L+ +GD+HG   +L  L+  +++    D L+ VGD+V KGP S  VV+L++ LGA  V 
Sbjct: 18  RLVVVGDIHGCLAQLQGLLRAVSFKQGSDTLVAVGDLVNKGPDSFGVVRLLKRLGAHSVL 77

Query: 114 GNHDDKVLQ-IKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
           GNHD K+L+ +K I      +K PL+E        +D  KS     A  + V++  YL  
Sbjct: 78  GNHDVKLLKLVKKI-----REKGPLNE--------RD-TKSSLAPFALTVPVDVEVYLSQ 123

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNGKPT-----SKKDV 222
            P I+ IP +++ V H GL P  PL  Q   ++ ++RN+     K G  T       KD 
Sbjct: 124 LPHIIRIPAHNVIVTHGGLHPQRPLDCQYIDEVTTLRNLIEKEQKAGGVTLVATPETKDG 183

Query: 223 GHAWSKHWNAAQQESSSPKTIIYGHDASRRL--KIKPYSFGLDSGCVYGGELSALIW 277
           G  W+  W         P+T+++GHD+ R L  + +P + GLDSGCVYGG LSA ++
Sbjct: 184 GVPWASLWRG-------PETVVFGHDSRRGLQEQYRPLAIGLDSGCVYGGRLSAAVF 233



>gi|407859298|gb|EKG06978.1| serine/threonine protein phosphatase, putative [Trypanosoma cruzi]
          Length = 666

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 125/247 (50%), Gaps = 37/247 (14%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
           AP  +   I +GDVHG  ++L  L+ K+NY   KD LI  GD+V KGP SI  V++ + L
Sbjct: 219 APPCEHRYIVVGDVHGCPEQLEKLMLKVNYQKGKDCLILAGDLVNKGPDSIGAVRVAQKL 278

Query: 108 GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           GA  V GNHD  +L   N +      K+ + E +       D V      LA        
Sbjct: 279 GAIGVLGNHDSTLL---NCIARCRKPKLTVQEEL-------DPVMQ----LALSFPQGCQ 324

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK--------------- 212
           +YL S P IL IP+Y++ VVHAGL  +  +  QD  +IM MR ++               
Sbjct: 325 DYLRSLPHILRIPKYNVIVVHAGLNLNNSIENQDVFEIMHMRRLEKIGGSEDKKARTITK 384

Query: 213 -NGKPTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGE 271
              K   K   G  W++HW         P+ +++GHDA   L+  P+++G+D+GCVYG E
Sbjct: 385 AKWKAVVKGTRGEPWAEHWKG-------PEFVVFGHDARSGLQEHPFAYGIDTGCVYGSE 437

Query: 272 LSALIWN 278
           L+ +++ 
Sbjct: 438 LTCVVYG 444



>gi|485625904|gb|EOD21704.1| hypothetical protein EMIHUDRAFT_354829 [Emiliania huxleyi CCMP1516]
          Length = 290

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 118/231 (51%), Gaps = 17/231 (7%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           I +GDVHG  DEL +L+    +D   DH++ VGD+V KGP S E V   R  G +CVRGN
Sbjct: 57  ILVGDVHGCLDELKSLLQACGFDASTDHVVLVGDLVNKGPHSAETVAYARESGFACVRGN 116

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HDD  L       F    +   +   +  D     +K        E D+    +L   P 
Sbjct: 117 HDDAAL-------FAHEART--EAGARGSDSKYSELKYAWVDALGEADL---AFLRELPH 164

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNG-----KPTSKKDVGHAWSKHW 230
            L +   ++ VVHAG++P VPL EQ   D+ +MRN+           +    G AW++ W
Sbjct: 165 TLRLEREEVLVVHAGVVPGVPLAEQRAEDMTTMRNLVRADGGGWWAAASASAGVAWAEEW 224

Query: 231 NAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNR 281
                  +  + +++GHDA RRL+   ++ GLD+GC YGGEL+AL+  + R
Sbjct: 225 RPEPTVVAGVRHVVFGHDAKRRLQRHEHATGLDTGCCYGGELTALVLPEWR 275



>gi|224001434|ref|XP_002290389.1| hypothetical protein THAPSDRAFT_268943 [Thalassiosira pseudonana
            CCMP1335]
 gi|220973811|gb|EED92141.1| hypothetical protein THAPSDRAFT_268943 [Thalassiosira pseudonana
            CCMP1335]
          Length = 1189

 Score =  132 bits (332), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 81/229 (35%), Positives = 125/229 (54%), Gaps = 25/229 (10%)

Query: 61   VHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKV 120
            VHG  DEL  L+ K +Y P  D ++F+GD+V KGP S+ VVQ+ R +GA  +RGNHD +V
Sbjct: 972  VHGCIDELQALLRKCDYHP-GDLVVFLGDLVCKGPDSLSVVQMAREIGAIGIRGNHDFEV 1030

Query: 121  LQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPIILDIP 180
            ++                + IK    P  ++ SEH  +A  L      ++ S P  +   
Sbjct: 1031 VR--------------WHQAIKSGADPP-VIGSEHYYVASALSTADLKWMYSLPWFISSS 1075

Query: 181  EYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNAAQQESSS 239
              +   VHAG +  + L +Q+P  +M+MR+I  +G  TSK      W++ W+        
Sbjct: 1076 HLNALFVHAGFVSGIRLAKQNPRLMMNMRSILPDGTVTSKFFNNWPWARLWDG------- 1128

Query: 240  PKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREI-INVK 287
            P+T+ +GHDA R L+   ++ GLD+GCVYGG+L+A I  + R + +N K
Sbjct: 1129 PQTVFFGHDADRGLQQYEHAIGLDTGCVYGGKLTACILPERRLVSVNAK 1177



>gi|425774182|gb|EKV12499.1| Ser/Thr protein phosphatase family protein [Penicillium digitatum
           PHI26]
 gi|425778366|gb|EKV16496.1| Ser/Thr protein phosphatase family protein [Penicillium digitatum
           Pd1]
          Length = 347

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 88/269 (32%), Positives = 137/269 (50%), Gaps = 49/269 (18%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           ++ L+ +GDVHG    L  L++++ ++  K DHL+ VGD+V KGP S  VV L   LGAS
Sbjct: 39  RRRLVIVGDVHGMRKSLEALLDQVGFNKSKGDHLVLVGDLVNKGPDSPGVVDLAMKLGAS 98

Query: 111 CVRGNHDDKVLQIKNILDFL-------------DSQKIP----LDEFIKEHDIP------ 147
            VRGNH++ VL     ++                S  IP    +   +++ +IP      
Sbjct: 99  AVRGNHENAVLNAAAEINATHDREGLGCPGGLPGSPAIPKPPEVGATVRDSEIPDKSGSA 158

Query: 148 --KDIVKSEH---GLLAKELDVELYNYLLSCPIILDI--PEYD-------LYVVHAGLLP 193
              D   S     GLL ++L      +L + P+I+ +  P          L VVHAGL+P
Sbjct: 159 TMTDTPTSHSTALGLLKRQL-----QWLAALPLIVRVKLPHVRTSSVGDALIVVHAGLVP 213

Query: 194 DVPLFEQDPSDIMSMRNIKNGKPTSKKDVG------HAWSKHWNAAQQESSSPKTIIYGH 247
            + L +QDP  +M MR++       ++ +        +W   W+  Q   +S  T+I+GH
Sbjct: 214 GLSLKDQDPHTVMHMRSLVRASGNEERFIPAEIPGEESWVVEWDRWQDRQASKTTVIFGH 273

Query: 248 DASRRLKIKPYSFGLDSGCVYGGELSALI 276
           DA R L++  Y+ GLDSGC+YG +LSA++
Sbjct: 274 DAKRGLQLGKYAIGLDSGCLYGHQLSAVV 302



>gi|343472761|emb|CCD15165.1| unnamed protein product [Trypanosoma congolense IL3000]
          Length = 711

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/246 (34%), Positives = 129/246 (52%), Gaps = 36/246 (14%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
           AP  +   I +GD+HG  ++L  L+ K++Y   KD LI VGD+V KGP S+ VVQL +  
Sbjct: 254 APPCKHRYIIVGDIHGCAEQLEELLLKVDYQQGKDCLIHVGDLVNKGPDSLAVVQLAQKK 313

Query: 108 GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           GA  V GNHD  +L   N +  +  + +        H    D V      LA     +  
Sbjct: 314 GAIGVLGNHDFTLL---NYIHRVRGKAL-------SHQDEADPVAR----LASTFPHDCE 359

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI------KNGKPTSKKD 221
           NY+ S P IL +P+Y++ VVHAGL  D  L +Q+  +IM +R +      K  +  S+K 
Sbjct: 360 NYIRSLPHILRVPQYNVIVVHAGLNVDCSLEDQNVYEIMHLRRLEHIVDSKQQQQRSEKS 419

Query: 222 V---------GHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGEL 272
                     G AW + W         P+ +++GHDA   L+  P ++G+D+GCVYGG+L
Sbjct: 420 RYRAIVKGSKGEAWGELWKG-------PECVVFGHDARAGLQELPSAYGIDTGCVYGGQL 472

Query: 273 SALIWN 278
           +A+++ 
Sbjct: 473 TAVVYG 478



>gi|354548617|emb|CCE45354.1| hypothetical protein CPAR2_703670 [Candida parapsilosis]
 gi|354548622|emb|CCE45359.1| hypothetical protein CPAR2_703720 [Candida parapsilosis]
          Length = 342

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 131/259 (50%), Gaps = 23/259 (8%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           K +I IGD+HG Y E   L+ K+ Y+  +D L+ +GD V KGP S  V+  +      C+
Sbjct: 84  KRIIMIGDIHGHYHEFKQLLKKVRYNKREDELLVLGDFVTKGPDSFRVLDYLIEHKIECI 143

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSE--HGLLAKELDVELYNYL 170
            GNH+  VLQ   +   LD  +  L++      I  D V ++    L AK+L      Y+
Sbjct: 144 VGNHEYYVLQYYALFHALDQPRFLLNDGQHVSHIGTDGVFNDDPEYLFAKKLQPHHVKYI 203

Query: 171 LSCPIILDIPEYDL-------YVVHAGLLPDVPLFEQDPSDIMSMRNIKN---GKPTSKK 220
             C +I ++    +         VHAG+ PD+ L +Q+P D + MR++      + TS  
Sbjct: 204 NQCSVIKELGIAPVGKDVAPGVAVHAGIRPDLKLSQQNPIDNLEMRSLIGPHFNETTSDP 263

Query: 221 DVGHA--WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
           D   A  WSK +N+   E+ +   + YGHDA R LK+K Y+ GLDSGC  GG+L+A + +
Sbjct: 264 DAPFAKSWSKVYNSKHGEAPANYVVYYGHDAGRGLKLKKYTKGLDSGCDKGGKLTAAVIS 323

Query: 279 DN---------REIINVKC 288
                       EI+ + C
Sbjct: 324 SGENKGKLKLEEEIVQIDC 342



>gi|358398085|gb|EHK47443.1| hypothetical protein TRIATDRAFT_262964 [Trichoderma atroviride IMI
           206040]
          Length = 369

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 134/289 (46%), Gaps = 72/289 (24%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           ++ LI +GD+HG    L  L+ K++++  KDHLI  GD++ KGP S  V+  + SL AS 
Sbjct: 66  KRRLIIVGDIHGMDASLETLLKKVDFNTNKDHLIAAGDMINKGPDSAGVISRLMSLNASA 125

Query: 112 VRGNHDDKVL----QIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           VRGNH+D++L    + +N+         P +E  +         ++E     ++L  E  
Sbjct: 126 VRGNHEDRILLSLAEAENLSGVSKDLASPHEEDRRG--------QTEFLATGRKLKKEHV 177

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI---------KNGKPTS 218
            +L   P+IL +   ++++VHAGL+P V    QDP  +M+MR +         K G+ +S
Sbjct: 178 EWLSKLPVILAVEPLNMFIVHAGLVPGVKPELQDPWAVMNMRTLIYPREKLRGKGGRKSS 237

Query: 219 K-----------------------------------KDV--------------GHAWSKH 229
           +                                   KD               G  WS  
Sbjct: 238 RSDDDDDDDNEEEAAAAEAPPPEEEEEGETLESIQQKDAYTDRDTIIPIEGRDGEKWSNA 297

Query: 230 WNAAQQ--ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
           WN  Q+  + S   T++YGHDA R  +   YS GLDSGCV GG L+A++
Sbjct: 298 WNHFQKRLKKSHRHTVVYGHDAKRGFREDKYSIGLDSGCVRGGALTAMV 346



>gi|407425701|gb|EKF39502.1| serine/threonine protein phosphatase, putative [Trypanosoma cruzi
           marinkellei]
          Length = 673

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 126/247 (51%), Gaps = 37/247 (14%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
           AP      I +GDVHG  ++L  L+ K+NY   KD LI  GD+V KGP SI  V++ + L
Sbjct: 226 APPCDHRYIVVGDVHGCPEQLEELMLKVNYQKGKDCLILAGDLVNKGPDSIGAVRVAQKL 285

Query: 108 GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
           GA  V GNHD  +L   N +      ++ + E +       D V      LA        
Sbjct: 286 GAIGVLGNHDITLL---NCIARCRKPRLTVQEEL-------DPVMQ----LALSFPQGCQ 331

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI--------KNGKPTS- 218
           +YL S P IL IP+Y++ VVHAGL  +  +  QD  +IM MR +        K G+  + 
Sbjct: 332 DYLRSLPHILRIPKYNVLVVHAGLNLNNSIENQDVFEIMHMRRLEKIGGSEDKKGRTVTR 391

Query: 219 -------KKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGE 271
                  K   G  W++HW         P+ +++GHDA   L+  P+++G+D+GCVYG E
Sbjct: 392 ARWKAVVKGTRGEPWAEHWKG-------PEFVVFGHDARSGLQEHPFAYGIDTGCVYGSE 444

Query: 272 LSALIWN 278
           L+ +++ 
Sbjct: 445 LTCVVYG 451



>gi|261327766|emb|CBH10743.1| serine/threonine protein phosphatase, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 250

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 127/237 (53%), Gaps = 34/237 (14%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            L+ +GD+HG   +L  L+  +++    D L+ VGD+V KGP S  VV+L++ LGA  V 
Sbjct: 18  RLVVVGDIHGCLAQLQGLLRAVSFKQGSDTLVAVGDLVNKGPDSFGVVRLLKRLGAHSVF 77

Query: 114 GNHDDKVLQ-IKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
           GNHD K+L+ +K I      +K PL+E        +D  KS     A  + V++  YL  
Sbjct: 78  GNHDVKLLKLVKKI-----REKGPLNE--------RD-TKSSLAPFALTVPVDVEVYLSQ 123

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNGKPT-----SKKDV 222
            P I+ IP +++ V H GL P  PL  Q   ++  +RN+     K G  T       KD 
Sbjct: 124 LPHIIRIPAHNVIVTHGGLHPQRPLDCQYIDEVTILRNLIEKEQKAGGVTLVATPETKDG 183

Query: 223 GHAWSKHWNAAQQESSSPKTIIYGHDASRRL--KIKPYSFGLDSGCVYGGELSALIW 277
           G  W+  W         P+T+++GHD+ R L  + +P + GLDSGCVYGG LSA ++
Sbjct: 184 GVPWASLWRG-------PETVVFGHDSRRGLQEQYRPLAIGLDSGCVYGGRLSAAVF 233



>gi|448536769|ref|XP_003871190.1| hypothetical protein CORT_0G03880 [Candida orthopsilosis Co 90-125]
 gi|380355546|emb|CCG25065.1| hypothetical protein CORT_0G03880 [Candida orthopsilosis]
          Length = 378

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 130/252 (51%), Gaps = 14/252 (5%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           K +I IGD+HG YDE   L+ K+ Y+   D L+ +GD V KGP S +V+  +      C+
Sbjct: 120 KRIIMIGDIHGHYDEFRQLLRKVEYNKKDDELLVLGDFVTKGPDSFKVLDYLIDHKIECI 179

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSE--HGLLAKELDVELYNYL 170
            GNH+  VLQ       LD     L E      I  D   ++    L +K+L      Y+
Sbjct: 180 LGNHEYYVLQYYANFHALDQPSFHLSETQPSSHIWIDGAFNDDPEYLFSKKLQPHHVKYI 239

Query: 171 LSCPIILD---IPEYD----LYVVHAGLLPDVPLFEQDPSDIMSMRNIKN---GKPTSKK 220
             C +I +   +P  D       VHAGL PD+ L  QDP D + MR++      + TS  
Sbjct: 240 NHCSVIKELGMVPVGDGVAPGVAVHAGLRPDLKLSRQDPIDNLEMRSLIGPFYNETTSDP 299

Query: 221 DVGHA--WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
           +   A  WSK +N+   ++ +   + YGHDA R LK+K Y+ GLDSGC  GG+L+A++ +
Sbjct: 300 NAPFAKSWSKIYNSKHGKAPAEYVVYYGHDAGRGLKLKEYTKGLDSGCDKGGKLTAVVIS 359

Query: 279 DNREIINVKCNK 290
            N++   ++  +
Sbjct: 360 SNKKKAKIRLEE 371



>gi|119183744|ref|XP_001242870.1| hypothetical protein CIMG_06766 [Coccidioides immitis RS]
          Length = 880

 Score =  129 bits (325), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 88/258 (34%), Positives = 135/258 (52%), Gaps = 36/258 (13%)

Query: 70  NLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNIL-- 127
           +L++K +++   DHLIF G+I+  GPKS+E VQL R   ASCVRGN++D++L  ++ L  
Sbjct: 620 SLLDKASFNRQTDHLIFTGNIITNGPKSVETVQLARKYNASCVRGNNEDRILLYRHELLT 679

Query: 128 --DFLDSQKIPLDEF-----------IKEHDIPKDIVK----SEHGLLAKELDVELYNYL 170
                     P  +F            K  +  ++I+      EH +LA++L  +   +L
Sbjct: 680 TGVLTGPNPRPNAKFESGGSAFEAGKTKPPEGDQEILPYGDYKEH-VLAQKLSDDDAAWL 738

Query: 171 LSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-NGKPTSKKDVGHA 225
             CP+IL + +     ++ VVH GL+P V L  QDP  +M+MR +  +    S +  G  
Sbjct: 739 HKCPVILKVGQINDLGEVVVVHGGLVPGVELENQDPLAVMTMRTLDVDTHVPSPRAKGMD 798

Query: 226 WSKHWNAAQQ---------ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
           W+K +N  Q           SS   T+IYGH   R   I+ ++ GLD+GCV GG+L+ALI
Sbjct: 799 WAKIFNKQQSLTVSTSKNPPSSQLTTVIYGHTPHRSPAIRRFTKGLDTGCVRGGKLTALI 858

Query: 277 WND--NREIINVKCNKYV 292
             +     I  V+C  YV
Sbjct: 859 ITEGGTTRIEQVRCKNYV 876



>gi|72393657|ref|XP_847629.1| diadenosine tetraphosphatase [Trypanosoma brucei brucei strain
           927/4 GUTat10.1]
 gi|62176778|gb|AAX70877.1| diadenosine tetraphosphatase, putative [Trypanosoma brucei]
 gi|70803659|gb|AAZ13563.1| diadenosine tetraphosphatase, putative [Trypanosoma brucei brucei
           strain 927/4 GUTat10.1]
          Length = 252

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 127/247 (51%), Gaps = 33/247 (13%)

Query: 44  NKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQL 103
           N +  P     +I +GD+HG   +L +L+  +++    D L+ VGD+V KGP S  VV+L
Sbjct: 8   NVVTLPNVTGRVIIVGDIHGCRAQLEDLLRAVSFKQGSDTLVAVGDLVNKGPDSFGVVRL 67

Query: 104 IRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELD 163
           ++ LGA  V GNHD K+L++   L           E +K  D      KS    LA+ + 
Sbjct: 68  LKRLGAYSVLGNHDAKLLKLVKKLGKK--------ECLKGRD-----AKSSLAPLAQSIP 114

Query: 164 VELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTS--- 218
            ++  YL   P I+ IP +++ V HAGL P  P+  Q   ++ +MRN+  K  + T    
Sbjct: 115 TDVETYLSQLPHIIRIPAHNVMVAHAGLHPQRPVDRQYEDEVTTMRNLIEKEQEATGGVT 174

Query: 219 ------KKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRL--KIKPYSFGLDSGCVYGG 270
                   D G  W+  W         P+T+++GHDA R L  + KP + GLDS CVYGG
Sbjct: 175 LTATEETNDGGKPWASMWRG-------PETVVFGHDARRGLQEQYKPLAIGLDSRCVYGG 227

Query: 271 ELSALIW 277
            LSA ++
Sbjct: 228 RLSAAVF 234



>gi|261330908|emb|CBH13893.1| diadenosine tetraphosphatase, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 252

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 127/247 (51%), Gaps = 33/247 (13%)

Query: 44  NKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQL 103
           N +  P     +I +GD+HG   +L +L+  +++    D L+ VGD+V KGP S  VV+L
Sbjct: 8   NVVTLPNVTGRVIIVGDIHGCRAQLEDLLRAVSFKQGSDTLVAVGDLVNKGPDSFGVVRL 67

Query: 104 IRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELD 163
           ++ LGA  V GNHD K+L++   L           E +K  D      KS    LA+ + 
Sbjct: 68  LKRLGAYSVLGNHDAKLLKLVKKLGKK--------ECLKGRD-----AKSSLAPLAQSIP 114

Query: 164 VELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTS--- 218
            ++  YL   P I+ IP +++ V HAGL P  P+  Q   ++ +MRN+  K  + T    
Sbjct: 115 TDVETYLSQLPHIIRIPAHNVMVAHAGLHPQRPVDRQYEDEVTTMRNLIEKEQEATGGVT 174

Query: 219 ------KKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRL--KIKPYSFGLDSGCVYGG 270
                   D G  W+  W         P+T+++GHDA R L  + KP + GLDS CVYGG
Sbjct: 175 LTATEETNDGGKPWASMWRG-------PETVVFGHDARRGLQEQYKPLAIGLDSRCVYGG 227

Query: 271 ELSALIW 277
            LSA ++
Sbjct: 228 RLSAAVF 234



>gi|260946455|ref|XP_002617525.1| hypothetical protein CLUG_02969 [Clavispora lusitaniae ATCC 42720]
 gi|238849379|gb|EEQ38843.1| hypothetical protein CLUG_02969 [Clavispora lusitaniae ATCC 42720]
          Length = 401

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 135/281 (48%), Gaps = 51/281 (18%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           ++ LI +GD+HG   E   L+ K+ Y+  KDHL+ +GD + KG  SI V++L+    A C
Sbjct: 128 RERLILVGDIHGQLKEFKKLLGKVKYNQEKDHLLVLGDFITKGRDSIGVLELLDEYNADC 187

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDI---------PKDIVKSEHGLLAKEL 162
           + GNH+  VL        LDS   P   F+ E+           P   ++    LLAK+L
Sbjct: 188 ILGNHEYYVLNNYARFHGLDS---PF--FVAENSTVPFRSLSVSPSGFIEDPEYLLAKKL 242

Query: 163 DVELYNYLLSCPIILDIPEYDLY--------------VVHAGLLPDV--PLFEQDPSDIM 206
             E   Y+  C +I  +    L+               VHAGL  D    L EQ+P D +
Sbjct: 243 QPEHIAYINKCSLIKKLGPVPLHSSRNNGKRKHADGLAVHAGLRLDALDNLNEQEPMDCL 302

Query: 207 SMR-------NIKNGKPTSKKDVGHAWSKHWNAAQQESS--SPKTIIYGHDASRRLKIKP 257
            MR       N     P  K  V  +WSK WNA Q+E S      + YGHDA R +K+K 
Sbjct: 303 EMRSYLAPHFNETTDDPHEKNAV--SWSKVWNAKQKEGSLDHEYIVYYGHDARRGVKLKK 360

Query: 258 YSFGLDSGCVYGGELSAL-IWND---------NREIINVKC 288
           ++ GLDSGCV G +LSA+ IW +           ++++V C
Sbjct: 361 WAKGLDSGCVRGDQLSAMVIWQEKTPKGHVLYKEQVVSVDC 401



>gi|443719866|gb|ELU09818.1| hypothetical protein CAPTEDRAFT_55531, partial [Capitella teleta]
          Length = 206

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 122/226 (53%), Gaps = 28/226 (12%)

Query: 55  LIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG--ASCV 112
           ++ IGDVHG +DEL +L+   N  P    L+F GDI+ +GPK+ EV+Q IR++G  A  V
Sbjct: 2   VVVIGDVHGCFDELQDLLRVHNLMPEDTVLVFCGDIINRGPKNQEVIQFIRNMGYAAYSV 61

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
           RGNH+D+V     I ++L+  K       K        + S++  +   L  E  ++L S
Sbjct: 62  RGNHEDRV-----IYEWLNFHKRSNGHVYK--------LPSKYKWVTT-LSSEDIDFLCS 107

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKK-----DVGHAWS 227
            P  L IP  +  V+HAG+ P   L +Q P D++  RNI N + T+ +     D G  W 
Sbjct: 108 LPYTLSIPCMETIVLHAGMDPWKCLCKQQPKDLVLTRNIVNPEETTYRLTDSLDDGVPWI 167

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELS 273
             WN        P+ + +GHDA R L+ + +  GLD+GCVYG  L+
Sbjct: 168 SCWNG-------PQHVYFGHDARRGLQERRFGTGLDTGCVYGNRLT 206



>gi|298709758|emb|CBJ31560.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 994

 Score =  127 bits (319), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 82/239 (34%), Positives = 125/239 (52%), Gaps = 27/239 (11%)

Query: 45  KLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLI 104
           + E+ L    ++ IGDVHG  +E+ +L+ K+ Y P    L  +GD+VAKGP S  VV+  
Sbjct: 715 RFESGLHPPRIVAIGDVHGCVNEMKDLVRKVEYWPGDLLLF-LGDLVAKGPNSAGVVRTA 773

Query: 105 RSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDV 164
           R LG   VRGNH+ +VL+  N+ +  + +                   S H  +A  L  
Sbjct: 774 RELGGVSVRGNHEFEVLRWLNVGENENGRG-----------------PSAHHQIAMSLGE 816

Query: 165 ELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTSKKDV 222
           +   +L + P      E D   VHAG +P V +  Q+P  +M+MR++  + G PTSK   
Sbjct: 817 DDGLWLKNSPWYFQCEELDALFVHAGFIPGVSMKRQNPRMMMNMRSLTLEGGAPTSKVVE 876

Query: 223 GHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNR 281
              W++ W       + P T+ +GHDA+R L++   + GLD+GCVYGG L+A I  + R
Sbjct: 877 NRPWAREW-------AGPDTVFFGHDAARGLQVLDQAMGLDTGCVYGGRLTACILPERR 928



>gi|261328575|emb|CBH11553.1| serine/threonine protein phosphatase, putative [Trypanosoma brucei
           gambiense DAL972]
          Length = 738

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 135/272 (49%), Gaps = 52/272 (19%)

Query: 31  NTHNFKPLNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDI 90
           N +  KP+  T+      P      I +GDVHG  ++L  L+ K+ +   KD LI VGD+
Sbjct: 259 NVNAHKPIIRTV------PPCDYRYIIVGDVHGCPEQLEELLLKVEFQQGKDCLIHVGDL 312

Query: 91  VAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQ-IKNILDFLDSQKIPLDEFIKEHDIPKD 149
           V KGP S+ VVQL+++ GA  V GNHD  +L  I  +     SQ+  +D  ++       
Sbjct: 313 VNKGPDSLAVVQLVQAKGAIGVLGNHDFTLLNCIARVKGKALSQQEEVDPVMR------- 365

Query: 150 IVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMR 209
                   LA        +Y+ S P IL IP+Y++ VVHAGL  +  L +Q+  +IM +R
Sbjct: 366 --------LASTFPQGCEDYIRSLPHILRIPQYNVIVVHAGLNVENSLEKQNVHEIMHLR 417

Query: 210 NIKNGKPTS-----------------------KKDVGHAWSKHWNAAQQESSSPKTIIYG 246
            ++    +S                       K   G  W + W       + P+ +++G
Sbjct: 418 RLERYTESSNNNNNNCGGKQQRNEKQRLRAVVKGSRGQPWGELW-------TGPECVVFG 470

Query: 247 HDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
           HDA   L+  P+++G+D+GCVYGG+L+A+++ 
Sbjct: 471 HDARAGLQELPFAYGIDTGCVYGGQLTAVVYG 502



