BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10288_c0_seq1-m.107 complete 331-1671(+) 447 (+)
         (446 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|390596564|gb|EIN05965.1| hypothetical protein PUNSTDRAFT_9067...   343   5e-92   Punctularia strigosozonata HHB-11173 SS5
gi|501308643|dbj|GAC97537.1| predicted urea transporter [Pseudoz...   339   1e-90   Pseudozyma hubeiensis SY62
gi|388853819|emb|CCF52540.1| uncharacterized protein [Ustilago h...   327   4e-87   Ustilago hordei
gi|343429781|emb|CBQ73353.1| conserved hypothetical protein [Spo...   324   4e-86   Sporisorium reilianum SRZ2
gi|443898725|dbj|GAC76059.1| hypothetical protein PANT_19d00093 ...   323   7e-86   Moesziomyces antarcticus T-34
gi|392864120|gb|EJB10754.1| urea transporter [Coccidioides immit...   321   3e-85   
gi|358393547|gb|EHK42948.1| hypothetical protein TRIATDRAFT_2470...   310   8e-82   Trichoderma atroviride IMI 206040
gi|399166435|emb|CCE32710.1| uncharacterized protein CPUR_06574 ...   308   2e-81   Claviceps purpurea 20.1
gi|406868486|gb|EKD21523.1| urea transporter [Marssonina brunnea...   308   2e-81   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|367041970|ref|XP_003651365.1| hypothetical protein THITE_2111...   308   3e-81   Thielavia terrestris NRRL 8126
gi|239613852|gb|EEQ90839.1| urea transporter [Ajellomyces dermat...   307   5e-81   
gi|440469250|gb|ELQ38367.1| urea transport protein [Magnaporthe ...   305   1e-80   Magnaporthe oryzae Y34
gi|389637038|ref|XP_003716160.1| urea transporter [Magnaporthe o...   305   2e-80   Magnaporthe oryzae 70-15
gi|440633300|gb|ELR03219.1| hypothetical protein GMDG_01202 [Geo...   305   2e-80   Pseudogymnoascus destructans 20631-21
gi|258573539|ref|XP_002540951.1| conserved hypothetical protein ...   302   1e-79   Uncinocarpus reesii 1704
gi|71017739|ref|XP_759100.1| hypothetical protein UM02953.1 [Ust...   302   2e-79   
gi|171676089|ref|XP_001902998.1| hypothetical protein [Podospora...   302   2e-79   Podospora anserina S mat+
gi|512203105|gb|EPE31930.1| hypothetical protein GLAREA_12012 [G...   301   3e-79   Glarea lozoyensis ATCC 20868
gi|315047150|ref|XP_003172950.1| hypothetical protein MGYG_09089...   300   5e-79   Microsporum gypseum CBS 118893
gi|367021828|ref|XP_003660199.1| hypothetical protein MYCTH_2298...   300   7e-79   Myceliophthora thermophila ATCC 42464
gi|320590557|gb|EFX03000.1| urea transport protein [Grosmannia c...   299   1e-78   Grosmannia clavigera kw1407
gi|336463537|gb|EGO51777.1| hypothetical protein NEUTE1DRAFT_125...   298   3e-78   Neurospora tetrasperma FGSC 2508
gi|350297242|gb|EGZ78219.1| hypothetical protein NEUTE2DRAFT_154...   297   4e-78   Neurospora tetrasperma FGSC 2509
gi|322709553|gb|EFZ01129.1| urea transporter [Metarhizium anisop...   297   4e-78   
gi|500255736|gb|EON99074.1| putative urea transporter protein [T...   297   4e-78   Phaeoacremonium minimum UCRPA7
gi|164429597|ref|XP_964341.2| hypothetical protein NCU11204 [Neu...   297   4e-78   
gi|154286680|ref|XP_001544135.1| conserved hypothetical protein ...   296   6e-78   Histoplasma capsulatum NAm1
gi|512188743|gb|EPE04513.1| urea transporter [Ophiostoma piceae ...   295   2e-77   Ophiostoma piceae UAMH 11346
gi|340519811|gb|EGR50049.1| hypothetical protein TRIREDRAFT_3412...   295   2e-77   Trichoderma reesei QM6a
gi|402086111|gb|EJT81009.1| urea transporter [Gaeumannomyces gra...   292   2e-76   Gaeumannomyces graminis var. tritici R3-111a-1
gi|302505048|ref|XP_003014745.1| hypothetical protein ARB_07307 ...   292   2e-76   Arthroderma benhamiae CBS 112371
gi|402086110|gb|EJT81008.1| urea transporter, variant [Gaeumanno...   291   2e-76   Gaeumannomyces graminis var. tritici R3-111a-1
gi|327306029|ref|XP_003237706.1| hypothetical protein TERG_02421...   291   3e-76   Trichophyton rubrum CBS 118892
gi|296414011|ref|XP_002836698.1| hypothetical protein [Tuber mel...   291   4e-76   Tuber melanosporum Mel28
gi|340975607|gb|EGS22722.1| hypothetical protein CTHT_0011960 [C...   290   8e-76   Chaetomium thermophilum var. thermophilum DSM 1495
gi|345566015|gb|EGX48962.1| hypothetical protein AOL_s00079g183 ...   289   1e-75   Arthrobotrys oligospora ATCC 24927
gi|302664422|ref|XP_003023841.1| hypothetical protein TRV_02038 ...   289   1e-75   Trichophyton verrucosum HKI 0517
gi|326481865|gb|EGE05875.1| hypothetical protein TEQG_04886 [Tri...   286   7e-75   Trichophyton equinum CBS 127.97
gi|336264692|ref|XP_003347122.1| hypothetical protein SMAC_05421...   286   7e-75   Sordaria macrospora k-hell
gi|50423383|ref|XP_460274.1| DEHA2E22396p [Debaryomyces hansenii...   286   8e-75   Debaryomyces hansenii CBS767
gi|346320510|gb|EGX90110.1| urea transporter [Cordyceps militari...   286   9e-75   Cordyceps militaris CM01
gi|407918302|gb|EKG11573.1| Sodium/solute symporter [Macrophomin...   286   1e-74   Macrophomina phaseolina MS6
gi|238882735|gb|EEQ46373.1| conserved hypothetical protein [Cand...   285   1e-74   Candida albicans WO-1
gi|68489472|ref|XP_711409.1| hypothetical protein CaO19.6656 [Ca...   285   1e-74   Candida albicans SC5314
gi|408392233|gb|EKJ71591.1| hypothetical protein FPSE_08230 [Fus...   285   3e-74   Fusarium pseudograminearum CS3096
gi|302919081|ref|XP_003052786.1| predicted protein [Nectria haem...   283   5e-74   Nectria haematococca mpVI 77-13-4
gi|241955795|ref|XP_002420618.1| urea transporter, putative; ure...   282   1e-73   Candida dubliniensis CD36
gi|477518870|gb|ENH71070.1| hypothetical protein FOC1_g10008443 ...   282   2e-73   Fusarium oxysporum f. sp. cubense race 1
gi|342878048|gb|EGU79459.1| hypothetical protein FOXB_10044 [Fus...   282   2e-73   Fusarium oxysporum Fo5176
gi|358384934|gb|EHK22531.1| hypothetical protein TRIVIDRAFT_1798...   281   2e-73   Trichoderma virens Gv29-8
gi|149237959|ref|XP_001524856.1| conserved hypothetical protein ...   280   8e-73   Lodderomyces elongisporus NRRL YB-4239
gi|400595550|gb|EJP63345.1| urea transporter [Beauveria bassiana...   279   1e-72   Beauveria bassiana ARSEF 2860
gi|295663094|ref|XP_002792100.1| urea transport protein [Paracoc...   278   2e-72   
gi|505755900|gb|EOR00094.1| putative urea active transporter 1 [...   278   2e-72   Wallemia ichthyophaga EXF-994
gi|378730007|gb|EHY56466.1| hypothetical protein HMPREF1120_0454...   278   2e-72   Exophiala dermatitidis NIH/UT8656
gi|477525718|gb|ENH77590.1| urea transporter [Colletotrichum orb...   277   5e-72   Colletotrichum orbiculare MAFF 240422
gi|451997584|gb|EMD90049.1| hypothetical protein COCHEDRAFT_1022...   276   7e-72   Bipolaris maydis C5
gi|396469553|ref|XP_003838434.1| hypothetical protein LEMA_P1137...   276   8e-72   Leptosphaeria maculans JN3
gi|451852092|gb|EMD65387.1| hypothetical protein COCSADRAFT_3544...   276   9e-72   Bipolaris sorokiniana ND90Pr
gi|38567077|emb|CAE76374.1| hypothetical protein [Neurospora cra...   276   1e-71   Neurospora crassa
gi|354547251|emb|CCE43985.1| hypothetical protein CPAR2_502100 [...   275   2e-71   Candida parapsilosis
gi|448515648|ref|XP_003867382.1| Dur3 urea transporter [Candida ...   274   5e-71   Candida orthopsilosis Co 90-125
gi|448084999|ref|XP_004195745.1| Piso0_005156 [Millerozyma farin...   273   8e-71   Millerozyma farinosa CBS 7064
gi|380471757|emb|CCF47122.1| hypothetical protein CH063_15636 [C...   273   8e-71   Colletotrichum higginsianum
gi|310794094|gb|EFQ29555.1| hypothetical protein GLRG_04699 [Glo...   273   9e-71   Colletotrichum graminicola M1.001
gi|388578764|gb|EIM19102.1| hypothetical protein WALSEDRAFT_6164...   272   2e-70   Wallemia mellicola CBS 633.66
gi|459369699|gb|EMG48026.1| Urea transporter, putative (Urea/pol...   271   3e-70   Candida maltosa Xu316
gi|448080486|ref|XP_004194649.1| Piso0_005156 [Millerozyma farin...   270   6e-70   Millerozyma farinosa CBS 7064
gi|50554165|ref|XP_504491.1| YALI0E27984p [Yarrowia lipolytica] ...   270   7e-70   Yarrowia lipolytica CLIB122
gi|255732433|ref|XP_002551140.1| conserved hypothetical protein ...   269   1e-69   Candida tropicalis MYA-3404
gi|326471561|gb|EGD95570.1| hypothetical protein TESG_03046 [Tri...   269   1e-69   Trichophyton tonsurans CBS 112818
gi|330917930|ref|XP_003298017.1| hypothetical protein PTT_08598 ...   267   6e-69   Pyrenophora teres f. teres 0-1
gi|225685269|gb|EEH23553.1| conserved hypothetical protein [Para...   266   1e-68   
gi|189202288|ref|XP_001937480.1| conserved hypothetical protein ...   265   1e-68   Pyrenophora tritici-repentis Pt-1C-BFP
gi|226294605|gb|EEH50025.1| urea transport protein [Paracoccidio...   265   2e-68   
gi|406605512|emb|CCH43156.1| Sodium/glucose cotransporter 1 [Wic...   265   2e-68   Wickerhamomyces ciferrii
gi|366999438|ref|XP_003684455.1| hypothetical protein TPHA_0B035...   265   2e-68   Tetrapisispora phaffii CBS 4417
gi|46129398|ref|XP_389060.1| hypothetical protein FG08884.1 [Fus...   263   5e-68   
gi|50551147|ref|XP_503047.1| YALI0D19866p [Yarrowia lipolytica] ...   261   2e-67   Yarrowia lipolytica CLIB122
gi|322696792|gb|EFY88579.1| urea transporter [Metarhizium acridu...   261   2e-67   Metarhizium acridum CQMa 102
gi|471566473|gb|EMR66770.1| putative urea transporter protein [E...   261   3e-67   Eutypa lata UCREL1
gi|482808759|gb|EOA85644.1| hypothetical protein SETTUDRAFT_1696...   261   3e-67   Setosphaeria turcica Et28A
gi|126137249|ref|XP_001385148.1| urea transport protein [Scheffe...   261   3e-67   Scheffersomyces stipitis CBS 6054
gi|119192082|ref|XP_001246647.1| hypothetical protein CIMG_00418...   261   3e-67   
gi|50305545|ref|XP_452732.1| hypothetical protein [Kluyveromyces...   261   3e-67   Kluyveromyces lactis NRRL Y-1140
gi|156847319|ref|XP_001646544.1| hypothetical protein Kpol_1055p...   261   4e-67   Vanderwaltozyma polyspora DSM 70294
gi|255718783|ref|XP_002555672.1| KLTH0G14718p [Lachancea thermot...   260   6e-67   Lachancea thermotolerans CBS 6340
gi|303313113|ref|XP_003066568.1| hypothetical protein CPC735_057...   258   4e-66   Coccidioides posadasii C735 delta SOWgp
gi|494831159|gb|EON67651.1| hypothetical protein W97_06794 [Coni...   257   5e-66   Coniosporium apollinis CBS 100218
gi|453084248|gb|EMF12293.1| hypothetical protein SEPMUDRAFT_4620...   257   6e-66   Sphaerulina musiva SO2202
gi|465795812|emb|CCV00245.1| unnamed protein product [Malassezia...   253   1e-64   Malassezia sympodialis ATCC 42132
gi|363755328|ref|XP_003647879.1| hypothetical protein Ecym_7216 ...   252   1e-64   Eremothecium cymbalariae DBVPG#7215
gi|398408051|ref|XP_003855491.1| hypothetical protein MYCGRDRAFT...   251   3e-64   Zymoseptoria tritici IPO323
gi|296804300|ref|XP_002843002.1| urea transport protein [Arthrod...   250   6e-64   Arthroderma otae CBS 113480
gi|320581949|gb|EFW96168.1| urea transporter, putative urea/poly...   249   1e-63   
gi|366987111|ref|XP_003673322.1| hypothetical protein NCAS_0A037...   248   2e-63   Naumovozyma castellii CBS 4309
gi|261193629|ref|XP_002623220.1| urea transporter [Ajellomyces d...   248   3e-63   Blastomyces gilchristii SLH14081
gi|344233479|gb|EGV65351.1| hypothetical protein CANTEDRAFT_1196...   247   5e-63   Candida tenuis ATCC 10573
gi|164656775|ref|XP_001729515.1| hypothetical protein MGL_3550 [...   245   2e-62   Malassezia globosa CBS 7966
gi|429848401|gb|ELA23890.1| urea transporter [Colletotrichum glo...   241   2e-61   Colletotrichum gloeosporioides Nara gc5
gi|325094525|gb|EGC47835.1| urea transporter [Ajellomyces capsul...   240   6e-61   Histoplasma capsulatum H88
gi|240275165|gb|EER38680.1| urea transporter [Ajellomyces capsul...   239   1e-60   Histoplasma capsulatum H143
gi|367008374|ref|XP_003678687.1| hypothetical protein TDEL_0A014...   238   3e-60   Torulaspora delbrueckii
gi|225558773|gb|EEH07057.1| urea transporter [Ajellomyces capsul...   237   6e-60   Histoplasma capsulatum G186AR
gi|254567718|ref|XP_002490969.1| hypothetical protein [Komagatae...   236   1e-59   Komagataella phaffii GS115
gi|365985345|ref|XP_003669505.1| hypothetical protein NDAI_0C060...   234   4e-59   Naumovozyma dairenensis CBS 421
gi|485923385|gb|EOD48562.1| putative urea transporter protein [N...   231   4e-58   Neofusicoccum parvum UCRNP2
gi|344301867|gb|EGW32172.1| hypothetical protein SPAPADRAFT_6126...   229   1e-57   Spathaspora passalidarum NRRL Y-27907
gi|513034046|gb|AGO14012.1| AaceriAGR155Cp [Saccharomycetaceae s...   228   4e-57   Saccharomycetaceae sp. 'Ashbya aceri'
gi|116193701|ref|XP_001222663.1| hypothetical protein CHGG_06568...   227   6e-57   Chaetomium globosum CBS 148.51
gi|361125484|gb|EHK97525.1| putative Eukaryotic translation init...   226   7e-57   Glarea lozoyensis 74030
gi|50290383|ref|XP_447623.1| hypothetical protein [Candida glabr...   223   7e-56   Candida glabrata CBS 138
gi|452984112|gb|EME83869.1| hypothetical protein MYCFIDRAFT_1627...   218   4e-54   Cercospora fijiensis CIRAD86
gi|302419953|ref|XP_003007807.1| urea transport protein [Vertici...   214   6e-53   Verticillium alfalfae VaMs.102
gi|260943103|ref|XP_002615850.1| hypothetical protein CLUG_04732...   213   1e-52   Clavispora lusitaniae ATCC 42720
gi|169594868|ref|XP_001790858.1| hypothetical protein SNOG_00164...   206   9e-51   Parastagonospora nodorum SN15
gi|403216744|emb|CCK71240.1| hypothetical protein KNAG_0G01820 [...   206   1e-50   Kazachstania naganishii CBS 8797
gi|302309420|ref|NP_986821.2| AGR155Cp [Ashbya gossypii ATCC 108...   197   8e-48   Eremothecium gossypii ATCC 10895
gi|507524472|ref|YP_008046085.1| solute symporter-like protein [...   181   3e-43   
gi|496243989|ref|WP_008957374.1| sodium:solute symporter [Halomo...   166   2e-38   Halomonas sp. HAL1
gi|219129440|ref|XP_002184897.1| predicted protein [Phaeodactylu...   163   9e-38   Phaeodactylum tricornutum CCAP 1055/1
gi|501087544|ref|WP_012137811.1| solute symporter-like protein [...   161   3e-37   Marinobacter lipolyticus
gi|384254250|gb|EIE27724.1| NAD(P)-binding protein [Coccomyxa su...   161   3e-37   Coccomyxa subellipsoidea C-169
gi|494264168|ref|WP_007153677.1| sodium:solute symporter [Marino...   159   1e-36   Marinobacter algicola
gi|512441197|ref|WP_016416980.1| sodium:solute symporter [Halomo...   155   2e-35   Halomonas anticariensis
gi|496591109|ref|WP_009288217.1| Sodium/solute symporter [Halomo...   154   4e-35   Halomonas
gi|490716886|ref|WP_004579451.1| solute symporter-like protein [...   154   5e-35   Marinobacter nanhaiticus
gi|494173757|ref|WP_007113484.1| sodium:solute symporter [Halomo...   152   3e-34   
gi|497407386|ref|WP_009721584.1| sodium:solute symporter [Halomo...   150   8e-34   Halomonas sp. TD01
gi|307544110|ref|YP_003896589.1| hypothetical protein HELO_1521 ...   149   2e-33   
gi|385331874|ref|YP_005885825.1| solute symporter-like protein [...   148   3e-33   
gi|323456367|gb|EGB12234.1| hypothetical protein AURANDRAFT_6136...   147   5e-33   Aureococcus anophagefferens
gi|346977478|gb|EGY20930.1| urea transport protein [Verticillium...   147   7e-33   Verticillium dahliae VdLs.17
gi|323455936|gb|EGB11803.1| hypothetical protein AURANDRAFT_6101...   147   7e-33   Aureococcus anophagefferens
gi|385305452|gb|EIF49423.1| urea urea polyamine [Dekkera bruxell...   145   3e-32   Brettanomyces bruxellensis AWRI1499
gi|223993879|ref|XP_002286623.1| predicted protein [Thalassiosir...   145   3e-32   Thalassiosira pseudonana CCMP1335
gi|428175810|gb|EKX44698.1| hypothetical protein GUITHDRAFT_8737...   144   7e-32   Guillardia theta CCMP2712
gi|328771326|gb|EGF81366.1| hypothetical protein BATDEDRAFT_3491...   138   3e-30   Batrachochytrium dendrobatidis JAM81
gi|158321712|ref|YP_001514219.1| Na+/solute symporter [Alkaliphi...   137   6e-30   
gi|145345452|ref|XP_001417224.1| SSS family transporter: sodium ...   137   6e-30   Ostreococcus lucimarinus CCE9901
gi|303282763|ref|XP_003060673.1| Na+/solute symporter [Micromona...   136   1e-29   Micromonas pusilla CCMP1545
gi|348678595|gb|EGZ18412.1| hypothetical protein PHYSODRAFT_3322...   134   6e-29   Phytophthora sojae
gi|294900101|ref|XP_002776900.1| Osmoregulated proline transport...   132   2e-28   Perkinsus marinus ATCC 50983
gi|344212553|ref|YP_004796873.1| sodium-solute symporter putativ...   129   1e-27   
gi|308802840|ref|XP_003078733.1| unnamed protein product [Ostreo...   129   2e-27   Ostreococcus tauri
gi|452837940|gb|EME39881.1| hypothetical protein DOTSEDRAFT_6579...   129   2e-27   Dothistroma septosporum NZE10
gi|495587964|ref|WP_008312543.1| sodium-solute symporter putativ...   129   2e-27   Haloarcula amylolytica
gi|428171596|gb|EKX40511.1| hypothetical protein GUITHDRAFT_7539...   126   2e-26   Guillardia theta CCMP2712
gi|491681725|ref|WP_005537864.1| sodium-solute symporter putativ...   126   2e-26   Haloarcula argentinensis
gi|495819990|ref|WP_008544569.1| sodium:solute transporter famil...   125   2e-26   Candidatus Pelagibacter sp. HTCC7211
gi|490652117|ref|WP_004517111.1| sodium-solute symporter putativ...   125   2e-26   Haloarcula vallismortis
gi|495594848|ref|WP_008319427.1| sodium/proline symporter [Halof...   125   2e-26   Haloferax mucosum
gi|401395637|ref|XP_003879646.1| hypothetical protein NCLIV_0010...   124   5e-26   Neospora caninum Liverpool
gi|71083513|ref|YP_266232.1| sodium/solute transporter family [C...   124   7e-26   
gi|494055010|ref|WP_006997107.1| sodium:solute transporter famil...   123   1e-25   Candidatus Pelagibacter ubique
gi|494345167|ref|WP_007188843.1| sodium-solute symporter putativ...   122   2e-25   Haloarcula californiae
gi|348678575|gb|EGZ18392.1| hypothetical protein PHYSODRAFT_3010...   122   2e-25   Phytophthora sojae
gi|495848440|ref|WP_008573019.1| sodium-solute symporter [Halofe...   122   3e-25   Haloferax
gi|494484685|ref|WP_007274158.1| sodium-solute symporter [Halofe...   122   3e-25   Haloferax sulfurifontis
gi|332283893|ref|YP_004415804.1| sodium transporter family prote...   122   3e-25   
gi|55378520|ref|YP_136370.1| sodium-solute symporter [Haloarcula...   121   4e-25   
gi|495289883|ref|WP_008014637.1| Na+/solute symporter [Haloterri...   121   4e-25   
gi|325185496|emb|CCA19979.1| Solute:Sodium Symporter (SSS) Famil...   121   5e-25   Albugo laibachii Nc14
gi|491109342|ref|WP_004968441.1| sodium-solute symporter [Halofe...   120   7e-25   Haloferax denitrificans
gi|491096221|ref|WP_004957825.1| sodium-solute symporter putativ...   120   1e-24   Haloarcula sinaiiensis
gi|330813504|ref|YP_004357743.1| sodium:solute transporter famil...   120   1e-24   
gi|167042009|gb|ABZ06745.1| putative Sodium:solute symporter fam...   119   1e-24   uncultured marine microorganism HF4000_141F21
gi|490163169|ref|WP_004061823.1| sodium-solute symporter [Halofe...   119   2e-24   Haloferax lucentense
gi|348689995|gb|EGZ29809.1| hypothetical protein PHYSODRAFT_3099...   119   2e-24   Phytophthora sojae
gi|493648470|ref|WP_006600045.1| sodium-solute symporter [Halofe...   119   2e-24   Haloferax alexandrinus
gi|491113813|ref|WP_004972271.1| sodium-solute symporter [Halofe...   119   2e-24   Haloferax gibbonsii
gi|490728987|ref|WP_004591385.1| sodium-solute symporter putativ...   119   3e-24   Haloarcula japonica
gi|167042081|gb|ABZ06816.1| putative sodium:solute symporter fam...   118   4e-24   uncultured marine microorganism HF4000_141I21
gi|495372393|ref|WP_008097106.1| sodium-solute symporter [Halofe...   116   2e-23   Haloferax prahovense
gi|292494311|ref|YP_003533454.1| sodium-solute symporter [Halofe...   116   2e-23   
gi|159478048|ref|XP_001697116.1| hypothetical protein CHLREDRAFT...   115   2e-23   Chlamydomonas reinhardtii
gi|389848875|ref|YP_006351112.1| sodium/proline symporter [Halof...   115   3e-23   
gi|452206656|ref|YP_007486778.1| sodium/solute symporter [Natron...   114   4e-23   
gi|485631099|gb|EOD26242.1| hypothetical protein EMIHUDRAFT_2368...   114   8e-23   Emiliania huxleyi CCMP1516
gi|401410997|ref|XP_003884946.1| conserved hypothetical protein ...   113   1e-22   Neospora caninum Liverpool
gi|495600235|ref|WP_008324814.1| sodium/proline symporter [Halof...   113   1e-22   Haloferax elongans
gi|494805783|ref|WP_007541191.1| sodium/proline symporter [Halof...   113   1e-22   Haloferax larsenii
gi|257051772|ref|YP_003129605.1| Na+/solute symporter [Halorhabd...   112   3e-22   
gi|221482350|gb|EEE20705.1| sodium/proline symporter, putative [...   110   9e-22   
gi|237842017|ref|XP_002370306.1| sodium:solute symporter family ...   110   1e-21   Toxoplasma gondii ME49
gi|496768627|ref|WP_009366258.1| sodium:proline symporter [Halog...   110   1e-21   Halogranum salarium
gi|385803739|ref|YP_005840139.1| sodium/proline symporter [Haloq...   110   1e-21   
gi|406706436|ref|YP_006756789.1| sodium:solute symporter [alpha ...   110   1e-21   
gi|221507030|gb|EEE32634.1| hypothetical protein TGVEG_093120 [T...   110   1e-21   
gi|110668293|ref|YP_658104.1| sodium/proline symporter [Haloquad...   110   1e-21   
gi|313117273|ref|YP_004044256.1| Na+/proline symporter [Halogeom...   108   4e-21   
gi|493057507|ref|WP_006114744.1| sodium/proline symporter [Halor...   108   5e-21   
gi|497072234|ref|WP_009458289.1| sodium:solute symporter family ...   107   5e-21   
gi|493564321|ref|WP_006517691.1| Na+/proline symporter [Leptolyn...   107   8e-21   Leptolyngbya sp. PCC 7375
gi|489896677|ref|WP_003800124.1| sodium:solute symporter [Alcali...   105   3e-20   Alcaligenes faecalis
gi|491920183|ref|WP_005672666.1| sodium:solute symporter [Lautro...   104   5e-20   Lautropia mirabilis
gi|374333905|ref|YP_005090592.1| sodium transporter family prote...   102   2e-19   
gi|399546779|ref|YP_006560087.1| Sodium/pantothenate symporter [...   101   4e-19   
gi|496388369|ref|WP_009097359.1| sodium:solute symporter [Halomo...   100   7e-19   
gi|494589580|ref|WP_007348174.1| sodium:solute symporter [Marino...   100   8e-19   Marinobacter sp. ELB17
gi|237829741|ref|XP_002364168.1| hypothetical protein TGME49_108...    99   3e-18   Toxoplasma gondii ME49
gi|221481082|gb|EEE19490.1| conserved hypothetical protein [Toxo...    98   6e-18   
gi|91776138|ref|YP_545894.1| Na+/solute symporter [Methylobacill...    96   2e-17   
gi|344233258|gb|EGV65131.1| hypothetical protein CANTEDRAFT_1135...    95   3e-17   Candida tenuis ATCC 10573
gi|301099137|ref|XP_002898660.1| Solute:Sodium Symporter (SSS) F...    94   6e-17   Phytophthora infestans T30-4
gi|493500829|ref|WP_006455347.1| transporter, SSS family, putati...    91   8e-16   Synechococcus sp. PCC 7335
gi|492986221|ref|WP_006079325.1| sodium-solute symporter putativ...    86   2e-14   
gi|495015305|ref|WP_007741316.1| sodium-solute symporter putativ...    86   3e-14   Halococcus thailandensis
gi|495661125|ref|WP_008385704.1| Na+/proline symporter [Halosarc...    86   3e-14   Halogeometricum pallidum
gi|490154212|ref|WP_004052888.1| sodium-solute symporter putativ...    84   8e-14   Halococcus morrhuae
gi|485648251|gb|EOD41160.1| hypothetical protein EMIHUDRAFT_1993...    81   6e-13   Emiliania huxleyi CCMP1516
gi|328771325|gb|EGF81365.1| hypothetical protein BATDEDRAFT_2427...    77   1e-11   Batrachochytrium dendrobatidis JAM81