>gi|72389785|ref|XP_845187.1| serine/threonine protein phosphatase [Trypanosoma brucei TREU927]
 gi|62360046|gb|AAX80468.1| serine/threonine protein phosphatase, putative [Trypanosoma brucei]
 gi|70801722|gb|AAZ11628.1| serine/threonine protein phosphatase, putative [Trypanosoma brucei
           brucei strain 927/4 GUTat10.1]
          Length = 734

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 135/272 (49%), Gaps = 52/272 (19%)

Query: 31  NTHNFKPLNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDI 90
           N +  KP+  T+      P      I +GDVHG  ++L  L+ K+ +   KD LI VGD+
Sbjct: 255 NVNAHKPIIRTV------PPCDYRYIIVGDVHGCPEQLEELLLKVEFQQGKDCLIHVGDL 308

Query: 91  VAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQ-IKNILDFLDSQKIPLDEFIKEHDIPKD 149
           V KGP S+ VVQL+++ GA  V GNHD  +L  I  +     SQ+  +D  ++       
Sbjct: 309 VNKGPDSLAVVQLVQAKGAIGVLGNHDFTLLNCIARVKGKALSQQEEVDPVMR------- 361

Query: 150 IVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMR 209
                   LA        +Y+ S P IL IP+Y++ VVHAGL  +  L +Q+  +IM +R
Sbjct: 362 --------LASTFPQGCEDYIRSLPHILRIPQYNVIVVHAGLNVENSLEKQNVHEIMHLR 413

Query: 210 NIKNGKPTS-----------------------KKDVGHAWSKHWNAAQQESSSPKTIIYG 246
            ++    +S                       K   G  W + W       + P+ +++G
Sbjct: 414 RLERYTESSNNNNNNCGGKQQRNEKQRLRAVVKGSRGQPWGELW-------TGPECVVFG 466

Query: 247 HDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
           HDA   L+  P+++G+D+GCVYGG+L+A+++ 
Sbjct: 467 HDARAGLQELPFAYGIDTGCVYGGQLTAVVYG 498



>gi|240277851|gb|EER41359.1| serine/threonine protein phosphatase [Ajellomyces capsulatus H143]
          Length = 414

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 73/166 (43%), Positives = 97/166 (58%), Gaps = 6/166 (3%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           +K LI IGDVHG  DEL  L+  +N++P + DHLIF GD++AKGPKS  VV L R   AS
Sbjct: 221 KKRLIVIGDVHGCLDELETLLQNVNFEPRQGDHLIFTGDLIAKGPKSTGVVDLARKFHAS 280

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKS-EHGLLAKELDVELYNY 169
           CVRGNH+D+VL  +  +    S K       +   I  DI  +     LA EL  E   +
Sbjct: 281 CVRGNHEDRVLLTRRHIQAEASTKSERSAAEEPDQIDDDIEPANRERALANELTDEQAKW 340

Query: 170 LLSCPIILDIP----EYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI 211
           L +CP++L +       ++ VVH GL+P + L  QDPS +MSMR I
Sbjct: 341 LDACPVMLKVGFIKHMGEVVVVHGGLVPGIDLESQDPSTVMSMRTI 386



>gi|453085236|gb|EMF13279.1| Metallo-dependent phosphatase [Mycosphaerella populorum SO2202]
          Length = 475

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 98/308 (31%), Positives = 151/308 (49%), Gaps = 75/308 (24%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
            ++ L+FIGD+HG   ELL L+ K+ ++   DHL+ VGD V KGP+++ V+  +  L A+
Sbjct: 178 GKRRLVFIGDIHGCKKELLKLLRKVEFNEDTDHLVLVGDTVTKGPENLGVLDELIRLNAT 237

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKIPLDEFIK-EHDIPKDIVKSEHGLLAKELDVELYNY 169
            VRGNH+D++L I        ++K+ LD  I  E +  K   +     L ++L+   + Y
Sbjct: 238 SVRGNHEDRLLHI--------AKKLRLDGSIPVEAESSKGYARD--AALVRQLEPRHFVY 287

Query: 170 LLSCPIILDIPEYDLY----------------VVHAGLLPDVPLFEQDPSDIMSMRNI-- 211
           +   P++L IP   +                 VVHAGL+P V L +QDP  +M+MR+I  
Sbjct: 288 MRQMPLMLQIPALPMARHPTRKTNSPITEHIIVVHAGLVPGVRLQKQDPYFVMNMRSING 347

Query: 212 -----------KNGKP--------------------------TSKKDVGH---AWS---- 227
                      KN KP                           S+ + G    +W+    
Sbjct: 348 RTHVPSALRDGKNAKPWYDIWCWYNDRIFRRHSMAGFPTDDLESEDEQGEDTPSWAVGLW 407

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN--DNREIIN 285
           K++    +    P+ +IYGHD+   L I  +S GLDSGCV GG+L+AL+ N    +E+ +
Sbjct: 408 KNFFGRSKVHPRPRVVIYGHDSKSGLVIHRWSKGLDSGCVGGGKLTALVLNAKGEQELFH 467

Query: 286 VKCNKYVD 293
           VKC  Y D
Sbjct: 468 VKCKNYRD 475



>gi|331245387|ref|XP_003335330.1| hypothetical protein PGTG_17183 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309314320|gb|EFP90911.1| hypothetical protein PGTG_17183 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 415

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 139/300 (46%), Gaps = 61/300 (20%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGP---KSIEVVQLIR 105
           P S   LI  GDVHG    L  L+  +N+DP  D ++ VGD+ AK P    S++ ++  R
Sbjct: 89  PNSDHRLITFGDVHGMGHSLKELLKNLNHDPQADTVLIVGDLAAKHPNIQASLDTIRYCR 148

Query: 106 SLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDE----------------FIKEHDIPKD 149
                 VRGNHD+ ++  +N ++   ++ +  D+                +++    P+D
Sbjct: 149 ESKFEAVRGNHDEYIIIWRNWMELNRAKFVEPDQVLGYNSDDHANLQSDLWLQASKPPQD 208

Query: 150 IVK---------SEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFE- 199
           + K         ++H  +A+ L    +++LL   + + +     Y VHAG+LP VP  E 
Sbjct: 209 LKKKLPNGMDWGTQHFEIARRLPKIDFHWLLERSLTIYVSPLRTYFVHAGMLPWVPPNEP 268

Query: 200 -----------------QDPSDIMSMRNIKNGK-PTSKKDVGHAWSKHWN---------- 231
                            ++   ++ MR +K G+ PT   + G  W K+WN          
Sbjct: 269 EADMAREVMSLLGVKENKESYTLLEMRGLKKGRRPTKDANKGKPWYKYWNKTMRSCNQTS 328

Query: 232 ----AAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVK 287
               AA+      + ++YGH A + L +KP+S GLDSGCVYG +LSAL+    R  +  K
Sbjct: 329 MTSSAARAWCERAQYVVYGHWAGKGLTVKPWSIGLDSGCVYGRQLSALVIGKPRASVTKK 388



>gi|342180789|emb|CCC90265.1| unnamed protein product [Trypanosoma congolense IL3000]
          Length = 250

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 88/254 (34%), Positives = 130/254 (51%), Gaps = 33/254 (12%)

Query: 46  LEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIR 105
           L  P     ++ +GD+HG   +L  L+  +++    D L+ VGD+V KGP S  VV+L++
Sbjct: 10  LTLPYVTGRVVVVGDIHGCRVQLEELLRAVSFKQGSDTLVAVGDLVNKGPDSYGVVRLLK 69

Query: 106 SLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVE 165
            LGA    GNHD K+L++   L    S K   D+       P          LA  +  +
Sbjct: 70  RLGAYSALGNHDAKLLKLTKKLRKYGSLK---DKHRSSTLAP----------LAASIPPD 116

Query: 166 LYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI------KNG----K 215
           +  YL   P I+  P ++L VVHAGL P  PL  QD  ++ +MRN+      K G     
Sbjct: 117 VEAYLSDLPHIIRFPAHNLIVVHAGLHPQRPLDGQDVEEVTTMRNLIDVGGDKAGVTLIA 176

Query: 216 PTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRL--KIKPYSFGLDSGCVYGGELS 273
               KD G  W+  W         P+T+++GHDA R L  + KP +FG+DS CVYGG LS
Sbjct: 177 TEETKDGGVPWASLWRG-------PETVVFGHDARRGLQEQYKPLAFGIDSRCVYGGNLS 229

Query: 274 ALIWNDNREIINVK 287
           A ++   + I++V+
Sbjct: 230 AAVFPGGK-IVSVR 242



>gi|488686074|ref|WP_002610293.1| metallophosphatase [Stigmatella aurantiaca]
 gi|115370569|gb|EAU69495.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Stigmatella
           aurantiaca DW4/3-1]
          Length = 304

 Score =  126 bits (317), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 126/242 (52%), Gaps = 36/242 (14%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
             I IGD+HG YDE L L+ K+     +D ++FVGD+V +GPK  E V+L  ++    ++
Sbjct: 73  RTIVIGDLHGCYDEALELLEKVGAT-SQDRILFVGDLVDRGPKPRECVEL--AMRHEAIQ 129

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNH++K LQ ++  D                    D +  +H    + L+ E ++Y+   
Sbjct: 130 GNHEEKHLQQRHRAD--------------------DRLTPDHLETRRALEPEHFDYMARL 169

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNGKPTSKKDVGHAWSK 228
           P  L +PEY+  VVHAG++P   L +QDP  ++  + I     K+  P+        W+ 
Sbjct: 170 PFYLRLPEYNAAVVHAGVMPGKRLEDQDPYHLLHAQCIRPPESKSHWPSKAPSTHRFWTH 229

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKC 288
           HW       + P+ II+GH    +  + P++ G+D+GCVYG  L+A++   + E+++V  
Sbjct: 230 HW-------TGPERIIFGHTVFDQPLVTPHAVGIDTGCVYGRSLTAVVL-PSWELVSVPA 281

Query: 289 NK 290
            +
Sbjct: 282 RR 283



>gi|388579569|gb|EIM19891.1| Metallo-dependent phosphatase [Wallemia sebi CBS 633.66]
          Length = 337

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 124/245 (50%), Gaps = 40/245 (16%)

Query: 70  NLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDF 129
           +L+ ++ +D   D LI +GDIV KGP+S  V+Q +  + A  VRGNHD KV++ K   D 
Sbjct: 7   HLLQELEFDEEFDTLISLGDIVNKGPESTPVIQKLSDINALAVRGNHDQKVIEWKAWFDQ 66

Query: 130 LDSQKIPLDEFIKEHDIPKDI-------------VKSEHGLLAKELDVELYNYLLSCPII 176
           ++S K   +    E   PK++              +  H  +AKEL+     YL + P++
Sbjct: 67  VESVKGGKEWL--ELGAPKNLKPKRALSLPKSWEWQGPHFQIAKELNDTTKEYLFNTPVL 124

Query: 177 LDIPEYDLYVVHAGLLPDVP--------------------LFEQDPSDIMSMRNI-KNGK 215
           L IP++DLY VHAG+L   P                    + +  P +++ MR+I   GK
Sbjct: 125 LHIPQHDLYAVHAGMLSHDPTKPKSAINPNHVNGDIDLWSIPQNTPDNMIEMRSIDPMGK 184

Query: 216 PTSKKDVGHAWSKHWNAAQQESSS----PKTIIYGHDASRRLKIKPYSFGLDSGCVYGGE 271
           P  K   G  W ++WN   +        P  IIYGH A+R L +  Y++GLD+GC  G  
Sbjct: 185 PIKKPKGGVKWYEYWNKDMETCHGDKCIPHRIIYGHAAARGLDLNEYTYGLDTGCCQGRR 244

Query: 272 LSALI 276
           L+A++
Sbjct: 245 LTAMV 249



>gi|310819558|ref|YP_003951916.1| ser/thr protein phosphatase family protein [Stigmatella aurantiaca
           DW4/3-1]
 gi|503140477|ref|WP_013375138.1| metallophosphatase [Stigmatella aurantiaca]
 gi|309392630|gb|ADO70089.1| Ser/Thr protein phosphatase family protein [Stigmatella aurantiaca
           DW4/3-1]
          Length = 235

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 126/240 (52%), Gaps = 36/240 (15%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           I IGD+HG YDE L L+ K+     +D ++FVGD+V +GPK  E V+L  ++    ++GN
Sbjct: 6   IVIGDLHGCYDEALELLEKVGATS-QDRILFVGDLVDRGPKPRECVEL--AMRHEAIQGN 62

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           H++K LQ ++  D                    D +  +H    + L+ E ++Y+   P 
Sbjct: 63  HEEKHLQQRHRAD--------------------DRLTPDHLETRRALEPEHFDYMARLPF 102

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNGKPTSKKDVGHAWSKHW 230
            L +PEY+  VVHAG++P   L +QDP  ++  + I     K+  P+        W+ HW
Sbjct: 103 YLRLPEYNAAVVHAGVMPGKRLEDQDPYHLLHAQCIRPPESKSHWPSKAPSTHRFWTHHW 162

Query: 231 NAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNK 290
                  + P+ II+GH    +  + P++ G+D+GCVYG  L+A++   + E+++V   +
Sbjct: 163 -------TGPERIIFGHTVFDQPLVTPHAVGIDTGCVYGRSLTAVVL-PSWELVSVPARR 214



>gi|485625953|gb|EOD21753.1| hypothetical protein EMIHUDRAFT_45167, partial [Emiliania huxleyi
           CCMP1516]
          Length = 211

 Score =  126 bits (316), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 122/229 (53%), Gaps = 30/229 (13%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL------GA 109
           + IGDVHG + EL  ++ +++  P  D ++FVGD+++KGP  +  ++L R+       G+
Sbjct: 3   MVIGDVHGCHRELQQMLARLSPGP-SDRVVFVGDVISKGPDPVASLRLARNTVAAAAAGS 61

Query: 110 SCVRGNHDDKVLQIKNILDFLDS--QKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
             + GNH+      +N+L +L    Q +P  +     +  +        +  ++L     
Sbjct: 62  EILVGNHE------RNLLTWLKQRDQGVPAGKRSGSGEGNR--------MTGEQLTRGEV 107

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVGHAWS 227
            +L   P  L +PE++  V HAGL   VPL +Q  +D+ +MR++      S      +W+
Sbjct: 108 EWLRGRPDRLALPEHNAIVAHAGLRAGVPLAQQQHADLTAMRSLDAAGLPSPTAGAVSWA 167

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
             W         P  +I+GHD+ RRL++ P++ G+D+GCVYGG+L+AL+
Sbjct: 168 ASWRG-------PTHVIFGHDSRRRLQLHPFATGIDTGCVYGGQLTALV 209



>gi|342183111|emb|CCC92591.1| putative diadenosine tetraphosphatase [Trypanosoma congolense
           IL3000]
          Length = 250

 Score =  126 bits (316), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 88/254 (34%), Positives = 131/254 (51%), Gaps = 33/254 (12%)

Query: 46  LEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIR 105
           L  P     ++ +GD+HG   +L  L+  +++    D L+ VGD+V KGP S  VV+L++
Sbjct: 10  LTLPHVTGRVVVVGDIHGCRVQLEELLRAVSFRQGSDTLVAVGDLVNKGPDSYGVVRLLK 69

Query: 106 SLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVE 165
            LGA    GNHD K+L++   L    S K   D+       P          LA  +  +
Sbjct: 70  RLGAYSALGNHDAKLLKLTKKLRKYGSLK---DKHRSSTLAP----------LAASIPPD 116

Query: 166 LYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI------KNG----K 215
           +  YL   P I+ +P ++L VVHAGL P  PL  QD  ++ +MRN+      K G     
Sbjct: 117 VEAYLSDLPHIIRLPAHNLIVVHAGLHPQRPLDGQDVEEVTTMRNLIDVGGDKAGVTLIA 176

Query: 216 PTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRL--KIKPYSFGLDSGCVYGGELS 273
               KD G  W+  W         P+T+++GHDA R L  + KP +FG+DS CVYGG LS
Sbjct: 177 TEETKDGGVPWASLWRG-------PETVVFGHDARRGLQEQYKPLAFGIDSRCVYGGNLS 229

Query: 274 ALIWNDNREIINVK 287
           A ++   + I++V+
Sbjct: 230 AAVFPGGK-IVSVR 242



>gi|342879241|gb|EGU80496.1| hypothetical protein FOXB_08956 [Fusarium oxysporum Fo5176]
          Length = 435

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 129/285 (45%), Gaps = 65/285 (22%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           + L+ +GD+HG  D    L+ KI ++   DH+I VGD++ KGPKS EVV  +  L AS V
Sbjct: 88  RRLVVVGDIHGMLDPFEKLLKKIEFNLKTDHVIAVGDMINKGPKSSEVVARLMELKASAV 147

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
           RGNH+D+V+     L    S +  +  ++   D  K   +  +   A+ L      +L +
Sbjct: 148 RGNHEDRVILAWRGL----SSQQGVAAYLDTKDAAKHRGEEAYLKTARSLSEAQMTWLRN 203

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQD------------------------------- 201
            P+I+      LY VHAGL+P VPL +QD                               
Sbjct: 204 LPVIISAESMALYFVHAGLVPGVPLPQQDAWAAEKQRQKELAKAQEDAQAKFQQRSFVPG 263

Query: 202 ----------------PSD----IMSMRNIKNGKPTSKKDV-----GHA---WSKHWNAA 233
                           P+D    ++S       +    +DV     GH    W+  WN+ 
Sbjct: 264 EEGTDSHAHAARAEPAPADSAGAVLSTDEAAAERTNPDRDVWIPIDGHEGERWTDLWNSE 323

Query: 234 QQESSSP--KTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
           Q++   P  +++IYGHDA    +   Y+FGLDSGCV G  L+AL+
Sbjct: 324 QRKLRGPDRRSVIYGHDAKMGYQEDSYTFGLDSGCVKGNALTALV 368



>gi|68488001|ref|XP_712159.1| hypothetical protein CaO19.6707 [Candida albicans SC5314]
 gi|68488052|ref|XP_712134.1| hypothetical protein CaO19.13999 [Candida albicans SC5314]
 gi|77023026|ref|XP_888957.1| hypothetical protein CaO19_6707 [Candida albicans SC5314]
 gi|46433502|gb|EAK92940.1| hypothetical protein CaO19.13999 [Candida albicans SC5314]
 gi|46433529|gb|EAK92966.1| hypothetical protein CaO19.6707 [Candida albicans SC5314]
 gi|76573770|dbj|BAE44854.1| hypothetical protein [Candida albicans]
          Length = 388

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 128/258 (49%), Gaps = 30/258 (11%)

Query: 55  LIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRG 114
           +I IGD+HG Y E   L+ KINY+  KDHLI +GD ++KGP S + +  + +    CV G
Sbjct: 115 IILIGDIHGHYIEFRKLLTKINYNKHKDHLIVLGDFISKGPDSFKTLDYLINNNIDCVLG 174

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSE-HGLLAKELDVELYNYLLSC 173
           NH+  +LQ       LD       E   +    KD    +   LLAK+L+     Y+ +C
Sbjct: 175 NHEYYILQNYATFHGLDQPNFSSSE--SQPIAVKDSFNDDPEFLLAKKLEPHHVKYINNC 232

Query: 174 PII-----------------LDIPEYDLYV-VHAGLLPDVPLFEQDPSDIMSMR------ 209
            II                  D  +Y   + VHAG+ PD+PL +QDP D + MR      
Sbjct: 233 SIIKKLGYVPNPKGKKKNKVGDGADYSQGIAVHAGIRPDLPLDQQDPIDNLEMRSLIGPF 292

Query: 210 -NIKNGKPTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVY 268
            N     PT       +WSK +N+   E  +   + YGHDA R LKIK ++ GLDS C  
Sbjct: 293 YNETTADPTIPN--SKSWSKIYNSKNGEYPADYIVYYGHDAGRGLKIKKFTKGLDSRCDR 350

Query: 269 GGELSALIWNDNREIINV 286
            G+LSA++ +  +  ++V
Sbjct: 351 NGKLSAMVISKKQVTVDV 368



>gi|225554541|gb|EEH02838.1| serine/threonine phosphatase [Ajellomyces capsulatus G186AR]
          Length = 431

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 112/205 (54%), Gaps = 11/205 (5%)

Query: 35  FKPLNYTLINKLEAPLS----QKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGD 89
            + L+ TL+   + P +    +K LI IGDVHG  DEL  L+  +N++P + DHLIF GD
Sbjct: 215 LRSLDPTLLPGEKEPTADNPHKKRLIVIGDVHGCLDELETLLQNVNFEPRQGDHLIFTGD 274

Query: 90  IVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKD 149
           ++AKGPKS  VV L R   ASCVRGNH+D+VL  +  +    S K       +   I  D
Sbjct: 275 LIAKGPKSTGVVDLARKFHASCVRGNHEDRVLLTRRHIQAEASTKSERSAAEEPDQIDDD 334

Query: 150 IVKS-EHGLLAKELDVELYNYLLSCPIILDIP----EYDLYVVHAGLLPDVPLFEQDPSD 204
           I  +     LA EL  E   +L +CP++L +       ++ VVH GL+P + L  QDPS 
Sbjct: 335 IEPANRERALANELTDEQAKWLDACPVMLKVGFIKHMGEVVVVHGGLVPGIDLESQDPST 394

Query: 205 IMSMRNIK-NGKPTSKKDVGHAWSK 228
           +MSMR I       S    G +W+K
Sbjct: 395 VMSMRTIDIFSHVPSASSKGVSWTK 419



>gi|384250237|gb|EIE23717.1| Metallo-dependent phosphatase [Coccomyxa subellipsoidea C-169]
          Length = 310

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 125/251 (49%), Gaps = 43/251 (17%)

Query: 37  PLNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPK 96
           P++ TL     A L    +I IGDVHG   EL  L++K  +    D ++FVGD+V KG +
Sbjct: 48  PVHATLT---PAELGDGQIIVIGDVHGCPVELNALLDKCKFQQGSDKVVFVGDLVNKGEQ 104

Query: 97  SIEVVQLIRSLGASCVRGNHDDKVLQIKNI---LDFLDSQKIPLDEFIKEHDIPKDIVKS 153
           S E V L R +G   VRGNHD+  L+   +      LD +   L++F +E          
Sbjct: 105 SAEAVHLARQIGGISVRGNHDEMALERYEMWKKCGRLDPKYKYLEQFSEE---------- 154

Query: 154 EHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK- 212
                    DVE   Y    P  L IP + + VVHAG++P  PL +Q   D+++MR++  
Sbjct: 155 ---------DVE---YFRQMPFSLSIPSHGVLVVHAGIVPGTPLEDQLLDDLINMRHVGA 202

Query: 213 -------NGKPTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSG 265
                     P   +  G  W+  +N        P+ +I+GH A RRL+   ++ G+D+G
Sbjct: 203 EGGANRYKALPKFPRSAGQPWANIYNG-------PQHVIFGHHARRRLQPCRFATGIDTG 255

Query: 266 CVYGGELSALI 276
           CV G +L+A++
Sbjct: 256 CVLGDQLTAVV 266



>gi|157835946|pdb|2QJC|A Chain A, Crystal Structure Of A Putative Diadenosine
           Tetraphosphatase
          Length = 262

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 126/247 (51%), Gaps = 33/247 (13%)

Query: 44  NKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQL 103
           N +  P     +I +GD+HG   +L +L+  +++    D L+ VGD+V KGP S  VV+L
Sbjct: 10  NVVTLPNVTGRVIIVGDIHGCRAQLEDLLRAVSFKQGSDTLVAVGDLVNKGPDSFGVVRL 69

Query: 104 IRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELD 163
           ++ LGA  V GNHD K+L++   L           E +K  D      KS    LA+ + 
Sbjct: 70  LKRLGAYSVLGNHDAKLLKLVKKLGKK--------ECLKGRD-----AKSSLAPLAQSIP 116

Query: 164 VELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI--KNGKPTS--- 218
            ++  YL   P I+ IP +++ V HAGL P  P+  Q   ++ + RN+  K  + T    
Sbjct: 117 TDVETYLSQLPHIIRIPAHNVXVAHAGLHPQRPVDRQYEDEVTTXRNLIEKEQEATGGVT 176

Query: 219 ------KKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRL--KIKPYSFGLDSGCVYGG 270
                   D G  W+  W         P+T+++GHDA R L  + KP + GLDS CVYGG
Sbjct: 177 LTATEETNDGGKPWASXWRG-------PETVVFGHDARRGLQEQYKPLAIGLDSRCVYGG 229

Query: 271 ELSALIW 277
            LSA ++
Sbjct: 230 RLSAAVF 236



>gi|328852249|gb|EGG01396.1| hypothetical protein MELLADRAFT_75613 [Melampsora larici-populina
           98AG31]
          Length = 394

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 135/290 (46%), Gaps = 61/290 (21%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPK---SIEVVQLI 104
            P +   LI +GD+HG    L  L+ +I+Y+   D +  +GD+ AK P    S++ ++  
Sbjct: 70  TPTNSTRLIVVGDIHGMVHSLKKLLRRIDYNSTTDQVFLLGDLAAKHPSIDSSLQTIRFA 129

Query: 105 RSLGASCVRGNHDDKVLQIKNILDF---LDSQKIPLDEFIK--------------EHDIP 147
           R    + +RGNHD  ++  +N ++      SQ I  DE ++              +  +P
Sbjct: 130 RESNFTVIRGNHDQDIIAWRNWMNEHKKYQSQIIGEDESLEHLPEFMSDQPTSSLKRKLP 189

Query: 148 KDI-VKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLL------------PD 194
           K    K +H  +A+ L  + + +LLS  +   +P  + Y VHAGLL            P 
Sbjct: 190 KGWKWKGQHFEIARRLPRKDFEWLLSLCLTYHLPALNTYFVHAGLLAWDPSRSVRGASPT 249

Query: 195 VPLFEQ------------DPSDIMSMRNIKNGK-PTSKKDVGHAWSKHWNAAQQ------ 235
             L +Q            DP  ++ MR ++ G+ PTS    G  W + WN A +      
Sbjct: 250 SFLDDQVQHSILQIDQNRDPLTLIEMRGVRKGRRPTSSGKKGTPWFELWNEAMEGCGTHL 309

Query: 236 ---------ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
                    +   P  +IYGH A++ L ++P+S GLDSGCVYG  LSA+I
Sbjct: 310 GEEPVGEDGKCGGPLNVIYGHWAAKGLTLRPWSSGLDSGCVYGRGLSAMI 359



>gi|190347218|gb|EDK39453.2| hypothetical protein PGUG_03551 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 366

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 137/282 (48%), Gaps = 43/282 (15%)

Query: 46  LEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIR 105
           L +  S++ LI IGDVHG Y     L+ K+N++   DHL+ +GD + KGP SI+++  + 
Sbjct: 89  LNSKGSKQRLILIGDVHGHYKPFRKLLRKVNFNNKTDHLLLLGDFITKGPHSIKMLDYLI 148

Query: 106 SLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHG-------LL 158
                C+ GNH+  V+        LD    P   F+   D  K++ ++  G       LL
Sbjct: 149 EHKVDCIIGNHEYYVMNNYARFHNLDP---PF--FVGNEDDNKNVFETNGGFNDDPEYLL 203

Query: 159 AKELDVELYNYLLSCPIILD---IPEY-----------DLYVVHAGLLPDVPLFE-QDPS 203
           AK+L      Y+  C +I     +P++           D   VH GL  D+P  E Q   
Sbjct: 204 AKKLQPHHIEYINQCAVIKTLGPVPQHKAKNEGSHKYSDGIAVHGGLRWDIPDLESQHAV 263

Query: 204 DIMSMRNI-----KNGKPTSKKDVGHAWSKHWNAAQQES--SSPKTIIYGHDASRRLKIK 256
           + + MR++            + D   +WSK WN  Q+E   +  K + YGHDA R L +K
Sbjct: 264 ECLEMRSLIGPYFNESTDDPRADRAVSWSKIWNLKQKEKNDTDTKVVYYGHDARRGLNLK 323

Query: 257 PYSFGLDSGCVYGGELSAL-IWND--------NREIINVKCN 289
            ++ GLDSGC  GG+LSA+ IW +          +II V+C+
Sbjct: 324 RFAKGLDSGCDTGGDLSAMVIWQEKARKRVMYKEQIIQVQCD 365



>gi|342183098|emb|CCC92578.1| unnamed protein product [Trypanosoma congolense IL3000]
          Length = 250

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 87/254 (34%), Positives = 130/254 (51%), Gaps = 33/254 (12%)