>gi|390596564|gb|EIN05965.1| hypothetical protein PUNSTDRAFT_90679 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 495

 Score =  343 bits (881), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 181/445 (40%), Positives = 270/445 (60%), Gaps = 7/445 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YAF S +PL  F +LG  IRK CP GF LT++  ERFG    +++S  S+  MF +M+S
Sbjct: 23  VYAFASSLPLLTFPYLGGKIRKLCPHGFVLTEYTRERFGITTALFLSFFSVVTMFIYMVS 82

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           EL+A+  ++ +LTG++ +   I   ++T LYT +GG R SL+TD +QG            
Sbjct: 83  ELTAITGVINSLTGLNAIPATIVEVVITMLYTAWGGFRTSLVTDYVQGVLILVLLVVCSA 142

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
               +IRI++++I+ S LLK+N LGWQLLYI+PVA+ +   F  G+WQRAF+SK +R+L 
Sbjct: 143 AMGANIRIDRALIEESGLLKANLLGWQLLYILPVAIVWNNFFLSGYWQRAFASKTNRDLW 202

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     +I++F +L  +G TG+IAVW+ L+PG E  +    FF +   LP WV G  +V 
Sbjct: 203 IGCSGAAIIVFVMLTIVGFTGLIAVWSRLYPGYEGDDGSFTFFEILATLPAWVVGFVLVF 262

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           A+S+SCAAYDTL +A  A  SND+F N+L +   R L LI NVPAV    K+L++L ++L
Sbjct: 263 AISLSCAAYDTLQNAIVATISNDVFRNKLNIWWVR-LVLIVNVPAVVVATKNLNILVLYL 321

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++A+ MPPI LGLI  LYFLN  D                +I+Y++AK G  ++ L
Sbjct: 322 ISDLVSAAIMPPIFLGLIPRLYFLNSFDIIIGGVGGFFTVFIWGAIYYNDAKKGAGVLIL 381

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             G+Y  D+S  GAF+ AP+ SI +TF +F +R  + +++ +  G  F       V D +
Sbjct: 382 QAGIYADDWSTFGAFVAAPVGSILWTFGAFALRAGATYLYARRTGAHF------GVFDKR 435

Query: 421 KYAGNKFKDDTEIIQSSDPDEIEIR 445
           +    +F ++      S PDE E+ 
Sbjct: 436 EIDVARFAEEAAQAGISVPDEAELE 460



>gi|501308643|dbj|GAC97537.1| predicted urea transporter [Pseudozyma hubeiensis SY62]
          Length = 523

 Score =  339 bits (869), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 173/409 (42%), Positives = 260/409 (63%), Gaps = 3/409 (0%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y F +++PL+ FAWLGPLIR+ CP+GFTL +++  RFG    +   L+ + +MFCFM+ E
Sbjct: 55  YCFATVVPLWFFAWLGPLIRRICPDGFTLAEYIRRRFGWPVGVLSGLIFVGFMFCFMLVE 114

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+  G+ + TL GV+     + +A+ TT+YT YGG +ASL TDN+               
Sbjct: 115 LNTYGSAVNTLGGVNPTIAALIVALSTTIYTAYGGFKASLYTDNVNAVIILIFIVIASVA 174

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
              ++ I+ + +++S LL+   LG +L YI+P A+ F+ +F++GFWQRAF+SKN++ L L
Sbjct: 175 VGVNLDIDHARVESSGLLRPQRLGGELWYILPAAIIFSQMFNQGFWQRAFASKNNKTLYL 234

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLESYLAFFTLFKVLPDWVSGITVV 239
           S ++ +I LF V + +G+ G +A W+GL+  P  E+ +  L FF +   LP+W++GI +V
Sbjct: 235 SVIFATIPLFAVCMLVGMAGPLAWWSGLFNGPTAED-DGSLTFFYILNTLPNWLTGIVIV 293

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           L   +S +AYDT  SA  +   ND+F  RL +   R + ++ NVP+V   +K++D+L VF
Sbjct: 294 LCGCLSSSAYDTFQSAQISTIQNDVFLGRLNIWWCRAILVLINVPSVVLAVKNIDILEVF 353

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LIADL A + +P  LLGL+  LYFLN +D                ++F+ +A  GI LIG
Sbjct: 354 LIADLAAIACIPAFLLGLVPQLYFLNGLDAVGGAVGGFLTVFLFGTVFFRSAAQGIALIG 413

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
           LP GLYI DYSVLGAFI APL S+ +TF++FG+R   MWV+ +  GE+F
Sbjct: 414 LPNGLYIDDYSVLGAFIAAPLGSLGWTFVTFGIRATVMWVWCRRTGEKF 462



>gi|388853819|emb|CCF52540.1| uncharacterized protein [Ustilago hordei]
          Length = 553

 Score =  327 bits (838), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 175/442 (39%), Positives = 261/442 (59%), Gaps = 2/442 (0%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y F ++ PL+VFAWLGP IR+ CP+GFTL++++  R+G    +  +L+ + +MFCFM+ E
Sbjct: 81  YCFSTVAPLWVFAWLGPQIRRICPDGFTLSEYIRRRYGWPVGVLSALIFVGFMFCFMLVE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+  G+ +  L GV+     + IA++TT+YT YGG +ASL TDN                
Sbjct: 141 LNTYGSTVNVLGGVNPTIAALVIALITTIYTAYGGFKASLYTDNANAIIIMIFIVIASIA 200

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
              ++ I+ + +++S LLK   LG +L YI+  A+ F+ +F++GFWQR F+SKN++ L L
Sbjct: 201 VGVNLDIDHARVESSGLLKPQRLGGELWYILTAALVFSQMFNQGFWQRVFASKNNKALYL 260

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG-EENLESYLAFFTLFKVLPDWVSGITVVL 240
           S  + +I LF +   +G+ G +A W+GL+ G     +  L FF +   LP+WV+GI +VL
Sbjct: 261 SVAFATIPLFAICFIVGMAGPLAWWSGLFDGPTAEDDGSLTFFYIINTLPNWVTGIVIVL 320

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           A  +S +AYDT  SA  +   ND+F  RL +   R + +  NVP+V   +K++D+L VFL
Sbjct: 321 AGCLSSSAYDTFQSAQISTIQNDVFLGRLNIWWCRLILVCINVPSVVLAVKNIDILEVFL 380

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           IADL   + +P  LLGLI  LYFLN +D                + FY NA DGI+LIGL
Sbjct: 381 IADLAGIACIPAFLLGLIPKLYFLNGVDAVGGAVGGFLTVFLFGTAFYGNAADGIKLIGL 440

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF-VFPKKPEVVDT 419
           P GLY+ D+SVLGAF  APL SI +TF +  +R    W++ +  G E+ VF  +   V  
Sbjct: 441 PNGLYLDDFSVLGAFFAAPLGSIGWTFATCAIRAGLTWLYCRYTGNEYKVFEYREFDVSK 500

Query: 420 KKYAGNKFKDDTEIIQSSDPDE 441
                ++  D   I  S +PD+
Sbjct: 501 WALPEDRPADFHGIHGSGNPDD 522



>gi|343429781|emb|CBQ73353.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 550

 Score =  324 bits (830), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 175/444 (39%), Positives = 265/444 (59%), Gaps = 6/444 (1%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y F ++ PL+ FAWLGPLIR+ CP+GFTL +++  RFG    +   L+ + +MFCFM+ E
Sbjct: 81  YCFATVAPLWFFAWLGPLIRRVCPDGFTLAEYIRRRFGWPVGVLSGLIFVGFMFCFMLVE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+  G+ +  L GV+     + +AI TT+YT YGG +ASL TDN+               
Sbjct: 141 LNTYGSAVNLLGGVNPTIAALIVAISTTIYTAYGGFKASLWTDNVNAVIILIFIVIASIA 200

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
              ++ I+ + +++S LL+   LG +L YI+P A+ F+ +F++GFWQRAF+SKN++ L L
Sbjct: 201 VGVNLDIDHARVESSGLLRPQQLGGELWYILPAALIFSQMFNQGFWQRAFASKNNKTLYL 260

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLESYLAFFTLFKVLPDWVSGITVV 239
           S ++ +I LF V + +G+ G +A W+GL+  P  E+ +  L FF +   LP+W++GI +V
Sbjct: 261 SVIFATIPLFAVCMLVGMAGPLAWWSGLFNGPTAED-DGSLTFFYILATLPNWLTGIVIV 319

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           L   +S +AYDT  SA  +   ND+F  RL +   R + ++ NVP+V   +K++D+L VF
Sbjct: 320 LCGCLSSSAYDTFQSAQISTIQNDVFLGRLNIWWCRAILVLINVPSVVLAVKNIDILEVF 379

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LIADL A + +P  LLGL+  LYFLN +D                +IF+ +A  GI LI 
Sbjct: 380 LIADLAAIACIPAFLLGLVPQLYFLNGVDAVGGAVGGFFTVFIFGTIFFGSASKGIALIS 439

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           LP GLY+ DYSVLGAF  APL S+ +TF +  +R    WV+ +  G +F   +  E  D 
Sbjct: 440 LPTGLYVDDYSVLGAFFAAPLGSLGWTFATCAIRAGVTWVYCRYTGHKFTVFEYRE-FDV 498

Query: 420 KKYA--GNKFKDDTEIIQSSDPDE 441
            K+A   ++  D   I  S +P +
Sbjct: 499 SKFALPEDRPADFHGIHGSGNPHD 522



>gi|443898725|dbj|GAC76059.1| hypothetical protein PANT_19d00093 [Pseudozyma antarctica T-34]
          Length = 493

 Score =  323 bits (828), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 169/442 (38%), Positives = 263/442 (59%), Gaps = 2/442 (0%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y F ++ PL+ F WLGP IR+ CP+GFTL +++  R+G    +   L+ + +MFCFM+ E
Sbjct: 26  YCFSTVAPLWAFGWLGPQIRRICPDGFTLAEYIRRRYGWPVGVLSGLIFVGFMFCFMLVE 85

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+  G+ +  L GV+     + +A+ TT+YT YGG +ASL TDN+               
Sbjct: 86  LNTYGSTVNVLGGVNPTIAALIVALSTTIYTAYGGFKASLYTDNVNAVIIMIFVVIATIA 145

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
              ++ I+ + +++S LLK   LG +L YI+  A+ F+ +F++GFWQRAF+SKN++ L L
Sbjct: 146 VGVNLDIDHARVESSGLLKPQRLGGELWYILTAALVFSQMFNQGFWQRAFASKNNKTLYL 205

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG-EENLESYLAFFTLFKVLPDWVSGITVVL 240
           S ++ ++ LF +   +G+ G +A WAGL+ G     +  L FF +   LP+WV+GI +VL
Sbjct: 206 SVIFATVPLFAICFIVGMAGPLAWWAGLFDGPTAEDDGSLTFFYIINTLPNWVTGIVIVL 265

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           A  +S +AYDT  SA  +   ND+F  R+ +   R + ++ NVP+V   +K++D+L VFL
Sbjct: 266 AGCLSSSAYDTFQSAQISTIQNDVFLGRVNIWWCRAILVLINVPSVVLAVKNIDILEVFL 325

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           +ADL A + +P  LLGL+  LYFLN +D                + FY +A+ GI+L+GL
Sbjct: 326 VADLAAIACIPAFLLGLVPQLYFLNGVDAVGGAVGGFLTVFLFGTAFYGSAEQGIKLLGL 385

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF-VFPKKPEVVDT 419
           P GLYI D+SVLGAF  APL S+ +TF +FG+R  + WV+ +  G  F VF  +   V  
Sbjct: 386 PNGLYIDDFSVLGAFFAAPLGSLGWTFATFGMRAAATWVYCRYTGRAFNVFEYREFDVTK 445

Query: 420 KKYAGNKFKDDTEIIQSSDPDE 441
                ++  D   +  S +P++
Sbjct: 446 WALPEDRPADFHGVHGSGNPND 467



>gi|392864120|gb|EJB10754.1| urea transporter [Coccidioides immitis RS]
          Length = 541

 Score =  321 bits (822), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 169/414 (40%), Positives = 245/414 (59%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL VF +LGP+IRKKCPEGF LT++  ER+G    IY+SL+++  +F +M++
Sbjct: 82  VYGLSSSLPLLVFGYLGPIIRKKCPEGFVLTEWTRERYGVVTAIYLSLLTLITLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDN+QG            
Sbjct: 142 ELSALQQIVNALTGLNGLPAVIVQVAVTTIYTSLGGFKVSFMTDNLQGAMVVGLIIIGVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              T   I++S+ID+S  L ++ LGWQL+YI+PVA+     F   FW R F+SK DR+LR
Sbjct: 202 TVGTKTTIDRSLIDSSGYLNASLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDRDLR 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV GI +V+
Sbjct: 262 IGVSIASFTVLCILVLVGCTGLLAAWSGAWPGDPPQSGSIAFFLLLERLPSWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V +S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V   LK   VL++FL
Sbjct: 322 TVVLSTAAFDSLQSAMVSTASNDLFRNKLPLIYIRVGVVLCIIPVVVVALKSPSVLQIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P ++LGL D  YF    +                +I+Y +A +G  LI L
Sbjct: 382 ISDLVSASAIPVLILGLWDKCYFWKGFEVIAGGLGGILSVFIFGTIYYGSAYEGGRLILL 441

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
             GLY  D+S  GAF+ AP+    F  ++FG R+   +V  KI+G  F    KP
Sbjct: 442 ENGLYAEDWSAFGAFVAAPVGGFIFALIAFGSRIAYQFVIAKIQGRRFDAFDKP 495



>gi|358393547|gb|EHK42948.1| hypothetical protein TRIATDRAFT_247013 [Trichoderma atroviride IMI
           206040]
          Length = 521

 Score =  310 bits (793), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 167/414 (40%), Positives = 253/414 (61%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP++R+KCP+GF LT++  ER+G    +Y+S M++  +F +M++
Sbjct: 82  VYALASALPLLIFAALGPILRRKCPDGFVLTEWTRERYGTVAMLYLSFMTLVTLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSAVG ++  LTG+D L  +I   +VTT+YT  GG R S +TD +QG            
Sbjct: 142 ELSAVGQVVNALTGLDGLPVIIVECVVTTIYTSLGGFRISFLTDVVQGAMVVGLIIIATI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++ +ID+S L K++ +GWQL+YI+PVAV     F   FW R FSSK D++L 
Sbjct: 202 TIGVKAEIDRDLIDSSGLTKASLVGWQLVYILPVAVLTNDFFLSNFWLRTFSSKTDKDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     ++ +  +L  +G TG+IA W G WPGE +++  LAFF L + LP+WV GI +V+
Sbjct: 262 IGVSVATVAVLCILTLVGATGLIAAWTGAWPGESDIDGSLAFFALLEQLPNWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S +A+D+L SA  ++ SND+F NRL + + R L ++  +P V   LK   +L++FL
Sbjct: 322 VVSLSVSAFDSLQSAMISSASNDLFRNRLNIWIIRVLVVLVIIPTVVIALKAPSILQIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL +A+T+PP+ LGLID  Y+    +                +I+Y +AK G ELI L
Sbjct: 382 ISDLASAATIPPLCLGLIDGFYWWRGFEVVVGGLGGILSVFIYGAIYYGDAKSGGELILL 441

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
             GLY  D+   GAF++AP+  I + F++  +RL   +V  K RGE F    +P
Sbjct: 442 EQGLYEGDWGAFGAFVMAPVGGIIWGFIALVLRLSVQFVQAKSRGERFDALDRP 495



>gi|399166435|emb|CCE32710.1| uncharacterized protein CPUR_06574 [Claviceps purpurea 20.1]
          Length = 515

 Score =  308 bits (790), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 163/437 (37%), Positives = 258/437 (59%), Gaps = 6/437 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YAF S +P+ VF  +GP+IR+KCPEGF LT++  +R+G    +Y+S +++  +F +M++
Sbjct: 74  IYAFASALPMLVFGAIGPIIRRKCPEGFVLTEWTRQRYGTVTMLYLSFLTLVTLFLYMVA 133

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLTG+D L  +I   ++TTLYT  GG + S +TD IQG            
Sbjct: 134 ELSALGQVVSTLTGLDSLPAIIVECVITTLYTSLGGFKISFLTDTIQGVMVVGLIIVATI 193

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  +++ ++D S LL+ + LGWQLLYI+PVAV     F   FW R FSS++D++L 
Sbjct: 194 TVGVKADVKRELVDASHLLEPSLLGWQLLYILPVAVLTNDFFLSNFWLRTFSSRSDKDLM 253

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           L     ++++  +L  +G TG+I+VW+G WP + +    LAFF L + LP WV GI +V+
Sbjct: 254 LGVSMATVVVLCILTLIGCTGLISVWSGAWPLDGSQPGSLAFFLLLEQLPTWVIGIILVM 313

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++SCAA+D+L SA  ++ SND+F NRL +   R + ++  +P V   L+   +L++FL
Sbjct: 314 VVALSCAAFDSLQSAMVSSASNDLFRNRLNIWWIRAMVVVIIIPVVIVALRASSILQIFL 373

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DLL+A+T+P + LGLID LY+    +                 I+Y N+ D  +L+ +
Sbjct: 374 ISDLLSAATIPVLCLGLIDRLYWWRGFEVVVGGLGGILTIFIFGVIYYGNSYDAGQLLLV 433

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+S  GAF+  PL  I + F + G+RL   ++  K R E F    +P +  T 
Sbjct: 434 KNGLYAKDWSTFGAFVAGPLGGIVWGFGALGLRLSFQYLKAKYRHERFDALDRPAIALTS 493

Query: 421 KYAGNKFKDDTEIIQSS 437
                    D ++++ S
Sbjct: 494 G------DSDVDVLRQS 504



>gi|406868486|gb|EKD21523.1| urea transporter [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 552

 Score =  308 bits (789), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 165/440 (37%), Positives = 255/440 (57%), Gaps = 1/440 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S  PL VFA+L P+IRKKCPEGF LT++  +R+G    IY+S M++A MF +M++
Sbjct: 100 IYAISSAAPLLVFAFLTPIIRKKCPEGFVLTEWTRQRYGVVTAIYLSFMTMATMFLYMVA 159

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S ITDNIQ             
Sbjct: 160 ELSALQQIMTALTGMDGLPMVIVQCAVTTIYTSVGGFKISFITDNIQATMVISLIIIATI 219

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+KS+ DNS LL+ + LGWQLLYI+PV++     F   FW RAF++K DR+L 
Sbjct: 220 TIGVQTKIDKSLRDNSVLLEPSKLGWQLLYILPVSIITNVFFLSSFWIRAFAAKTDRDLW 279

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLW-PGEENLESYLAFFTLFKVLPDWVSGITVV 239
                 ++++  +L  +G+TG+IA W+G + P   + +  +AFF L + LP W  G+ +V
Sbjct: 280 TGVTIATLVVLIILTLVGVTGLIATWSGAYDPTNPDQDGSIAFFLLLESLPTWTIGLILV 339

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           + +SMS AA+D++ SA  +  SND+F N+L +   R   ++   P V   LK   VLR++
Sbjct: 340 IVISMSTAAFDSIQSAMVSTASNDLFRNKLNIWFIRASVVLLIFPVVVIALKSPSVLRIY 399

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI++L++ ST+P ++LGL+D  Y+    +                +I++ +A+ G  L+ 
Sbjct: 400 LISNLVSTSTIPVLVLGLMDRFYWWRGFEVVVGGLGGLLSVFVFGTIYFGDAEQGANLLI 459

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           +  GL+  D+SV GAF+ AP+ SI + F +  VRL   +V  K++G  F    +P  +  
Sbjct: 460 IDSGLFANDWSVFGAFVAAPVGSILWGFGALAVRLGYRFVEAKVKGHRFDALDRPAYMQE 519

Query: 420 KKYAGNKFKDDTEIIQSSDP 439
           +      + DD + + S  P
Sbjct: 520 RAEGVTDYVDDHDEVHSDAP 539



>gi|367041970|ref|XP_003651365.1| hypothetical protein THITE_2111546 [Thielavia terrestris NRRL 8126]
 gi|346998627|gb|AEO65029.1| hypothetical protein THITE_2111546 [Thielavia terrestris NRRL 8126]
          Length = 538

 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 170/450 (37%), Positives = 271/450 (60%), Gaps = 17/450 (3%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP+IR+KCPEGF LT++  +R+G F  +Y+S M++  +F +M+S
Sbjct: 82  VYALSSALPLLIFAALGPIIRRKCPEGFVLTEWTRQRYGTFAALYLSFMTLVTLFLYMVS 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LTG+D L  +I   IVTT+YT  GG + S  TDNIQG            
Sbjct: 142 ELSAIGQVVNLLTGLDGLPVLIVECIVTTVYTSMGGFKISFFTDNIQGAMVLGLILIATI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+ S+ID+S L K++ LGWQLLYI+PVA+     F   FW R F+SK DR+L 
Sbjct: 202 TIGVETKIDTSLIDSSGLTKASLLGWQLLYILPVAILTNDFFLSNFWLRTFASKTDRDLW 261

Query: 181 L---SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG--EENLESYLAFFTLFKVLPDWVSG 235
           L    AV G+++   ++  +G TG++A WAG+WPG  ++ ++  +AFF L + LP WV G
Sbjct: 262 LGISGAVVGTLI---IVTLVGATGLVAAWAGIWPGPADDPVDGSVAFFALLEQLPSWVVG 318

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 295
           I +V++V++S AA+D+L SA   + SND+F NRL + + R   ++  +P V   ++   +
Sbjct: 319 IVLVMSVTLSTAAFDSLQSAMVTSASNDLFRNRLNIWLIRAGVVLVMIPVVVIAIRAPSI 378

Query: 296 LRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGI 355
           L+++LI+DL++A+++P +++GL D+ Y+    +                +++Y NA+ G 
Sbjct: 379 LQIYLISDLVSAASIPVLMIGLCDACYWWRGFEVVVGGLGGLFTVFLFGTVYYGNAQLGA 438

Query: 356 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP- 414
           EL+ L  GLY  D+   GAF+ AP+  + + F + G+RL   ++  + +GE F    +P 
Sbjct: 439 ELMLLEQGLYTADWGAFGAFVAAPVGGLLWGFGALGLRLGIQYIRARAKGERFDALDRPL 498

Query: 415 ------EVVDTKKYAGNKFKDDTEIIQSSD 438
                  VVD +      F +++EI  SSD
Sbjct: 499 ATGGPRPVVDPEVGGNAGFGEESEI--SSD 526



>gi|239613852|gb|EEQ90839.1| urea transporter [Ajellomyces dermatitidis ER-3]
 gi|327349966|gb|EGE78823.1| urea transporter [Ajellomyces dermatitidis ATCC 18188]
          Length = 520

 Score =  307 bits (786), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 158/408 (38%), Positives = 244/408 (59%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL VF +LGP+IR+KCPEGF LT++  +R+G     Y+SL+++  +F +M++
Sbjct: 47  VYGLASSLPLLVFGYLGPIIRRKCPEGFVLTEWARQRYGIVAATYLSLLTLITLFLYMVA 106

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDN+QG            
Sbjct: 107 ELSALQQIITALTGLDGLPVVIVEVAVTTIYTSLGGFKVSFVTDNLQGAMVVGLIIIAVI 166

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              T + I+++++++S  L+ + LGWQL+YI+P+A+     F   FW R F+SK DR+LR
Sbjct: 167 TVGTEVNIDRALVESSGFLEPSLLGWQLIYILPIAILTNDFFLSNFWLRTFASKTDRDLR 226

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S  +F +L  +G++G++A W+G WPG+      +AFF L + LP WV GI +V+
Sbjct: 227 IGVSIASGAIFCILTLVGVSGLLAAWSGAWPGDPPQLGSIAFFLLLEKLPAWVVGIVLVM 286

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P +   L    VL++FL
Sbjct: 287 TVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVIVVALMSPSVLQIFL 346

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS++P ++ GL D +Y+    +                +I+Y +A  G +LI L
Sbjct: 347 ISDLVSASSIPVLVFGLWDKVYWWTGFEVVVGGLGGIFSVFIFGTIYYGDAHAGAKLILL 406

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
             GLY  D+SV GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 407 ENGLYAKDWSVFGAFLAAPLGGILFAIAALILRLGYHYLLAKSQHRRF 454



>gi|440469250|gb|ELQ38367.1| urea transport protein [Magnaporthe oryzae Y34]
 gi|440486720|gb|ELQ66559.1| urea transport protein [Magnaporthe oryzae P131]
          Length = 537