Query: 46  LEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIR 105
           L  P     ++ +GD+HG   +L  L+  +++    D L+ VGD+V KGP S  VV+L++
Sbjct: 10  LTLPYVTGRVVVVGDIHGCRVQLEELLRAVSFRQGSDTLVAVGDLVNKGPDSYGVVRLLK 69

Query: 106 SLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVE 165
            LGA    GNHD K+L++   L    S K   D+       P          LA  +  +
Sbjct: 70  RLGAYSALGNHDAKLLKLTKKLRKYGSLK---DKHRSSTLAP----------LAASIPPD 116

Query: 166 LYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI------KNG----K 215
           +  YL   P I+ +P ++L VVHAGL P  PL  QD  ++ +MRN+      K G     
Sbjct: 117 VEAYLSGLPHIIRLPAHNLIVVHAGLHPQRPLDGQDVEEVTTMRNLIDVGGDKAGVTLIA 176

Query: 216 PTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRL--KIKPYSFGLDSGCVYGGELS 273
               KD G  W+  W         P+T+++GHDA R L  + KP + G+DS CVYGG LS
Sbjct: 177 TEETKDGGVPWASLWRG-------PETVVFGHDARRGLQEQYKPLAVGIDSRCVYGGNLS 229

Query: 274 ALIWNDNREIINVK 287
           A ++   + I++V+
Sbjct: 230 AAVFPGGK-IVSVR 242



>gi|390347097|ref|XP_001199366.2| PREDICTED: bis(5'-nucleosyl)-tetraphosphatase, symmetrical-like
           [Strongylocentrotus purpuratus]
          Length = 385

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/263 (31%), Positives = 126/263 (47%), Gaps = 34/263 (12%)

Query: 35  FKPLNYTLINKLEAPLSQ-----KNLIFIGDVHGSYDELLNLINKINYDPLKDHL-IFVG 88
            K L + +  K    LS+     K +  IGDVHG YD LL L++  + D   + L IFVG
Sbjct: 126 LKELTFPIPTKPHLTLSEDDVAGKRIFVIGDVHGCYDNLLTLLHVADIDKNPNALLIFVG 185

Query: 89  DIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPK 148
           DI+ KGPKS+EV+  +RS  +  V GNH+   ++   ++      +            PK
Sbjct: 186 DIINKGPKSLEVLNFVRSSNSYSVMGNHERAAVRKLRLIKMNVGYE------------PK 233

Query: 149 DIVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSM 208
              +  H L   +     Y YL   P  + IP  +  +VH GLLP  PL E    +++ M
Sbjct: 234 ASKQWLHDLNGSD-----YEYLQELPYTISIPSLNAVIVHGGLLPGKPLEEHTQDEMLLM 288

Query: 209 RNI----KNGKPTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDS 264
           RNI       K T     G  W + W         P+ + +GH A   L+  PY+ GLD+
Sbjct: 289 RNIIVEGNELKATKHISQGQLWGELWKG-------PRHVYFGHHALEGLQRYPYATGLDT 341

Query: 265 GCVYGGELSALIWNDNREIINVK 287
           GCVY G L+ +    ++++++VK
Sbjct: 342 GCVYHGSLTGVFLTGDKKLVSVK 364



>gi|344299540|gb|EGW29893.1| hypothetical protein SPAPADRAFT_52747 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 359

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/269 (31%), Positives = 136/269 (50%), Gaps = 32/269 (11%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI IGDVH  Y EL +L+ K+ YD  +D+++ +GD + KGP SI+V+  +      C+ 
Sbjct: 91  RLILIGDVHAHYTELQHLLKKVKYDRKQDYVVMLGDFITKGPDSIKVLDYLIDNEIDCIM 150

Query: 114 GNHDDKVLQIKNILDFLDSQKIPL--DEFIKEHDIPKDIVKSE-HGLLAKELDVELYNYL 170
           GNH+  VLQ   I   L   +  L  D F+      KD   ++   LLAK+L  +   Y+
Sbjct: 151 GNHEYNVLQNYAIFHGLQQPQFELVPDAFVPSTIRIKDSFNNDPEFLLAKKLQPKHIQYI 210

Query: 171 LSCPIILDIPEYDLY------------VVHAGLLPDVPLFEQDPSDIMSMRNIKN---GK 215
             C +I  + +  +              VHAG+  D+ L  QDP + + MR+       +
Sbjct: 211 NKCSVIKRLGDTPIMGKNKPKGVIPGIAVHAGIRWDITLSAQDPEENLEMRSFIGPYYNE 270

Query: 216 PTSKKDVGHA--WSKHWNAAQQESSSPK--TIIYGHDASRRLKIKPYSFGLDSGCVYGGE 271
            TS   +  A  WSK +N  Q+E  + +  ++ YGHDA R L +K Y+ GLD+ C  GGE
Sbjct: 271 TTSDPSLPDAVSWSKIYNMKQKEGEAVERVSVYYGHDARRGLSLKEYTKGLDTRCSRGGE 330

Query: 272 LSALIWNDN----------REIINVKCNK 290
           L+A++ + +           E ++V+C +
Sbjct: 331 LTAMVISSDLGKHDEVVYTEETVSVQCQE 359



>gi|115398746|ref|XP_001214962.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114191845|gb|EAU33545.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 353

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/166 (42%), Positives = 104/166 (62%), Gaps = 8/166 (4%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           SQ+ LI IGDVHG   EL  L+++++++   DHLIF GD++ KGP S+ VV L R   AS
Sbjct: 166 SQRRLIVIGDVHGCKTELDRLLDEVSFNHEHDHLIFTGDMINKGPDSLGVVDLARQYSAS 225

Query: 111 CVRGNHDDKVLQIKN-ILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
           CVRGNH+D+VL +++ +L    S    L +   E  +P+D  + +   LA+EL  E   +
Sbjct: 226 CVRGNHEDRVLLLRHEMLTSNSSVNASLGDPNGEPFLPQDTQERQ---LARELTDEQAEW 282

Query: 170 LLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI 211
           L +CP+ILD+ +      + VVHAGL+P V L +QDP   M+MR +
Sbjct: 283 LDTCPVILDVGQIANMGQVVVVHAGLVPGVDLEKQDPYSAMNMRTV 328



>gi|146416401|ref|XP_001484170.1| hypothetical protein PGUG_03551 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 366

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 136/282 (48%), Gaps = 43/282 (15%)

Query: 46  LEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIR 105
           L +  S++ LI IGDVHG Y     L+ K+N++   DHL+ +GD + KGP SI+++  + 
Sbjct: 89  LNSKGSKQRLILIGDVHGHYKPFRKLLRKVNFNNKTDHLLLLGDFITKGPHSIKMLDYLI 148

Query: 106 SLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHG-------LL 158
                C+ GNH+  V+        LD    P   F+   D  K++ ++  G       LL
Sbjct: 149 EHKVDCIIGNHEYYVMNNYARFHNLDP---PF--FVGNEDDNKNVFETNGGFNDDPEYLL 203

Query: 159 AKELDVELYNYLLSCPIILD---IPEY-----------DLYVVHAGLLPDVPLFE-QDPS 203
           AK+L      Y+  C +I     +P++           D   VH GL  D+P  E Q   
Sbjct: 204 AKKLQPHHIEYINQCAVIKTLGPVPQHKAKNEGSHKYSDGIAVHGGLRWDIPDLESQHAV 263

Query: 204 DIMSMRNI-----KNGKPTSKKDVGHAWSKHWNAAQQES--SSPKTIIYGHDASRRLKIK 256
           + + MR++            + D    WSK WN  Q+E   +  K + YGHDA R L +K
Sbjct: 264 ECLEMRSLIGPYFNESTDDPRADRAVLWSKIWNLKQKEKNDTDTKVVYYGHDARRGLNLK 323

Query: 257 PYSFGLDSGCVYGGELSAL-IWND--------NREIINVKCN 289
            ++ GLDSGC  GG+LSA+ IW +          +II V+C+
Sbjct: 324 RFAKGLDSGCDTGGDLSAMVIWQEKARKRVMYKEQIIQVQCD 365



>gi|428177123|gb|EKX46004.1| hypothetical protein GUITHDRAFT_56118, partial [Guillardia theta
           CCMP2712]
          Length = 217

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 121/238 (50%), Gaps = 41/238 (17%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            ++ +GDVHG  DEL  L+   + +   D LI  GD+V KGPKS+EVV+L R + A  V 
Sbjct: 2   RVMIVGDVHGCCDELEELLRLHHKEG--DLLILAGDLVNKGPKSVEVVRLARRMNAMAVV 59

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNH     +I ++  +          F +     KD+   E       L VE   ++ S 
Sbjct: 60  GNH-----EISSLRGY----------FARSGGKVKDV--EEKYEWTDGLCVEDVEFIRSL 102

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK---NGKPTSKK---------- 220
           P  + IP Y++ VVHAGL+PD+ L EQD   +++MRN++    G+  S+           
Sbjct: 103 PFTISIPSYNVIVVHAGLVPDLSLAEQDHRHMVTMRNLRVCNAGEEESETCRTRYEALEL 162

Query: 221 --DVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
              V   W+  W         P  + +GHDA RRL++  ++ GLD+GC+YG  LSA I
Sbjct: 163 DDGVSEPWAALWKG-------PSHVYFGHDAKRRLQLYKHATGLDTGCLYGDRLSAAI 213



>gi|241957611|ref|XP_002421525.1| calcineurin-like phosphoesterase, putative; metallophosphoesterase,
           putative; serine/threonine protein phosphatase, putative
           [Candida dubliniensis CD36]
 gi|223644869|emb|CAX40865.1| calcineurin-like phosphoesterase, putative [Candida dubliniensis
           CD36]
          Length = 388

 Score =  123 bits (308), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 87/260 (33%), Positives = 129/260 (49%), Gaps = 29/260 (11%)

Query: 55  LIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRG 114
           +I IGD+HG Y E   L+ KI+Y+  KDHLI +GD ++KGP S + +  + +    CV G
Sbjct: 114 IILIGDIHGHYIEFRKLLTKIHYNKHKDHLIVLGDFISKGPDSFKTLNYLINNNIDCVLG 173

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NH+  +LQ       LD       +  +   I          LLAK+L+     Y+ +C 
Sbjct: 174 NHEYYILQNYATFHGLDQPNFSSSKG-QSITIKDSFNDDPEFLLAKKLEPHQVKYINNCS 232

Query: 175 IILDIP-----------------EYDLYV-VHAGLLPDVPLFEQDPSDIMSMR------- 209
           II  +                  +Y   + VHAG+ PD+PL +QDP D + MR       
Sbjct: 233 IIKKLGYVPNPKGKSKNSIGGDNKYSQGIAVHAGIRPDLPLDQQDPIDNLEMRSLVGPFY 292

Query: 210 NIKNGKPTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYG 269
           N     PT       +WSK +N+   E  +   + YGHDA R LKIK ++ GLDS C   
Sbjct: 293 NETTSDPTMPN--SKSWSKIYNSKNGEYPADYIVYYGHDAGRGLKIKKFTKGLDSRCDRN 350

Query: 270 GELSALIWNDNREIINVKCN 289
           G+LSA++ +  +E+ +V+ N
Sbjct: 351 GKLSAMVIS-KQEVGDVETN 369



>gi|255731924|ref|XP_002550886.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240131895|gb|EER31454.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 357

 Score =  122 bits (307), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 88/255 (34%), Positives = 130/255 (50%), Gaps = 21/255 (8%)

Query: 55  LIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRG 114
           +I IGD+HG Y E   L++K+ Y+P  D ++ +GD + KGP S +V+  +      C+ G
Sbjct: 103 IILIGDIHGHYIEFRKLLSKLKYNPKDDQVVVLGDFITKGPDSFKVLDYLIKNNIECILG 162

Query: 115 NHDDKVLQIKNILDFLDSQKI----PLDEFIKEHDIP---KDIVKSE-HGLLAKELDVEL 166
           NH+  VLQ       LD  +     P+D        P   KD    +   LLAK+L    
Sbjct: 163 NHEYYVLQYYATFHGLDQPEFMFNNPIDLSSSSLTTPISTKDSFNDDPEFLLAKKLQPHH 222

Query: 167 YNYLLSCPIIL---DIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI---KNGKPTSKK 220
             Y+ +C II    D+P      VHAG++P + L  Q+P D + MR +      + TS  
Sbjct: 223 IKYINNCSIIKKLGDVPNGKGVAVHAGIVPQLSLKNQNPIDNLEMRALIPPLFNETTSDP 282

Query: 221 DVGHA--WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSAL-IW 277
            V  A  WSK +N+ + +  +   + YGHDA + L +K ++ GLDSGC  G +LSA+ I 
Sbjct: 283 HVPGAKRWSKIYNSMKGKYPADNIVYYGHDAGKGLNLKSFTKGLDSGCDKGQKLSAMVIS 342

Query: 278 NDNR----EIINVKC 288
            D R    E+I V C
Sbjct: 343 KDGRKLIEEVIQVNC 357



>gi|384245243|gb|EIE18738.1| Metallo-dependent phosphatase [Coccomyxa subellipsoidea C-169]
          Length = 373

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 116/239 (48%), Gaps = 35/239 (14%)

Query: 47  EAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRS 106
           E  +    LI IGDVHG   EL  L+ +  Y   +D ++ VGD+V KGP  +EV+   R 
Sbjct: 119 EDAIGPGRLIIIGDVHGCVKELKELLEEAEYVEGEDTVVLVGDLVDKGPYPLEVLAEARR 178

Query: 107 LGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVEL 166
           L    VRGNHDD+VL     L     + +P  +                    K+L    
Sbjct: 179 LKFHSVRGNHDDEVLAAYEAL--ARGKHVPGGKK-----------------WVKDLPAAA 219

Query: 167 YNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNG------KPTSKK 220
             +L + P  L IP Y + VVHAG++PDVPL  Q   D+  MR + NG         +K 
Sbjct: 220 AQWLHALPFSLRIPSYGVTVVHAGIVPDVPLERQSLGDMYLMREVVNGTNGRWRAEEAKC 279

Query: 221 DVGH---AWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
           D GH    W+  W+        P+ I +GHD  R L+ +PY+ GLD+GC YG  L+A +
Sbjct: 280 DRGHLGPPWAAVWD-------GPEHIYFGHDHQRGLQERPYATGLDTGCCYGDRLTAAV 331



>gi|313237824|emb|CBY12957.1| unnamed protein product [Oikopleura dioica]
          Length = 301

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 129/254 (50%), Gaps = 39/254 (15%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYD-----PLKD---HLIFVGDIVAKGPKSIEVVQ 102
           + + ++ IGD+HG +DE   L+ KI  +     P++     L  VGD+V KGPKS EVV+
Sbjct: 61  TDRPVVVIGDIHGCFDEFEELLVKIKDEIYGGRPMEHSTFQLFLVGDLVNKGPKSAEVVK 120

Query: 103 LIRSLGAS----CVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLL 158
            +R++  S     VRGNH++ +L+  +  + L                     +S++  +
Sbjct: 121 KVRAMVESGSTHVVRGNHEEALLEEWSTTNALTR-------------------RSKYSYI 161

Query: 159 AKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTS 218
           +K L+ +   +LL  P  + +P+ +  +VHAGL P   L  Q+P  ++ MRN  + KPT 
Sbjct: 162 SK-LNSDDRLFLLQLPYTISVPKLEWMIVHAGLDPQKSLEHQEPDYMVRMRNFNDNKPTH 220

Query: 219 KKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIW- 277
             + G  W   W     E      +I+GHDA RRL+      GLD+G VYG  L+AL+  
Sbjct: 221 LIEKGEKWVIKW-----EKEGEFRVIFGHDARRRLQQGNNYLGLDTGVVYGDRLTALVRL 275

Query: 278 -NDNREIINVKCNK 290
            N N + I+V   K
Sbjct: 276 PNGNEKFISVPAKK 289



>gi|336383024|gb|EGO24173.1| hypothetical protein SERLADRAFT_467065 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 427

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 92/312 (29%), Positives = 140/312 (44%), Gaps = 86/312 (27%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGP--KSIEVVQLIRSLG 108
           + K +I +GD+HG    L +L+ K++YDP +D LI +GDI  +     S+ V+  + +  
Sbjct: 70  TTKRIIAVGDIHGMNQSLHSLLKKVSYDPNQDTLIHLGDIAVRSSLSNSLAVLSFMANNA 129

Query: 109 ASCVRGNHDDKVLQIKNILDFL-------------DSQKIPLDE--------FIKE---- 143
              VRGN+D +++Q +  ++++             D +    DE        ++K+    
Sbjct: 130 ILGVRGNNDHEIIQWRTWINWISLLPGGQAWLAQVDDKLFGTDEDSNFKFKKWLKQEKGN 189

Query: 144 ----HDIPKDI-VKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLL------ 192
               + IP D  +  +H  +A+ +  + Y YL S P+IL  PE   Y VHAGLL      
Sbjct: 190 KKWLNKIPDDWKIHRKHFEIARAMSQDHYEYLASLPLILHAPEAHTYFVHAGLLAYDLKH 249

Query: 193 ----PDVPLFE-----------------------------QDPSDIMSMRNI-KNGKPTS 218
               PD PL                               +DP  +M+MR+I KNGK T 
Sbjct: 250 KPSHPDQPLSHFPTLPQAHTNVSLLRSLQEKALLSDIPQNKDPWVLMNMRSIKKNGKITK 309

Query: 219 KKDVGHAWSKHWNAAQQESSS--------------PKTIIYGHDASRRLKIKPYSFGLDS 264
               G  W+K WN      S               P T++YGH A R L +  +S GLD+
Sbjct: 310 SNTKGSPWAKSWNRIMDRCSGFVSLDDDLDQLPCYPSTVVYGHAAYRDLDVNRWSIGLDT 369

Query: 265 GCVYGGELSALI 276
           GCVY  EL+AL+
Sbjct: 370 GCVYERELTALV 381



>gi|307102913|gb|EFN51179.1| hypothetical protein CHLNCDRAFT_141323 [Chlorella variabilis]
          Length = 487

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 101/201 (50%), Gaps = 28/201 (13%)

Query: 25  GNNYSINTHNFKPLNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHL 84
           GN   +  H + P   TL          + ++ +GD+HG Y+ELL+L++K +Y P +D L
Sbjct: 24  GNPLPLQLHAYLPEAATL---------GRRVLVVGDIHGCYEELLDLLDKCSYAPGEDVL 74

Query: 85  IFVGDIVAKGPKSIEVVQLIRSLG--ASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIK 142
           + VGD+V KGP+S EV++ +R  G     VRGNHDD  L     L   D   +       
Sbjct: 75  VLVGDLVNKGPRSAEVLRFVRDGGPLVFAVRGNHDDSSLAAYTRLSSGDGPAV------- 127

Query: 143 EHDIPKDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDP 202
                      +    A++LD  L   L   P  L +P YD  VVHAGL+P++P+ EQ  
Sbjct: 128 ----------RQRYAWARDLDASLATVLEQLPFTLRLPAYDALVVHAGLVPNIPVGEQRM 177

Query: 203 SDIMSMRNIKNGKPTSKKDVG 223
            D++ MRN+K     + +  G
Sbjct: 178 MDLLHMRNVKPASGAAAEAPG 198



>gi|50292017|ref|XP_448441.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527753|emb|CAG61402.1| unnamed protein product [Candida glabrata]
          Length = 320

 Score =  120 bits (300), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 83/247 (33%), Positives = 135/247 (54%), Gaps = 30/247 (12%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKD-HLIFVGDIVAKGPKSIEVVQ-LIRSLG-A 109
           + L+FIGDVHG YD+LL L++K+N++   +  L+F+GD + KGP S +V+  +I+  G  
Sbjct: 62  RQLVFIGDVHGMYDKLLELVDKLNFETTPEMELVFLGDFITKGPDSTKVLDWMIKHEGRV 121

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
             V GN++  V+     +  L+S+ +  ++    HD+     KS H  LA++L+   Y Y
Sbjct: 122 HFVLGNNEFSVIMGALDMGLLESKMLNNEQ---GHDVTGTFKKS-HAELAQQLNPSHYTY 177

Query: 170 LLSCPIILDIPEYDL-------YVVHAGLLPDVPLFEQD----PSDIMSMRNIK-----N 213
           L     +  + E+D+         VHAG+LP    FE+      SD+ S+ N+K     N
Sbjct: 178 LFKNAAV--VLEFDMEKTRQRFIAVHAGILPQDYDFERRHVILKSDVFSILNMKFVNEEN 235

Query: 214 GKPTSKKDVGHAWSKHWNAAQQE-----SSSPKTIIYGHDASRRLKIKPYSFGLDSGCVY 268
              TS++     W + +   ++E     +    TI+YGHDA + L ++ Y+ GLDS CV 
Sbjct: 236 SMETSREKQTKHWKRWYKLWEKELDNHHTKEQITILYGHDAKKGLNLRKYTKGLDSACVK 295

Query: 269 GGELSAL 275
           GG+LSA+
Sbjct: 296 GGKLSAM 302



>gi|338529922|ref|YP_004663256.1| serine/threonine protein phosphatase family protein [Myxococcus
           fulvus HW-1]
 gi|503701276|ref|WP_013935352.1| metallophosphatase [Myxococcus fulvus]
 gi|337256018|gb|AEI62178.1| serine/threonine protein phosphatase family protein [Myxococcus
           fulvus HW-1]
          Length = 235

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 118/229 (51%), Gaps = 35/229 (15%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           +  I IGD+HG YDE + L++K+      D +IF GD+V +GPK  E V+L  ++    V
Sbjct: 3   RRTIVIGDLHGCYDEAVELLDKVGATS-SDRVIFAGDLVDRGPKRRECVEL--AMRHEAV 59

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
            GNH++K LQ ++  D         +  + +H   + ++++EH           Y ++  
Sbjct: 60  LGNHEEKHLQQRHRAD---------ERLLPDHLETRRVLEAEH-----------YAWMAG 99

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNGKPTSKKDVGHAWS 227
            P  L +PE++  VVHAG+LP  P+ EQD   ++  + I     K+  P+        W+
Sbjct: 100 LPHYLRLPEHNAIVVHAGMLPGRPVEEQDAYHLLHAQCIRPPATKSYWPSKAPAGWTFWT 159

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
            HW         P+ +I+GH A     +  Y+ G+D+GCVYG  L+A++
Sbjct: 160 HHWKG-------PERVIFGHTAFDAPLVTEYAVGIDTGCVYGHSLTAVV 201



>gi|154337671|ref|XP_001565068.1| putative ser/thr protein phosphatase [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134062108|emb|CAM45225.1| putative ser/thr protein phosphatase [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 807

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 120/230 (52%), Gaps = 28/230 (12%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           I +GDVHG  D+L  L+ K+ Y   KD L+ +GD V KGP SI VV+  + LGA  V GN
Sbjct: 337 IIVGDVHGCVDQLEQLVEKVKYVKGKDCLLIIGDYVNKGPDSIGVVRTCQRLGAYGVLGN 396

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  +L+    +     ++ P        D  +D VK     LA++L  +   YL   P 
Sbjct: 397 HDYTLLRCCARM-----RRRPFTP-----DDLRDPVKR----LAQKLPKDCEYYLRGLPH 442

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNG--KPTSKKDVGHAWSK 228
           I+ IP Y++ +VHAGL     L  Q+  ++M +R +     K G  K  +K   G  W+K
Sbjct: 443 IVRIPRYNVLLVHAGLNLQYALENQNVEEVMHLRRLEMVPNKPGMFKAITKGVEGAPWAK 502

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWN 278
            W         P+T+I+GHDA    +   ++ G+D+GCVYG  L+ +++ 
Sbjct: 503 LWRG-------PETVIFGHDAYSGFQAHAHACGIDTGCVYGDPLTCVVYG 545



>gi|126138882|ref|XP_001385964.1| Serine/threonine protein phosphatase 2A [Scheffersomyces stipitis
           CBS 6054]
 gi|126093242|gb|ABN67935.1| Serine/threonine protein phosphatase 2A, partial [Scheffersomyces
           stipitis CBS 6054]
          Length = 370

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 126/247 (51%), Gaps = 25/247 (10%)

Query: 55  LIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRG 114
           +I +GDVH  Y +   L+NK+ Y+   DHL+ +GD + KGP S +++  + +    C+ G
Sbjct: 98  IIMVGDVHAHYTQFRKLLNKVKYNKKNDHLLLLGDFITKGPDSRKILDYLIANDVDCILG 157

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEH--DIPKDIVKSEHG-----LLAKELDVELY 167
           NH+   LQ       LD      +  I++   D    +VK         L+AK+L+ E  
Sbjct: 158 NHEYYALQNYATFHGLDQPSFEFNGTIEKFLGDGSSFLVKDGFNDDPEFLIAKKLEPEHV 217

Query: 168 NYLLSCPIILDIPEYDL---------YVVHAGLLPDVPLFEQDPSDIMSMRNIKN---GK 215
            Y+ +C II  +    L           VHAG+  D+ L +QDP D + MR++      +
Sbjct: 218 QYINNCSIIKKLGTMPLQKSKGGANGVAVHAGIRWDLDLQDQDPIDNLEMRSLIGPYFNE 277

Query: 216 PTSKKDV--GHAWSKHWNAAQQESSSP----KTIIYGHDASRRLKIKPYSFGLDSGCVYG 269
            TS  DV    +WSK +N  Q+E S+       + YGHDA R L +K Y+ GLDSGC  G
Sbjct: 278 TTSDPDVEDSVSWSKIFNMKQKEKSAHDKDLTVVYYGHDARRGLNLKQYTKGLDSGCDRG 337

Query: 270 GELSALI 276
            +L+A++
Sbjct: 338 DKLTAMV 344



>gi|477523476|gb|ENH75474.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Fusarium oxysporum
           f. sp. cubense race 1]
          Length = 391

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 108/355 (30%), Positives = 152/355 (42%), Gaps = 104/355 (29%)

Query: 26  NNYSINTHNFKPLN------YTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYD- 78
           N Y INTH+    +      Y L  +++  ++   LI +GDVHG   EL  L+ K+ Y  
Sbjct: 6   NEYEINTHSSTAHSHAGFPWYPLQTRIQDVIAPGRLIIVGDVHGRLPELKELVEKVAYSK 65

Query: 79  PLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIP-- 136
           P  D LI VGD++ KGP S  VVQL   LGAS +RGN++D+VL   + +   D  K+   
Sbjct: 66  PNGDKLILVGDLINKGPDSPGVVQLAMELGASAIRGNNEDRVLAAHSAIKRGDDTKLVER 125

Query: 137 ----LDEFIKEHD------------------IPKDI--VKSEHGLL-AKELDVELYNYLL 171
                 E  KE+D                   P+D+    SE     A  L  E  ++L 
Sbjct: 126 LKRLAREAEKENDKKDGEPAPSETKDDLKSISPEDLKPYSSESDFTTAANLSDEQISWLA 185

Query: 172 SCPIILDI--------PEYD---LYVVHAGLLPDVPLFEQDPSDIMSMRN---------- 210
           S P++L I        P ++   L V H GL+P +PL EQD   +M+MR           
Sbjct: 186 SQPLVLRIKLRKGATSPPWNSGTLLVAHGGLVPLLPLEEQDSWAVMNMRGLVYPDPEATV 245

Query: 211 ---------------------------IKNGKPTS---KKDV---------GHAWSKHWN 231
                                      + NG+  S   K+ V         G  W   WN
Sbjct: 246 TEPIRVAAYGDVNDADIKAELLKWADIVNNGEGFSGQYKEGVIGFPLETREGDWWIDAWN 305

Query: 232 AAQQESSSPKT---IIYGHDASRRLKIKP-------YSFGLDSGCVYGGELSALI 276
             Q     P+    ++YGHDA   +++         Y+FGLDSGCVYG  L+A+I
Sbjct: 306 RWQNSIRDPEKRSIVVYGHDARVGIQVGADSPEVARYTFGLDSGCVYGKSLTAMI 360



>gi|336463349|gb|EGO51589.1| hypothetical protein NEUTE1DRAFT_54861 [Neurospora tetrasperma FGSC
           2508]
          Length = 507

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 124/279 (44%), Gaps = 77/279 (27%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           K L+ +GD HG    L +L++KI++D   DHLI  GD+V KGP S  +VQ  R +GAS V
Sbjct: 69  KRLVIVGDTHGRPTALRSLLDKISFDNTTDHLILAGDLVTKGPDSKGLVQFARDIGASAV 128