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 167/445 (37%), Positives = 256/445 (57%), Gaps = 3/445 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP IR KCPEGF LT++  ER+G+   +Y+S MS+  +F +M++
Sbjct: 82  VYALSSALPLLIFAALGPKIRNKCPEGFVLTEWTRERYGKVTALYLSFMSLVTLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLT ++ L  +I   IVTT YT  GG + S +TDN+QG            
Sbjct: 142 ELSAIGQVISTLTTMNPLPVMIVQCIVTTAYTSMGGFKISFLTDNVQGAMVLGLILIATI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 RI+ ++ID+S L K   LGWQLLYI+PVA+     F   FW R F+SK D++L 
Sbjct: 202 AIGVETRIDLALIDSSGLTKPTLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDKDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     +  +  +L  +G+TG++AVW+G WPG +N +  +AFF L + LP+WV G+ +++
Sbjct: 262 IGISLATGAILCILTLVGVTGLVAVWSGAWPGPDNADGSVAFFMLLQQLPNWVVGMVLLM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +   L+   +L+++L
Sbjct: 322 AVTLSTAAFDSLQSAMVSSASNDLFRNRLGVWPIRAAVVLVMIPVIVIALRAPSILQIYL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
           I+DL++AST+P ++LGL D  YF  W   D                + +Y +A+ G ELI
Sbjct: 382 ISDLVSASTIPVLVLGLSDH-YFYWWRGFDVVCGGLGGILSVFIFGTAYYGSAQAGGELI 440

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVD 418
            L  GLY  D+ V GAF+ AP   + F FL+   R+  ++V  K+ G  F    +P    
Sbjct: 441 LLQQGLYTGDWGVFGAFVAAPAGGLIFAFLAMLGRVGFLFVRAKMIGAPFTAFDRPMAEV 500

Query: 419 TKKYAGNKFKDDTEIIQSSDPDEIE 443
                     +D E+ +     E E
Sbjct: 501 ALPARAEPEYEDGELREEDSITEQE 525



>gi|389637038|ref|XP_003716160.1| urea transporter [Magnaporthe oryzae 70-15]
 gi|351641979|gb|EHA49841.1| urea transporter [Magnaporthe oryzae 70-15]
          Length = 511

 Score =  305 bits (782), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 167/445 (37%), Positives = 256/445 (57%), Gaps = 3/445 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP IR KCPEGF LT++  ER+G+   +Y+S MS+  +F +M++
Sbjct: 56  VYALSSALPLLIFAALGPKIRNKCPEGFVLTEWTRERYGKVTALYLSFMSLVTLFLYMVA 115

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLT ++ L  +I   IVTT YT  GG + S +TDN+QG            
Sbjct: 116 ELSAIGQVISTLTTMNPLPVMIVQCIVTTAYTSMGGFKISFLTDNVQGAMVLGLILIATI 175

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 RI+ ++ID+S L K   LGWQLLYI+PVA+     F   FW R F+SK D++L 
Sbjct: 176 AIGVETRIDLALIDSSGLTKPTLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDKDLW 235

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     +  +  +L  +G+TG++AVW+G WPG +N +  +AFF L + LP+WV G+ +++
Sbjct: 236 IGISLATGAILCILTLVGVTGLVAVWSGAWPGPDNADGSVAFFMLLQQLPNWVVGMVLLM 295

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +   L+   +L+++L
Sbjct: 296 AVTLSTAAFDSLQSAMVSSASNDLFRNRLGVWPIRAAVVLVMIPVIVIALRAPSILQIYL 355

Query: 301 IADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
           I+DL++AST+P ++LGL D  YF  W   D                + +Y +A+ G ELI
Sbjct: 356 ISDLVSASTIPVLVLGLSDH-YFYWWRGFDVVCGGLGGILSVFIFGTAYYGSAQAGGELI 414

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVD 418
            L  GLY  D+ V GAF+ AP   + F FL+   R+  ++V  K+ G  F    +P    
Sbjct: 415 LLQQGLYTGDWGVFGAFVAAPAGGLIFAFLAMLGRVGFLFVRAKMIGAPFTAFDRPMAEV 474

Query: 419 TKKYAGNKFKDDTEIIQSSDPDEIE 443
                     +D E+ +     E E
Sbjct: 475 ALPARAEPEYEDGELREEDSITEQE 499



>gi|440633300|gb|ELR03219.1| hypothetical protein GMDG_01202 [Geomyces destructans 20631-21]
          Length = 530

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 258/445 (57%), Gaps = 12/445 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S  PL VFA LGP+IR KCPEGF LT++  +R+G    +++S +++  MF +M++
Sbjct: 82  VYAVSSAAPLMVFAILGPIIRNKCPEGFILTEWTRQRYGVVTAMFLSFLTLVTMFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG+D L  +I  A+VTT+YT  GG + S ITDNIQ             
Sbjct: 142 ELSAMQQIVGALTGMDGLPAIIVQAVVTTIYTSLGGFKISFITDNIQAVMVFFLVTVATI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  +++S++D+S LL +  LGWQLLYI+PVAV     F   FW R F+S+ D++L 
Sbjct: 202 TIGVKTNVDRSLVDSSGLLNATLLGWQLLYILPVAVLTNDFFLSNFWIRTFASRTDKDLF 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     S ++  +L  +G+TG++AVW G L PGE+     +AFF L + LP WV GI +V
Sbjct: 262 IGVSSASAIVLVILTLVGVTGLLAVWTGALAPGEDG---SIAFFLLLETLPSWVVGIVLV 318

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           + V++S AA+D+  SA  ++ SND+F N+L + V R   +    P V   LK   +L+++
Sbjct: 319 MTVTLSTAAFDSFQSAMVSSASNDLFGNKLNIWVIRAGIVALIFPVVVIALKAPSILQIY 378

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI+DL++AST+P +++GL D  Y+    +                +I++ NA DG +LI 
Sbjct: 379 LISDLVSASTIPVLVIGLSDRFYWWRGFEVVIGGLGGILTVFIFGTIYFGNALDGAKLIL 438

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF------VFPKK 413
           L  GLY  D+SV GAF+ AP   + + F +  VRL   W+  KI+G+ F       +  +
Sbjct: 439 LEGGLYANDWSVFGAFVAAPFGGLLWGFGALVVRLGFQWLIAKIKGQRFDSLDKPDYLTR 498

Query: 414 PEVVDTKKY--AGNKFKDDTEIIQS 436
           P +VD  +Y   G+    D E I S
Sbjct: 499 PRIVDANEYTDGGDITAADEEFITS 523



>gi|258573539|ref|XP_002540951.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237901217|gb|EEP75618.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 463

 Score =  302 bits (774), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 176/454 (38%), Positives = 263/454 (57%), Gaps = 9/454 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL  F +LGP+IRKKCPEGF LT++  +R+G    +Y+SL+++  +F +M++
Sbjct: 3   VYGLSSSLPLLAFGYLGPIIRKKCPEGFVLTEWTRQRYGVAAAMYLSLLTLITLFLYMVA 62

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDNIQG            
Sbjct: 63  ELSALQQIVNALTGLNGLPAVIVQVVVTTIYTSLGGFKVSFMTDNIQGAMVVGLIIIGVI 122

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              T  +I +S+ID+S LL+ + LGWQL+YI+PVA+     F   FW R F+SK DR+LR
Sbjct: 123 TVGTKTQINRSLIDSSGLLEPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDRDLR 182

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV GI +V+
Sbjct: 183 IGVSIASFTVLCILVLVGSTGLLAAWSGAWPGDPPQSGSIAFFLLLEKLPGWVVGIVLVM 242

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S AA+D+L SA  +  SND+F N+L L   R   ++  VP V   LK   VL++FL
Sbjct: 243 TVALSTAAFDSLQSAMVSTASNDLFRNKLSLIYIRIGVVLCIVPVVVVALKSPSVLQIFL 302

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P +++ L D  YF    +                +I+Y +A +G  LI L
Sbjct: 303 ISDLVSASAIPVLVISLWDKCYFWKGSEVIAGGLGGILSIFIFGTIYYGSAYEGGRLILL 362

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP------ 414
             GLY  D+SV GAF+ AP+    F  ++F +R+   +V +K+RGE F    KP      
Sbjct: 363 ENGLYADDWSVFGAFVAAPVGGFIFALIAFALRIAYQFVVSKVRGEHFDAFDKPIKPVRT 422

Query: 415 --EVVDTKKYAGNKFKDDTEIIQSSDPDEIEIRG 446
             +V D  +  GN  +D+ +  Q+  P     RG
Sbjct: 423 TSQVDDPIRPVGNA-RDEEDGKQNDSPAVEADRG 455



>gi|71017739|ref|XP_759100.1| hypothetical protein UM02953.1 [Ustilago maydis 521]
 gi|46098892|gb|EAK84125.1| hypothetical protein UM02953.1 [Ustilago maydis 521]
          Length = 503

 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 168/409 (41%), Positives = 252/409 (61%), Gaps = 3/409 (0%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y F ++ PL+ FAWLGP IR+ CP+GFTL +++  RFG    +   L+ + +MFCFM+ E
Sbjct: 26  YCFATVAPLWFFAWLGPQIRRICPDGFTLAEYIRRRFGWPVGVLSGLIFVGFMFCFMLVE 85

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+  G+ +  L GV+     + IAI+TT+YT YGG +ASL TDN+               
Sbjct: 86  LNTYGSAVNLLGGVNPTIAALVIAIITTIYTTYGGFKASLYTDNVNAIIILIFIVIASIA 145

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
               + I+ + +++S LLK   LG +L YI+P A+ F+ +F++GFWQRAF+SK+++ L +
Sbjct: 146 VGVKLDIDHARVESSGLLKPQRLGGELWYILPAALIFSQMFNQGFWQRAFASKDNKTLYI 205

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLESYLAFFTLFKVLPDWVSGITVV 239
           S +  +I LF V + +G+ G +A W+GL+  P  E+ +  L FF +   LP+W++GI +V
Sbjct: 206 SVICATIPLFAVCMLVGMAGPLAWWSGLFNGPTAED-DGSLNFFYILGTLPNWLTGIVIV 264

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           L   +S +AYDT  SA  +   ND+F  R+ +   R + ++ N+P+V   +K++D+L VF
Sbjct: 265 LCGCLSSSAYDTFQSAQISTIQNDVFLGRVNIWWCRAILILINIPSVVLAVKNIDILEVF 324

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LIADL A + +P  LLGL+  LYFLN +D                +IF+ +A  GI LIG
Sbjct: 325 LIADLAAIACIPAFLLGLVPRLYFLNGVDAVGGAVGGFLTVFLFGTIFFGSASQGIALIG 384

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
           LP GLYI DYSVLGAFI APL S+ +TF++  +R    WV+ K  G +F
Sbjct: 385 LPNGLYIDDYSVLGAFIAAPLGSLGWTFVTCAIRAAVTWVWCKKTGRKF 433



>gi|171676089|ref|XP_001902998.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936110|emb|CAP60770.1| unnamed protein product [Podospora anserina S mat+]
          Length = 504

 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/440 (37%), Positives = 254/440 (57%), Gaps = 6/440 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PLF FAWLGP+IRKKCP+GF LT++  +R+G    +++S M++  +F +M+S
Sbjct: 43  VYALSSALPLFAFAWLGPIIRKKCPQGFVLTEWTRQRYGDAAALFLSFMTLVTLFLYMVS 102

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSAVG ++  L G+D L  +I   I+TT+YT  GG + S  TDNIQG            
Sbjct: 103 ELSAVGQVVNMLAGIDGLPVLIVECIITTIYTSLGGFKISFFTDNIQGTMVMALVVIATI 162

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+ S+I+ S LLK N LGWQL+YI+PVA+   + F   FW R F+SK DR+L 
Sbjct: 163 SIGVETKIDTSLIEESGLLKGNLLGWQLVYILPVALLTNSFFLSHFWLRTFASKTDRDLW 222

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGIT 237
                  + +  + V +G TG++AVWAGL PG   E  ++  +AFF L + LP+WV GI 
Sbjct: 223 TGISLAVVAILVIFVLVGCTGLVAVWAGLVPGDDLENPVDGGIAFFALLQQLPNWVVGIV 282

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +V++V++S AA+D+  +A   + SND+F NRL +   R   ++  VP V   ++   +L+
Sbjct: 283 IVMSVTLSTAAFDSFQTAMVTSASNDLFRNRLNIWWIRAGVVVIMVPVVVIAIRAPSILQ 342

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           ++LI DL++A+T+P + LGL +  YF    +                 ++Y +A+ G EL
Sbjct: 343 IYLITDLVSAATIPVLCLGLSEKFYFWRGFEVVVGGLGGLFTVFLFGLVYYQDAQKGAEL 402

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 417
           + L  GL+  D+   GAF+ AP+  I + F + G+RL   +   K +G  F    KP VV
Sbjct: 403 LLLQQGLFTGDWGCFGAFVAAPVGGILWGFGALGLRLSIQYFSAKRKGVRFDALDKPFVV 462

Query: 418 DTKKYAGNKFKDDTEIIQSS 437
           D  +    +   DT+ + S 
Sbjct: 463 DGGQ---QQLVGDTQHVDSG 479



>gi|512203105|gb|EPE31930.1| hypothetical protein GLAREA_12012 [Glarea lozoyensis ATCC 20868]
          Length = 488

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 169/434 (38%), Positives = 254/434 (58%), Gaps = 1/434 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S  PL +FAWLGP+IR KCP GF LT++  +R+G    +Y+S +S+A MF +M++
Sbjct: 37  VYAVSSAAPLLIFAWLGPIIRSKCPGGFVLTEWTRQRYGVVAALYISFLSMATMFLYMVA 96

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG+D L  VI   +V T+YT  GG + S ITDNIQG            
Sbjct: 97  ELSALQQIMTALTGMDGLPMVIVQCVVATIYTSLGGFKISFITDNIQGAMVVCLIIIATI 156

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+ S+ID+S L +++ LGWQLLYI+PVAV     F   FW RAF+SK D++L 
Sbjct: 157 TIGVKTDIDTSLIDSSGLTQASLLGWQLLYILPVAVLTNDFFLSNFWIRAFASKTDKDLW 216

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     ++++  +L  +G TG+IAVW+G L P +      +AFF L + LP WV GI +V
Sbjct: 217 IGISIAAVVVLIILTLIGCTGLIAVWSGALGPDDIESSGSIAFFLLLERLPAWVVGIVLV 276

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           + VS+S AA+D+  SA  +  SND+F N+L +   R   ++  VP +   LK   +L+++
Sbjct: 277 MVVSLSTAAFDSFQSAMVSMGSNDLFRNKLNIWFIRAAVVLLIVPVIILALKAPSILQIY 336

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI+DL +AS++P ++LGL D  Y+    +                +I+Y NA+ G +LI 
Sbjct: 337 LISDLFSASSIPVLILGLSDRFYWWRGFEVVVGGLGGIITVFIFGTIYYGNAQAGADLIL 396

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           L  GLY  D+SV GAF+ AP+  + + F +F VR+   ++F KI G  F    +P  ++ 
Sbjct: 397 LEGGLYANDWSVFGAFVAAPVGGLLWGFGAFVVRIAFQFIFAKITGRHFGALDRPAYLNR 456

Query: 420 KKYAGNKFKDDTEI 433
           +     ++ D  EI
Sbjct: 457 RVMGAPEYADSDEI 470



>gi|315047150|ref|XP_003172950.1| hypothetical protein MGYG_09089 [Arthroderma gypseum CBS 118893]
 gi|311343336|gb|EFR02539.1| hypothetical protein MGYG_09089 [Arthroderma gypseum CBS 118893]
          Length = 536

 Score =  300 bits (769), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 254/443 (57%), Gaps = 1/443 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL  FA++GP+IRKK PE F LT++  +R+G    IY+S++++  +F +M++
Sbjct: 82  VYGLSSALPLLAFAFVGPIIRKKFPEVFVLTEWTRQRYGVVAGIYLSILTLITLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDNIQG            
Sbjct: 142 ELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFKVSFLTDNIQGAMVVGLIIIAVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W R F+SK DR+LR
Sbjct: 202 TVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLWLRTFASKTDRDLR 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S ++  +LV +G TG++A W+G+WPG+      +AFF L + LP WV GI +V+
Sbjct: 262 IGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLEKLPSWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V   L+   VLR+FL
Sbjct: 322 TVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIIPVVVVALRSPSVLRIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P ++LGL D  Y+    +                +I+Y NA DG  LI L
Sbjct: 382 ISDLVSASAIPVLVLGLSDKFYWWTAFEVIVGGLGGILSVFIFGTIYYGNATDGGNLILL 441

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+S  GAF+ AP+  + F  L+ G+R+   ++ +K  G  F     P +  + 
Sbjct: 442 QNGLYANDWSAFGAFVAAPVGGLIFACLALGLRVGYKFILSKTTGRHFDVFDLP-LPRSH 500

Query: 421 KYAGNKFKDDTEIIQSSDPDEIE 443
             AG    D+ E I +     I 
Sbjct: 501 MAAGPMHLDEPEFIATGTDATIR 523



>gi|367021828|ref|XP_003660199.1| hypothetical protein MYCTH_2298205 [Myceliophthora thermophila ATCC
           42464]
 gi|347007466|gb|AEO54954.1| hypothetical protein MYCTH_2298205 [Myceliophthora thermophila ATCC
           42464]
          Length = 542

 Score =  300 bits (767), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 167/446 (37%), Positives = 264/446 (59%), Gaps = 10/446 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL  FA LGP+IR+KCP+GF LT++  +R+G    +Y+S M++  +F +MIS
Sbjct: 87  VYALASALPLLSFAALGPIIRRKCPQGFVLTEWTRQRYGTLAALYLSFMTLVTLFLYMIS 146

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LTG+D L  +I   ++TT+YT  GG + S  TDNIQG            
Sbjct: 147 ELSAIGQVVNLLTGIDGLPVLIVECVITTIYTSVGGFKVSFFTDNIQGAMVLGLILIATI 206