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDI-------------------------- 146
           RGNHDDKVL+    L  +   K   ++   E D                           
Sbjct: 129 RGNHDDKVLEAAKWLGRIKQGKKGWEKTENEGDSVREDDEEMSEEEEAKDSVEISGRRRR 188

Query: 147 --PKDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEY-----------DLYVVHAGLLP 193
             PK  VK EH  +A+ L +   ++L S PIIL +              ++ VVH GL+P
Sbjct: 189 KKPKG-VKPEHIAVARSLTLSQLHWLASRPIILRVGHLSGAKTAPWNAKEVVVVHGGLIP 247

Query: 194 DVPLFEQDPSDIMSMRNIKNGKPTS------------KKD-------------------- 221
            +PL +QDP  +M++R++   + TS            KK+                    
Sbjct: 248 SLPLEKQDPWAVMNVRSLVYKRSTSSTSDDNTDNQDEKKNNDGSIDTAITHNRITTIPLD 307

Query: 222 --VGHAWSKHWNAAQQESSSPK---TIIYGHDASRRLKI 255
              G  WS+ WN  Q   SS      +IYGHDA   L++
Sbjct: 308 TREGEPWSRAWNRYQNLISSESNRVVVIYGHDARSGLQV 346



>gi|350297440|gb|EGZ78417.1| Metallo-dependent phosphatase [Neurospora tetrasperma FGSC 2509]
          Length = 508

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 124/279 (44%), Gaps = 77/279 (27%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           K L+ +GD HG    L +L++KI++D   DHLI  GD+V KGP S  +VQ  R +GAS V
Sbjct: 70  KRLVIVGDTHGRPTALRSLLDKISFDNTTDHLILAGDLVTKGPDSKGLVQFARDIGASAV 129

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDI-------------------------- 146
           RGNHDDKVL+    L  +   K   ++   E D                           
Sbjct: 130 RGNHDDKVLEAAKWLGRIKQGKKGWEKTENEGDSVREDDEEMSEEEEAKDSVEISGRRRR 189

Query: 147 --PKDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEY-----------DLYVVHAGLLP 193
             PK  VK EH  +A+ L +   ++L S PIIL +              ++ VVH GL+P
Sbjct: 190 KKPKG-VKPEHIAVARSLTLSQLHWLASRPIILRVGHLSGAKTAPWNAKEVVVVHGGLIP 248

Query: 194 DVPLFEQDPSDIMSMRNIKNGKPTS------------KKD-------------------- 221
            +PL +QDP  +M++R++   + TS            KK+                    
Sbjct: 249 SLPLEKQDPWAVMNVRSLVYKRSTSSTSDDNTDNQDEKKNNDGSIDTAITHNRITTIPLD 308

Query: 222 --VGHAWSKHWNAAQQESSSPK---TIIYGHDASRRLKI 255
              G  WS+ WN  Q   SS      +IYGHDA   L++
Sbjct: 309 TREGEPWSRAWNRYQNLISSESNRVVVIYGHDARSGLQV 347



>gi|197123203|ref|YP_002135154.1| metallophosphoesterase [Anaeromyxobacter sp. K]
 gi|501518868|ref|WP_012526805.1| metallophosphoesterase [Anaeromyxobacter sp. K]
 gi|196173052|gb|ACG74025.1| metallophosphoesterase [Anaeromyxobacter sp. K]
          Length = 242

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/236 (29%), Positives = 125/236 (52%), Gaps = 27/236 (11%)

Query: 50  LSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           ++    + +GDVHG   EL +L+    Y+P++D L+F+GD+V +GP  + VV+ +R+LGA
Sbjct: 1   MAPSRTLVVGDVHGCLGELEDLLAAARYEPMRDRLVFLGDLVDRGPDPVGVVRRVRALGA 60

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
            C+ GNH++K L+      +   +    ++    + +  D  ++E  L    L  +   +
Sbjct: 61  DCLLGNHEEKHLR------YAAHEARRREDPRHRNPVRLDPRRTEEHL---RLSPDDLAW 111

Query: 170 LLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHA--- 225
           + + P  L + +     VH GLLP  PL  Q P  ++ +R +  +GKP S++  G     
Sbjct: 112 MAALPRALRL-DGGWLAVHGGLLPGRPLSRQPPDWLIRLRFLDASGKPVSREHGGEPGVV 170

Query: 226 -WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYS-----FGLDSGCVYGGELSAL 275
            W++ W       + P +++YGH A   + +   +      G+D+GCVYGG+L+AL
Sbjct: 171 RWAERW-------TGPSSVVYGHHARDEVVVDEPAPGVRCVGIDTGCVYGGKLTAL 219



>gi|220917992|ref|YP_002493296.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|501753570|ref|WP_012633977.1| metallophosphoesterase [Anaeromyxobacter dehalogenans]
 gi|219955846|gb|ACL66230.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 242

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/236 (29%), Positives = 123/236 (52%), Gaps = 27/236 (11%)

Query: 50  LSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           ++    + +GDVHG   EL +L+    Y+P++D L+F+GD+V +GP  + VV+ +R+LGA
Sbjct: 1   MAPSRTLVVGDVHGCLGELEDLLAAARYEPMRDRLVFLGDLVDRGPDPVGVVRRVRALGA 60

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNY 169
            C+ GNH++K L+      +   +    ++    + +  D  ++E  L    L  +   +
Sbjct: 61  DCLLGNHEEKHLR------YAAHEARRREDPRHRNPVRLDPRRTEEHL---RLSPDDLAW 111

Query: 170 LLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHA--- 225
           + + P  L + +     VH GLLP  PL  Q P  ++ +R +   GKP S++  G     
Sbjct: 112 MAALPRALRL-DGGWVAVHGGLLPGRPLSRQPPDWLIRLRFLDATGKPVSREHGGEPGVV 170

Query: 226 -WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYS-----FGLDSGCVYGGELSAL 275
            W++ W       + P +++YGH A   + +   +      G+D+GCVYGG L+AL
Sbjct: 171 RWAERW-------TGPSSVVYGHHARDEVVVDEPAPGVRCVGIDTGCVYGGRLTAL 219



>gi|477508692|gb|ENH61985.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Fusarium oxysporum
           f. sp. cubense race 1]
          Length = 394

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 126/288 (43%), Gaps = 68/288 (23%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           + L+ +GD+HG  D    L+ KI ++P  DH+I VGD++ KGPKS EVV  +  L AS V
Sbjct: 88  RRLVVVGDIHGMLDPFEKLLKKIEFNPKTDHVIAVGDMINKGPKSSEVVARLMELKASAV 147

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
           RGNH+D+V+     L    S +  +  ++   D  K   +  +   A+ L      +L +
Sbjct: 148 RGNHEDRVILAWRGL----SSQQGVAAYLDTKDAAKHRGEEAYLKTARSLSEAQMTWLRN 203

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK----------------NGKP 216
            P+I+      LY VHAGL+P VPL +QD   +M+MR ++                  + 
Sbjct: 204 LPVIISAESMALYFVHAGLVPGVPLPQQDAWAVMNMRTLRFPREEFRKKEIEKKRKQAEK 263

Query: 217 TSKKDVGHAWSKHWNAAQQESSSPKTI--------------------IYGHDASR----- 251
             +K++  A        QQ + S   +                    I GH+  R     
Sbjct: 264 QRQKELAKAQEDAQAKFQQRTDSAGAVLSTDEAAAERTNPDRDVWIPIDGHEGERWTDLW 323

Query: 252 ---RLKIK--------------------PYSFGLDSGCVYGGELSALI 276
              + K++                     Y+FGLDSGCV G  L+AL+
Sbjct: 324 NSEQRKLRGPDRRSVIYGHDAKMGYQEDSYTFGLDSGCVKGNALTALV 371



>gi|340055803|emb|CCC50124.1| putative diadenosine tetraphosphatase [Trypanosoma vivax Y486]
          Length = 258

 Score =  117 bits (293), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 137/265 (51%), Gaps = 29/265 (10%)

Query: 35  FKPLNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKG 94
            K   Y  ++ L   +S   +I +GD+HG   EL  L+  +++D   D L+ VGD+V KG
Sbjct: 1   MKQKGYARVSSLS--VSSGRVIIVGDIHGCNRELQELLRIVSFDKKSDTLVTVGDLVNKG 58

Query: 95  PKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSE 154
           P S  VV+ ++ LGA  V GNHD K+L++   L+   +    L E  ++  +      + 
Sbjct: 59  PDSFGVVRFLQQLGAYNVLGNHDLKLLKLVKKLEKHGT----LKEKDRKSSMASLAASAP 114

Query: 155 HGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNG 214
           H + A         YL   P IL IP +++ VVHAGL P   L +Q   ++ +MRN+   
Sbjct: 115 HDVTA---------YLSGLPHILRIPAHNVIVVHAGLHPQRLLEKQVVKEVTTMRNLIER 165

Query: 215 KPTSKKDVGHAWSKHWNAAQQESS-----------SPKTIIYGHDASRRLK--IKPYSFG 261
             T   D     +     A +E++            P+T+++GHDA R L+   +P++ G
Sbjct: 166 DCTGTTDEVTGETGITLTATEETTKGGVPWASLWGGPETVVFGHDARRGLQEEYRPFAIG 225

Query: 262 LDSGCVYGGELSALIWNDNREIINV 286
           +DS CVYGG LSA+++    EI++V
Sbjct: 226 IDSRCVYGGRLSAVVYPGG-EIVSV 249



>gi|405966379|gb|EKC31672.1| Serine/threonine-protein phosphatase 1 [Crassostrea gigas]
          Length = 299

 Score =  117 bits (293), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 133/252 (52%), Gaps = 32/252 (12%)

Query: 47  EAPLSQKNLIFIGDVHGSYDELLNLINKINYD-PLKDHL-IFVGDIVAKGPKSIEVVQLI 104
           E  +  + ++ +GDVHG   E+  L+ +     P ++ L IFVGD+++KGP  +E ++ +
Sbjct: 67  EDAIRGRKVLIVGDVHGCLREMEELLQEAKSKFPDQEILPIFVGDLLSKGPFPVETLKKL 126

Query: 105 RSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDV 164
           + +    VRGNHD+ VL+       L  +K  L E   ++    ++   + G        
Sbjct: 127 QKIEHYAVRGNHDEAVLR-----QALSLKKEELHELPPKYSWVPNLSDDDIG-------- 173

Query: 165 ELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRN-IKNGKPT----SK 219
               YL   P  + I    + +VHAGL+P +PL EQ+ ++++ MRN +K+ + T      
Sbjct: 174 ----YLRELPYTISITSLSVIIVHAGLVPGIPLTEQELTNMIIMRNLVKSPEGTLCAAEL 229

Query: 220 KDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELS-ALIWN 278
            + G AW+  W         P  + +GHDA R+L+   ++ GLD+GCVYG +L+ A++  
Sbjct: 230 TNEGEAWASFW-------PGPDHVYFGHDARRKLQKHAHATGLDTGCVYGNQLTGAVVTK 282

Query: 279 DNREIINVKCNK 290
           D+ E+I VK  +
Sbjct: 283 DSTELIQVKAKQ 294



>gi|488714448|ref|WP_002638324.1| metallophosphatase [Chondromyces apiculatus]
 gi|397088553|gb|EJJ19534.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Myxococcus sp.
           (contaminant ex DSM 436)]
          Length = 235

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 119/229 (51%), Gaps = 35/229 (15%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           +  I IGD+HG +DE + L++K+      D +IF GD+V +GPK  E V+L  ++    +
Sbjct: 3   RRTIVIGDLHGCHDEAVELLDKVGATS-SDRIIFAGDLVDRGPKRRECVEL--AMRHEAI 59

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
            GNH++  LQ ++  D         +  + +H   + +++ EH           Y ++  
Sbjct: 60  LGNHEETHLQQRHRAD---------ERMLPDHLETRRVLEPEH-----------YAWMAG 99

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNGKPTSKKDVGHAWS 227
            P  L +PE++  VVHAG+LP+VP+ +QDP  ++  + I     K+  P+   +    W+
Sbjct: 100 LPHYLRLPEHNAVVVHAGMLPNVPVEKQDPYHLLHAQCIRPPATKSYWPSKAPEGWTFWT 159

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
            HW         P+ +I+GH       +  Y+ G+D+GCVYG  L+A++
Sbjct: 160 HHWKG-------PERVIFGHTVFDAPLVTEYAVGIDTGCVYGHSLTAVV 201



>gi|85113370|ref|XP_964509.1| hypothetical protein NCU02150 [Neurospora crassa OR74A]
 gi|28926294|gb|EAA35273.1| predicted protein [Neurospora crassa OR74A]
          Length = 509

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 123/279 (44%), Gaps = 77/279 (27%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           K L+ +GD HG    L +L++KI++D   DHLI  GD+V KGP S  +VQ  R +GAS V
Sbjct: 69  KRLVIVGDTHGRPTALRSLLDKISFDNTTDHLILAGDLVTKGPDSKGLVQFARDIGASAV 128

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDI-------------------------- 146
           RGNHDDKVL+    L  +   K    +   + D                           
Sbjct: 129 RGNHDDKVLEAAKWLGRIKQGKNGWGKTENQRDSVREDDEEMFEEEEAKDSVEISGRRRT 188

Query: 147 --PKDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEY-----------DLYVVHAGLLP 193
             PK  VK EH  +A+ L V   ++L S PIIL +              ++ VVH GL+P
Sbjct: 189 KKPKG-VKPEHIAVARSLTVSQLHWLASRPIILRVGHLYGAKTAPWNAKEVVVVHGGLIP 247

Query: 194 DVPLFEQDPSDIMSMRNIKNGKPTS------------KKD-------------------- 221
            +PL +QDP  +M++R++   + TS            KK+                    
Sbjct: 248 SLPLEKQDPWAVMNVRSLVYKRSTSSTSDDNTGDEDEKKNDDGSIDTTVTHNRITTIPLD 307

Query: 222 --VGHAWSKHWNAAQQESSSPK---TIIYGHDASRRLKI 255
              G  WS+ WN  Q   SS      ++YGHDA   L++
Sbjct: 308 TREGEPWSRAWNRYQNLISSESNRVVVVYGHDARSGLQV 346



>gi|146086846|ref|XP_001465660.1| putative ser/thr protein phosphatase [Leishmania infantum JPCM5]
 gi|134069759|emb|CAM68085.1| putative ser/thr protein phosphatase [Leishmania infantum JPCM5]
          Length = 811

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 119/232 (51%), Gaps = 28/232 (12%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           I +GDVHG  D+L  L+ K+ Y   KD L  +GD V KGP SI  V+  + LGA  V GN
Sbjct: 341 IIVGDVHGCVDQLEQLVEKVKYVKGKDCLFIIGDYVNKGPDSIGAVRACQRLGAYGVLGN 400

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  +L+    +     ++ P        D  +D VK     LA++L  +   YL   P 
Sbjct: 401 HDYTLLRCCARM-----RRRPFTP-----DDLRDPVKR----LAQKLPKDCEYYLRGLPH 446

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNG--KPTSKKDVGHAWSK 228
           I+ IP +++ +VHAGL P   L  Q+  ++M +R +     K G  K  +K   G  W+K
Sbjct: 447 IVRIPRHNVLLVHAGLNPQHSLENQNVEEVMHLRRLEMVPSKPGMFKAIAKGVEGEPWAK 506

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN 280
            W         P+ +I+GHDA    +   ++ G+D+GCVYG  L+ +++  +
Sbjct: 507 LWRG-------PEMVIFGHDAYAGFQAHAHACGIDTGCVYGDPLTCVVYGQD 551



>gi|398015403|ref|XP_003860891.1| ser/thr protein phosphatase, putative [Leishmania donovani]
 gi|322499114|emb|CBZ34186.1| ser/thr protein phosphatase, putative [Leishmania donovani]
          Length = 811

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 119/232 (51%), Gaps = 28/232 (12%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           I +GDVHG  D+L  L+ K+ Y   KD L  +GD V KGP SI  V+  + LGA  V GN
Sbjct: 341 IIVGDVHGCVDQLEQLVEKVKYVKGKDCLFIIGDYVNKGPDSIGAVRACQRLGAYGVLGN 400

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  +L+    +     ++ P        D  +D VK     LA++L  +   YL   P 
Sbjct: 401 HDYTLLRCCARM-----RRRPFTP-----DDLRDPVKR----LAQKLPKDCEYYLRGLPH 446

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNG--KPTSKKDVGHAWSK 228
           I+ IP +++ +VHAGL P   L  Q+  ++M +R +     K G  K  +K   G  W+K
Sbjct: 447 IVRIPRHNVLLVHAGLNPQHSLENQNVEEVMHLRRLEMVPSKPGMFKAIAKGVEGEPWAK 506

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN 280
            W         P+ +I+GHDA    +   ++ G+D+GCVYG  L+ +++  +
Sbjct: 507 LWRG-------PEMVIFGHDAYAGFQAHAHACGIDTGCVYGDPLTCVVYGQD 551



>gi|393242078|gb|EJD49597.1| Metallo-dependent phosphatase [Auricularia delicata TFB-10046 SS5]
          Length = 371

 Score =  115 bits (289), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 90/334 (26%), Positives = 148/334 (44%), Gaps = 102/334 (30%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           ++ ++F+GD+HG    LL L++KI+YDP +D L+  GDI+ KG  S+ V+  + S     
Sbjct: 15  KRRIVFVGDIHGMRKPLLQLLDKISYDPRRDALVHTGDIITKGDDSLGVLDWLASHNILG 74

Query: 112 VRGNHDDKVLQIKNILDFLDSQK---------------------IPLDEFIKEHDIPKD- 149
           VRGN D KV++ +  L++++SQ+                     +   +  K+ D P D 
Sbjct: 75  VRGNQDQKVIEWRGWLEWVESQRGGRKWLRKMERKYPDGVNGEDMKSRKKDKKFDFPNDW 134

Query: 150 IVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFE---------- 199
           +   EH +LA+++  E Y YLL  P+ L +     +V HAG+LP  P             
Sbjct: 135 MFNGEHYVLARDMSAEHYQYLLQLPLNLHLVPLHTFVGHAGVLPMDPTLSPTAKRQPLAH 194

Query: 200 -----------------------------QDPSDIMSMRNI-KNGKPTSKKDVGHAWSKH 229
                                         DP  ++++R+I K+G+ T     G  WS  
Sbjct: 195 VPEVDLPEPDTEFLRLAQEMAIKREIPQNTDPWTLLNVRSILKDGRVTRDGAEGAPWSDL 254

Query: 230 WNA-------------------------AQQESSS---------------PKTIIYGHDA 249
           WNA                          +   +S               P +++YGH A
Sbjct: 255 WNAIVSKCEGFEAARTLPQGNTPQLVMNGEAPGASGVVDIIKPDLRLPCHPASVVYGHAA 314

Query: 250 SRRLKIKPYSFGLDSGCVYGGELSALIWNDNREI 283
           SR L IK ++ GLD+GCVYG +L+A++ ++ R++
Sbjct: 315 SRGLDIKRWTKGLDTGCVYGRKLTAMVIDNRRKV 348



>gi|336370266|gb|EGN98606.1| hypothetical protein SERLA73DRAFT_181148 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 443

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 92/328 (28%), Positives = 140/328 (42%), Gaps = 102/328 (31%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGP--KSIEVVQLIRSLG 108
           + K +I +GD+HG    L +L+ K++YDP +D LI +GDI  +     S+ V+  + +  
Sbjct: 70  TTKRIIAVGDIHGMNQSLHSLLKKVSYDPNQDTLIHLGDIAVRSSLSNSLAVLSFMANNA 129

Query: 109 ASCVRGNHDDKVLQIKNILDFL-------------DSQKIPLDE--------FIKE---- 143
              VRGN+D +++Q +  ++++             D +    DE        ++K+    
Sbjct: 130 ILGVRGNNDHEIIQWRTWINWISLLPGGQAWLAQVDDKLFGTDEDSNFKFKKWLKQEKGN 189

Query: 144 ----HDIPKDI-VKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLL------ 192
               + IP D  +  +H  +A+ +  + Y YL S P+IL  PE   Y VHAGLL      
Sbjct: 190 KKWLNKIPDDWKIHRKHFEIARAMSQDHYEYLASLPLILHAPEAHTYFVHAGLLAYDLKH 249

Query: 193 ----PDVPLFE-----------------------------QDPSDIMSMRNI-KNGKPTS 218
               PD PL                               +DP  +M+MR+I KNGK T 
Sbjct: 250 KPSHPDQPLSHFPTLPQAHTNVSLLRSLQEKALLSDIPQNKDPWVLMNMRSIKKNGKITK 309

Query: 219 KKDVGHAWSKHWNAAQQESSS------------------------------PKTIIYGHD 248
               G  W+K WN      S                               P T++YGH 
Sbjct: 310 SNTKGSPWAKSWNRIMDRCSGFVGTRINSFAVNSDNRFVSLDDDLDQLPCYPSTVVYGHA 369

Query: 249 ASRRLKIKPYSFGLDSGCVYGGELSALI 276
           A R L +  +S GLD+GCVY  EL+AL+
Sbjct: 370 AYRDLDVNRWSIGLDTGCVYERELTALV 397



>gi|108759347|ref|YP_629761.1| serine/threonine protein phosphatase [Myxococcus xanthus DK 1622]
 gi|499870886|ref|WP_011551620.1| metallophosphatase [Myxococcus xanthus]
 gi|108463227|gb|ABF88412.1| Ser/Thr protein phosphatase family protein [Myxococcus xanthus DK
           1622]
          Length = 235

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 117/229 (51%), Gaps = 35/229 (15%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           +  I IGD+HG YDE + L+ K+      D +IF GD+V +GPK  E V+L  ++    +
Sbjct: 3   RRTIVIGDLHGCYDEAVELLGKVGATS-SDRIIFAGDLVDRGPKRRECVEL--AMRHEAI 59

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
            GNH++K LQ ++  D         +    +H   + +++  H           Y+++  
Sbjct: 60  LGNHEEKHLQQRHRAD---------ERLHPDHLETRRVLQPGH-----------YDWMAR 99

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNGKPTSKKDVGHAWS 227
            P  L +PE++  VVHAG+LPD+P+ +QDP  ++  + I     K+  P+        W+
Sbjct: 100 LPRYLRLPEHNAIVVHAGMLPDIPVEKQDPYHLLHAQCIRPPASKSYWPSKAPHGWTFWT 159

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
            HW         P+ +I+GH       +  ++ G+D+GCVYG  L+A++
Sbjct: 160 HHWKG-------PERVIFGHTVFDAPLVTEHAVGIDTGCVYGRSLTAVV 201



>gi|401422252|ref|XP_003875614.1| putative ser/thr protein phosphatase [Leishmania mexicana
           MHOM/GT/2001/U1103]
 gi|322491852|emb|CBZ27125.1| putative ser/thr protein phosphatase [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 808

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 119/232 (51%), Gaps = 28/232 (12%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           I +GDVHG  D+L  L+ K+ Y   KD L  +GD V KGP SI  V+  + LGA  V GN
Sbjct: 338 IIVGDVHGCVDQLEQLVEKVKYVKGKDCLFIIGDYVNKGPDSIGAVRACQRLGAYGVLGN 397

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  +L+    +     ++ P        D  +D VK     LA++L  +   YL   P 
Sbjct: 398 HDYTLLRCCARM-----RRRPFTP-----DDLRDPVKR----LAQKLPKDCEYYLRGLPH 443

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNG--KPTSKKDVGHAWSK 228
           I+ IP +++ +VHAGL     L  Q+  ++M +R +     K G  K  +K   G  W+K
Sbjct: 444 IVRIPRHNVLLVHAGLNLQHSLENQNVEEVMHLRRLEMVPNKPGMFKAIAKGVEGEPWAK 503

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN 280
            WN        P+ +I+GHDA    +   ++ G+D+GCVYG  L+ +++  +
Sbjct: 504 LWNG-------PEMVIFGHDAYAGFQAHAHACGIDTGCVYGDPLTCVVYGQD 548



>gi|299749834|ref|XP_001836366.2| calcineurin-like phosphoesterase [Coprinopsis cinerea okayama7#130]
 gi|298408619|gb|EAU85455.2| calcineurin-like phosphoesterase [Coprinopsis cinerea okayama7#130]
          Length = 468

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 93/354 (26%), Positives = 149/354 (42%), Gaps = 114/354 (32%)

Query: 34  NFKPLNYTLINKLEAPLS--QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIV 91
            ++PL   ++++ E PL    + +I +GD+HG       L+  ++YDP  D LI  GDI+
Sbjct: 59  QYEPLR--ILSRSEFPLDDPTRRVIIVGDIHGMIHPFNKLLATVDYDPDADVLIHTGDII 116

Query: 92  AKGPK--SIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFL------------------- 130
           +K P   S+ V+  +     + VRGNHD  V++ K  + ++                   
Sbjct: 117 SKAPHRDSMAVLSFMARNNITGVRGNHDQMVIEWKGWMKWICSSFDGCQWLQRVERDWDR 176

Query: 131 ---DSQKIPLDEFIKEHD-------------IPKDI-VKSEHGLLAKELDVELYNYLLSC 173
              + + + L++F++  +             IP +  +  +H  +A+ +  E Y+YLL+ 
Sbjct: 177 RHKEDKSLALEDFLESEEQALGLKDKRWWSLIPSEWKMLGDHYRIARSMSDEEYSYLLNL 236

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQD-------------------------------- 201
           P+ L IP    YVVHAGLLP  P +  D                                
Sbjct: 237 PLRLYIPSAHAYVVHAGLLPSDPQYPFDSKRQPLAHLPKVGGRSKSEERNGVEHMRNLQE 296

Query: 202 ------------PSDIMSMRNIKNGKPTSKKDVGHAWSKHWNAAQ--------------- 234
                       P  +++MR +KNGK + K++ G  W K W                   
Sbjct: 297 MAVLTKVPQNTNPWVVLNMRAVKNGKISRKRN-GKDWYKIWGREMDHCIGFSSKLFDDYS 355

Query: 235 ---QESSS---------PKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
              Q +S          P ++ YGH AS  L ++ +SFGLDSGCVYG  LSA +
Sbjct: 356 SLIQPTSGKKKHGLPCYPISVFYGHTASVGLNVQRWSFGLDSGCVYGRRLSAFV 409



>gi|325185712|emb|CCA20193.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 239

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 110/223 (49%), Gaps = 41/223 (18%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIR-SLGASC 111
           + +I +GDVHG  DEL  L+ + N     D ++ VGD+V KGPKS+EV+Q +R S     
Sbjct: 15  RRVIIVGDVHGCLDELQQLLTECNATTEHDLIVLVGDLVNKGPKSVEVLQFVRTSPNMLS 74

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLL 171
           VRGNHD+  L                 ++  + D+P    K ++    KE   E   +L 
Sbjct: 75  VRGNHDEAAL-------------TAYSKWKNDEDVPG---KYDY---VKEFSTEDVEFLR 115

Query: 172 SCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNG--------------KPT 217
             P  + +PE+++ VVHAG++P + L +QDP  +  MR ++                K  
Sbjct: 116 DLPYTIKLPEFNVMVVHAGIIPGLALQDQDPVLLTKMRFLERQEGSMVTETKWKALEKCQ 175

Query: 218 SKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSF 260
            + +    W+K WN        P+ I +GHDA R L+++P S+
Sbjct: 176 EETEAISLWAKQWNG-------PEHIYFGHDAKRGLQVRPLSY 211



>gi|254564975|ref|XP_002489598.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238029394|emb|CAY67317.1| Hypothetical protein PAS_chr1-3_0253 [Komagataella pastoris GS115]
 gi|328350021|emb|CCA36421.1| hypothetical protein PP7435_Chr1-0260 [Komagataella pastoris CBS
           7435]
          Length = 357

 Score =  112 bits (281), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 135/266 (50%), Gaps = 36/266 (13%)

Query: 44  NKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDP--LKDHLIFVGDIVAKGPKSIEVV 101
           N+LE P   + LI IGDVHGS   L  L+ K++Y+P    D ++ +GD ++KGP+S+EVV
Sbjct: 78  NQLEVP---RRLILIGDVHGSLKPLKKLLRKLDYNPKGSTDTVLLLGDFISKGPQSVEVV 134

Query: 102 QLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEF-IKEHDIPKDIVK--SEHGLL 158
            L       C+ GNH+  VLQ  N    L   K   +E  I+ +D+    +    +   L
Sbjct: 135 DLAIKNKFQCILGNHEISVLQRYNQFHGLSGLKYRNNESDIENYDLQSGQLYPLDDEMRL 194