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+ S+I++S L K++ LGWQLLYI+PVA+     F   FW R FS+K DR+L 
Sbjct: 207 TIGVETKIDTSLIESSGLTKASLLGWQLLYILPVAILTNDFFLSNFWLRTFSAKTDRDLW 266

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN--LESYLAFFTLFKVLPDWVSGITV 238
           L      +    ++  +G TG+IA WAG+WPG E+  ++  +AFF L   LP+WV G+ V
Sbjct: 267 LGITGAVVATLVIITLVGSTGLIAAWAGVWPGPEDAPVDGSVAFFALLTQLPNWVVGVVV 326

Query: 239 VLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRV 298
           V++V++S AA+D+L SA   + SND+F NRL +   R   ++  +P V   ++   +L++
Sbjct: 327 VMSVTLSTAAFDSLQSAMVTSASNDLFRNRLNIWWIRAGVVLIMIPVVVIAIRAPSILQI 386

Query: 299 FLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
           +LI+DL++A+T+P +++GL D+ Y+    +                +++Y +A+ G EL+
Sbjct: 387 YLISDLVSAATIPVLVIGLSDACYWWRGFEVVVGGLGGLFTVFLFGTVYYGDAQLGAELM 446

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF------VFPK 412
            L  GLY  D+   GAF+ AP+  + + F + G+RL   +V  ++RG+ F      V   
Sbjct: 447 LLEQGLYTADWGAFGAFVAAPVGGLLWGFGALGLRLGIQYVSARLRGQRFDALDRPVAVS 506

Query: 413 KPEVVDTKKYAGNKFKDDTEIIQSSD 438
            P++VD +        D+TEI  SSD
Sbjct: 507 GPQLVDPEAGRDGGTWDNTEI--SSD 530



>gi|320590557|gb|EFX03000.1| urea transport protein [Grosmannia clavigera kw1407]
          Length = 493

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 165/446 (36%), Positives = 249/446 (55%), Gaps = 14/446 (3%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P+F+FA LGP+IR+KCPEGF LT++  +R+G    I++  +++A +F +M++
Sbjct: 36  VYALASALPMFIFAALGPIIRRKCPEGFVLTEWTRQRYGIPATIFLGFVTLATLFLYMMA 95

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LTG+D L  VI   IVTT+YT  GG   S +TDNIQG            
Sbjct: 96  ELSAIGQVVTALTGLDGLPAVIVECIVTTIYTAIGGFHISFVTDNIQGAMVLGLIVIATI 155

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++S I  S LLK N LGWQLLYI+PVA+     F   FW R F+S+ DR+L 
Sbjct: 156 AIGAETHIDRSTIAESGLLKGNLLGWQLLYILPVAILTNDFFLSNFWLRTFASRTDRDLW 215

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG----EENLESYLAFFTLFKVLPDWVSGI 236
           +     +  +  +   +G TG++AVW+G WPG      + +S  AFF L ++LP+WV G 
Sbjct: 216 IGISIAAAAILVIATLVGCTGLVAVWSGAWPGAGQDASDADSSTAFFNLLQLLPNWVVGF 275

Query: 237 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 296
            +V+++S+S A++D+L SA  ++ SNDIF NRL     R    I  VP V   L+   VL
Sbjct: 276 VLVMSISLSTASFDSLQSAMVSSASNDIFRNRLSSIYIRIAVAIVIVPTVVLALRTPSVL 335

Query: 297 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIE 356
           +++LI+DL++A+ +P +++GL D     N  D                +I+Y +A  G +
Sbjct: 336 QIYLISDLVSAAIIPVLVVGLSDRCSAWNGTDVVVGGLGGLLAVFAFGAIYYQDAYSGAK 395

Query: 357 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF-VFPKKPE 415
           L+ L  GLY  D+   GAF+ AP+  + F   SF +R+  +++  +  G  F    K  +
Sbjct: 396 LLLLEQGLYEGDWGAFGAFVAAPIGGVLFGLASFLLRMAYLYIRARATGRPFDPVSKGKQ 455

Query: 416 VVDTK--------KYAGN-KFKDDTE 432
            V T          Y G  +  DD E
Sbjct: 456 AVGTSVVEEPVLDPYVGQPELHDDEE 481



>gi|336463537|gb|EGO51777.1| hypothetical protein NEUTE1DRAFT_125428 [Neurospora tetrasperma
           FGSC 2508]
          Length = 564

 Score =  298 bits (762), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 162/446 (36%), Positives = 260/446 (58%), Gaps = 13/446 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PLFVFA LGP+IR+KCPEGF LT++  +R+G    +Y+S +++  +F +M++
Sbjct: 110 VYALASALPLFVFALLGPIIRRKCPEGFVLTEWTRQRYGTIAALYLSFVTLVTLFLYMVA 169

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELS +G ++  LTG++ L  +I   ++TT+YT  GG R S ITDNIQG            
Sbjct: 170 ELSGIGQVVEVLTGLNGLPVLIVECVITTIYTSLGGFRISFITDNIQGAMVIGLLVVASI 229

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+ S+I+ S LLK + LGWQLLYI+PVA+     F   FW R F+SK DR+L 
Sbjct: 230 AIGVETKIDTSLIEPSGLLKDSLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDRDLW 289

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGIT 237
           +     ++ +  ++  +G TG+IA W+G+WPG   E  L   +AFF L + LP WV G  
Sbjct: 290 IGITLAALFILIIITMIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGLLENLPAWVVGFV 349

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +V++V++S AA+D+L SA  ++ SND+F N+L +   R   ++  +P V   +K   +L+
Sbjct: 350 LVMSVTLSTAAFDSLQSAMVSSASNDLFRNKLSVWWIRVAVVLIIIPIVVLAIKAPSILQ 409

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           ++LI+DL++A+T+P +++GL D  Y+    +                +I+Y++A  G +L
Sbjct: 410 IYLISDLVSAATIPVLIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYNDAYKGAQL 469

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 417
           I L  G+Y   ++  GAF+ AP+  + + F +  +RL   WV  K +G  F    +P VV
Sbjct: 470 ILLEDGIYQEGWAAFGAFVAAPVGGLLWGFGALALRLTVQWVQAKRKGVRFDALDRPVVV 529

Query: 418 DTKKYAGNKFKDDTEIIQSSDPDEIE 443
           ++          D+E IQ     ++E
Sbjct: 530 ES----------DSEAIQYVAGGDLE 545



>gi|350297242|gb|EGZ78219.1| hypothetical protein NEUTE2DRAFT_154667 [Neurospora tetrasperma
           FGSC 2509]
          Length = 564

 Score =  297 bits (761), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 162/446 (36%), Positives = 260/446 (58%), Gaps = 13/446 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PLFVFA LGP+IR+KCPEGF LT++  +R+G    +Y+S +++  +F +M++
Sbjct: 110 VYALASALPLFVFALLGPIIRRKCPEGFVLTEWTRQRYGTIAALYLSFVTLVTLFLYMVA 169

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELS +G ++  LTG++ L  +I   ++TT+YT  GG R S ITDNIQG            
Sbjct: 170 ELSGIGQVVEVLTGLNGLPVLIVECVITTIYTSLGGFRISFITDNIQGAMVIGLLVVASI 229

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+ S+I+ S LLK + LGWQLLYI+PVA+     F   FW R F+SK DR+L 
Sbjct: 230 AIGVETKIDTSLIEPSGLLKDSLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDRDLW 289

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGIT 237
           +     ++ +  ++  +G TG+IA W+G+WPG   E  L   +AFF L + LP WV G  
Sbjct: 290 IGITLAALFILIIITMIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGLLENLPAWVVGFV 349

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +V++V++S AA+D+L SA  ++ SND+F N+L +   R   ++  +P V   +K   +L+
Sbjct: 350 LVMSVTLSTAAFDSLQSAMVSSASNDLFRNKLSVWWIRVAVVLVIIPIVVLAIKAPSILQ 409

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           ++LI+DL++A+T+P +++GL D  Y+    +                +I+Y++A  G +L
Sbjct: 410 IYLISDLVSAATIPVLIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYNDAYKGAQL 469

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 417
           I L  G+Y   ++  GAF+ AP+  + + F +  +RL   WV  K +G  F    +P VV
Sbjct: 470 ILLEDGIYQEGWAAFGAFVAAPVGGLLWGFGALALRLAVQWVQAKRKGVRFDALDRPVVV 529

Query: 418 DTKKYAGNKFKDDTEIIQSSDPDEIE 443
           ++          D+E IQ     ++E
Sbjct: 530 ES----------DSEAIQYVAGGDLE 545



>gi|322709553|gb|EFZ01129.1| urea transporter [Metarhizium anisopliae ARSEF 23]
          Length = 510

 Score =  297 bits (761), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 162/436 (37%), Positives = 260/436 (59%), Gaps = 2/436 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P+ +F  LGP+IR+KCPEGF LT++  +R+G    +Y+S M++  +F +M++
Sbjct: 71  IYALASALPMLIFGALGPIIRRKCPEGFVLTEWTRQRYGTVAMLYLSFMTLVTLFLYMVA 130

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLTG+D L  +I   ++TT+YT  GG + S +TD +QG            
Sbjct: 131 ELSALGQVVSTLTGIDSLPVIIVECVITTIYTSLGGFKISFLTDVVQGGMVVGLIIIATI 190

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++ +ID+S LL+ + LGWQLLYI+PVAV     F   FW R FSSK+D++L 
Sbjct: 191 TVGAKTEIKRELIDSSHLLEPSLLGWQLLYILPVAVLTNDFFLSNFWLRTFSSKSDKDLW 250

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +      +++  +L  +G +G+IA W+G WPGE   E  LAFF L + LP WV GI +V+
Sbjct: 251 VGVSVAMVVILCILTLVGCSGLIAAWSGAWPGEPEQEGSLAFFLLLQQLPSWVVGIILVM 310

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S AA+D+L SA  ++ SND+F NRL +   R + ++  +P V   L+   +L+++L
Sbjct: 311 VVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWYIRGMVVLIIIPVVVVALRASSILQIYL 370

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DLL+A+T+P + LGL D LY+    +                +I+Y +A+ G +L+ +
Sbjct: 371 ISDLLSAATIPVLCLGLSDRLYWWRGFEVVVGGLGGILTVFIFGAIYYKDAEQGAQLLLI 430

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+S  GAF+ AP+  I + F +  +RL   ++  ++R E F    +P  + T+
Sbjct: 431 QNGLYANDWSAFGAFVAAPVGGIVWGFGALALRLSFQYIKARLRRERFDALDRP--LMTR 488

Query: 421 KYAGNKFKDDTEIIQS 436
             + ++  D+  I  S
Sbjct: 489 TVSDSEMPDEVVIASS 504



>gi|500255736|gb|EON99074.1| putative urea transporter protein [Togninia minima UCRPA7]
          Length = 515

 Score =  297 bits (761), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 166/438 (37%), Positives = 256/438 (58%), Gaps = 1/438 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL VFA+LGP+IR+KCPEGF LT++  +R+G    +++S +++  +F +M++
Sbjct: 67  VYALSSALPLLVFAFLGPIIRRKCPEGFVLTEWTRQRYGIVTALFLSFLTLVTLFLYMVA 126

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSAVG ++ TLTG+D L  VI   +VTT+YT  GG + S ITDNIQG            
Sbjct: 127 ELSAVGQVVTTLTGLDGLPVVIVECVVTTIYTSLGGFQISFITDNIQGALVVGLVIIATI 186

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++ +ID+S LLK N LGWQLLYI+P+A+     F   FW R F+SK D++LR
Sbjct: 187 TIGVKTDIDQDLIDSSGLLKGNLLGWQLLYILPIAILTNDFFLSNFWLRTFASKTDKDLR 246

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     + ++  +L  +G+TG++A W+G WPG+   E  +AFF L + LP WV GI +V+
Sbjct: 247 IGVSIATCVILVILTLVGMTGVLAAWSGAWPGDPPQEGSIAFFLLLEQLPSWVVGIVLVM 306

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V +S A++D+L SA  ++ SND+F NRL +   R   ++  +P V   LK   +L+++L
Sbjct: 307 VVCLSTASFDSLQSAMVSSASNDLFRNRLNIWFIRGAVVLIIIPVVVLALKAPSILQIYL 366

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++A+T+P + LGL D LY+    +                +I+Y +A  G +L+ L
Sbjct: 367 ISDLVSAATIPVLCLGLSDRLYWWRGFEIVVGGLGGILTVFIFGTIYYGDALTGAQLMLL 426

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+   GAF+ AP+  + + F    +RL    V  K+ G  F    +P  +   
Sbjct: 427 EQGLYEGDWGAFGAFVAAPVGGLLWGFGGCALRLAFQLVKAKVTGRRFDALDRPAFLSAD 486

Query: 421 KYAGN-KFKDDTEIIQSS 437
           + AG     DD + +  S
Sbjct: 487 EGAGAYGSADDADALYQS 504



>gi|164429597|ref|XP_964341.2| hypothetical protein NCU11204 [Neurospora crassa OR74A]
 gi|157073543|gb|EAA35105.2| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 542

 Score =  297 bits (761), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 162/446 (36%), Positives = 260/446 (58%), Gaps = 13/446 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PLFVFA LGP+IR+KCPEGF LT++  +R+G    +Y+S +++  +F +M++
Sbjct: 88  VYALASALPLFVFALLGPIIRRKCPEGFVLTEWTRQRYGTIAALYLSFVTLVTLFLYMVA 147

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELS +G ++  LTG++ L  +I   ++TT+YT  GG R S ITDNIQG            
Sbjct: 148 ELSGIGQVVEVLTGLNGLPVLIVECVITTIYTSLGGFRISFITDNIQGAMVIGLLVVASI 207

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+ S+I+ S LLK + LGWQLLYI+PVA+     F   FW R F+SK DR+L 
Sbjct: 208 AIGVETKIDTSLIEPSGLLKDSLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDRDLW 267

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGIT 237
           +     ++ +  ++  +G TG+IA W+G+WPG   E  L   +AFF L + LP WV G  
Sbjct: 268 IGITLAALFILIIITMIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGLLENLPAWVVGFV 327

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +V++V++S AA+D+L SA  ++ SND+F N+L +   R   ++  +P V   +K   +L+
Sbjct: 328 LVMSVTLSTAAFDSLQSAMVSSASNDLFRNKLSVWWIRVAVVLIIIPIVVLAIKAPSILQ 387

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           ++LI+DL++A+T+P +++GL D  Y+    +                +I+Y++A  G +L
Sbjct: 388 IYLISDLVSAATIPVLIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYNDAYKGAQL 447

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 417
           I L  G+Y   ++  GAF+ AP+  + + F +  +RL   WV  K +G  F    +P VV
Sbjct: 448 ILLEDGIYQEGWAAFGAFVAAPVGGLLWGFGALALRLAVQWVQAKRKGVRFDALDRPVVV 507

Query: 418 DTKKYAGNKFKDDTEIIQSSDPDEIE 443
           ++          D+E IQ     ++E
Sbjct: 508 ES----------DSEAIQYVAGGDLE 523



>gi|154286680|ref|XP_001544135.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150407776|gb|EDN03317.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 485

 Score =  296 bits (759), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 163/408 (39%), Positives = 246/408 (60%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL VF +LGP+IR+KCPEGF LT++  +R+G    IY+S++++  +F +M++
Sbjct: 12  VYGLASALPLLVFGYLGPIIRRKCPEGFVLTEWARQRYGIVAGIYLSILTLITLFLYMVA 71

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG            
Sbjct: 72  ELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVGLIVIAVI 131

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+SK DR+LR
Sbjct: 132 TVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDRDLR 191

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S  +F +L  +G+TG++A W+G WPG+      +AFF L + LP WV GI +V+
Sbjct: 192 IGVSLASGAVFCILTLVGVTGLLAAWSGAWPGDPPQLGSIAFFLLLEQLPGWVVGIVLVM 251

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S AA+D+L SA  +  SND+F NRLPL   R L +++ +P V   LK   VL++FL
Sbjct: 252 TVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLSIIPVVVVALKSPSVLQIFL 311

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS++P ++ GL D +Y+    +                +I++ +A  G +LI L
Sbjct: 312 ISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHAGAKLILL 371

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
             GLY  D+S  GAF+ APL    F   +  +RL   ++  K +   F
Sbjct: 372 GNGLYAEDWSAFGAFVAAPLGGTLFGMGALLLRLSYHYLLAKRQHRRF 419



>gi|512188743|gb|EPE04513.1| urea transporter [Ophiostoma piceae UAMH 11346]
          Length = 511

 Score =  295 bits (755), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 255/440 (57%), Gaps = 7/440 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PLFVF+ LGP+IR+KCPEGF LT++  +R+G    I++  +++A +F +M++
Sbjct: 50  VYALSSALPLFVFSALGPIIRRKCPEGFVLTEWTRQRYGVPAAIFLGFLTLATLFLYMVA 109

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLTG+D L  VI   +VTT+YT  GG R S ITDNIQG            
Sbjct: 110 ELSAIGQVVSTLTGLDGLPVVIVECVVTTIYTAVGGFRISFITDNIQGAIVLCMIIIATI 169

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              T   I++  + +S LLKSN LGWQLLYI+PVA+     F   FW R F+S+ D++L 
Sbjct: 170 TVGTKTHIDRQDVIDSGLLKSNLLGWQLLYILPVAILTNDFFLSNFWLRTFASRTDKDLW 229

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLFKVLPDWVSGITVV 239
           L     ++ +  +L  +G  G++AVW+G +   + + +S +AFF L + LP WV GI +V
Sbjct: 230 LGVSMAALAILIILTLVGCGGLVAVWSGAYDMSDPDADSSVAFFLLLEQLPSWVVGIVLV 289

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           ++VS+S AA+D+L SA  ++ SNDIF NRL     R   ++  +P V   LK   +L+++
Sbjct: 290 MSVSLSTAAFDSLQSAMISSASNDIFRNRLSTKWIRGGVVLVIIPIVVLALKAPSILQIY 349

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI+DL++AST+P +++GL +     N  D                +I+Y +A+ G EL+ 
Sbjct: 350 LISDLVSASTIPVLIIGLSNRFPLWNGTDVIIGGLGGLMTVFIFGTIYYGSAQSGAELLL 409

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           L  GLY  D+   GAF+ AP+  + F   SF  R+     +T IR      P +P  ++ 
Sbjct: 410 LEQGLYEGDWGAFGAFVAAPIGGLLFGLASFLARM----AYTYIRARASGRPFQP--LNP 463

Query: 420 KKYAGNKFKDDTEIIQSSDP 439
           + Y       D   I + DP
Sbjct: 464 RAYIIGPDNSDDASIGAFDP 483



>gi|340519811|gb|EGR50049.1| hypothetical protein TRIREDRAFT_3412 [Trichoderma reesei QM6a]
          Length = 520

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 165/414 (39%), Positives = 248/414 (59%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL VFA LGP+IR+KCP+GF LT++   R+G    +Y+S M++  +F +M++
Sbjct: 82  VYALASALPLLVFAALGPMIRRKCPDGFVLTEWTRNRYGTVAMLYLSFMTLVTLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSAVG ++  LTG+D L  +I    VTT+YT  GG R S +TD IQG            
Sbjct: 142 ELSAVGQVVNALTGLDGLPVIIVECAVTTIYTSLGGFRISFLTDVIQGAMVVGLIIIATI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++ +ID+S L K++ +GWQL+YI+PVAV     F   FW R FSSK D++L 
Sbjct: 202 TIGVKAEIDRDLIDSSGLTKASLVGWQLVYILPVAVLTNDFFLSNFWLRTFSSKTDKDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     ++ +  +L  +G TG+IA W G WPGE +++  LAFF L + LP WV GI +V+
Sbjct: 262 VGVSIATVAVLCILTLVGATGLIAAWTGAWPGESDIDGSLAFFALLEQLPSWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S +A+D+L SA  ++ SND+F NRL + + R + ++  +P V   LK   +L++FL
Sbjct: 322 VVSLSVSAFDSLQSAMISSASNDLFRNRLNIWIIRVIVVLVIIPTVVIALKAPSILQIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL +A+T+P + LGL D+ Y+    +                +I+Y +AK G ELI L
Sbjct: 382 ISDLASAATIPALCLGLFDTFYWWRGFEVVVGGLGGILTVFIYGAIYYGDAKSGGELILL 441

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
             GLY  D+   GAF+ AP+  I + F++  +RL   +   K+RGE F    +P
Sbjct: 442 EQGLYAGDWGAFGAFVAAPVGGIIWGFIALALRLSVQFTLAKMRGERFDALDRP 495



>gi|402086111|gb|EJT81009.1| urea transporter [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 533

 Score =  292 bits (747), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 154/416 (37%), Positives = 248/416 (59%), Gaps = 3/416 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP IR++CPEGF LT++  +R+G    +Y+  M++  +F +M++
Sbjct: 82  VYALSSALPLLIFAALGPAIRRRCPEGFVLTEWTRQRYGAVAALYLGFMTLLTLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  ++ TL+ +D L  VI    +TT+YT  GG + S +TDN+QG            
Sbjct: 142 ELSAISQVVTTLSNLDGLPVVIVQCAITTIYTSMGGFKISFLTDNVQGAMVLGLIIIATI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 RI+ ++I++S LL+   LGWQL+YI+PVA+     F   FW R F+SK DR+L 
Sbjct: 202 TIGVETRIDPALIESSGLLQPTLLGWQLVYILPVAILTNDFFLSSFWLRTFASKTDRDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S     +L  +G TG++AVW+G WPG +N +  +AFFTL ++LP+WV GI +V+
Sbjct: 262 IGVGMASAATLCILTLVGTTGLVAVWSGAWPGPDNADGSVAFFTLLQLLPNWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +   L+   +L+++L
Sbjct: 322 AVTLSTAAFDSLQSAMVSSASNDLFRNRLGIWYIRAAVVLVIIPVIVIALRAPSILQIYL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
           I+D+++A+T+P ++LGL D  YF  W   D                + +Y + + G  LI
Sbjct: 382 ISDMVSAATIPVLVLGLSDR-YFYWWRGFDVVCGGLGGILSVFIFGTAYYGDVEAGGRLI 440

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
            L  GLY  D+ V GAF+ AP+  + F F++  +R+  ++   K  G +F   ++P
Sbjct: 441 LLEQGLYTGDWGVFGAFVAAPVGGMVFGFIAMLLRVGFLFAQAKATGGQFTAFERP 496



>gi|302505048|ref|XP_003014745.1| hypothetical protein ARB_07307 [Arthroderma benhamiae CBS 112371]
 gi|291178051|gb|EFE33842.1| hypothetical protein ARB_07307 [Arthroderma benhamiae CBS 112371]
          Length = 497

 Score =  292 bits (747), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 166/443 (37%), Positives = 257/443 (58%), Gaps = 1/443 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL  FA++GP+IR+K PE F LT++  +R+G    IY+S++++  +F +M++
Sbjct: 43  VYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLSILTLITLFLYMVA 102

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+QG            
Sbjct: 103 ELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQGAMVVGLIIIAVI 162

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W R F+SK DR+LR
Sbjct: 163 TVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLWLRTFASKTDRDLR 222

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S ++  +LV +G TG++A W+G+WPG+      +AFF L + LP+WV GI +V+
Sbjct: 223 IGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLEKLPNWVVGIVLVM 282

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S AA+D+L SA  +  SND+F N+LPL   R   ++  VP V   L+   VLR+FL
Sbjct: 283 TVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIVPVVVVALRSPSVLRIFL 342

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P ++LGL D +Y+    +                +I+Y NA +G +LI L
Sbjct: 343 ISDLVSASAIPVLVLGLSDRMYWWTAFEVIVGGLGGILSVFIFGTIYYGNATEGGKLILL 402

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  F    +P +  + 
Sbjct: 403 QNGLYANDWSAFGAFVAAPIGGLIFACIALGLRVGYAFVLSKTTGRHFDVFDRP-LPRSH 461

Query: 421 KYAGNKFKDDTEIIQSSDPDEIE 443
             AG    D  + I +     I 
Sbjct: 462 MAAGPMHLDQPDFIATGTDATIR 484



>gi|402086110|gb|EJT81008.1| urea transporter, variant [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 482

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 157/442 (35%), Positives = 254/442 (57%), Gaps = 3/442 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP IR++CPEGF LT++  +R+G    +Y+  M++  +F +M++
Sbjct: 31  VYALSSALPLLIFAALGPAIRRRCPEGFVLTEWTRQRYGAVAALYLGFMTLLTLFLYMVA 90

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  ++ TL+ +D L  VI    +TT+YT  GG + S +TDN+QG            
Sbjct: 91  ELSAISQVVTTLSNLDGLPVVIVQCAITTIYTSMGGFKISFLTDNVQGAMVLGLIIIATI 150

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 RI+ ++I++S LL+   LGWQL+YI+PVA+     F   FW R F+SK DR+L 
Sbjct: 151 TIGVETRIDPALIESSGLLQPTLLGWQLVYILPVAILTNDFFLSSFWLRTFASKTDRDLW 210

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S     +L  +G TG++AVW+G WPG +N +  +AFFTL ++LP+WV GI +V+
Sbjct: 211 IGVGMASAATLCILTLVGTTGLVAVWSGAWPGPDNADGSVAFFTLLQLLPNWVVGIVLVM 270

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +   L+   +L+++L
Sbjct: 271 AVTLSTAAFDSLQSAMVSSASNDLFRNRLGIWYIRAAVVLVIIPVIVIALRAPSILQIYL 330

Query: 301 IADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
           I+D+++A+T+P ++LGL D  YF  W   D                + +Y + + G  LI
Sbjct: 331 ISDMVSAATIPVLVLGLSDR-YFYWWRGFDVVCGGLGGILSVFIFGTAYYGDVEAGGRLI 389

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVD 418
            L  GLY  D+ V GAF+ AP+  + F F++  +R+  ++   K  G +F   ++P    
Sbjct: 390 LLEQGLYTGDWGVFGAFVAAPVGGMVFGFIAMLLRVGFLFAQAKATGGQFTAFERPLPES 449

Query: 419 TKKYAGNKFKDDTEIIQSSDPD 440
           T          +     S+D +
Sbjct: 450 TAISENGPADGEVRFDDSADRE 471



>gi|327306029|ref|XP_003237706.1| hypothetical protein TERG_02421 [Trichophyton rubrum CBS 118892]
 gi|326460704|gb|EGD86157.1| hypothetical protein TERG_02421 [Trichophyton rubrum CBS 118892]
          Length = 536

 Score =  291 bits (745), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 169/452 (37%), Positives = 260/452 (57%), Gaps = 7/452 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL  FA++GP+IRKK PE F LT++  +R+G    IY+S++++  +F +M++
Sbjct: 82  VYGLSSALPLLAFAFVGPIIRKKFPEVFVLTEWTRQRYGVVAGIYLSILTMITLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+QG            
Sbjct: 142 ELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQGAMVVGLIIIAVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W R F+SK DR+LR
Sbjct: 202 TVGARTNIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLWLRTFASKTDRDLR 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S ++  +LV +G TG++A W+G+WPG       +AFF L + LP+WV GI +V+
Sbjct: 262 IGISIASFVVLCILVLVGSTGLLAAWSGVWPGNPPQAGSIAFFLLLEKLPNWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S AA+D+L SA  +  SND+F N+LPL   R   ++  VP V   L+   VLR+FL
Sbjct: 322 TVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIVPVVVVALRSPSVLRIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P ++LGL + +Y+    +                +I+Y NA +G +LI L
Sbjct: 382 ISDLVSASAIPVLVLGLSNRMYWWTAFEVIVGGLGGILSVFIFGTIYYGNATEGGKLILL 441

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF-VF----PKKPE 415
             GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  F VF    P+ P 
Sbjct: 442 QNGLYANDWSAFGAFVAAPVGGLIFACIALGLRVGYKYVLSKTTGRHFDVFDRPLPRSPM 501

Query: 416 VVDTKKYAGNKF--KDDTEIIQSSDPDEIEIR 445
                      F       II+++D +  + R
Sbjct: 502 AAGPMHLDQPDFIATGTDAIIRNNDEEGAKFR 533



>gi|296414011|ref|XP_002836698.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630533|emb|CAZ80889.1| unnamed protein product [Tuber melanosporum]
          Length = 541

 Score =  291 bits (744), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 165/433 (38%), Positives = 250/433 (57%), Gaps = 7/433 (1%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA  S +PL  FA L P +R+K P GF LT +V ER+G +  +Y++ +S+A MF +M++E
Sbjct: 103 YAACSALPLMSFAILAPKVRRKLPGGFILTMWVRERYGPYAALYLTFLSLATMFLYMVAE 162

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           LS++  ++ TLTG++ L  VI   +VT++YT  GG R S +TDNIQG             
Sbjct: 163 LSSLQQVISTLTGLNGLPVVIVEVVVTSIYTSLGGFRISFLTDNIQGVLIAVLIAICTIA 222

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
             TS+ I++S I  S L     LG+QL+YI+   + F+ +F   FW RAF+SK D++L +
Sbjct: 223 IGTSVEIDRSRIGPSGLTHDTLLGYQLIYILFTGILFSFMFLSSFWMRAFASKTDKDLWI 282

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLA 241
                ++++F +L+ +  TG IA WAG+W  E  +   +AFF L   LP WV G TVV+ 
Sbjct: 283 GVSIAAVVIFVILLLVSSTGFIAAWAGVW--EPGMYGGMAFFLLLAELPSWVVGFTVVMV 340

Query: 242 VSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLI 301
           V++SCA +D+  SA  +  SND+F N+L L   RF  L+ ++PA+   LK   +LR+FLI
Sbjct: 341 VALSCAIFDSQQSAMVSTISNDLFKNKLSLIWVRFFVLLVSIPAIVVALKSPSILRIFLI 400

Query: 302 ADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLP 361
           +++ + + MP ILLGL+D++YFL  +D                  +Y +AK   ELI L 
Sbjct: 401 SNIFSCAAMPSILLGLLDTMYFLRGVDIIIAGVGGMLSVFLFGCAYYGDAKKAAELIILT 460

Query: 362 LGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF-----VFPKKPEV 416
            GLY  D+SV G F+ AP+ S+ F  L+   R+  +WV  K++G  F       P++  V
Sbjct: 461 TGLYANDWSVFGVFVAAPVGSLIFLALAVACRMGGVWVRCKVQGGRFDCLDKPLPREGGV 520

Query: 417 VDTKKYAGNKFKD 429
            +     G   +D
Sbjct: 521 CEGDGTPGGSLED 533



>gi|340975607|gb|EGS22722.1| hypothetical protein CTHT_0011960 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 557

 Score =  290 bits (741), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 156/448 (34%), Positives = 258/448 (57%), Gaps = 8/448 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL  FA LGP+IR+KCP+GF LT++  +R+G    +Y+S M++  +F +M+S
Sbjct: 113 VYALASGLPLLAFATLGPIIRRKCPQGFVLTEWTRQRYGTITALYLSFMTLVTLFLYMVS 172

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LTG+D L  +I   +VTT+YT  GG + S  TDNIQG            
Sbjct: 173 ELSAIGQVVNLLTGLDGLPVLIVECLVTTIYTSLGGFKISFFTDNIQGAMVLGLIIIATI 232

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+  +I++S L K N LGWQLLYI+PVA+     F   FW R F+SK DR+L 
Sbjct: 233 TIGVETKIDTGLIESSGLTKGNLLGWQLLYILPVAILTNDFFLSQFWLRTFASKTDRDLW 292

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG--EENLESYLAFFTLFKVLPDWVSGITV 238
           L      + +  ++  +G TG+IA W+G+WPG  +  ++  +AFF L + LP WV GI +
Sbjct: 293 LGISAAVVAIIIIVTLVGSTGLIAAWSGVWPGPPDNPVDGSVAFFALLQQLPSWVVGIVL 352

Query: 239 VLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRV 298
           V++V++S AA+D+  SA   + S D+F N+L +   R   ++  +P V   ++   +L++
Sbjct: 353 VMSVTLSTAAFDSFQSAMVTSASTDLFRNKLSIWWIRAGVVLTMIPVVVIAIRAPSILQI 412

Query: 299 FLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
           +LI+DL++A+T+P ++LGL D+ Y+    +                +++Y + K G EL+
Sbjct: 413 YLISDLVSAATIPVLILGLSDACYWWRGFEVVVGGLGGLFTVFLFGTVYYGDVKSGAELM 472

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVD 418
            L  GL+  D+   GAF+ AP+  + + F +  +RL   +   K++G+ F    +P  +D
Sbjct: 473 LLQQGLFTGDWGCFGAFVAAPIGGLLWGFGALALRLGIQYTRAKLQGKRFDSLDRPVSLD 532

Query: 419 TKKYAGNKFKDDTEIIQSSDPDEIEIRG 446
            +   G+ ++ ++    S +P   E  G
Sbjct: 533 EE---GHGWETESS---SDNPGIAETTG 554



>gi|345566015|gb|EGX48962.1| hypothetical protein AOL_s00079g183 [Arthrobotrys oligospora ATCC
           24927]
          Length = 532

 Score =  289 bits (740), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 164/418 (39%), Positives = 252/418 (60%), Gaps = 6/418 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S  P+ +FA L P+IR++ P GF LT++  +RFG    +Y+SL+++  MF +M++
Sbjct: 82  VYALASATPIILFALLTPIIRRRTPNGFLLTEWTRDRFGAPAALYLSLLTMITMFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSAV +++  LTG++ L  +I   +VTT+YT  GG R S +TDNIQG            
Sbjct: 142 ELSAVNSVINLLTGLNGLPALIVEVVVTTIYTSLGGFRVSFVTDNIQGALVLCLIIICTI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              T   I+ S+I+ S L ++  LGW+LLYI+PVA+S   +F   FW R+F+S+ D++L 
Sbjct: 202 SIGTKSHIDTSLIEPSGLTRATLLGWKLLYILPVAISTNFMFLSPFWMRSFASRTDKDLY 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG---LWPGEENLESYLAFFTLFKVLPDWVSGIT 237
           + +    + +F +L   G TG+IAVWA     W G  +  S +AFF L   LP WV G+ 
Sbjct: 262 IGSAIAGVWIFVILTVTGFTGIIAVWAHGVDKW-GPVSEWSSVAFFYLIAELPAWVVGLV 320

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLK-DLDVL 296
           +++ V++S A +D+L SA  +  SND+F N+LPL   R    I  +P +   +K D  VL
Sbjct: 321 LLMVVALSTAIFDSLQSALISTASNDLFRNKLPLTYIRVGVAILTIPVIVVAIKADASVL 380

Query: 297 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIE 356
           ++FLI+D+++A+ +P +LLGL+DSLYFL+ +D                +I+Y +AK G E
Sbjct: 381 QIFLISDIVSAAAIPALLLGLVDSLYFLSGLDVIIAGCGGILSVFIFGTIYYGSAKAGGE 440

Query: 357 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
           LI +   LY+ D+ V GA++ AP+  + F F S  +RL  +WVF K++G  F    KP
Sbjct: 441 LIAMKT-LYVDDWGVFGAYVAAPVGGLLFLFGSCAIRLAGLWVFAKVKGRRFDGLDKP 497



>gi|302664422|ref|XP_003023841.1| hypothetical protein TRV_02038 [Trichophyton verrucosum HKI 0517]
 gi|291187859|gb|EFE43223.1| hypothetical protein TRV_02038 [Trichophyton verrucosum HKI 0517]
          Length = 536