Query: 159 AKELDVELYNYLLSCPIILD---IPEY-----------DLYVVHAGLLPDV-PLFEQDPS 203
           AK+L      Y+ +CP I D   +P Y           D   VHAGL  +V  L++QD +
Sbjct: 195 AKQLYPRHIEYMGTCPFIYDLGPVPRYNRKHTNYKETVDGVAVHAGLNWNVHELYDQDVT 254

Query: 204 DIMSMRNI---KNGKPTSKKDVGHA--WSKHWNAAQQESSSP--------KTIIYGHDAS 250
           ++  MR +      K T  K +  +  W+K WN  Q   +          + + YGH AS
Sbjct: 255 EVTEMRAMLPPDFSKATDDKSIPGSVGWAKIWNHWQNNITDSDDFDGLKNRKVYYGHHAS 314

Query: 251 RRLKIKPYSFGLDSGCVYGGELSALI 276
           R L ++PY+ G+D+ CV G  L+A++
Sbjct: 315 RGLNVRPYTMGIDTACVKGDRLTAVV 340



>gi|336258528|ref|XP_003344076.1| hypothetical protein SMAC_09059 [Sordaria macrospora k-hell]
 gi|380093050|emb|CCC09287.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 528

 Score =  112 bits (281), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 89/294 (30%), Positives = 123/294 (41%), Gaps = 77/294 (26%)

Query: 39  NYTLINKLEAPLS----QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKG 94
           + T+ +   AP S     K L+ IGD HG    L +L++KI++D   DHLI  GD+V KG
Sbjct: 49  STTIPSPTSAPSSDVTNNKRLVIIGDTHGRLTTLKSLLDKISFDNTTDHLILAGDLVTKG 108

Query: 95  PKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKD----- 149
           P S  +VQ  R +GAS VRGNHDD VL+    L      K    +   E D   D     
Sbjct: 109 PDSRGLVQFARDIGASAVRGNHDDHVLEAAKWLSRKKQGKKWWGKAENEADGLSDGEEKA 168

Query: 150 ---------------------IVKSEHGLLAKELDVELYNYLLSCPIILDIPEY------ 182
                                 VK EH  +A  L     ++L S PIIL +         
Sbjct: 169 SEKEAEDTVDAAGQRRNKKPKGVKPEHIAVAHSLSAAQLHWLASQPIILRVGHLSGAKTA 228

Query: 183 -----DLYVVHAGLLPDVPLFEQDPSDIMSMRNI-------------KNGKPTSKKDV-- 222
                ++ VVH GL+P +PL +QDP  +M+MR++                  T+K D   
Sbjct: 229 PWNAKEVVVVHGGLIPSLPLEKQDPWAVMNMRSLVYELSTASTPDNNSEEDETTKDDGGS 288

Query: 223 ------------------GHAWSKHWNAAQ---QESSSPKTIIYGHDASRRLKI 255
                             G  WS+ WN  Q     +S    ++YGHDA   L++
Sbjct: 289 INTSTHKRITTIPLDTRDGEPWSRAWNRWQNLINNASKRVAVVYGHDARSGLQV 342



>gi|157869519|ref|XP_001683311.1| putative ser/thr protein phosphatase [Leishmania major strain
           Friedlin]
 gi|68224195|emb|CAJ04893.1| putative ser/thr protein phosphatase [Leishmania major strain
           Friedlin]
          Length = 811

 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 118/232 (50%), Gaps = 28/232 (12%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           I +GDVHG  D+L  L+ K+ Y   KD L  +GD V KGP SI  V+  + LGA  V GN
Sbjct: 341 IIVGDVHGCVDQLEQLVEKVKYVKGKDCLFIIGDYVNKGPDSIGAVRACQRLGAYGVLGN 400

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  +L+       +  ++ P        D  +D VK     LA++L  +   YL   P 
Sbjct: 401 HDYTLLRC-----CVRMRRRPFTP-----DDLRDPVKR----LAQKLPKDCEYYLRGLPH 446

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-----KNG--KPTSKKDVGHAWSK 228
           I+ IP +++ +VHAGL     +  Q+  ++M +R +     K G  K  +K   G  W+K
Sbjct: 447 IVRIPRHNVLLVHAGLNLQHSVENQNVEEVMHLRRLEMVPHKPGMFKAIAKGVEGEPWAK 506

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN 280
            W         P+ +I+GHDA    +   ++ G+D+GCVYG  L+ +++  N
Sbjct: 507 LWKG-------PEMVIFGHDAYAGFQAHAHACGIDTGCVYGDPLTCVVYGQN 551



>gi|46128693|ref|XP_388900.1| hypothetical protein FG08724.1 [Fusarium graminearum PH-1]
          Length = 455

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 92/165 (55%), Gaps = 4/165 (2%)

Query: 48  APLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL 107
            P +++ L+ +GD+HG  D    L+ KI ++P  DH+I VGD++ KGPKS EV+  +  +
Sbjct: 126 TPKNKRRLVVVGDIHGMLDPFEKLLKKIKFNPETDHVIAVGDMINKGPKSSEVIARLMEI 185

Query: 108 GASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELY 167
            AS VRGNH+D+V+     L    S +  +  +++     K   + E    A+ L     
Sbjct: 186 KASAVRGNHEDRVILAWRGL----SSQQGVAAYLESESAAKHRGEGEDLKTARSLTEPQM 241

Query: 168 NYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK 212
            +L   P+IL      LY VHAGL+P VPL +QD   +M+MR ++
Sbjct: 242 TWLKRLPVILSAEPMALYFVHAGLVPGVPLPQQDAWAVMNMRTLR 286



>gi|403216266|emb|CCK70763.1| hypothetical protein KNAG_0F00940 [Kazachstania naganishii CBS
           8797]
          Length = 321

 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 142/280 (50%), Gaps = 37/280 (13%)

Query: 43  INKLEAPLSQKNLIFIGDVHGSYDELLNLINKI--NYDPLKDH--LIFVGDIVAKGPKSI 98
           + +L  P  ++ L+F+GDVHG YD LL LI+      D + +H  ++ +GD + KGP+S 
Sbjct: 45  VQRLTDP--REKLLFVGDVHGRYDALLQLIDTQYGGIDAVDEHTKIVLLGDFLMKGPQSK 102

Query: 99  EVVQLIRSLG--ASCVRGNHDDKVL----------QIKNILDFLDSQKIPLDEFIKEHDI 146
           EV   I S     +C+ GN +  VL          +++N L F  ++ +        H++
Sbjct: 103 EVADYILSHKDKIACLLGNTEITVLLSAVNPFYRFRMRNPLVFSHNKTVSSAMRDSAHEL 162

Query: 147 PKDIVKSEHGLLAKELDVELYNYLLS-CPII----LDIPEYDLYVVHAGLLP-DVPLFEQ 200
             +  K +H  +  EL     + L   C I     L +    LY VHAG++P D    E 
Sbjct: 163 IFE-PKGKHRAMVSELGYPRLSRLAEHCTIAAKFDLTLTGSTLYGVHAGMIPGDFSDDEH 221

Query: 201 DPSDIMSMRNIK--NGK---PTSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKI 255
             S + S+ N+K  NGK    T++K      +K W    + + SP T++YGHDASR L +
Sbjct: 222 ALSSVASLVNMKYVNGKNKTQTARKQSSLPHAKRWYKLWEGTRSPVTVLYGHDASRGLNL 281

Query: 256 KPYSFGLDSGCVYGGELSALIWNDNR-------EIINVKC 288
           + ++ GLDSGC  GG+LSAL ++ N        +++ V C
Sbjct: 282 RKHTKGLDSGCARGGQLSALEYSYNTGDHEYTAQLLQVHC 321



>gi|408392764|gb|EKJ72084.1| hypothetical protein FPSE_07709 [Fusarium pseudograminearum CS3096]
          Length = 419

 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 92/167 (55%), Gaps = 4/167 (2%)

Query: 46  LEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIR 105
           +  P +++ L+ +GD+HG  D    L+ KI ++P  DH+I VGD++ KGPKS EV+  + 
Sbjct: 84  IPTPKNKRRLVVVGDIHGMLDPFEKLLKKIKFNPETDHVIAVGDMINKGPKSSEVIARLM 143

Query: 106 SLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVE 165
            + AS VRGNH+D+V+     L    S +  +  ++      K   + E    A+ L   
Sbjct: 144 EIKASAVRGNHEDRVILAWRGL----SSQQGVAAYLDSESAAKHRGEGEDLKTARSLTEP 199

Query: 166 LYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK 212
              +L   P+IL      LY VHAGL+P VPL +QD   +M+MR ++
Sbjct: 200 QMTWLKRLPVILSAEPMALYFVHAGLVPGVPLPQQDAWAVMNMRTLR 246



>gi|367008228|ref|XP_003678614.1| hypothetical protein TDEL_0A00710 [Torulaspora delbrueckii]
 gi|359746271|emb|CCE89403.1| hypothetical protein TDEL_0A00710 [Torulaspora delbrueckii]
          Length = 317

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 131/256 (51%), Gaps = 33/256 (12%)

Query: 42  LINKLEAPLSQK-NLIFIGDVHGSYDELLNLINKINYDPLKDH--LIFVGDIVAKGPKSI 98
           L+ +   P  Q   LIF+GDVHG Y EL+N++       L D   L+ +GD+V+KGP S 
Sbjct: 47  LLEQWTMPTDQDWRLIFVGDVHGQYTELMNIVEG-ELGGLDDQTTLVLLGDVVSKGPDSG 105

Query: 99  EVVQLIRSLG--ASCVRGNHDDKVL------QIKNILDFLDSQKIPLDEFIKEHDIPKDI 150
            V+Q I        CV GNHD  VL      ++ N  + L   ++   +FI     PKD+
Sbjct: 106 RVIQFILEYRDRVKCVLGNHDLAVLFALVNPELSNHHNLL-PLRVGDSQFI-----PKDL 159

Query: 151 --VKSEHGLLAKELD-VELYNYLL--SCPIILDIPEYD-LYVVHAGLLPDVPLFEQDPSD 204
             VK  H  LA EL  V+  ++ L  S  +   +P    LY  HAG+LP    F Q    
Sbjct: 160 SKVKKMHQQLAHELGFVKAKSWALHSSLAVQFTLPNGQILYGCHAGMLPGD--FSQRTPS 217

Query: 205 IMSMRNIKNGKP-----TSKKDVGHAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYS 259
           + ++  +K   P     TSK+   +  SKHW     + S   T++YGHDA R L ++ ++
Sbjct: 218 VHALTEMKFVDPKDWTHTSKEKFKN--SKHWYKLWDDVSEHITVLYGHDAKRGLNLRSHT 275

Query: 260 FGLDSGCVYGGELSAL 275
            GLDSGCV G ELSAL
Sbjct: 276 KGLDSGCVKGKELSAL 291



>gi|340975750|gb|EGS22865.1| phosphatase-like protein [Chaetomium thermophilum var. thermophilum
           DSM 1495]
          Length = 558

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 123/268 (45%), Gaps = 64/268 (23%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           + L+ + DVH +   L  L++KI +D  K DHL+ VGD++AKGP S  V+ L+ SL AS 
Sbjct: 180 RRLVIVSDVHANLSPLKELLHKIGFDTTKGDHLVLVGDMIAKGPDSKGVLDLVMSLNASA 239

Query: 112 VRGNHDDKVLQIKNILDFL---DSQKIPLD--EFIKEHDIPKDIVKSEHGLLAKELDVEL 166
           VRGNH+DKVL     +  L   +S  +  D  E  +  D+     K     +AKEL    
Sbjct: 240 VRGNHEDKVLAAAREIGRLKSYESLHVQGDAMEAERRGDVSAQYGKKHAHRIAKELTKAQ 299

Query: 167 YNYLLSCPIILDI---PEYD----------LYVVHAGLLPDVPLFEQDPSDIMSMRNIK- 212
             +L S P+IL I   P+            L VVHAGL+P VPL  QDP  +M+MR++  
Sbjct: 300 LQWLRSLPLILRIGALPDAGEDQAPWNASTLVVVHAGLVPGVPLERQDPWAVMNMRSLTY 359

Query: 213 ---------NGK-------------------------------PTSKKDVGHAWSKHWNA 232
                    +GK                               P + ++ G  WS  WN 
Sbjct: 360 PGRKKHIKLDGKDVVIEEGGDGEVDGDVLEETYPHFPAKAVAVPVAGRE-GEPWSHAWNR 418

Query: 233 AQQESSSPKT---IIYGHDASRRLKIKP 257
            Q   S  K+    IYGHDA   L++ P
Sbjct: 419 HQNHLSPSKSHILAIYGHDAGSGLQVDP 446



>gi|442318632|ref|YP_007358653.1| bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Myxococcus
           stipitatus DSM 14675]
 gi|505160129|ref|WP_015347231.1| bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Myxococcus
           stipitatus]
 gi|441486274|gb|AGC42969.1| bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) [Myxococcus
           stipitatus DSM 14675]
          Length = 235

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 115/237 (48%), Gaps = 26/237 (10%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
             I IGD+HG +DE L L+ K+      D +IF GD+V +GPK  E V+L  ++    V 
Sbjct: 4   RTIVIGDLHGCHDEALELLAKVGATS-SDRVIFAGDLVDRGPKRRECVEL--AMRHEAVL 60

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNH++  LQ ++            +    +H   + +++ EH           + ++   
Sbjct: 61  GNHEETQLQQRHRA---------AERLTPDHLETRQVLEPEH-----------FEWMARL 100

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVGHAWSKHWNAA 233
           P  L +PE++  VVHAG++P  P+  QDP  ++  + I+   PT K          W   
Sbjct: 101 PHYLRLPEHNAIVVHAGMMPGRPVEAQDPYHLLHAQCIQ--PPTKKSYWPSKAPADWKFW 158

Query: 234 QQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNK 290
                 P+ +I+GH    +  +  Y+ G+D+GCVYG  L+A++     E+++V   K
Sbjct: 159 THYWQGPERVIFGHTVFDKPLVTEYAVGIDTGCVYGRSLTAVV-LPTWELVSVPARK 214



>gi|485640178|gb|EOD34437.1| hypothetical protein EMIHUDRAFT_228609 [Emiliania huxleyi CCMP1516]
          Length = 293

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 110/217 (50%), Gaps = 29/217 (13%)

Query: 68  LLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSL------GASCVRGNHDDKVL 121
           LL  +   N    +  ++FVGD+++KGP  +  ++L R+       G+  + GNH+    
Sbjct: 8   LLGKLAFSNRSFARYRVVFVGDVISKGPDPVASLRLARNTVAAAAAGSEILVGNHE---- 63

Query: 122 QIKNILDFLDS--QKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPIILDI 179
             +N+L +L    Q +P  +     +  +        +  ++L      +L   P  L +
Sbjct: 64  --RNLLTWLKQRDQGVPAGKRSGSGEGNR--------MTGEQLTRGEVEWLRGRPDRLAL 113

Query: 180 PEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVGHAWSKHWNAAQQESSS 239
           PE++  V HAGL   VPL +Q  +D+ +MR++      S      +W+  W         
Sbjct: 114 PEHNAIVAHAGLRAGVPLAQQQHADLTAMRSLDAAGLPSPTAGAVSWAASWRG------- 166

Query: 240 PKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALI 276
           P  +I+GHD+ RRL++ P++ G+D+GCVYGG+L+AL+
Sbjct: 167 PTHVIFGHDSRRRLQLHPFATGIDTGCVYGGQLTALV 203



>gi|345562999|gb|EGX46005.1| hypothetical protein AOL_s00112g22 [Arthrobotrys oligospora ATCC
           24927]
          Length = 502

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 84/147 (57%), Gaps = 12/147 (8%)

Query: 157 LLAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK 212
           +LAK L      ++ SCP+IL +       D+ VVHAG++  V L +Q PS +M++R   
Sbjct: 356 VLAKSLKPRHAEFIDSCPLILKLNNVSNLGDIAVVHAGIMAGVELKDQQPSVLMNVRTFV 415

Query: 213 NGKPTSKKDVGHAWSKHWN---AAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYG 269
              PTS +  G  WSK WN   A +     P T++YGHDA R L IK Y+ GLD+ CV G
Sbjct: 416 KNHPTSGRK-GLHWSKMWNEFVANRPSGQKPLTVVYGHDARRGLDIKKYTKGLDTNCVRG 474

Query: 270 GELSALIWNDNR----EIINVKCNKYV 292
           G L+AL+    +     I+NVKC KY+
Sbjct: 475 GRLTALVVEGGKHGKTSIVNVKCRKYL 501



>gi|320582739|gb|EFW96956.1| Serine/threonine protein phosphatase 2A [Ogataea parapolymorpha
           DL-1]
          Length = 336

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 85/285 (29%), Positives = 136/285 (47%), Gaps = 45/285 (15%)

Query: 43  INKLEAPLSQ---KNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSI 98
             KL+A   Q   K LI IGDVHGS  EL  L+  + +D  + DH++ +GD +AKG  S+
Sbjct: 41  FRKLKAAACQRPAKRLILIGDVHGSLLELQKLLKHVKFDGGRYDHVVLLGDFLAKGKNSL 100

Query: 99  EVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLL 158
            V++        C+ GNH+ ++L  K  + +     +  +E   E    +     E   +
Sbjct: 101 GVLEYAIQNRIDCILGNHEWEIL--KRYVQYHGLPGVGFNESKNELRAAEQYDLDEQMRI 158

Query: 159 AKELDVELYNYLLSCPIILD---IPEY-------------DLYVVHAGLLPDV-PLFEQD 201
           AK L  E  +Y+  C +I +   +P                   VH GL+  V  L +QD
Sbjct: 159 AKRLMPEHIDYISKCSLIKELGPVPRMTNKKRTKYASTPASGVAVHGGLVWSVETLQDQD 218

Query: 202 PSDIMSMRNI---KNGKPTSKK------DVGHAWSKHW---------NAAQQESSSPKTI 243
           P  I+++RN+       PT  +      +    W++ W         NA++   ++   +
Sbjct: 219 PEAILTIRNLLPPDYTIPTEDRHEVVDGEKSKPWTRFWTRRQLEVAANASEDALTAGTKV 278

Query: 244 IYGHDASRRLKIKPYSFGLDSGCVYGGELSA-LIWNDNREIINVK 287
            YGHDA R +  + +S GLDSGCVYG +LSA +IW+   E+++ K
Sbjct: 279 YYGHDAKRGVCFREFSTGLDSGCVYGAQLSAEIIWS---EVVSTK 320



>gi|406604505|emb|CCH44043.1| hypothetical protein BN7_3602 [Wickerhamomyces ciferrii]
          Length = 320

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 129/264 (48%), Gaps = 23/264 (8%)

Query: 43  INKLEAPLSQKN--LIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEV 100
            +KL  PL++ N  LI IGDVHGS   L NLI K+ ++   D +I +GD ++KGP SI V
Sbjct: 62  FDKLSKPLTKTNERLIIIGDVHGSLKPLKNLIEKVEFNNEMDQVILLGDYLSKGPDSIGV 121

Query: 101 VQLIRSLGASCVRGNHDDKVL---QIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGL 157
           +      G   + GNH+  +L   Q    L F D     L +  K  D PK I K    +
Sbjct: 122 LDYAMENGFKGILGNHELSILAKYQGSKNLYFQDDDLYNLTK--KTIDGPKKIDKEI--M 177

Query: 158 LAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPL--FEQDPSDIMSMRNIKNGK 215
           +AK+L  E  NY+ S PI L++     +  H     + P+          +  + I+N K
Sbjct: 178 IAKKLTPEHINYITSMPIFLELGLVSSFTNHENKW-NSPINGIASHLGINIDKKTIENQK 236

Query: 216 PTSKKDVGHAWSKHWNAAQQ--ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELS 273
              +  +   W K +N  ++  +      I YGH A   L +  YS GLDSGCVYGGEL+
Sbjct: 237 IMDQLQLNKYWFKDYNNYEKTIDKKHRNIIFYGHYAGLGLNLNKYSKGLDSGCVYGGELT 296

Query: 274 ALIWNDNRE---------IINVKC 288
           A++    +E         +++VKC
Sbjct: 297 AMVIYIEKEHDELVYKHDVVSVKC 320



>gi|497197421|ref|WP_009511683.1| metallophosphoesterase [Opitutaceae bacterium TAV5]
 gi|372474921|gb|EHP34931.1| metallophosphoesterase [Opitutaceae bacterium TAV5]
          Length = 220

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 114/240 (47%), Gaps = 31/240 (12%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            +I IGD+HG Y E   L+++++  P  D ++ +GD+V +GP S  V+ L R   A  + 
Sbjct: 4   RIIAIGDIHGCYQEFAELLDRLSLTP-ADQVVLLGDLVNRGPDSSRVIDLARKCRALSLL 62

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNH+ ++L  K   D            +KE D+P            + L  E + YL + 
Sbjct: 63  GNHEGRLLLWKRTGD---------RSGLKEVDLPT----------IELLRPEDWAYLQTM 103

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHA--WSKHW 230
            +   IPE +   VH G LP+ P  +Q  S +  ++ I   G+P  + +   A  W+  W
Sbjct: 104 QLTYYIPELNTVCVHGGFLPNEPWQKQPASVVTRIQVIDAAGRPRKRSEAPEAPLWADLW 163

Query: 231 NAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNK 290
           N        P  +IYGH     +    +S GLD+GC  GG L+A I  + R ++ VK  +
Sbjct: 164 NG-------PPFVIYGHTPRPDVYKLKWSIGLDTGCAMGGLLTAYILPEKR-LVQVKARR 215



>gi|116193371|ref|XP_001222498.1| hypothetical protein CHGG_06403 [Chaetomium globosum CBS 148.51]
 gi|88182316|gb|EAQ89784.1| hypothetical protein CHGG_06403 [Chaetomium globosum CBS 148.51]
          Length = 359

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/275 (32%), Positives = 126/275 (45%), Gaps = 59/275 (21%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYD-PLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           K L+ +GDVHG    L  L+ KI +D    DHL+  GD++ KGP S  VV+L  ++GAS 
Sbjct: 43  KRLVVVGDVHGQTAALKALLEKIGFDHKHGDHLVLAGDMITKGPDSKGVVKLAMAVGASA 102

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGL----------LAKE 161
           VRGN +D+VL     L    +    +DEF  +     +    E G+          +A+ 
Sbjct: 103 VRGNQEDRVLAAARELHRWSA----IDEFKSDRASEAEKADGEVGIETRRKNHAHRVAES 158

Query: 162 LDVELYNYLLSCPIILDI--------PEYD---LYVVHAGLLPDVPLFEQDPSDIMSMRN 210
           L      +L S PIIL I        P ++   L VVH GL+P V L +QDP  +M+MR+
Sbjct: 159 LTRAQLAWLRSLPIILRIGHLPDAASPPWNASTLAVVHGGLVPGVHLEKQDPWAVMNMRS 218

Query: 211 IKNGKPTSKKDVGHAWSKHWNAAQQES-------------------------SSPKTIIY 245
           +K  +            KH + +Q ES                         + P     
Sbjct: 219 LKYPRKGKGGKK----GKHHSESQPESPVDHDEDQTDPTTTTDGLTLTPDAVAVPVDTHG 274

Query: 246 GHDASRRLKIKP----YSFGLDSGCVYGGELSALI 276
           G   S  LK K     Y++GLDSGC +G +L+AL+
Sbjct: 275 GEPWSHVLKKKQKGHRYAYGLDSGCGHGKQLTALV 309



>gi|58267334|ref|XP_570823.1| phosphoric monoester hydrolase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134111661|ref|XP_775366.1| hypothetical protein CNBE0840 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258025|gb|EAL20719.1| hypothetical protein CNBE0840 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227057|gb|AAW43516.1| phosphoric monoester hydrolase, putative [Cryptococcus neoformans
           var. neoformans JEC21]
          Length = 543

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 87/163 (53%), Gaps = 16/163 (9%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           S   +IF+GDVH SYD L  L++K+ YD   D L  VGD++AKGPK  +V+Q +R     
Sbjct: 173 SGHRVIFVGDVHSSYDPLQRLMSKLQYDDTSDVLFHVGDLLAKGPKPEQVLQWMREHKIR 232

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKIPL--------DEFIKEHDIPKD--------IVKSE 154
            VRGNHD  V+Q +  +++    +           +E    H + KD        + K E
Sbjct: 233 GVRGNHDQPVIQWRTWMEWAGGVEWEAYMDLLSGKEEEEAIHILGKDKKKYPDGWVWKGE 292

Query: 155 HGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPL 197
           H  +A+E+  E Y YL +  +IL  P    +VVHAGLLP  PL
Sbjct: 293 HWNIAREISKESYEYLTNLSLILHFPSLHAFVVHAGLLPSNPL 335



>gi|224010187|ref|XP_002294051.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220970068|gb|EED88406.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 275

 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 132/262 (50%), Gaps = 41/262 (15%)

Query: 45  KLEAPLSQKN------LIFIGDVHGSYDELLNLINKI----NYDPLKDHLIFVGDIVAKG 94
           K+  PL+  N      ++ IGD+HG  DEL  L++K     N       ++ VGD+  KG
Sbjct: 7   KIVNPLNSANSKCTDKILLIGDIHGCLDELKALVSKATDEHNNGKQFKAIVLVGDLCNKG 66

Query: 95  PKSIEVVQLIR-SLGASCVRGNHDDKVLQI---------KNILDFLDSQKIPLDE-FIKE 143
           P S +V++ +R  L    VRGNHDD+ L           K   D++   K+  DE  +  
Sbjct: 67  PYSAQVIEYVRHQLHWYAVRGNHDDRALAAAFGDEACLAKPKYDWV---KVLTDEDVVWM 123

Query: 144 HDIPKDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPS 203
            ++P  I +   GLL +E +  + N  +S         +D+ VVHAGL+P+V L EQ   
Sbjct: 124 ANLPYTI-RIPKGLLMEETEQHMNNTSMSSG-------HDVIVVHAGLIPNVDLEEQKLK 175

Query: 204 DIMSMRNIKNGKPTSKKDVGHAWSKHWNAAQQESS---------SPKTIIYGHDASRRLK 254
            ++++R++              +  + N++  + S          P+ I++GHDA R ++
Sbjct: 176 TMLTVRDLIPIPRREDDSTTQHYKYYKNSSNADESPIPWVAAWHGPELIVFGHDAKRGIQ 235

Query: 255 IKPYSFGLDSGCVYGGELSALI 276
           ++ ++ GLDSGCVYG +L+ LI
Sbjct: 236 LEEFAIGLDSGCVYGKKLTGLI 257



>gi|405120595|gb|AFR95365.1| phosphoric monoester hydrolase [Cryptococcus neoformans var. grubii
           H99]
          Length = 542

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 90/165 (54%), Gaps = 20/165 (12%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           S   +IF+GDVH SYD L  L++K+ YD   D L  VGD++AKGPK  +V+Q +R     
Sbjct: 172 SGHRVIFVGDVHSSYDPLQRLMSKLQYDDTSDVLFHVGDLLAKGPKPEQVLQWMREHKVR 231

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKIPLDEFI-----KE-----HDIPKD--------IVK 152
            VRGNHD  V+Q +  +++  +  +  + ++     KE     H + KD        I K
Sbjct: 232 GVRGNHDQPVIQWRTWMEW--AGGVEWEAYMDLLSTKEGEEAIHILGKDKKKYPDGWIWK 289

Query: 153 SEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPL 197
            EH  +A+++  E Y YL +  +IL  P    +VVH GLLP  PL
Sbjct: 290 GEHWNIARQISKESYEYLTNLSLILHFPSLHAFVVHGGLLPSNPL 334



>gi|494487848|ref|WP_007277321.1| putative bis(5'-nucleosyl)-tetraphosphatase, symmetrical
           [Lentisphaera araneosa]
 gi|149140621|gb|EDM29019.1| putative bis(5'-nucleosyl)-tetraphosphatase, symmetrical
           [Lentisphaera araneosa HTCC2155]
          Length = 230

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 115/242 (47%), Gaps = 32/242 (13%)

Query: 46  LEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIR 105
           +E  L +K  IF+GD+HG Y E   L+ K+NYD   D LI VGDIV KGP+S  V+    
Sbjct: 1   MEVKLKRK--IFVGDIHGCYAEFKKLLKKVNYDADCDRLISVGDIVNKGPQSAAVLDYFI 58

Query: 106 SLGASCVRGNHDDKVLQIKNILDFLDSQKIPL----DEFIKEHDIPKDIVKSEHGLLAKE 161
                 V+GNH+D + +         S + P+    ++ ++E    K+            
Sbjct: 59  KNKIEVVKGNHEDWLFRAL-------SGESPMYKEGEQIVQESAYSKE------------ 99

Query: 162 LDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKK 220
              E+ ++L + P    I   D   VHAG  P   L E +  D+ ++R + K  +    K
Sbjct: 100 ---EILHWLKNLPCY--IKGEDFVAVHAGFSPYCKLKENNERDLFTVRYVDKETQELFAK 154

Query: 221 DVG-HAWSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWND 279
           D G H  S  +     +    + II+GH A +++       GLD+GCVYGG LSA I+  
Sbjct: 155 DNGEHKLSPWYEEFTYQKPGKREIIHGHWAKKKICEYGRVIGLDTGCVYGGHLSAYIFPS 214

Query: 280 NR 281
            R
Sbjct: 215 KR 216



>gi|340516297|gb|EGR46546.1| predicted protein [Trichoderma reesei QM6a]
          Length = 466

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 91/172 (52%), Gaps = 22/172 (12%)

Query: 49  PLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG 108
           P +++ L+ +GD+HG    L  L+ K+++DP +DHLI  GD++ KGP S  VV  +  L 
Sbjct: 135 PSNKRRLVIVGDIHGMDAALEALLRKVDFDPSRDHLIAAGDMINKGPDSPGVVSRLMRLN 194

Query: 109 ASCVRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIV-------KSEHGLLA-- 159
           AS VRGNH+D+VL             + L E   +  + K++        + E  LLA  
Sbjct: 195 ASAVRGNHEDRVL-------------LALAEAEAQTGVSKELASPDAEAHRGEAELLATG 241

Query: 160 KELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI 211
           + L  E   +L   P+IL +    + V HAGL+P V    QDP  +M+MR +
Sbjct: 242 RRLATEHVEWLRRLPVILAVEPLRILVAHAGLVPGVRPELQDPWAVMNMRTL 293



>gi|348677286|gb|EGZ17103.1| hypothetical protein PHYSODRAFT_264248 [Phytophthora sojae]
          Length = 238

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 108/226 (47%), Gaps = 48/226 (21%)

Query: 51  SQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGA 109
           +   L+ IGDVHG  DEL  L+   ++ P   D L+FVGD+V KGPKS++VV+ +R  GA
Sbjct: 28  ASSRLLVIGDVHGCLDELQALLAACHFAPFAGDRLVFVGDLVNKGPKSLDVVRFVRDSGA 87

Query: 110 SCVRGNHDDKVLQIKNILDFLDSQKIPLDE---FIKEHDIPKDIVKSEHGLLAKELDVEL 166
            CVRGNHDD  L       ++   + P      ++++ + P+D+                
Sbjct: 88  LCVRGNHDDAAL--SAYYRWVQGGRQPGSAKYPYVEQFE-PRDVA--------------- 129

Query: 167 YNYLLSCPIILDIPEY-DLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVGHA 225
             +L   P  L +P + ++ VVHAGL+  V L +Q P D+  MR ++  +   +     A
Sbjct: 130 --FLEQLPFSLSLPNHGNIIVVHAGLVEGVELQDQKPFDMYKMRFVQRERAEDEGSQWKA 187

Query: 226 ----------------WSKHWNAAQQESSSPKTIIYGHDASRRLKI 255
                           W+K W       S P+ + +GH AS  L++
Sbjct: 188 LEKEKFKSESGGEPKMWAKVW-------SGPRHVYFGHAASAGLQV 226



>gi|321258911|ref|XP_003194176.1| phosphoric monoester hydrolase [Cryptococcus gattii WM276]
 gi|317460647|gb|ADV22389.1| phosphoric monoester hydrolase, putative [Cryptococcus gattii
           WM276]
          Length = 543

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 91/169 (53%), Gaps = 21/169 (12%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            +IF+GD+HGSYD L  L++++ YD   D L  VGD+VAKGPK  +V+Q +R      VR
Sbjct: 176 RMIFVGDIHGSYDPLQRLMSELQYDDNNDVLFHVGDLVAKGPKPEQVLQWMREHKIRGVR 235

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFI-----KEHDIPKDIV-------------KSEH 155
           GNHD  V+Q +  +++  +  +  + ++     KE D    I+             K EH
Sbjct: 236 GNHDQPVIQWRTWMEW--AGGVEWEAYMDLLSGKEGDEAIQILDKDKKKYPDDWIWKGEH 293

Query: 156 GLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPL-FEQDPS 203
             +A+++  E Y YL +  +IL +P    + VH GLLP  PL    DPS
Sbjct: 294 WNIARQISKESYEYLTNLSLILHLPSLHAFAVHGGLLPSNPLKSSSDPS 342



>gi|358379323|gb|EHK17003.1| hypothetical protein TRIVIDRAFT_65961 [Trichoderma virens Gv29-8]
          Length = 409

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 90/161 (55%), Gaps = 6/161 (3%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           ++ L+ +GD+HG    L  L+ K+++D  +DHLI  GD++ KGP S  VV  +  L AS 
Sbjct: 95  KRRLVIVGDIHGMDAALETLLKKVDFDAKRDHLIATGDMINKGPDSPGVVSRLMRLNASA 154

Query: 112 VRGNHDDKVLQIKNILDFLDSQ-KIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYL 170
           VRGNH+D+VL     L   +++ +  + + +   D      +SE     ++L  E   +L
Sbjct: 155 VRGNHEDRVL-----LSLAEAEAQTGVSKDLSSADAESHRGESEFLATGRKLSKEHVQWL 209

Query: 171 LSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI 211
           L  P+IL +    +++ HAGL+P V    QDP  +M+MR +
Sbjct: 210 LKLPVILSVEPLRMFIAHAGLVPGVRPELQDPWAVMNMRTL 250



>gi|67537086|ref|XP_662317.1| hypothetical protein AN4713.2 [Aspergillus nidulans FGSC A4]
 gi|40741565|gb|EAA60755.1| hypothetical protein AN4713.2 [Aspergillus nidulans FGSC A4]
          Length = 370

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 87/144 (60%), Gaps = 12/144 (8%)

Query: 158 LAKELDVELYNYLLSCPIILDIPEY----DLYVVHAGLLPDVPLFEQDPSDIMSMRNIK- 212
           LA++L  E   +L +CP+IL++ +      + V HAGL+P V L  QDP  +M+M+ +  
Sbjct: 206 LARQLSAEQAEWLDACPVILNVGQITNMGQVVVAHAGLIPGVDLDRQDPYSVMNMKTVDL 265

Query: 213 -NGKPTSKKDVGHAWSKHWNAAQQESSSPK----TIIYGHDASRRLKIKPYSFGLDSGCV 267
               P+S  + G  W+K +N  Q  S   K    T+IYGHD+   L +K Y+ GLD+GCV
Sbjct: 266 PTHVPSSSLEKGVKWTKLFNKHQTLSLESKNGVMTVIYGHDSKSGLSLKEYTKGLDTGCV 325

Query: 268 YGGELSALIWNDN--REIINVKCN 289
            GG+L+A++ +D   +EI+ VKC+
Sbjct: 326 KGGKLTAMVISDGGKQEIVQVKCS 349



>gi|358060624|dbj|GAA93665.1| hypothetical protein E5Q_00310 [Mixia osmundae IAM 14324]
          Length = 734

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 97/181 (53%), Gaps = 30/181 (16%)

Query: 36  KPLNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGP 95
           + L+++L N      ++  LI +GDVHG  D L +L+  +++ P +D LI VGD+VAK P
Sbjct: 209 ESLDWSLSN------ARGRLIVVGDVHGMVDSLKSLLQGLDFQPDEDQLILVGDLVAKHP 262

Query: 96  K---SIEVVQLIRSLGASCVRGNHDDKVLQIK--------------------NILDFLDS 132
               S+  V   RS+ AS VRGNHDDKV+  +                    N L  LDS
Sbjct: 263 SVNASLATVAYARSVNASIVRGNHDDKVVAWREWMQQQVMLSASNADNATSVNQLSMLDS 322

Query: 133 QKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLL 192
           + +P D  + + D  +   +S+H  +A+++  +   +L + P+ L IP    YVVHAGL+
Sbjct: 323 KDLPDDVQVPD-DWREYKWQSQHFQIARQMSSDDAAWLAASPLTLHIPSLHSYVVHAGLM 381

Query: 193 P 193
           P
Sbjct: 382 P 382



>gi|367021514|ref|XP_003660042.1| hypothetical protein MYCTH_2297823 [Myceliophthora thermophila ATCC
           42464]
 gi|347007309|gb|AEO54797.1| hypothetical protein MYCTH_2297823 [Myceliophthora thermophila ATCC
           42464]
          Length = 521

 Score =  100 bits (250), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 122/282 (43%), Gaps = 79/282 (28%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           K L+ +GDVHG    L  L+ KI +D    DHLI  GD+V KGP S  VV+L   +GAS 
Sbjct: 146 KRLVIVGDVHGHRAALEALLRKIGFDHRNGDHLILAGDMVTKGPDSKGVVELAMEIGASA 205

Query: 112 VRGNHDDKVLQI-KNILDF-LDSQKIPLDEFIKEHDIPKDIVKSEHGL------------ 157
           VRGN DDKVL   + I  F +D +  P      E D  +D V  + G             
Sbjct: 206 VRGNQDDKVLATAREIGRFSVDGESTPGP--ATEEDDEQDEVGGKEGADGKAETKTRRKA 263

Query: 158 ----LAKELDVELYNYLLSCPIILDI--------PEYD---LYVVHAGLLPDVPLFEQDP 202
               +A+ L      ++ S P+IL +        P ++   L V+H GL+P +P  +QDP
Sbjct: 264 NARRVARSLTRSQLAWIRSLPLILRVGNIPGATSPPWNASTLVVIHGGLVPGLPPEKQDP 323

Query: 203 SDIMSMRNI-------------------KNGKPTSKKDV--------------------- 222
             +M+MR++                      +P S+ D                      
Sbjct: 324 WAVMNMRSLIYPRVGKGKKNKDKDGRRHARDEPESEIDETETDMDETDPASVRAAVAIPT 383

Query: 223 ----GHAWSKHWNAAQQE--SSSPKTI-IYGHDASRRLKIKP 257
               G  WS  WN  Q     ++P+T+ +YGHDA   L++ P
Sbjct: 384 DRHGGEPWSHAWNRYQNNLPPTAPRTVAVYGHDAKAGLQVDP 425



>gi|494604542|ref|WP_007362790.1| metallophosphoesterase [Opitutaceae bacterium TAV1]
 gi|391221405|gb|EIP99825.1| putative phosphoesterase [Opitutaceae bacterium TAV1]
          Length = 220

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 112/240 (46%), Gaps = 31/240 (12%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            +I IGD+HG + E   L++++   P  D ++ +GD+V +GP S  V+ L R   A  + 
Sbjct: 4   RIIAIGDIHGCHQEFAELLDRLALTP-ADQVVLLGDLVNRGPDSSRVIDLARKCRALSLL 62

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNH+ ++L  K   D            +KE D+P            + L  E + YL + 
Sbjct: 63  GNHEGRLLLWKRTGD---------RSGLKEVDLPT----------IELLRPEDWAYLQTM 103

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHA--WSKHW 230
            +   IPE +   VH G L + P  +Q  S +  ++ I   G+P  + +   A  W+  W
Sbjct: 104 QLTYYIPELNTVCVHGGFLSNEPWQKQPASVVTRIQVIDAAGRPRKRSEAPEAPLWADLW 163

Query: 231 NAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNK 290
           N        P  +IYGH     +    +S GLD+GC  GG L+A I  + R ++ VK  +
Sbjct: 164 NG-------PPFVIYGHTPRPDVYKLKWSIGLDTGCAMGGLLTAYILPEKR-LVQVKARR 215



>gi|392572659|gb|EIW65804.1| hypothetical protein TREMEDRAFT_35995 [Tremella mesenterica DSM
           1558]
          Length = 519

 Score =  100 bits (249), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 148/352 (42%), Gaps = 110/352 (31%)

Query: 39  NYTLINKL--EAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPK 96
           +YT++  L  E P   K LI IGD+HGS D L  L+ KI YD   D LI VGD++AKG  
Sbjct: 141 HYTILRTLPGELPALGKRLILIGDIHGSIDPLKRLMTKIQYDQEHDRLIHVGDLIAKGEG 200

Query: 97  SIEVVQLIRSLGASCVRGNHDDKVLQI---------KNILDFLD-----SQKIPLDEFIK 142
           + EV+  +R      VRGNHD  V+Q          +N  D++D      +K  L    K
Sbjct: 201 NDEVLSWMREREVMGVRGNHDQPVIQWRAWMEWAGGRNWQDYVDGLEPLGEKTALSALSK 260

Query: 143 EHDI-PKDI-VKSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLL-------- 192
              + PKD   K EH  LA+E+    Y+YLL+ P++L +P    +VVHAGLL        
Sbjct: 261 NGKMFPKDWEWKGEHWQLAREIQSTNYHYLLNLPLVLHLPVLHTFVVHAGLLPSNQLKSS 320

Query: 193 --PDVPLFEQD-----------------------PSDIMSMRNI-----KNGKPTSKKDV 222
             P  PL +                         P +++++R++       G+PT+    
Sbjct: 321 SDPSQPLVQASNSTGLSRASEELGILFQVPQNSVPWNLLNIRSVLKKGKHRGEPTNSSKK 380

Query: 223 GHAWSKHWNA-----------AQQESSSP---------------------KTII---YGH 247
           G  WS  WN            A  ++SS                      K++     G 
Sbjct: 381 GTPWSDIWNKEMKRCRGEGAWADTKTSSEVENEIEDSDIETEEEEEVDELKSVTPTQKGR 440

Query: 248 DASRRLKI-------------------KPYSFGLDSGCVYGGELSALIWNDN 280
              RR K+                   K +S G+D+GCVYG +L+ LI  D 
Sbjct: 441 SGGRRDKLPCSPITVIYGHAAGRGLDIKRFSKGIDTGCVYGKQLTGLIIGDT 492



>gi|410075547|ref|XP_003955356.1| hypothetical protein KAFR_0A07870 [Kazachstania africana CBS 2517]
 gi|372461938|emb|CCF56221.1| hypothetical protein KAFR_0A07870 [Kazachstania africana CBS 2517]
          Length = 317

 Score =  100 bits (248), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 121/245 (49%), Gaps = 32/245 (13%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDH--LIFVGDIVAKGPKSIEVVQLI--RSLG 108
           K ++F+GDVHG + EL NLINK     L D   LI +GD   KGP S +V+  I      
Sbjct: 62  KRIVFVGDVHGQFKELDNLINK-KLGGLDDETLLILLGDFTMKGPDSEKVIDFILDNKAN 120

Query: 109 ASCVRGNHDDKVLQ--IKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVEL 166
             C+ GNH+  +L   +K  L F +   I   EF          V   H  LA ++    
Sbjct: 121 VKCLLGNHEVSLLLAFLKGNLFFDNDSVIKRKEFK---------VTENHVNLANKIGFRK 171

Query: 167 YNYLLS-CPII----LDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIK-------NG 214
            + L   C ++    L + +  LY VHAG+LP+V   +++  ++ S+  +K       + 
Sbjct: 172 LSALARHCSVLTRLELGLTDEILYGVHAGMLPNVVNDDENKFNVNSLVEMKYVNDRDWSE 231

Query: 215 KPTSKKDVGH--AWSKHWNAAQQESSSPK--TIIYGHDASRRLKIKPYSFGLDSGCVYGG 270
               K D+ H   W K W    ++    K  TI+YGHDA + L I+ ++ GLDS CV GG
Sbjct: 232 ASRDKDDISHPVRWYKIWEDYVEKHKELKNITILYGHDARKGLNIRNFTKGLDSACVKGG 291

Query: 271 ELSAL 275
           +LSA+
Sbjct: 292 KLSAM 296



>gi|310799192|gb|EFQ34085.1| calcineurin-like phosphoesterase [Glomerella graminicola M1.001]
          Length = 375

 Score = 99.4 bits (246), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 99/195 (50%), Gaps = 23/195 (11%)

Query: 38  LNYTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPK 96
           L+  L+   E   S++ L+ +GDVHG   +L  L+  I +D    DHL+F GD++ KGP 
Sbjct: 17  LDPILLPSAEPCASRRRLVIVGDVHGHLSKLKRLLRNIGFDKASGDHLVFTGDLINKGPD 76

Query: 97  SIEVVQLIRSLGASCVRGNHDDKVLQIKNILDF-------LDSQKIPLDEFIKEHDIPKD 149
           S  VVQL    GAS VRGN++D+VL    +L             ++P +       +P D
Sbjct: 77  SPGVVQLAMDHGASAVRGNNEDRVLAANRLLRIGRVPSVSGGDGRLPFEN--SSAPLPLD 134

Query: 150 I--VKSEHGLLAKELDVELYNYLLSCPIILDIPEY-----------DLYVVHAGLLPDVP 196
           I    S   + A +L      +L S P++L I  +            + +VH GL+P +P
Sbjct: 135 IPYAVSSDFVTATQLSNAQLAWLSSLPLMLRIGPFRGAVSPPWNAGSVVIVHGGLVPSLP 194

Query: 197 LFEQDPSDIMSMRNI 211
           L EQDP  +M+MR++
Sbjct: 195 LEEQDPWAVMNMRSL 209



>gi|342889143|gb|EGU88311.1| hypothetical protein FOXB_01206 [Fusarium oxysporum Fo5176]
          Length = 404

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/231 (33%), Positives = 111/231 (48%), Gaps = 45/231 (19%)

Query: 26  NNYSINTHNFKPLN------YTLINKLEAPLSQKNLIFIGDVHGSYDELLNLINKINYD- 78
           N Y INTH+    +      Y L  +++  ++   LI +GDVHG   EL  L+ K+ Y  
Sbjct: 6   NEYEINTHSSTAHSHAGFPWYPLQTRIQDVIAPGRLIIVGDVHGRLPELKELVEKVAYSK 65

Query: 79  PLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILDFLDSQKIP-- 136
           P  D LI VGD++ KGP S  VVQL   LGAS +RGN++D+VL   + +   D  K+   
Sbjct: 66  PNGDKLILVGDLINKGPDSPGVVQLAMELGASAIRGNNEDRVLAAHSAIKRGDDTKLVER 125

Query: 137 ----LDEFIKEHD------------------IPKDI--VKSEHGLL-AKELDVELYNYLL 171
                 E  KE+D                   P+D+    SE     A  L  E  ++L 
Sbjct: 126 LKRLAREAEKENDKKDGEPAPSETKDDLKSISPEDLKPYSSESDFTTAANLSDERISWLA 185

Query: 172 SCPIILDI--------PEYD---LYVVHAGLLPDVPLFEQDPSDIMSMRNI 211
           S P++L I        P ++   L V H GL+P +PL EQD   +M+MR +
Sbjct: 186 SQPLVLRIKLRKGATSPPWNSGTLLVAHGGLVPLLPLEEQDSWAVMNMRGL 236



>gi|367042292|ref|XP_003651526.1| hypothetical protein THITE_2111951 [Thielavia terrestris NRRL 8126]
 gi|346998788|gb|AEO65190.1| hypothetical protein THITE_2111951 [Thielavia terrestris NRRL 8126]
          Length = 510

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 127/290 (43%), Gaps = 74/290 (25%)

Query: 39  NYTLINKLEAPLSQKN-------LIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDI 90
            YT  +++E P   KN       L+ +GDVHG    L  L+ KI +D    DHL+  GD+
Sbjct: 93  TYTPPSQIEGPGGDKNKKTQGKRLVVVGDVHGHLVALKALLRKIGFDNNNGDHLVLAGDL 152

Query: 91  VAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNILD--FLDSQKIPLDEFIKEHDIPK 148
           V KGP S  VVQL   LGAS VRGN DD+VL     L    +D Q   L  +I + D   
Sbjct: 153 VTKGPDSRGVVQLAMDLGASAVRGNQDDRVLVAARELRRASVDDQSR-LVGYISDADAEA 211

Query: 149 D------------IVKSEH-GLLAKELDVELYNYLLSCPIILDI--------PEYD---L 184
           D            I K  H   +A+ L     ++L + PIIL I        P ++   L
Sbjct: 212 DADAEEDDEAQTHIRKRAHVRKVARSLTRAQLDWLSTRPIILRIGRLPDATSPPWNASIL 271

Query: 185 YVVHAGLLPDVPLFEQDPSDIMSMRNI---KNGK------------------------PT 217
            VVH GL+P  P  +QDP  +M+MR++     GK                        PT
Sbjct: 272 AVVHGGLVPGTPFEKQDPWAVMNMRSLLYPGRGKHHISKDTPKDDPDNNDENSPSTPIPT 331

Query: 218 SKKDV---------GHAWSKHWNAAQQE--SSSPKT-IIYGHDASRRLKI 255
              +          G  WS  WN  Q     ++P T +IYGHDA   L++
Sbjct: 332 PATEAVAVPIDGRKGEPWSHAWNRYQNHLPPTAPHTVVIYGHDAKAGLQV 381



>gi|471563292|gb|EMR64580.1| putative ser thr protein phosphatase family protein [Eutypa lata
           UCREL1]
          Length = 455

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 99/179 (55%), Gaps = 14/179 (7%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLK-DHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
            LI IGDVHG   EL +L++K+ Y   + D +I  GD V KG  S  VV L  + G S V
Sbjct: 85  RLIIIGDVHGQLSELRSLLSKVEYSASRGDRVILTGDTVNKGADSAGVVALAMAHGFSSV 144

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLL--AKELDVELYNYL 170
           RGNH+D+VL+   +   +++ ++   E ++E +    + K+E   L  A+ L  E   +L
Sbjct: 145 RGNHEDRVLR---VFALVEAMQVAGGEALEEAE--AHLSKNEKIALATARSLSAEQRAWL 199

Query: 171 LSCPIILDI------PEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVG 223
            + P+IL++       +  + VVH GL+P + L +QDP  +M+MR +      +KK+ G
Sbjct: 200 AALPVILEVGAIPGSAQGKVVVVHGGLVPGLELEKQDPWAVMNMRTLLYPTKKNKKEKG 258



>gi|294056547|ref|YP_003550205.1| metallophosphoesterase [Coraliomargarita akajimensis DSM 45221]
 gi|502809775|ref|WP_013044751.1| metallophosphoesterase [Coraliomargarita akajimensis]
 gi|293615880|gb|ADE56035.1| metallophosphoesterase [Coraliomargarita akajimensis DSM 45221]
          Length = 226

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 111/241 (46%), Gaps = 31/241 (12%)

Query: 53  KNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCV 112
           K  I IGD+HG  +E   L++ +N     D LI +GD++ +GP S  V+++ R      +
Sbjct: 2   KRTIAIGDIHGCAEEFAELLDALNLQ-AGDRLIQLGDLINRGPDSRGVLEIARDYRVEAI 60

Query: 113 RGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLS 172
            GNH+ +VL          + +    + +K++D+             K+L  E + YL S
Sbjct: 61  LGNHEVRVLT---------ALREGRPDILKDYDLET----------IKQLHNEDWKYLES 101

Query: 173 CPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKN-GKPTSKKDVGHA--WSKH 229
            P  +     D   VH G LPD P  +Q  S I +++ +   G P  + D   A  W+  
Sbjct: 102 LPNWIHDTSSDTVFVHGGFLPDQPWQQQSVSVITTIQVLDALGHPAKRSDCPEADNWADS 161

Query: 230 WNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCN 289
           W         P  ++YGH     +     S G+D+GCVYGG L+A I  + +  + V+  
Sbjct: 162 WEG-------PPFVVYGHTPRPNVYQHSASIGIDTGCVYGGHLTAFIL-EEQSFVQVRAR 213

Query: 290 K 290
           K
Sbjct: 214 K 214



>gi|182414904|ref|YP_001819970.1| metallophosphoesterase [Opitutus terrae PB90-1]
 gi|501344264|ref|WP_012375899.1| metallophosphoesterase [Opitutus terrae]
 gi|177842118|gb|ACB76370.1| metallophosphoesterase [Opitutus terrae PB90-1]
          Length = 220

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 115/238 (48%), Gaps = 27/238 (11%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI IGD+HG   E   L+NK+      D ++ +GD++ +GP+S  V+ L R      + 
Sbjct: 4   RLIAIGDIHGCAREFEELLNKLELQ-RGDRVVLLGDLINRGPESARVLALAREQAHLSLL 62

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNH+ ++L  +   D                  P  + KS++  L K+L    + Y+ + 
Sbjct: 63  GNHELRLLNYRKTSD------------------PTHLKKSDYDTL-KQLGRRDWAYMAAM 103

Query: 174 PIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI-KNGKPTSKKDVGHAWSKHWNA 232
           P+        + +VH G LPD+P  +Q    +  ++NI ++G P  + +  +    HW+ 
Sbjct: 104 PLTYFDRRDGVVLVHGGFLPDLPWRQQPARIVTRVQNIDRDGNPRKRSEAPNC--PHWST 161

Query: 233 AQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNK 290
             Q    P  ++YGH +  ++    +S G+D+ C  GG L+A I  + + ++ VK ++
Sbjct: 162 LWQ---GPPFVVYGHTSRPQVARLKWSLGIDTACAMGGRLTACILPEQK-LVQVKAHE 215



>gi|488859789|ref|WP_002772029.1| metallophosphoesterase [Leptonema illini]
 gi|373874482|gb|EHQ06476.1| metallophosphoesterase [Leptonema illini DSM 21528]
          Length = 236

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 107/226 (47%), Gaps = 35/226 (15%)

Query: 56  IFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGN 115
           IFIGDVHG  DEL  +  ++     +D ++ +GD++ +GP    VV  +      C+ GN
Sbjct: 13  IFIGDVHGCIDELQAMCKRLRLSQ-EDRIVMLGDLINRGPDPAAVVAFVAEKKFDCLMGN 71

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           H+D                    E++KE+       + ++  L +EL ++L+ ++   P+
Sbjct: 72  HED--------------------EYLKEYK-----HEEKYAALREELGLDLHLWIEERPL 106

Query: 176 ILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVGHAWSKHWNAAQQ 235
            +D P +    VHAGL P       D   ++++R         K     AW +++     
Sbjct: 107 WIDHPSF--LCVHAGLKPGALPASNDRRYLLNIRTWDGEGRDIKTPSNPAWYEYY----- 159

Query: 236 ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNR 281
             + P+ + YGH A + L I+  + GLDSGCVYG  LSA I  + R
Sbjct: 160 --TQPRPVFYGHWAQQGLTIRRNTVGLDSGCVYGRALSAWILEEER 203



>gi|399165576|emb|CCE33510.1| uncharacterized protein CPUR_07435 [Claviceps purpurea 20.1]
          Length = 414

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 96/180 (53%), Gaps = 30/180 (16%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC 111
           Q+ LI IGD+HG   EL +L++K  YD  +DH++ +GD+V KG  S  V+  + ++ AS 
Sbjct: 88  QRRLIVIGDIHGMNTELGHLLDKARYDSSRDHVVTLGDMVNKGHDSKGVLARLMAMNASA 147

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLD--------------------EFIKEHDIPKDIV 151
           VRGNH+D++L     L+   ++  P                      E +++ D  K I+
Sbjct: 148 VRGNHEDRLLL---ALEEYHNRAAPARHGDSDSDSDSSKDGNDRPNIEKMRKKD--KKIL 202

Query: 152 KSEHGLLAKELDVELYNYLLSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIMSMRNI 211
           K     +AK L  +   +L   P+IL+     LY VHAGL+P V L  QDP  +M+MR++
Sbjct: 203 K-----VAKSLTAKQVKWLSHLPVILEAKPLQLYFVHAGLVPGVRLDRQDPWAVMNMRSL 257



>gi|380484989|emb|CCF39646.1| calcineurin-like phosphoesterase [Colletotrichum higginsianum]
          Length = 377

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 95/180 (52%), Gaps = 21/180 (11%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDP-LKDHLIFVGDIVAKGPKSIEVVQLIRSLGAS 110
           ++ LI +GDVHG   +L  L+    +D    DHLIF GD++ KGP S  VVQL   LGAS
Sbjct: 31  RRRLIIVGDVHGHLAQLKKLLETTGFDRDAGDHLIFTGDLINKGPDSPGVVQLAMDLGAS 90