 Score =  289 bits (740), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 165/443 (37%), Positives = 256/443 (57%), Gaps = 1/443 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL  FA++GP+IR+K PE F LT++  +R+G    IY+S++++  +F +M++
Sbjct: 82  VYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLSILTLITLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+QG            
Sbjct: 142 ELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQGAMVVGLIIIAVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W R F+SK DR+LR
Sbjct: 202 TVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLWLRTFASKTDRDLR 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S ++  +LV +G TG++A W+G+WPG+      +AFF L + LP+WV GI +V+
Sbjct: 262 IGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLEKLPNWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S AA+D+L SA  +  SND+F N+LPL   R   ++  VP V   L+   VLR+FL
Sbjct: 322 TVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIVPVVVVALRSPSVLRIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P ++LGL + +Y+    +                +I+Y NA +G +LI L
Sbjct: 382 ISDLVSASAIPVLVLGLSERMYWWTAFEVIVGGLGGILSVFIFGTIYYGNATEGGKLILL 441

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  F     P +  + 
Sbjct: 442 QNGLYANDWSAFGAFVAAPIGGLIFACIALGLRVGYAFVLSKTTGRHFDVFDHP-LPRSH 500

Query: 421 KYAGNKFKDDTEIIQSSDPDEIE 443
             AG    D  + I +     I 
Sbjct: 501 MAAGPMHLDQPDFIATGTDATIR 523



>gi|326481865|gb|EGE05875.1| hypothetical protein TEQG_04886 [Trichophyton equinum CBS 127.97]
          Length = 552

 Score =  286 bits (733), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 165/443 (37%), Positives = 255/443 (57%), Gaps = 1/443 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL  FA++GP+IR+K PE F LT++  +R+G    IY+S++++  +F +M++
Sbjct: 98  VYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLSILTMITLFLYMVA 157

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+QG            
Sbjct: 158 ELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQGAMVVGLIIIAVI 217

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W R F+SK DR+LR
Sbjct: 218 TVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLWLRTFASKTDRDLR 277

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S ++  +LV +G TG++A W+G+WPG+      +AFF L + LP+WV GI +V+
Sbjct: 278 IGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLEKLPNWVVGIVLVM 337

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S AA+D+L SA  +  SND F N+LPL   R   ++  VP V   L+   VLR+FL
Sbjct: 338 TVALSTAAFDSLQSAMVSTASNDAFRNKLPLIYVRIGVVLCIVPVVVVALRSPSVLRIFL 397

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P ++LGL D +Y+    +                +I+Y NA +G +LI L
Sbjct: 398 ISDLVSASAIPVLVLGLSDRMYWWTAFEVIVGGLGGILSVFIFGTIYYGNATEGGKLILL 457

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+S  GAF+ AP+  + F  ++  +R+   +V +K  G  F    +P +  + 
Sbjct: 458 QNGLYANDWSAFGAFVAAPIGGLIFACIALCLRVGYKFVLSKTTGRHFDVFDRP-LTHSH 516

Query: 421 KYAGNKFKDDTEIIQSSDPDEIE 443
             AG    D  + I +     I 
Sbjct: 517 VPAGPMHLDQPDFIATGTDATIR 539



>gi|336264692|ref|XP_003347122.1| hypothetical protein SMAC_05421 [Sordaria macrospora k-hell]
 gi|380093817|emb|CCC08781.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 495

 Score =  286 bits (733), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 162/450 (36%), Positives = 259/450 (57%), Gaps = 8/450 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PLF FA LGP+IR+KCPEGF LT++  +R+G    +Y+S +++  +F +M++
Sbjct: 41  VYALASSLPLFAFASLGPIIRRKCPEGFVLTEWTRQRYGTVTALYLSFVTLVTLFLYMVA 100

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELS++G ++  LTG+  L  +I   ++TT+YT  GG R S ITDNIQG            
Sbjct: 101 ELSSIGQVVEVLTGLHGLPVIIVECVITTIYTSLGGFRISFITDNIQGAMVVGLIVVAAI 160

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+ S+I+ S LLK N LGWQLLYI+PVA+     F   FW R F+SK D++L 
Sbjct: 161 AIGVETKIDTSLIEPSGLLKDNLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDKDLW 220

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGIT 237
           +     ++++  ++  +G TG+IA W+G+WPG   E  L   +AFF L + LP WV G  
Sbjct: 221 IGISLAALIILIIITMVGCTGLIAAWSGIWPGSDPENPLPGSVAFFGLLENLPAWVVGFV 280

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +V++V++S AA+D+L SA  +  SND+F N+L +   R   ++  +P V   +K   +L+
Sbjct: 281 LVMSVTLSTAAFDSLQSAMVSTASNDLFRNKLNVWWIRGAVVLVIIPIVVIAIKAPSILQ 340

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           ++LI+DL++A+T+P +++GL D  Y+    +                +I+Y +A  G +L
Sbjct: 341 IYLISDLVSAATIPVLVIGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYKDAHRGAQL 400

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 417
           + L  GLY   ++  GAF+ AP+  + + F +  +RL   WV  K +G  F    +P +V
Sbjct: 401 MLLEEGLYQEGWAAFGAFVAAPVGGLLWGFGALALRLSVQWVQAKRKGVRFDALDRPVMV 460

Query: 418 ----DTKKY-AGNKFKDDTEIIQSSDPDEI 442
               +T +Y AG   +      Q S   +I
Sbjct: 461 EGDGETVQYIAGGDLETILSTGQESGAGKI 490



>gi|50423383|ref|XP_460274.1| DEHA2E22396p [Debaryomyces hansenii CBS767]
 gi|49655942|emb|CAG88555.1| DEHA2E22396p [Debaryomyces hansenii CBS767]
          Length = 527

 Score =  286 bits (733), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 163/450 (36%), Positives = 255/450 (56%), Gaps = 11/450 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA+ GP+IRKKCPEGF LT++V  RFG    +Y+S  +   MF FM+ 
Sbjct: 80  VYTLCGAIPILGFAYFGPIIRKKCPEGFVLTEWVRHRFGVITALYLSFFTCLTMFLFMVG 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+   + TLTG+D LA VI   +VT++YT  GG + S +TDN QG            
Sbjct: 140 ELSAIRTAIETLTGLDALAAVIVQCVVTSIYTSIGGFKVSFVTDNFQGVFVLLLVIICAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+KS +  S LLK+N LGWQLLYI+ VA+     F  GFW R F+S+ +++L 
Sbjct: 200 GMGSYIDIDKSKVGESGLLKANKLGWQLLYILFVAILTNDCFMAGFWLRTFASRTNKDLW 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     S + F +   +G TG +AVWAG L  G+  ++ Y AFF L   +P W+    ++
Sbjct: 260 IGCSIASFVTFVICTLVGTTGFLAVWAGDLVVGD--VDGYNAFFILLSKMPGWLVAFILI 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DVLRV 298
             +S+S   +D+L SA  +  SND+F N+L +N TR L ++  +P +   +K   D+L++
Sbjct: 318 FVISLSTCTFDSLQSAMVSTISNDVFRNKLHINYTRVLVVLIMIPIIVLAVKVADDILQI 377

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL++A+ +P + LGL D+  +FL  +D                +++Y +AK+G +L
Sbjct: 378 YLIADLVSAAIIPVVFLGLSDTYFWFLRGLDVMCGGLGGLLGVFIFGTVYYGSAKEGGKL 437

Query: 358 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP-- 414
           + +  G+Y   D+   GAF++AP   I   F    +R+   +++++I G  FV   KP  
Sbjct: 438 LLVWNGIYDDADWGPFGAFVIAPFGGIVICFCVAALRIGVTYIYSRISGSPFVALDKPEP 497

Query: 415 -EVVDTKKYAGNKFKDDTE--IIQSSDPDE 441
            E++D+ ++      D TE  I +S D  +
Sbjct: 498 KEIIDSTEFHNGSQYDSTEDNIKKSIDESQ 527



>gi|346320510|gb|EGX90110.1| urea transporter [Cordyceps militaris CM01]
          Length = 573

 Score =  286 bits (732), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 165/437 (37%), Positives = 253/437 (57%), Gaps = 6/437 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P+ VF +LGP+IR++CPEGF LT++  +R+G    +++S +++  +F +M++
Sbjct: 134 VYALASALPMLVFGYLGPVIRRRCPEGFVLTEWTRQRYGTVAMLFLSFLTLVTLFLYMVA 193

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLTG+D L  VI   +VTT+YT  GG + S +TD IQG            
Sbjct: 194 ELSAIGQVVSTLTGLDGLPVVIVQCVVTTIYTSLGGFKISFLTDVIQGGMVVGLIIIATI 253

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+  +ID+S L K+N LGWQLLYI+PVA+     F   FW R FSSK D++LR
Sbjct: 254 TIGVKTEIKTELIDSSGLTKANLLGWQLLYILPVAILTNDFFLSNFWLRTFSSKTDKDLR 313

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +      +++  VL  +G TG+IA W+G WPG+      LAFF L + LP WV GI +V+
Sbjct: 314 IGVTMAMLVILCVLTLVGSTGLIAAWSGAWPGDPPQGGSLAFFVLLEQLPAWVVGIVLVM 373

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S AA+D+L SA  ++ SND+F NRL +   R   ++  VP V   LK   +L++FL
Sbjct: 374 VVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWFIRVGVVVLIVPVVVLALKAPSILQIFL 433

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++++ +P ++LGL+   +F    +                + +Y +A  G  LI L
Sbjct: 434 ISDLVSSAAIPVLVLGLLPQCWFWRGFEFVVGSLGGIFTVFIFGACYYRDAYRGARLILL 493

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+SV GAF+ AP   + + F++   RL   +   KI G  F    KP  +DT 
Sbjct: 494 EEGLYAQDWSVFGAFVAAPFGGLVWGFIALVCRLGFQYGKAKITGGVFDALDKP--LDTV 551

Query: 421 KYAGNKFKDDTEIIQSS 437
           +        D+E+++ +
Sbjct: 552 R----PLSSDSEVVEQT 564



>gi|407918302|gb|EKG11573.1| Sodium/solute symporter [Macrophomina phaseolina MS6]
          Length = 468

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 237/385 (61%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +F +LGPLIRKKCPEGF LT++  +R+G    +++SLM++  +F +M+S
Sbjct: 82  VYALSSGLPLLIFGYLGPLIRKKCPEGFVLTEWTRQRYGTVAALFLSLMTLITLFLYMVS 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDNIQG            
Sbjct: 142 ELSALQQIITALTGLDGLPAVIVQCAVTTIYTSVGGFKVSFVTDNIQGVMVLGLIIIACI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++S+ID+S  L S+ LGWQL+YI+PVA+     F  GFW R F+S+ DR+LR
Sbjct: 202 TVGVETEIDRSLIDSSGYLNSSLLGWQLIYILPVAILTNDFFLSGFWLRTFASRTDRDLR 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           ++    ++ +  +L  +G TG++A W+G+WPG       +AFFTL   LP WV GI +V+
Sbjct: 262 IAVSIAAVTVTIILTLVGCTGLLATWSGVWPGNPPQVGSIAFFTLLGTLPAWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S AA+D+  SA  +  SND+F NRLPL   R L ++A VP V   L+   VL+V+L
Sbjct: 322 VVALSTAAFDSFQSAMVSTGSNDLFRNRLPLWWIRALVVVAIVPVVVVALRSPSVLQVYL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P +++GL D  ++ +  +                +++Y NA+DG  LI L
Sbjct: 382 ISDLVSASLVPVLVIGLSDRCWWWSGTEVVVGGLGGIFSVFLFGTVYYGNARDGANLILL 441

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFF 385
             GLY  D+S  GAF+ AP+  + +
Sbjct: 442 ENGLYGDDWSAFGAFVAAPVGGLLW 466



>gi|238882735|gb|EEQ46373.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 521

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 161/449 (35%), Positives = 254/449 (56%), Gaps = 14/449 (3%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA +GP+IR+KCP+GF LT++V  RFG    +Y+S  +   MF FM+ 
Sbjct: 80  VYTICGAIPIVGFAVVGPVIRRKCPDGFILTEWVRHRFGMVTALYLSAFTCLTMFLFMVG 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+ + + TLTG++ L  VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 140 ELSAIRSAIETLTGLNALGAVIVECVVTTIYTFFGGFRVSFITDNFQGVCVLLLLIICAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S I  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 200 GMGSYIEIDTSKIGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     + + F +   +G TG +AVW+G L  G+EN   Y AFF L   +P W+    ++
Sbjct: 260 IGTSIAAFVTFAICTLIGTTGFLAVWSGDLTVGDEN--GYDAFFILLSKMPRWLVAFVLI 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 298
             + +S   +D+L SA  +  SND+F N+L +N  R + ++  VP V   +K  D +L++
Sbjct: 318 FCIVLSTCTFDSLQSAMVSTISNDVFRNKLHINYVRIMLILIMVPIVVLAVKVADNILQI 377

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL++A+ +P + LGL D+  ++L   D                +++YH+A++G +L
Sbjct: 378 YLIADLVSAAIIPSVFLGLADTWFWYLRGFDVMAGGLGALLGVFIFGTVYYHSAREGGKL 437

Query: 358 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 416
           + +  GLY  +D+   GAF++AP+  +  T  S  +R+  ++ ++K+ G+EF    KP  
Sbjct: 438 LLIWNGLYDSSDWGPFGAFVIAPVGGVIITLASAALRIAVLYAYSKVTGKEFTALDKPVT 497

Query: 417 VDTKKYAGNKFKDDTEIIQSSDPDEIEIR 445
           V+ +       +D T    S D DE + +
Sbjct: 498 VEVEN------QDHTY--GSIDDDESDTK 518



>gi|68489472|ref|XP_711409.1| hypothetical protein CaO19.6656 [Candida albicans SC5314]
 gi|46432709|gb|EAK92179.1| hypothetical protein CaO19.6656 [Candida albicans SC5314]
          Length = 521

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 161/449 (35%), Positives = 254/449 (56%), Gaps = 14/449 (3%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA +GP+IR+KCP+GF LT++V  RFG    +Y+S  +   MF FM+ 
Sbjct: 80  VYTICGAIPIVGFAVVGPVIRRKCPDGFILTEWVRHRFGMVTALYLSAFTCLTMFLFMVG 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+ + + TLTG++ L  VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 140 ELSAIRSAIETLTGLNALGAVIVECVVTTIYTFFGGFRVSFITDNFQGVCVLLLLIICAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S I  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 200 GMGSYIEIDTSKIGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     + + F +   +G TG +AVW+G L  G+EN   Y AFF L   +P W+    ++
Sbjct: 260 IGTSIAAFVTFAICTLIGTTGFLAVWSGDLIVGDEN--GYDAFFILLSKMPRWLVAFVLI 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 298
             + +S   +D+L SA  +  SND+F N+L +N  R + ++  VP V   +K  D +L++
Sbjct: 318 FCIVLSTCTFDSLQSAMVSTISNDVFRNKLHINYVRIMLILIMVPIVVLAVKVADNILQI 377

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL++A+ +P + LGL D+  ++L   D                +++YH+A++G +L
Sbjct: 378 YLIADLVSAAIIPSVFLGLADTWFWYLRGFDVMAGGLGALLGVFIFGTVYYHSAREGGKL 437

Query: 358 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 416
           + +  GLY  +D+   GAF++AP+  +  T  S  +R+  ++ ++K+ G+EF    KP  
Sbjct: 438 LLIWNGLYDSSDWGPFGAFVIAPVGGVIITLASAALRIAVLYAYSKVTGKEFTALDKPVT 497

Query: 417 VDTKKYAGNKFKDDTEIIQSSDPDEIEIR 445
           V+ +       +D T    S D DE + +
Sbjct: 498 VEVEN------QDHTY--GSIDDDESDTK 518



>gi|408392233|gb|EKJ71591.1| hypothetical protein FPSE_08230 [Fusarium pseudograminearum CS3096]
          Length = 522

 Score =  285 bits (728), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 157/415 (37%), Positives = 246/415 (59%), Gaps = 1/415 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P+ +F +LGP+IR++CPEGF LT++  +R+G    +Y+S MS+  +F +M+S
Sbjct: 82  VYALASALPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGIITMLYLSFMSMVTLFLYMVS 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LTG+D L  +I    +TT+YT  GG R S +TD +QG            
Sbjct: 142 ELSAIGQVVQALTGLDPLPVMIVQCAITTIYTSLGGFRISFMTDVVQGTMVIGLVIIAAI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++ +ID S L K N LGWQLLYI+PVAV     F   FW R F+SK D++LR
Sbjct: 202 TIGAKTEIQRPLIDESGLTKPNLLGWQLLYILPVAVLTNDFFLSSFWLRTFASKTDKDLR 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     +I++  VL  +G TG+IAVW+G  P  ++     +AFF L + LP WV GI +V
Sbjct: 262 IGTTIATIVILCVLTLVGSTGLIAVWSGALPLADKAGSGSVAFFVLLETLPSWVVGIVLV 321

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           + V+MS AA+D+L SA  ++ SND+F N+L +   R + ++  +P +   LK   VL+++
Sbjct: 322 MVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAIVVLIIIPVIAIALKAPSVLQIW 381

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI DL++A+T+P +++GL++  Y+    +                 ++Y NAK+  EL+ 
Sbjct: 382 LITDLISAATIPVLVIGLVEKFYWWRGFEVVVGGLGGILTVFIFGCVYYGNAKEAGELLL 441

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
           +  GLY  D+S  GAF+ AP+ S+ +   +  VR+   +V  K+RG  F    +P
Sbjct: 442 VQKGLYGNDWSAFGAFVAAPVGSLLWGCGAMIVRITFQYVHAKVRGHHFDALDRP 496



>gi|302919081|ref|XP_003052786.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256733726|gb|EEU47073.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 521