Query: 111 CVRGNHDDKVLQIKNILDFLDSQKI------PLDEFIKEHDIPKDI--VKSEHGLLAKEL 162
            VRGN++D+VL    ++       +      P  E    H +P+DI    S   L A +L
Sbjct: 91  AVRGNNEDRVLAAHRLISIGRVSGVSGVEGRPPFEDDSTH-LPRDIPYAVSSDFLAATQL 149

Query: 163 DVELYNYLLSCPIILDI--------PEYD---LYVVHAGLLPDVPLFEQDPSDIMSMRNI 211
                 +L S P+I+          P ++   + VVH GL+P +PL +QDP  +M+MR+I
Sbjct: 150 SDAQVAWLSSLPLIIRAGPLKGAASPPWNAGSVVVVHGGLVPSLPLEKQDPWAVMNMRSI 209



>gi|495777443|ref|WP_008502022.1| diadenosine tetraphosphatase [Enterobacter sp. SST3]
 gi|400215327|gb|EJO46238.1| diadenosine tetraphosphatase [Enterobacter sp. SST3]
          Length = 282

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 83/280 (29%), Positives = 122/280 (43%), Gaps = 69/280 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++++ P +D L   GD+VA+GP S+EV++ ++SLG S   V G
Sbjct: 5   LIGDVHGCYDELIALLKQVDFTPGQDTLWLTGDLVARGPGSLEVLRFVKSLGDSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +    S+  P D      D P             + D EL N+L   P
Sbjct: 65  NHDLHLLAVFAGI----SRNKPKDRLTPLLDAP-------------DAD-ELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         P F             +D
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLETAKTCARDVEAVLASDSYPFFLDAMYGDMPNHWSED 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          A  K W A     +S   +++G
Sbjct: 167 LSGLARLRFITNAFTRMRFCFPNGQLDMYSKETPESAPAPLKPWFAIPGPVTSEYNVVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIIN 285
           H A+   K  P   +GLD+GC +GGEL+ L W D    + 
Sbjct: 227 HWAALEGKGTPEGIYGLDTGCCWGGELTCLRWEDKTYFVQ 266



>gi|490309474|ref|WP_004204272.1| diadenosine tetraphosphatase [Klebsiella pneumoniae]
 gi|471243049|gb|EMR20465.1| diadenosine tetraphosphatase [Klebsiella pneumoniae 700603]
          Length = 282

 Score = 97.1 bits (240), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 83/276 (30%), Positives = 118/276 (42%), Gaps = 69/276 (25%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ +DP  D L   GD+VA+GP S+EV++ ++SLG S   V G
Sbjct: 5   LIGDVHGCYDELIALLAQVEFDPRSDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +KS   LL      EL N+L   P
Sbjct: 65  NHDLHLLAVFAGI---------------SRNKPKDRLKS---LLEAPDADELLNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLPD---------------------VPLF------------EQD 201
           ++    E  L + HAG+ P                       P F              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          A  K W A     SS  +I +G
Sbjct: 167 LSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSSAYSIAFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           H AS   +  P   + LD+GC +GGEL+ L W D +
Sbjct: 227 HWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQ 262



>gi|495737137|ref|WP_008461716.1| diadenosine tetraphosphatase [Enterobacter sp. Ag1]
 gi|394728824|gb|EJF28859.1| diadenosine tetraphosphatase [Enterobacter sp. Ag1]
          Length = 283

 Score = 96.7 bits (239), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 86/280 (30%), Positives = 121/280 (43%), Gaps = 69/280 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGAS--CVRG 114
            IGDVHG YDEL+ L+ ++N++P +D L   GD+VA+GP S+EV++ +RSLG S   V G
Sbjct: 5   LIGDVHGCYDELIALLQQVNFNPEEDTLWLTGDLVARGPDSLEVLRYVRSLGDSVRVVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD V     LL      EL N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRVTP---LLEAPDADELLNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           +I    E  L + HAG+ P            DV         PLF              D
Sbjct: 107 LIQVDEEKKLVMSHAGITPQWDINTALACARDVEAVLSSDSYPLFLDAMYGDMPNNWSSD 166

Query: 202 PSDIMSMRNIKNGK-------PTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          +  K W A     ++  ++ +G
Sbjct: 167 LSGLARLRFITNSLTRMRYCFPNGQLDMYCKDTPEKAPSPLKPWFAIPGPVTAEYSVAFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIIN 285
           H AS   K  P   + LD+GC +GGEL+ L W D    + 
Sbjct: 227 HWASLEGKGTPEGIYALDTGCCWGGELTCLRWEDKAWFVQ 266



>gi|238893022|ref|YP_002917756.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|402782477|ref|YP_006638023.1| bis(5'-nucleosyl)-tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae 1084]
 gi|490281527|ref|WP_004177431.1| diadenosine tetraphosphatase [Klebsiella pneumoniae]
 gi|238545338|dbj|BAH61689.1| diadenosinetetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|238774025|dbj|BAH66522.1| diadenosinetetraphosphatase [Klebsiella pneumoniae NTUH-K2044]
 gi|238774057|dbj|BAH66553.1| diadenosinetetraphosphatase [Klebsiella pneumoniae]
 gi|402543333|gb|AFQ67482.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella
           pneumoniae subsp. pneumoniae 1084]
 gi|405590293|gb|EKB63827.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella
           pneumoniae subsp. pneumoniae WGLW1]
 gi|405600202|gb|EKB73369.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella
           pneumoniae subsp. pneumoniae WGLW3]
          Length = 282

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 82/276 (29%), Positives = 119/276 (43%), Gaps = 69/276 (25%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ +DP +D L   GD+VA+GP S+EV++ ++SLG S   V G
Sbjct: 5   LIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +KS   LL      EL N+L   P
Sbjct: 65  NHDLHLLAVFAGI---------------SRNKPKDRLKS---LLEAPDADELLNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLPD---------------------VPLF------------EQD 201
           ++    E  L + HAG+ P                       P F              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          A  K W A     S+  +I +G
Sbjct: 167 LSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           H AS   +  P   + LD+GC +GGEL+ L W D +
Sbjct: 227 HWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQ 262



>gi|255711706|ref|XP_002552136.1| KLTH0B08008p [Lachancea thermotolerans]
 gi|238933514|emb|CAR21698.1| KLTH0B08008p [Lachancea thermotolerans CBS 6340]
          Length = 249

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 117/230 (50%), Gaps = 23/230 (10%)

Query: 65  YDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGAS--CVRGNHDDKVL- 121
           ++E   L+ K+N      H++ +GD  +KGP+S  VV  +R    S  C+ GNH+  V+ 
Sbjct: 2   FEEFAKLMAKVNAKDENTHVVLLGDFTSKGPQSRAVVDYMREHQDSTHCILGNHEVNVMF 61

Query: 122 ------QIKNILDFLDSQKIPLDEFIKEHDIP-KDIVKSEHGLLAKELDVELYNYLLS-C 173
                  ++  L    ++  PL EF  E  IP +  V   H  +A+EL  E  +++   C
Sbjct: 62  AYLNHVGLEQRLSSGHARWRPL-EFSSESYIPPRGQVNRMHRDVARELGEERLDWVAKHC 120

Query: 174 P--IILDIPEYDLYVVHAGLLPDVPLFEQDPS--DIMSMRNI--KNGKPTSKKDVGHA-- 225
           P  + ++     L  VHAGL PD+   E  P   DI +M+ +  ++   TSK    H+  
Sbjct: 121 PAELAIEFGPQTLVAVHAGLDPDLSR-EDVPKVKDITTMKYMLPEDHSKTSKFKFKHSRR 179

Query: 226 WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSAL 275
           W K W+   Q +    T+ YGHD+S  L ++  + GLDS CV GG+LSAL
Sbjct: 180 WYKFWDG--QHAPRNTTVFYGHDSSNGLTLRKRTKGLDSACVSGGQLSAL 227



>gi|444321687|ref|XP_004181499.1| hypothetical protein TBLA_0G00310 [Tetrapisispora blattae CBS 6284]
 gi|387514544|emb|CCH61980.1| hypothetical protein TBLA_0G00310 [Tetrapisispora blattae CBS 6284]
          Length = 391

 Score = 96.3 bits (238), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 95/313 (30%), Positives = 141/313 (45%), Gaps = 81/313 (25%)

Query: 55  LIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQ-LIRSL--GASC 111
           L+FIGDVHG YD + +L  ++NYD   D +I VGD + KGP S++V+  L+ S+  G   
Sbjct: 76  LLFIGDVHGEYDTMTSLFEEMNYDSDTDMVILVGDFLTKGPDSLKVLDFLVDSIHKGNRN 135

Query: 112 VR---GNHDDKVLQI---KNILDFL-DSQKIPLDEFIKEHDIPKD---IVKSEHGLLAKE 161
           VR   GN+D KVL     +++ ++  +S+  PL+   + + +PKD    +K  H  LA E
Sbjct: 136 VRYVLGNNDIKVLVALINQDMENYSKESEFNPLNFNTEFNYVPKDPLKKIKQSHLKLANE 195

Query: 162 LDV-ELYNYLLSCPIILDI------PEYDLYVVHAGLLP--------------------- 193
           L   +LY       +   I        + L+ VHAGLLP                     
Sbjct: 196 LGFKKLYELAKHSTVAFKIQRSNNDASHALFAVHAGLLPGNFINTTLNANDNELFIPSID 255

Query: 194 ---DVPLFEQDP-SDIMSMRNIKNGKPTS-----KKDVGHAWSKHWNAAQQESS------ 238
              ++   EQD  S+      +K+ K  S      K     W K W+  + E +      
Sbjct: 256 TLTEMKFVEQDNWSNTYKQLGMKDKKKKSNDIDATKKSLIKWYKLWDETKVEQTFNDNKK 315

Query: 239 ----------------SPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSAL--IWNDN 280
                           +  T++YGHDAS  L I  ++ GLDSGC  GG+LS L  +W+  
Sbjct: 316 IQKNFDYDLLEFSEIINNITVVYGHDASSGLNIHNHTKGLDSGCTKGGQLSGLEFVWDPT 375

Query: 281 REIINVKCNKYVD 293
                   NKY+D
Sbjct: 376 N-------NKYID 381



>gi|493064814|ref|WP_006117644.1| diadenosine tetraphosphatase [Pantoea stewartii]
 gi|377819214|gb|EHU02294.1| diadenosine tetraphosphatase [Pantoea stewartii subsp. stewartii
           DC283]
          Length = 285

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 117/279 (41%), Gaps = 69/279 (24%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC-- 111
           N   IGDVHG YDEL  L+N++NYDP +D L   GD+VA+GP S+EV++ ++SLG S   
Sbjct: 2   NTYLIGDVHGCYDELRALLNQVNYDPGQDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRL 61

Query: 112 VRGNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLL 171
           V GNHD  +L +   +                 + PKD +     LL  E   EL N+L 
Sbjct: 62  VLGNHDLHLLAVYAGI---------------SRNKPKDRLTP---LLEAEDADELINWLR 103

Query: 172 SCPIILDIPEYDLYVVHAGLLPD---------------------VPLF------------ 198
             P++    E  L + HAG+ P                       PLF            
Sbjct: 104 RQPLLQVDEEKKLVMGHAGITPQWDLETAQRCAREVEAVLASDSYPLFLDAMYGDMPNNW 163

Query: 199 EQDPSDIMSMRNIKNGKPTSK------------KDVGHAWS---KHWNAAQQESSSPKTI 243
            +  S +  +R   N     +            KD   +     K W   +   +   TI
Sbjct: 164 SESLSGLARLRFSTNALTRMRFCFPNGQLDMICKDAPESAPLPLKPWFTIEGPVARDHTI 223

Query: 244 IYGHDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           ++GH AS   K  P    GLD+GC +GG L+ L W   R
Sbjct: 224 VFGHWASLEGKGTPEGIIGLDTGCCWGGNLTLLHWETQR 262



>gi|363754873|ref|XP_003647652.1| hypothetical protein Ecym_6464 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356891289|gb|AET40835.1| hypothetical protein Ecym_6464 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 310

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 130/260 (50%), Gaps = 28/260 (10%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQ-LIRSLGA- 109
           ++ LIF+GDVHG YD+ + L+ ++  D  +  ++ +GD ++KGP S ++ + L+R+    
Sbjct: 46  EQRLIFVGDVHGMYDKFMLLLKQVKPDD-RTTVVLLGDFLSKGPDSAKIARYLLRNKDRI 104

Query: 110 SCVRGNHDDKVL------------QIKNILDFLDSQKIPLDEFIKEHDIPKDI-VKSEHG 156
            CV GNH+  +L            + K  +D  D  K     F+ E  IP++  +K  H 
Sbjct: 105 QCVLGNHELAILFALLNPKKARKFKPKRKMDPGDFSKWKRISFVTEDYIPQETKIKKMHM 164

Query: 157 LLAKELDVELYNYLL-----SCPIILDIPEYDLYVVHAGLLPD-VPLFEQDPSDIMSMRN 210
            LA++L  ++ + +      +    L      L  VHAG+LP+    F+     +M   +
Sbjct: 165 RLARQLGPDVLDRIADHCSAAAYFNLTATNETLIGVHAGILPNGFEHFKIADLTMMKFVD 224

Query: 211 IKNGKPTSKKDVGHA--WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVY 268
             N   TSK    +A  W   WN+      +  T++YGH +S  L ++  + GLD GCV 
Sbjct: 225 ADNWNHTSKNRFDNAIWWHDLWNSVHDYEDT--TVLYGHASSAGLTLRRRTKGLDVGCVN 282

Query: 269 GGELSAL--IWNDNREIINV 286
           GG L+AL   ++D ++I N 
Sbjct: 283 GGSLAALEYTFDDTKKIYNT 302



>gi|157147531|ref|YP_001454851.1| diadenosine tetraphosphatase [Citrobacter koseri ATCC BAA-895]
 gi|501083592|ref|WP_012134118.1| diadenosine tetraphosphatase [Citrobacter koseri]
 gi|166215851|sp|A8ALQ2.1|APAH_CITK8 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase, symmetrical;
           AltName: Full=Ap4A hydrolase; AltName: Full=Diadenosine
           5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase;
           AltName: Full=Diadenosine tetraphosphatase
 gi|157084736|gb|ABV14414.1| hypothetical protein CKO_03331 [Citrobacter koseri ATCC BAA-895]
          Length = 282

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 124/289 (42%), Gaps = 72/289 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR--- 113
            IGDVHG YDEL+ L++++ + P  D L   GD+VA+GP S+EV++ ++SLG  CVR   
Sbjct: 5   LIGDVHGCYDELIALLHQVEFTPGSDTLWLTGDLVARGPGSLEVLRYVKSLG-DCVRLVL 63

Query: 114 GNHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSC 173
           GNHD   L +  +   +   K            PKD +     LL      EL N+L   
Sbjct: 64  GNHD---LHLLAVFAGISRNK------------PKDRLTP---LLEAPDADELLNWLRRQ 105

Query: 174 PIILDIPEYDLYVVHAGLLP---------------------DVPLF------------EQ 200
           P++    E  L + HAG+ P                       P F              
Sbjct: 106 PLLQVDEEKKLVMAHAGITPQWDLQTAKDCARDVEAVLSSDSYPFFLDAMYGDMPNNWTP 165

Query: 201 DPSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIY 245
           + + +  +R I N         P  + D+          A  K W A     S   +I++
Sbjct: 166 ELTGLARLRFITNAFTRMRYCFPNGQLDMYSKESPENAPAPLKPWFAIPGPVSEAYSIVF 225

Query: 246 GHDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
           GH AS   K  P   +GLD+GC +GG+L+ L W D R  +    N+++D
Sbjct: 226 GHWASLEGKGTPEGIYGLDTGCCWGGDLTCLRWEDKRYFVQ-PSNRHLD 273



>gi|392977556|ref|YP_006476144.1| diadenosine tetraphosphatase [Enterobacter cloacae subsp.
           dissolvens SDM]
 gi|504643513|ref|WP_014830615.1| diadenosine tetraphosphatase [Enterobacter cloacae]
 gi|392323489|gb|AFM58442.1| diadenosine tetraphosphatase [Enterobacter cloacae subsp.
           dissolvens SDM]
          Length = 282

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 123/280 (43%), Gaps = 69/280 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++++ P +D L   GD+VA+GP S+EV++ ++SLG S   V G
Sbjct: 5   LIGDVHGCYDELIALLKQVDFTPGRDILWLTGDLVARGPGSLEVLRFVKSLGDSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +    S+  P D      D P             + D EL N+L   P
Sbjct: 65  NHDLHLLAVFAGI----SRNKPKDRLTPLLDAP-------------DAD-ELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         P F             +D
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLETAKTCARDVEAVLASDSYPFFLDAMYGDMPNHWSED 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          A  K W A     +S  ++++G
Sbjct: 167 LSGLARLRFITNAFTRMRFCFPNGQLDMYSKETPESAPAPLKPWFAIPGPVTSEYSVVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIIN 285
           H A+   K  P   +GLD+GC +GG+L+ L W D    + 
Sbjct: 227 HWAALEGKGTPDGIYGLDTGCCWGGDLTCLRWEDKTYFVQ 266



>gi|206579673|ref|YP_002240487.1| diadenosine tetraphosphatase [Klebsiella pneumoniae 342]
 gi|288937187|ref|YP_003441246.1| bis(5'nucleosyl)-tetraphosphatase, ApaH [Klebsiella variicola
           At-22]
 gi|496082968|ref|WP_008807475.1| diadenosine tetraphosphatase [Klebsiella sp. KTE92]
 gi|238057844|sp|B5Y1Z6.1|APAH_KLEP3 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase, symmetrical;
           AltName: Full=Ap4A hydrolase; AltName: Full=Diadenosine
           5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase;
           AltName: Full=Diadenosine tetraphosphatase
 gi|206568731|gb|ACI10507.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae 342]
 gi|288891896|gb|ADC60214.1| bis(5'nucleosyl)-tetraphosphatase, ApaH [Klebsiella variicola
           At-22]
 gi|289774949|gb|EFD82951.1| bis(5'-nucleosyl)-tetraphosphatase [Klebsiella sp. 1_1_55]
 gi|500615421|gb|EOQ55975.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella sp.
           KTE92]
          Length = 282

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/276 (29%), Positives = 118/276 (42%), Gaps = 69/276 (25%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ +DP  D L   GD+VA+GP S+EV++ ++SLG S   V G
Sbjct: 5   LIGDVHGCYDELIALLAQVEFDPSTDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +KS   LL      EL N+L   P
Sbjct: 65  NHDLHLLAVFAGI---------------SRNKPKDRLKS---LLEAPDADELLNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLPD---------------------VPLF------------EQD 201
           ++    E  L + HAG+ P                       P F              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          A  K W A     S+  +I +G
Sbjct: 167 LSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           H AS   +  P   + LD+GC +GGEL+ L W D +
Sbjct: 227 HWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQ 262



>gi|509563330|gb|EOY62224.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae KP-7]
 gi|509589445|gb|EOY75042.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC81]
 gi|509636815|gb|EOZ19843.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC22]
 gi|509705642|gb|EOZ90035.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae 540_1460]
 gi|510303960|gb|EPA89993.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC57]
 gi|510362783|gb|EPB40544.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC48]
          Length = 299

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 118/276 (42%), Gaps = 69/276 (25%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ +DP +D L   GD+VA+GP S+EV++ ++SLG S   V G
Sbjct: 22  LIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLG 81

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +K    LL      EL N+L   P
Sbjct: 82  NHDLHLLAVFAGI---------------SRNKPKDRLKP---LLEAPDADELLNWLRRQP 123

Query: 175 IILDIPEYDLYVVHAGLLPD---------------------VPLF------------EQD 201
           ++    E  L + HAG+ P                       P F              +
Sbjct: 124 LLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNE 183

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          A  K W A     S+  +I +G
Sbjct: 184 LSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFG 243

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           H AS   +  P   + LD+GC +GGEL+ L W D +
Sbjct: 244 HWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQ 279



>gi|296101213|ref|YP_003611359.1| diadenosine tetraphosphatase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|502860562|ref|WP_013095538.1| diadenosine tetraphosphatase [Enterobacter cloacae]
 gi|295055672|gb|ADF60410.1| diadenosine tetraphosphatase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 282

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 122/280 (43%), Gaps = 69/280 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++++ P +D L   GD+VA+GP S+EV++ ++SLG S   V G
Sbjct: 5   LIGDVHGCYDELIALLKQVDFTPGRDILWLTGDLVARGPGSLEVLRFVKSLGDSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +     LL      EL N+L   P
Sbjct: 65  NHDLHLLAVFAGI---------------SRNKPKDRLTP---LLEAPDADELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         P F             +D
Sbjct: 107 LLQIDEEKKLVMAHAGITPQWDLETAKTCARDVEAVLASDSYPFFLDAMYGDMPNHWSED 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          A  K W A     +S  ++++G
Sbjct: 167 LSGLARLRFITNAFTRMRFCFPNGQLDMYSKETPESAPAPLKPWFAIPGPVTSEYSVVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIIN 285
           H A+   K  P   +GLD+GC +GG+L+ L W D    + 
Sbjct: 227 HWAALEGKGTPEGIYGLDTGCCWGGDLTCLRWEDKTYFVQ 266



>gi|494951159|ref|WP_007677187.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           condimenti]
 gi|426546370|emb|CCJ73724.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           condimenti 1330]
          Length = 283

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 123/288 (42%), Gaps = 70/288 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ + P KD L   GD+VA+GP S+EV++ +RSLG +   V G
Sbjct: 5   LIGDVHGCYDELVALLQQVEFTPGKDTLWLTGDLVARGPGSLEVLRYVRSLGDAVRLVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD V     LL      EL N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRVTP---LLEAPDADELLNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         P F              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLATAQACARDVEAVLSSDSYPFFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNGK-------PTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            + +  +R I N         P  + D+          A  K W A     S   +I++G
Sbjct: 167 LTGLARLRFITNALTRMRFCFPNGQLDMYCKESPESAPAPLKPWFAIPGPVSQDYSIVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
           H AS   K  P + +GLD+GC +GG L+ L W D + I     N+  D
Sbjct: 227 HWASLEGKGTPENIYGLDTGCCWGGTLTCLRWED-KAIFTQHSNRQTD 273



>gi|260596473|ref|YP_003209044.1| diadenosine tetraphosphatase [Cronobacter turicensis z3032]
 gi|502536864|ref|WP_012815264.1| diadenosine tetraphosphatase [Cronobacter turicensis]
 gi|260215650|emb|CBA27945.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           turicensis z3032]
          Length = 283

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 124/288 (43%), Gaps = 70/288 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++++ P +D L   GD+VA+GP S+EV++ +RSLG S   V G
Sbjct: 5   LIGDVHGCYDELVALLQQVDFTPGQDTLWLTGDLVARGPGSLEVLRYVRSLGDSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD V     LL      EL N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRVTP---LLEAPDADELLNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         PLF              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLATAQACARDVEAVLASDSYPLFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNGK-------PTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            + +  +R I N         P  + D+          A  K W A     +    I++G
Sbjct: 167 LTGLARLRFISNALTRMRYCFPNGQLDMYCKESPESAPAPLKPWFAIPGPVAQEYAIVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
           H AS   K  P + +GLD+GC +GG L+ L W D + +     N+  D
Sbjct: 227 HWASLEGKGTPENIYGLDTGCCWGGTLTCLRWED-KAVFTQHSNRQTD 273



>gi|152968627|ref|YP_001333736.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|378976917|ref|YP_005225058.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae HS11286]
 gi|386033104|ref|YP_005953017.1| diadenosine tetraphosphatase [Klebsiella pneumoniae KCTC 2242]
 gi|488977452|ref|WP_002888321.1| diadenosine tetraphosphatase [Klebsiella pneumoniae]
 gi|166215858|sp|A6T4I5.1|APAH_KLEP7 RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase, symmetrical;
           AltName: Full=Ap4A hydrolase; AltName: Full=Diadenosine
           5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase;
           AltName: Full=Diadenosine tetraphosphatase
 gi|150953476|gb|ABR75506.1| diadenosinetetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|259037645|gb|EEW38874.1| bis(5'-nucleosyl)-tetraphosphatase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328534859|gb|EGF61401.1| bis(5'-nucleosyl)-tetraphosphatase [Klebsiella sp. MS 92-3]
 gi|339760232|gb|AEJ96452.1| diadenosine tetraphosphatase [Klebsiella pneumoniae KCTC 2242]
 gi|363651388|gb|EHL90456.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella sp.
           4_1_44FAA]
 gi|364516328|gb|AEW59456.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae HS11286]
 gi|397346994|gb|EJJ40104.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH2]
 gi|397348154|gb|EJJ41256.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH1]
 gi|397353034|gb|EJJ46111.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH4]
 gi|397366136|gb|EJJ58755.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH6]
 gi|397367750|gb|EJJ60359.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH5]
 gi|397370369|gb|EJJ62952.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH7]
 gi|397379181|gb|EJJ71379.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH9]
 gi|397383975|gb|EJJ76102.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH8]
 gi|397389336|gb|EJJ81278.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH10]
 gi|397398599|gb|EJJ90261.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH11]
 gi|397399802|gb|EJJ91452.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH12]
 gi|397404859|gb|EJJ96345.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH14]
 gi|397415525|gb|EJK06710.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH17]
 gi|397416862|gb|EJK08032.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH16]
 gi|397423849|gb|EJK14766.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH18]
 gi|397432243|gb|EJK22907.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH20]
 gi|397435490|gb|EJK26105.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH19]
 gi|397440142|gb|EJK30556.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH21]
 gi|397447919|gb|EJK38104.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH22]
 gi|397450459|gb|EJK40564.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KPNIH23]
 gi|405606736|gb|EKB79706.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella
           pneumoniae subsp. pneumoniae WGLW2]
 gi|405614493|gb|EKB87192.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella
           pneumoniae subsp. pneumoniae WGLW5]
 gi|410113676|emb|CCM84761.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella
           pneumoniae subsp. pneumoniae ST258-K26BO]
 gi|410120516|emb|CCM89361.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella
           pneumoniae subsp. pneumoniae ST258-K28BO]
 gi|414706321|emb|CCN28025.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae subsp. pneumoniae Ecl8]
 gi|427538429|emb|CCM95455.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Klebsiella
           pneumoniae subsp. pneumoniae ST512-K30BO]
 gi|448874056|gb|EMB09119.1| diadenosine tetraphosphatase [Klebsiella pneumoniae hvKP1]
 gi|459673021|gb|EMH89696.1| ApaH [Klebsiella pneumoniae JHCK1]
 gi|459935911|gb|EMH99573.1| diadenosine tetraphosphatase [Klebsiella pneumoniae RYC492]
 gi|460780202|gb|EMI36774.1| ApaH [Klebsiella pneumoniae VA360]
 gi|471249781|gb|EMR27126.1| diadenosine tetraphosphatase [Klebsiella pneumoniae ATCC BAA-2146]
 gi|471250737|gb|EMR28073.1| diadenosine tetraphosphatase [Klebsiella pneumoniae ATCC BAA-1705]
 gi|480517916|gb|ENY59018.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae KpMDU1]
 gi|499528840|emb|CCI75200.1| apaH [Klebsiella pneumoniae]
 gi|507126651|gb|EOR19537.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC23]
 gi|509574974|gb|EOY68189.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC40]
 gi|509594012|gb|EOY79345.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC09]
 gi|509598305|gb|EOY83427.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC01]
 gi|509605964|gb|EOY90629.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC27]
 gi|509612581|gb|EOY96958.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC24]
 gi|509614168|gb|EOY98458.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC26]
 gi|509625858|gb|EOZ09484.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC04]
 gi|509637443|gb|EOZ20441.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae VAKPC252]
 gi|509638484|gb|EOZ21415.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae VAKPC254]
 gi|509642967|gb|EOZ25739.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae VAKPC269]
 gi|509656849|gb|EOZ38969.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae VAKPC280]
 gi|509660243|gb|EOZ42240.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae VAKPC270]
 gi|509672894|gb|EOZ54233.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae VAKPC276]
 gi|509673326|gb|EOZ54641.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae VAKPC297]
 gi|509676598|gb|EOZ57769.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae KP-11]
 gi|509678686|gb|EOZ59742.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae 361_1301]
 gi|509687514|gb|EOZ68144.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae VAKPC309]
 gi|509702888|gb|EOZ87303.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae 440_1540]
 gi|509704225|gb|EOZ88694.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae 500_1420]
 gi|509716392|gb|EPA00417.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae 646_1568]
 gi|510326851|gb|EPB06818.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC45]
 gi|510334638|gb|EPB14070.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC 52]
 gi|510336306|gb|EPB15611.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC05]
 gi|510340521|gb|EPB19571.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae VAKPC278]
 gi|510349914|gb|EPB28476.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC29]
 gi|510350378|gb|EPB28919.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae DMC0526]
 gi|510366027|gb|EPB44055.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Klebsiella
           pneumoniae UHKPC32]
 gi|513475391|gb|EPF22686.1| diadenosine tetraphosphatase [Klebsiella pneumoniae subsp.
           pneumoniae B5055]
          Length = 282

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 118/276 (42%), Gaps = 69/276 (25%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ +DP +D L   GD+VA+GP S+EV++ ++SLG S   V G
Sbjct: 5   LIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +K    LL      EL N+L   P
Sbjct: 65  NHDLHLLAVFAGI---------------SRNKPKDRLKP---LLEAPDADELLNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLPD---------------------VPLF------------EQD 201
           ++    E  L + HAG+ P                       P F              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          A  K W A     S+  +I +G
Sbjct: 167 LSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           H AS   +  P   + LD+GC +GGEL+ L W D +
Sbjct: 227 HWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQ 262



>gi|490296592|ref|WP_004192052.1| diadenosine tetraphosphatase [Klebsiella pneumoniae]
 gi|407809321|gb|EKF80572.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical 2 [Klebsiella
           pneumoniae subsp. pneumoniae KpQ3]
          Length = 282

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 118/276 (42%), Gaps = 69/276 (25%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ +DP +D L   GD+VA+GP S+EV++ ++SLG S   V G
Sbjct: 5   LIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +K    LL      EL N+L   P
Sbjct: 65  NHDLHLLAVFAGI---------------SRNKPKDRLKP---LLEAPDADELLNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLPD---------------------VPLF------------EQD 201
           ++    E  L + HAG+ P                       P F              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R I N         P  + D+          A  K W A     S+  +I +G
Sbjct: 167 LSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           H AS   +  P   + LD+GC +GGEL+ L W D +
Sbjct: 227 HWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQ 262



>gi|366995247|ref|XP_003677387.1| hypothetical protein NCAS_0G01470 [Naumovozyma castellii CBS 4309]
 gi|342303256|emb|CCC71034.1| hypothetical protein NCAS_0G01470 [Naumovozyma castellii CBS 4309]
          Length = 324

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 125/251 (49%), Gaps = 29/251 (11%)

Query: 52  QKNLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLI--RSLGA 109
            + L+FIGDVHG Y EL  L+ +         ++ VGD + KGP++ EVV  I       
Sbjct: 56  HERLLFIGDVHGQYHELKKLLRREVDARENTTVVLVGDFITKGPRNKEVVSFILENKDKV 115

Query: 110 SCVRGNHDD-KVLQIKNILDFLDSQ---KIPLDEFIKEHDIPKDIVK--SEHGLLAKELD 163
            CV GN++    L + N L     Q   K+PL    ++  IP+D  K   +H  + KE+ 
Sbjct: 116 KCVFGNNEILAYLAMVNPLYPSKRQRGIKVPLQFTSEKSFIPEDWTKISKKHKDVVKEVG 175

Query: 164 V----ELYNYL-LSCPIILDIPEYDLYVVHAGLLPDVPLFEQDPSDIM--SMRNIKNGKP 216
           V    EL N+  ++    L++   +++ VHAG+LP       +P   +  S+  + + K 
Sbjct: 176 VKKLVELANHCSVALEFDLELTGQNMFAVHAGMLPG-DFMNNNPRGHVHASVAALTDMKY 234

Query: 217 TSKKDVGHA------------WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDS 264
             ++D  +             W K W+    E+    T++YGHDAS+ L I+ Y+ GLD+
Sbjct: 235 VDEEDWSYTSRTGEEFKQSIRWYKLWDR-YGETFENVTVVYGHDASKGLNIRKYTKGLDT 293

Query: 265 GCVYGGELSAL 275
            CV GG+LSAL
Sbjct: 294 SCVQGGKLSAL 304



>gi|494977045|ref|WP_007703069.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           universalis]
 gi|426508411|emb|CCK16452.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           universalis NCTC 9529]
          Length = 283

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 124/288 (43%), Gaps = 70/288 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++++ P +D L   GD+VA+GP S+EV++ +RSLG S   V G
Sbjct: 5   LIGDVHGCYDELVALLQQVDFTPGQDTLWLTGDLVARGPGSLEVLRYVRSLGDSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD V     LL      EL N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRVTP---LLEAPDADELVNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         PLF              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLATAQACARDVEAVLASDSYPLFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            + +  +R I N         P  + D+          A  K W A     +    I++G
Sbjct: 167 LTGLARLRFISNAFTRMRYCFPNGQLDMYCKESPESAPAPLKPWFAIPGPVAQEYAIVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
           H AS   K  P + +GLD+GC +GG L+ L W D + +     N+  D
Sbjct: 227 HWASLEGKGTPENIYGLDTGCCWGGTLTCLRWED-KAVFTQHSNRQTD 273



>gi|495057758|ref|WP_007782592.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           malonaticus]
 gi|426294935|emb|CCJ96194.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           malonaticus 681]
          Length = 283

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 123/288 (42%), Gaps = 70/288 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ + P +D L   GD+VA+GP S+EV++ +RSLG S   V G
Sbjct: 5   LIGDVHGCYDELVALLQQVEFTPGQDTLWLTGDLVARGPGSLEVLRYVRSLGDSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD V     LL      EL N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRVTP---LLEAPDADELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         PLF              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLATAQACARDVEAVLASDSYPLFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            + +  +R I N         P  + D+          A  K W A     +    I++G
Sbjct: 167 LTGLARLRFISNAFTRMRYCFPNGQLDMYCKESPENAPAPLKPWFAIPGPVAQEYAIVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
           H AS   K  P + +GLD+GC +GG L+ L W D + +     N+  D
Sbjct: 227 HWASLEGKGTPENIYGLDTGCCWGGTLTCLRWED-KAVFTQHSNRQTD 273



>gi|495065807|ref|WP_007790632.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           malonaticus]
 gi|426309998|emb|CCJ96724.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           malonaticus 507]
          Length = 283

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 123/288 (42%), Gaps = 70/288 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ + P +D L   GD+VA+GP S+EV++ +RSLG S   V G
Sbjct: 5   LIGDVHGCYDELVALLQQVEFTPGQDTLWLTGDLVARGPGSLEVLRYVRSLGDSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD V     LL      EL N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRVTP---LLEAPDADELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         PLF              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLATAQACARDVEAVLASDSYPLFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            + +  +R I N         P  + D+          A  K W A     +    I++G
Sbjct: 167 LTGLARLRFISNAFTRMRYCFPNGQLDMYCKESPENAPAPLKPWFAIPGPVAQEYAIVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
           H AS   K  P + +GLD+GC +GG L+ L W D + +     N+  D
Sbjct: 227 HWASLEGKGTPENIYGLDTGCCWGGTLTCLRWED-KAVFTQHSNRQTD 273



>gi|94676672|ref|YP_588991.1| diadenosine tetraphosphatase [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|499839990|ref|WP_011520724.1| diadenosine tetraphosphatase [Candidatus Baumannia cicadellinicola]
 gi|166215845|sp|Q1LSS3.1|APAH_BAUCH RecName: Full=Bis(5'-nucleosyl)-tetraphosphatase, symmetrical;
           AltName: Full=Ap4A hydrolase; AltName: Full=Diadenosine
           5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase;
           AltName: Full=Diadenosine tetraphosphatase
 gi|94219822|gb|ABF13981.1| bis(5'-nucleosyl)-tetraphosphatase (symmetrical) [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 288

 Score = 94.0 bits (232), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 131/285 (45%), Gaps = 70/285 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
           FIGD+HG YDEL  ++ K+ +DPL D L   GD+VA+GP S+EV+++IR LG S   V G
Sbjct: 5   FIGDIHGCYDELQTILEKVAFDPLIDTLWLTGDLVARGPSSLEVLRMIRRLGNSVRIVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +         +   IK+H IP         LL      +L N+L   P
Sbjct: 65  NHDLHLLAVYTGI---------MRNRIKDHTIP---------LLTAPDAEDLMNWLRYQP 106

Query: 175 IILDIPEYDLYVVHAGLLP--DVPLFEQDPSDIMSMRNIKNGK---PTSKKDVGHAWSKH 229
           ++    +  + + HAG+ P  ++    Q  S+I ++   ++      +  +D+ + WS  
Sbjct: 107 VLQVDNKKKILMAHAGITPQWNIDTALQCASEIETVLRSESYPLFLHSIYEDIPNYWSNE 166

Query: 230 --WNAAQQESSS-----------------------------------PKTI------IYG 246
             + A  Q S++                                   P TI      I+G
Sbjct: 167 LSYRARLQFSTNVFTRMRYCFPNGKLDMLCKDIPNKAPEPLRPWFNLPSTIVEKYSIIFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNK 290
           H +S   K  P   +GLD+GC +GG+L+ L W D ++II +   K
Sbjct: 227 HWSSLLGKGTPTGIYGLDTGCCWGGKLTLLCWED-KKIIQIPSQK 270



>gi|494983907|ref|WP_007709930.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           dublinensis]
 gi|426744965|emb|CCJ79441.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           dublinensis 1210]
          Length = 283

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 123/288 (42%), Gaps = 70/288 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ + P KD L   GD+VA+GP S+EV++ +RSLG +   V G
Sbjct: 5   LIGDVHGCYDELVALLQQVEFTPGKDTLWLTGDLVARGPGSLEVLRYVRSLGDAVRLVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD V     LL      EL N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRVTP---LLEAPDADELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         PLF              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLATAQACARDVEAVLSSDSYPLFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            + +  +R I N         P  + D+          A  K W A     +    I++G
Sbjct: 167 LTGLARLRFITNAFTRMRYCFPNGQLDMYCKESPESAPAPLKPWFAIPGPVADEYAIVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
           H AS   K  P + +GLD+GC +GG L+ L W D + +     N+  D
Sbjct: 227 HWASLEGKGTPENIYGLDTGCCWGGTLTCLRWED-KAVFTQHSNRQTD 273



>gi|491093832|ref|WP_004955439.1| diadenosine tetraphosphatase [Serratia odorifera]
 gi|291424436|gb|EFE97648.1| bis(5'-nucleosyl)-tetraphosphatase [Serratia odorifera DSM 4582]
          Length = 283

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 117/276 (42%), Gaps = 69/276 (25%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG +DEL +L+ ++++DP +D L   GD+VA+GP S+EV++ +RSLG +   V G
Sbjct: 5   LIGDVHGCFDELKSLLAQVSFDPQQDTLWLTGDLVARGPGSLEVLRFVRSLGPAVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +     LL      EL N+L   P
Sbjct: 65  NHDLHLLAVYAGI---------------SRNKPKDRITP---LLEAPDADELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLPD---------------------VPLF------------EQD 201
           ++    +  L + HAG+ P                       PLF              +
Sbjct: 107 VLQVDEQQQLIMAHAGITPQWDIETAKICAREVEAVLSSDSYPLFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNGK-------PTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R   N         P  + D+          A  K W A  +      TII+G
Sbjct: 167 LSGLARLRFSTNALTRMRYCFPNGQLDMISKDAPGTAPAPLKPWFALPRLVDPQYTIIFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           H AS   K  P     LD+GC +GGEL+ L W D R
Sbjct: 227 HWASLEGKGTPDGIIALDTGCCWGGELTMLRWEDKR 262



>gi|301120558|ref|XP_002908006.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262103037|gb|EEY61089.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 325

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 99/209 (47%), Gaps = 45/209 (21%)

Query: 67  ELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVRGNHDDKVLQIKNI 126
           EL  L++  ++ P  D L+FVGD+V KGPK ++VV+ +R  G+ CVRGNHDD  L     
Sbjct: 137 ELQLLLSACDFSPPNDCLVFVGDLVNKGPKPLDVVRFVRESGSLCVRGNHDDAALSA--F 194

Query: 127 LDFLDSQKIPLDEFIK--EHDIPKDIVKSEHGLLAKELDVELYNYLLSCPIILDIPEY-D 183
             +++  ++P        EH  P+D+                  +L   P  + +P + +
Sbjct: 195 YQWINGGRVPGSAKYPYVEHFKPEDV-----------------EFLEQLPFSVSLPNHSN 237

Query: 184 LYVVHAGLLPDVPLFEQDPSDIMSMRNIKNGKPTSKKDVGHA----------------WS 227
           + V+HAG++P+V L EQ P D+  MR ++  K   +     A                W+
Sbjct: 238 IIVIHAGVVPEVNLEEQRPVDMYKMRFVQREKADDETSTWMALEKKKYKNENSGEPEMWA 297

Query: 228 KHWNAAQQESSSPKTIIYGHDASRRLKIK 256
           K W         P+ + +GH AS  L+++
Sbjct: 298 KVWGG-------PRHVYFGHAASAGLQVR 319



>gi|491335046|ref|WP_005193005.1| diadenosine tetraphosphatase [Yersinia intermedia]
 gi|238725479|gb|EEQ17046.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Yersinia
           intermedia ATCC 29909]
          Length = 291

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 118/276 (42%), Gaps = 69/276 (25%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG  DELL L+ ++++DP +D L   GD+VA+GP S++V++ +RSLG +   V G
Sbjct: 5   LIGDVHGCLDELLALLAQVSFDPQQDTLWLTGDLVARGPASLDVLRYVRSLGPAVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +     LL      EL N+L   P
Sbjct: 65  NHDLHLLAVYAGI---------------SRNKPKDRITP---LLEAPDADELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLPD---------------------VPLF------------EQD 201
           ++    E  L + HAG+ P                       PLF              +
Sbjct: 107 VLQVDDELKLIMAHAGITPQWDIETAQMCAREVEAVLSSDSYPLFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNGK-------PTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R   N         P  + D+          A  K W    +  S   +II+G
Sbjct: 167 LSGLARLRFSTNALTRMRFCFPNGQLDMICKDTPENAPAPLKPWFELPRSVSPDYSIIFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           H AS   K  P   +GLD+GC +GG+L+ L W D R
Sbjct: 227 HWASLEGKGVPEGIYGLDTGCCWGGDLTLLRWEDKR 262



>gi|152990030|ref|YP_001355752.1| hypothetical protein NIS_0281 [Nitratiruptor sp. SB155-2]
 gi|501029574|ref|WP_012081658.1| hypothetical protein [Nitratiruptor sp. SB155-2]
 gi|151421891|dbj|BAF69395.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 248

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 117/236 (49%), Gaps = 21/236 (8%)

Query: 54  NLIFIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASCVR 113
            LI  GD+HG  DEL  L   ++    +D    VGD++ KGP S+E ++ ++     CVR
Sbjct: 3   RLIVYGDIHGCLDELCKLREMLSITE-EDEEYCVGDVINKGPYSLETLRYVKEKNIRCVR 61

Query: 114 GNHDDKVLQIKN--ILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLL 171
           GNH+DK+L+  +  +     S+  P+    KE ++             + ++ E + +L 
Sbjct: 62  GNHEDKLLRYHHHEMERITTSKPNPMHLSQKELEV------------YRSMEREDFLFLQ 109

Query: 172 SCPIILDIPEYDLYVVHAGLLPDVPLF---EQDPSDIMSMRNIKNGKPTSKKDVGHAWSK 228
           S P+   I +  L ++HAG+LP   L+   +++ + +M +R +         D      K
Sbjct: 110 SFPLF--IQKKRLTIIHAGVLPSTNLYALDKKEAAKVMRVRYLDEKGNFVVLDKSEP-KK 166

Query: 229 HWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREII 284
           H+  +         I+YGH      ++  +SFG+D+G VYG  L+A++++   E++
Sbjct: 167 HFWWSSLYDGRFGYIVYGHQPFLTPRVDRFSFGIDTGAVYGNRLTAIVFDQKDEVL 222



>gi|498977644|ref|XP_004528646.1| PREDICTED: bis(5'-nucleosyl)-tetraphosphatase, symmetrical-like
           [Ceratitis capitata]
          Length = 283

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 120/280 (42%), Gaps = 69/280 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG--ASCVRG 114
            IGD+HG YDEL+ L+ ++ ++P +D L   GD+VA+GP S+EV++ ++SLG  A  V G
Sbjct: 5   LIGDIHGCYDELIALLEQVQFNPREDSLWLTGDLVARGPASLEVLRYVKSLGDSARIVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +                 + PKD +     LL      EL N+L   P
Sbjct: 65  NHDLHLLAVFAGIS---------------RNKPKDRLTP---LLEAPDADELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP--DVPLFEQDPSDIMS------------------------- 207
           ++    E  L + HAG+ P  D+   E+   D+ +                         
Sbjct: 107 LLQVDREKKLVMAHAGITPQWDLATAERCARDVEAVLCSDSYPFFLDAMYGDLPNHWSEA 166

Query: 208 ------MRNIKNGKPT-------------SKKDVGHAWS--KHWNAAQQESSSPKTIIYG 246
                 +R I N                 SK+   +A S  K W A     S   +I +G
Sbjct: 167 LTGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPENAPSPLKPWFAIPGPVSQEYSIAFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIIN 285
           H AS   K  P   +GLD+GC +GG L+ L W D R  + 
Sbjct: 227 HWASLEGKGTPEGIYGLDTGCCWGGNLTCLRWEDKRYFVQ 266



>gi|449309552|ref|YP_007441908.1| diadenosine tetraphosphatase [Cronobacter sakazakii SP291]
 gi|505199897|ref|WP_015386999.1| diadenosine tetraphosphatase [Cronobacter sakazakii]
 gi|449099585|gb|AGE87619.1| diadenosine tetraphosphatase [Cronobacter sakazakii SP291]
          Length = 283

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 121/288 (42%), Gaps = 70/288 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ + P +D L   GD+VA+GP S+EV++ +RSLG S   V G
Sbjct: 5   LIGDVHGCYDELVALLQQVEFTPGQDTLWLTGDLVARGPGSLEVLRYVRSLGDSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD V     LL      EL N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRVTP---LLEAPDADELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP--DVPLFEQDPSDIMS------------------------- 207
           ++    E  L + HAG+ P  D+P  +    D+ +                         
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLPTAQACARDVEAVLASDSYPLFLDAMYGDMPNNWSPE 166

Query: 208 ------MRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
                 +R I N         P  + D+          A  K W A     +    I++G
Sbjct: 167 LTGLARLRFISNAFTRMRYCFPNGQLDMYCKESPESAPAPLKPWFAIPGPVAQEYAIVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
           H AS   K  P + + LD+GC +GG L+ L W D + +     N+  D
Sbjct: 227 HWASLEGKGTPENIYALDTGCCWGGTLTCLRWED-KAVFTQHSNRQAD 273



>gi|491443659|ref|WP_005301447.1| diadenosine tetraphosphatase [Photobacterium damselae]
 gi|268163450|gb|EEZ41946.1| bis(5'-nucleosyl)-tetraphosphatase symmetrical [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 273

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 117/285 (41%), Gaps = 70/285 (24%)

Query: 58  IGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG--ASCVRGN 115
           +GD+ G +D+L  L+ ++ +D   D L   GD+VA+GPKS++ ++ I++LG  A+ V GN
Sbjct: 6   VGDIQGCFDDLEKLLQQVQFDANTDELWLAGDLVARGPKSLQTLRFIKALGNAATIVLGN 65

Query: 116 HDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCPI 175
           HD  +L + N +              K  D   DI  +  G        EL N+L   PI
Sbjct: 66  HDLHLLAVANGI-----------AKAKSKDKIHDIFTAPDG-------EELLNWLRMQPI 107

Query: 176 ILDIPEYDLYVVHAGLLPDVPL-------------------------------------- 197
           + + P+++  +VHAG+ P   L                                      
Sbjct: 108 LAEHPQHNFVMVHAGITPQWSLEQARTQARHVESVLQSDRYLWLLTNMYGDGPNLWQDNL 167

Query: 198 --FEQDPSDIMSMRNIKNGKPTSKKDVGHAWS---------KHWNAAQQESSSPKTIIYG 246
              EQ    I +   ++   P  + D+              K W    + +   KTI++G
Sbjct: 168 TELEQLRFTINNFTRMRFCYPDGRLDMACKEGPDSQSVTELKPWFDIPRLTPMEKTILFG 227

Query: 247 HDASRRLKIKPYSFGLDSGCVYGGELSALIWNDNREIINVKCNKY 291
           H A+       Y  GLD+GCV+G  L+ + W D +   +  C  Y
Sbjct: 228 HWAALMGHQDEYCIGLDTGCVWGNSLTMMRWED-KAFFSTPCPIY 271



>gi|493737475|ref|WP_006686665.1| diadenosine tetraphosphatase [Citrobacter youngae]
 gi|291069412|gb|EFE07521.1| bis(5'-nucleosyl)-tetraphosphatase [Citrobacter youngae ATCC 29220]
          Length = 282

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/280 (29%), Positives = 120/280 (42%), Gaps = 69/280 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L++++N+ P KD L   GD+VA+GP S++V++ ++SLG S   V G
Sbjct: 5   LIGDVHGCYDELVALLHQVNFTPEKDTLWLTGDLVARGPGSLDVLRYVKSLGDSVRLVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD +     L A + DV L N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRLTPL--LEAPDADV-LLNWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP---------------------DVPLF------------EQD 201
           ++    E  L + HAG+ P                       P F              +
Sbjct: 107 LLQIDEEKKLVMAHAGITPQWDLQTAKDCARDVEAVLSSDSYPFFLDAMYGDMPNNWTPE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            + +  +R I N         P  + D+          A  K W A     S   +I +G
Sbjct: 167 LTGLARLRFITNAFTRMRYCFPNGQLDMYSKESPEDAPAPLKPWFAIPGPVSEAYSIAFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIIN 285
           H AS   K  P   + LD+GC +GG+L+ L W D R  + 
Sbjct: 227 HWASLEGKGTPEGIYALDTGCCWGGDLTCLRWEDKRYFVQ 266



>gi|495139407|ref|WP_007864214.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           sakazakii]
 gi|423233637|emb|CCK05328.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Cronobacter
           sakazakii 696]
          Length = 283

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/288 (29%), Positives = 122/288 (42%), Gaps = 70/288 (24%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG YDEL+ L+ ++ + P +D L   GD+VA+GP S+EV++ +RSLG S   V G
Sbjct: 5   LIGDVHGCYDELVALLQQVEFTPGQDTLWLTGDLVARGPGSLEVLRYVRSLGDSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD   L +  +   +   K            PKD V     LL      EL N+L   P
Sbjct: 65  NHD---LHLLAVFAGISRNK------------PKDRVTP---LLEAPDADELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLP------------DV---------PLF------------EQD 201
           ++    E  L + HAG+ P            DV         PLF              +
Sbjct: 107 LLQVDEEKKLVMAHAGITPQWDLATAQACALDVEAVLASDSYPLFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNG-------KPTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            + +  +R I N         P  + D+          A  K W A     +    I++G
Sbjct: 167 LTGLARLRFISNAFTRMRYCFPNGQLDMYCKESPENAPAPLKPWFAIPGPVAQEYAIVFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNREIINVKCNKYVD 293
           H AS   K  P + + LD+GC +GG L+ L W D + +     N+  D
Sbjct: 227 HWASLEGKGTPENIYALDTGCCWGGTLTCLRWED-KAVFTQHSNRQAD 273



>gi|365758765|gb|EHN00592.1| YNL217W-like protein [Saccharomyces cerevisiae x Saccharomyces
           kudriavzevii VIN7]
          Length = 326

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 128/265 (48%), Gaps = 33/265 (12%)

Query: 56  IFIGDVHGSYDELLNLIN-KINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLG--ASCV 112
           +F+GD+HG+YDE + LI+ KI        +I +GD + KGP S +VV  I +      CV
Sbjct: 64  VFVGDIHGNYDEFIELIDDKIGGLRENTTMILLGDFIHKGPDSDKVVSYILNHKDQVKCV 123

Query: 113 RGNHDDKVLQIKNILDFLDSQK-----IPLDEFIKEHDIPKDIVK--SEHGLLAKELDVE 165
            GNH+  V+      D+    +     IPL    +   IP+DI K    H  LA EL   
Sbjct: 124 LGNHEILVMMAYLNPDYSQWVRHPKLMIPLTFSTETDFIPQDISKISGAHARLAHELGFS 183

Query: 166 LYNYLLS-CPII----LDIPEYDLYVVHAGLLP-DVPLFEQDPSDIMSMRNIK--NGKPT 217
             + L   C ++    LD+ +  L+ VHAG+LP D     Q PS + S+ N+K  N K  
Sbjct: 184 KLSQLAEHCSVVIELDLDVTDDKLFGVHAGMLPGDFIKSNQIPS-VSSLSNMKFVNKKHW 242

Query: 218 SKKDVGHA------WSKHWNAAQQESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGE 271
           SK            W   W+      S+ K + YGHDAS  L ++  + GLD+ CV    
Sbjct: 243 SKTSREKENKNYVRWFTMWDKYGDSFSNAK-VFYGHDASMGLNLRKQTKGLDTACVKDNL 301

Query: 272 LSALI--WNDNRE-----IINVKCN 289
           LS++   +N  +E     +I V+C+
Sbjct: 302 LSSMRVKYNGKKEQYEYTLIQVECS 326



>gi|326474312|gb|EGD98321.1| hypothetical protein TESG_08539 [Trichophyton tonsurans CBS 112818]
          Length = 120

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 74/119 (62%), Gaps = 10/119 (8%)

Query: 183 DLYVVHAGLLPDVPLFEQDPSDIMSMR--NIKNGKPTSKKDVGHAWSKHWNAAQ-----Q 235
           D+ V+H GL+P VPL  QDP  +M+MR  ++ +  P+S K+ G  WSK ++  Q     +
Sbjct: 3   DVVVIHGGLVPGVPLERQDPLSVMTMRTLDVDSHTPSSLKE-GTGWSKVFDEYQRRMVKE 61

Query: 236 ESSSPKTIIYGHDASRRLKIKPYSFGLDSGCVYGGELSALIWNDN--REIINVKCNKYV 292
           ++  P T+IYGHDA +   I+ Y+ GLD+ CV GG+L+ALI  D   + +  VKC  YV
Sbjct: 62  KNEQPTTVIYGHDAKQLPVIRLYTKGLDTSCVRGGKLTALIIGDGGRQRLKQVKCKGYV 120



>gi|490840712|ref|WP_004702787.1| diadenosine tetraphosphatase [Yersinia aldovae]
 gi|238702802|gb|EEP95348.1| Bis(5'-nucleosyl)-tetraphosphatase, symmetrical [Yersinia aldovae
           ATCC 35236]
          Length = 292

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 121/276 (43%), Gaps = 69/276 (25%)

Query: 57  FIGDVHGSYDELLNLINKINYDPLKDHLIFVGDIVAKGPKSIEVVQLIRSLGASC--VRG 114
            IGDVHG  DELL L+ ++N+DP +D L   GD+VA+GP S++V++ +RSLG S   V G
Sbjct: 5   LIGDVHGCLDELLALLAQVNFDPQQDTLWLTGDLVARGPASLDVLRYVRSLGPSVRMVLG 64

Query: 115 NHDDKVLQIKNILDFLDSQKIPLDEFIKEHDIPKDIVKSEHGLLAKELDVELYNYLLSCP 174
           NHD  +L +   +    S+  P     K+H  P         L A + D EL N+L   P
Sbjct: 65  NHDIHLLAVYAGI----SRNKP-----KDHITPL--------LEAPDAD-ELINWLRRQP 106

Query: 175 IILDIPEYDLYVVHAGLLPD---------------------VPLF------------EQD 201
           ++       + + HAG+ P                       PLF              +
Sbjct: 107 VLQVDDNLKIIMAHAGISPQWDIETAQMCAREVEAVLSSDSYPLFLDAMYGDMPNNWSPE 166

Query: 202 PSDIMSMRNIKNGK-------PTSKKDV--------GHAWSKHWNAAQQESSSPKTIIYG 246
            S +  +R   N         P  + D+          A  K W    +  S   +II+G
Sbjct: 167 LSGLARLRFSTNALTRMRYCFPNGQLDMICKDTPENAPAPLKPWFDLPRRVSPEYSIIFG 226

Query: 247 HDASRRLKIKPYS-FGLDSGCVYGGELSALIWNDNR 281
           H AS   K  P   +GLD+GC +GG+L+ L W D R
Sbjct: 227 HWASLEGKGVPEGIYGLDTGCCWGGDLTLLRWEDKR 262