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 160/430 (37%), Positives = 255/430 (59%), Gaps = 5/430 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y+F S IP+ +F ++GP+IR++CPEGF LT++  +R+G    +Y+S M++  +F +M+S
Sbjct: 82  VYSFSSAIPILMFGYIGPVIRRRCPEGFVLTEWTRQRYGTLTMLYLSFMTLVTLFLYMVS 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LTG+D L  +I   ++TT+YT  GG R S +TD IQG            
Sbjct: 142 ELSAIGQVVTALTGLDGLPVMIVQCVITTIYTSLGGFRISFLTDVIQGAMVIGLVIIATI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++S+ID+S LL +N LGWQLLYI PVAV   + F   FW R F+SK D++L 
Sbjct: 202 TIGAKTSIDRSLIDSSGLLDANLLGWQLLYIFPVAVVTNSFFLSSFWLRTFASKTDKDLH 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVV 239
           L  +  +I++  VL  +G TG+IA+W+G    +E   S  +AFF L + LP WV G+ +V
Sbjct: 262 LGTIIATIVVLCVLTLVGSTGLIAIWSGALQEDETASSGAIAFFALLEQLPSWVVGVVLV 321

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           + V++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +   LK   +L+++
Sbjct: 322 MVVTLSTAAFDSLQSAMVSSASNDLFRNRLNVWFIRGGVVLIIIPVIVLALKAPSILQIY 381

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI DL++A+T+P + +GLI S Y+    +                 ++Y NA++  EL+ 
Sbjct: 382 LITDLISAATIPVLCIGLIKSCYWWRGFEVVVGGLGGIFTVFLFGLVYYGNAQEAGELLL 441

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVF---P-KKPE 415
           +  GLY  D+S  GAF+ AP+    +   +  +RL   +V  K++G  F     P ++PE
Sbjct: 442 VQKGLYGNDWSAFGAFVAAPVGGFLWGVGALILRLSVQFVMAKVQGRRFDALDRPLERPE 501

Query: 416 VVDTKKYAGN 425
             +T + A N
Sbjct: 502 SRETDEPAEN 511



>gi|241955795|ref|XP_002420618.1| urea transporter, putative; urea/polyamine transporter, putative
           [Candida dubliniensis CD36]
 gi|223643960|emb|CAX41700.1| urea transporter, putative [Candida dubliniensis CD36]
          Length = 523

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/446 (35%), Positives = 250/446 (56%), Gaps = 7/446 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA +GP+IR+KCP+GF LT++V  RFG    +Y+S  +   MF FM+ 
Sbjct: 80  VYTICGAIPIVGFALVGPIIRRKCPDGFILTEWVRHRFGMVTALYLSAFTCLTMFLFMVG 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+ + + TLTG++ L  VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 140 ELSALRSAVETLTGLNALGAVIVECVVTTIYTFFGGFRVSFITDNFQGVCVLLLLIICAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S I  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 200 GMGSYIEIDTSKIGPSGLLKANKLGWQLIYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     + + F +   +G TG +AVW+G L  G+EN   Y AFF L   +P W+    ++
Sbjct: 260 IGTSIAAFVTFAICTLIGTTGFLAVWSGDLTVGDEN--GYDAFFILLSKMPRWLVAFVLI 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DVLRV 298
             + +S   +D+L SA  +  SND+F N+L +N  R + ++  VP V   +K   ++L++
Sbjct: 318 FCIVLSTCTFDSLQSAMVSTISNDVFRNKLHINYVRIMLVLIMVPIVVLAVKVANNILQI 377

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL++A+ +P + LGL DS  ++L   D                +++YH+A++G +L
Sbjct: 378 YLIADLVSAAIIPSVFLGLADSWFWYLRGFDVMAGGLGALVGVFIFGTVYYHSAREGGKL 437

Query: 358 IGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 416
           + +  GLY  +D+   GAF++AP+  +  T  S  +R+  ++ ++K+ G EF    KP  
Sbjct: 438 LLIWNGLYDPSDWGAFGAFVIAPVGGVVITLASAALRIAVLYAYSKVTGGEFTALDKPIA 497

Query: 417 VDTKKYAGNKFKDDTEIIQSSDPDEI 442
           V+       K+    +    SD  ++
Sbjct: 498 VEVDN-EDQKYGSIDDDDDESDTKKV 522



>gi|477518870|gb|ENH71070.1| hypothetical protein FOC1_g10008443 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 569

 Score =  282 bits (721), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 165/444 (37%), Positives = 257/444 (57%), Gaps = 8/444 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P+ +F +LGP+IR++CPEGF LT++  +R+G    +Y+S MS+  +F +M+ 
Sbjct: 129 VYALASSLPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGVITMLYLSFMSLVTLFLYMVG 188

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  +TG+  L  +I    VTT+YT  GG R S ITD  QG            
Sbjct: 189 ELSAIGQVVNAMTGLKPLPVMIVQCAVTTIYTSLGGFRISFITDVAQGTMVIGLVIIAAI 248

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++ +I+ S L KSN LGWQLLYI+PVAV     F   FW R F+SK D++LR
Sbjct: 249 TIGAKTEIQRPLIEESGLTKSNLLGWQLLYILPVAVLTNDFFLSSFWLRTFASKTDKDLR 308

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVV 239
           +     +I++  +L  +G TG+IAVW+G    E+   S  +AFF L + LP WV GI +V
Sbjct: 309 IGTTIATIVILCILTLVGSTGLIAVWSGALSLEDAAGSGSVAFFVLLETLPSWVVGIVLV 368

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           + V+MS AA+D+L SA  ++ SND+F N+L +   R   ++  +P +   LK   VL+++
Sbjct: 369 MVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAFVVLIIIPVIVIALKAPSVLQIW 428

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI DL++A+T+P +++GL+D  Y+    +                 I+Y NA++  EL+ 
Sbjct: 429 LITDLISAATIPVLVIGLVDKFYWWRGFEVVVGGLGGILTVFIFGCIYYGNAQEAGELLL 488

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           +  GLY  D+S  GAF+ AP+ S+ +   +  +RL   ++  KIRG  F    +P  VD 
Sbjct: 489 VQKGLYGNDWSAFGAFVAAPVGSLLWGCGALALRLSYQYMSAKIRGHRFDALDRP--VDL 546

Query: 420 KKYAGNKFKDD--TEIIQSSDPDE 441
           +    +  ++D  TE + SS P +
Sbjct: 547 RP---SSTEEDVPTENLVSSTPGK 567



>gi|342878048|gb|EGU79459.1| hypothetical protein FOXB_10044 [Fusarium oxysporum Fo5176]
          Length = 581

 Score =  282 bits (721), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 165/444 (37%), Positives = 257/444 (57%), Gaps = 8/444 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P+ +F +LGP+IR++CPEGF LT++  +R+G    +Y+S MS+  +F +M+ 
Sbjct: 141 VYALASSLPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGVITMLYLSFMSLVTLFLYMVG 200

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  +TG+  L  +I    VTT+YT  GG R S ITD  QG            
Sbjct: 201 ELSAIGQVVNAMTGLKPLPVMIVQCAVTTIYTSLGGFRISFITDVAQGTMVIGLVIIAAI 260

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++ +I+ S L KSN LGWQLLYI+PVAV     F   FW R F+SK D++LR
Sbjct: 261 TIGAKTEIQRPLIEESGLTKSNLLGWQLLYILPVAVLTNDFFLSSFWLRTFASKTDKDLR 320

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVV 239
           +     +I++  +L  +G TG+IAVW+G    E+   S  +AFF L + LP WV GI +V
Sbjct: 321 IGTTIATIVILCILTLVGSTGLIAVWSGALSLEDAAGSGSVAFFVLLETLPSWVVGIVLV 380

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           + V+MS AA+D+L SA  ++ SND+F N+L +   R   ++  +P +   LK   VL+++
Sbjct: 381 MVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAFVVLIIIPVIVIALKAPSVLQIW 440

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI DL++A+T+P +++GL+D  Y+    +                 I+Y NA++  EL+ 
Sbjct: 441 LITDLISAATIPVLVIGLVDKFYWWRGFEVVVGGLGGILTVFIFGCIYYGNAQEAGELLL 500

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           +  GLY  D+S  GAF+ AP+ S+ +   +  +RL   ++  KIRG  F    +P  VD 
Sbjct: 501 VQKGLYGNDWSAFGAFVAAPVGSLLWGCGALALRLSYQYMSAKIRGHRFDALDRP--VDL 558

Query: 420 KKYAGNKFKDD--TEIIQSSDPDE 441
           +    +  ++D  TE + SS P +
Sbjct: 559 RP---SSTEEDVPTENLVSSTPGK 579



>gi|358384934|gb|EHK22531.1| hypothetical protein TRIVIDRAFT_179853 [Trichoderma virens Gv29-8]
          Length = 510

 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 159/434 (36%), Positives = 249/434 (57%), Gaps = 17/434 (3%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA+LGP+IR+KCP+GF LT++   R+G    +Y+S M++  +F +M++
Sbjct: 82  VYALASALPLLIFAYLGPMIRRKCPDGFVLTEWTRNRYGTVAMLYLSFMTLVTLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSAVG ++  LTG+D L  +I   +VTT+YT             IQG            
Sbjct: 142 ELSAVGQVVNALTGLDGLPVIIVECVVTTIYTYV-----------IQGAMVVGLIIIATI 190

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I + +ID+S L K++ +GWQL+YI+PVAV     F   FW R FSSK D++L 
Sbjct: 191 TIGVKAEINRDLIDSSGLTKASLVGWQLVYILPVAVLTNDFFLSNFWLRTFSSKTDKDLW 250

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     ++ +  +L  +G TG+IA W G WPG+ +++  LAFF L + LP WV GI +V+
Sbjct: 251 VGISVATVAVLCILTLVGATGLIAAWTGAWPGDSDIDGSLAFFALLEQLPSWVVGIVLVM 310

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S +A+D+L SA  ++ SND+F N+L + + R L ++  +P V   LK   +L++FL
Sbjct: 311 VVSLSVSAFDSLQSAMISSASNDLFRNKLNIWIIRVLVVLVIIPTVVIALKAPSILQIFL 370

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL +A+T+P + LGL D+ Y+    +                +I+Y +AK G ELI L
Sbjct: 371 ISDLASAATIPVLCLGLFDTFYWWRGFEVVVGGLGGILTVFIYGAIYYGDAKSGGELILL 430

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+   GAF+ AP+  I + F++  +RL   +   K+RGE F    +P      
Sbjct: 431 EQGLYAGDWGAFGAFVAAPVGGIIWGFIALALRLSVQFTQAKMRGERFDGLDRPLATSEV 490

Query: 421 KYAGNKFKDDTEII 434
           +      +DD +++
Sbjct: 491 E------EDDAQLV 498



>gi|149237959|ref|XP_001524856.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451453|gb|EDK45709.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 479

 Score =  280 bits (715), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 160/448 (35%), Positives = 253/448 (56%), Gaps = 10/448 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA  GP+IRK+CP+GF LT++V  RFG    +Y+S  +   MF FM+ 
Sbjct: 23  VYTLCGSIPILGFAVFGPIIRKRCPDGFILTEWVRHRFGVVTALYLSFFTCLTMFLFMVG 82

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+   + TLTG++ L  VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 83  ELSAIRGAIETLTGLNALGAVIVECVVTTIYTFFGGFRVSFITDNFQGACVLILIIICAC 142

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              T I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 143 GMGTYIEIDPSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 202

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     + + F +   +G  G +AVW+G +  G+EN   Y AFF L   +P W+    ++
Sbjct: 203 IGCSIAAFVTFVICTLVGTPGFLAVWSGDITVGDEN--GYNAFFILLAKMPRWLVAFVLI 260

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DVLRV 298
             + +S   +D+L SA  +  SND+F N+L  N TR L ++  VP V   +K   D+L++
Sbjct: 261 FCIMLSTCTFDSLQSAMVSTISNDVFRNKLHTNWTRGLVVLICVPIVVLAVKVADDILQI 320

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL++A+ +P + LGL ++  ++L  ID                +++YH+A++G +L
Sbjct: 321 YLIADLVSAAIIPAVFLGLSNTYFWYLRGIDVMCGGLGALLGVFIFGTVYYHSAREGGKL 380

Query: 358 IGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 416
           + +  G+Y   D+   GAF++AP   +  T    GVR++ +++++KI G+ F   +KP  
Sbjct: 381 LLIWNGIYSPEDWGAFGAFVIAPFGGLVITMAVAGVRILGLYLYSKITGKPFTALEKP-- 438

Query: 417 VDTKKYAGNKFKDDTEIIQSSDPDEIEI 444
             T+    ++ + +TE + SS    I +
Sbjct: 439 --TQVIYVDEQERETESLTSSSNINITV 464



>gi|400595550|gb|EJP63345.1| urea transporter [Beauveria bassiana ARSEF 2860]
          Length = 521

 Score =  279 bits (714), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 158/414 (38%), Positives = 237/414 (57%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P+ VF +LGP+IR++CPEGF LT++  +R+G    +++S++++  +F +M++
Sbjct: 82  VYALASSLPMLVFGYLGPVIRRRCPEGFVLTEWTRQRYGIPGMLFLSVLTLITLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLTG+D L  VI   IVTT+YT  GG + S +TD IQG            
Sbjct: 142 ELSAIGQVVSTLTGLDGLPVVIVQCIVTTIYTSLGGFKISFLTDVIQGGMVVGLIIIATI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+  +ID S L K   LGWQLLYI+PVAV     F   FW R FSSK D++LR
Sbjct: 202 TIGVKTEIQTELIDASGLTKPTLLGWQLLYILPVAVLTNDFFLSNFWLRTFSSKTDKDLR 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +      +++  VL  +G TG+IA W+G WPG+      LAFF L + LP WV GI +V+
Sbjct: 262 VGVTMAMVVILCVLTLVGCTGLIAAWSGAWPGDPAQAGSLAFFVLLERLPGWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S AA+D+L SA  ++ SND+F NRL +   R   ++  +P V   LK   +L++FL
Sbjct: 322 VVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWFIRGFVVLVIIPVVVLALKAPSILQIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++++ +P + +GL+   +     +                + +Y +A  G  LI L
Sbjct: 382 ISDLVSSAAIPVLCIGLLPQAWVWRGFEFVVGTLGGILTVFIFGACYYKDAYRGARLILL 441

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
             GLY  D+SV GAF+ AP   + +  ++   RL   +   KI G  F    KP
Sbjct: 442 EEGLYAQDWSVFGAFVAAPFGGLVWGCIALACRLTFQYAKAKITGGVFDALDKP 495



>gi|295663094|ref|XP_002792100.1| urea transport protein [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226279275|gb|EEH34841.1| urea transport protein [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 503

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 149/381 (39%), Positives = 226/381 (59%)

Query: 35  LERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGY 94
           L R+G    IY+S++++  +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  
Sbjct: 73  LLRYGLVTAIYLSILTLITLFLYMVAELSALQQIVSALTGLNGLPTVIVQVMVTTIYTSL 132

Query: 95  GGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPV 154
           GG + S ITDNIQG               T   I++S+ID+S LL ++ LGWQL+YI+P+
Sbjct: 133 GGFKVSFITDNIQGAMVVGLVIIAVITVGTKTNIDRSLIDSSGLLDASLLGWQLIYILPI 192

Query: 155 AVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEE 214
           A+     F   FW R F+SK+DR+LR+     S  +F +L  +G+TG++A W+G WPG  
Sbjct: 193 AIFTNDFFLSNFWLRTFASKSDRDLRIGVSIASGTVFCILTLVGVTGLLAAWSGAWPGNP 252

Query: 215 NLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVT 274
              + +AFF L + LP WV GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   
Sbjct: 253 PQRASIAFFLLLEKLPGWVVGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLKYV 312

Query: 275 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXX 334
           R L ++  +P V   L+   VL++FLI+DL++AS++P +  GL +  Y+    +      
Sbjct: 313 RILVVLCIIPVVVVALRSPSVLQIFLISDLVSASSIPVLTFGLWEKAYWWKGFEVVVGGL 372

Query: 335 XXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRL 394
                     +I++ +A++G +LI L  GLY  D+SV GAF+ APL  I F   + G+RL
Sbjct: 373 GGIFSVFVFGAIYFKDAQEGAKLILLGNGLYAQDWSVFGAFLAAPLGGILFGIAALGLRL 432

Query: 395 ISMWVFTKIRGEEFVFPKKPE 415
              ++  K +   F    KPE
Sbjct: 433 GYQFLLCKHQHRRFDALDKPE 453



>gi|505755900|gb|EOR00094.1| putative urea active transporter 1 [Wallemia ichthyophaga EXF-994]
          Length = 560

 Score =  278 bits (711), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 158/441 (35%), Positives = 255/441 (57%), Gaps = 16/441 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y+  + +PL  F  L   +RKKCPEGF LT+F+  RFG    +++S  +I  ++ FM+SE
Sbjct: 81  YSLAASLPLLTFPPLASQLRKKCPEGFILTEFIRARFGVPAGLFLSTFTIITLYVFMLSE 140

Query: 62  LSAVGNILVTLTGVDK-------LAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXX 114
           ++++ +++ +LTG          + P++   +VT +YT +GG + SL+TD IQ       
Sbjct: 141 MTSIHSVIQSLTGWSSETQNVWLIMPIVVEMLVTMMYTAWGGFKVSLVTDTIQASFFIIL 200

Query: 115 XXXXXXXXATSIRIEKSVIDN-SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                   A ++ I+  +I   SDLLK + LGWQLLYI+PVAV F   F   +WQR +++
Sbjct: 201 VVVCTIAVAVNVEIDTDLIHQRSDLLKDSQLGWQLLYILPVAVVFNNYFLSSYWQRCYAA 260

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE----SYLAFFTLFKVL 229
           K+ ++L +  +  + ++F +   +G +G+IA W+ ++PG  N+     S + F  + +  
Sbjct: 261 KSQKDLTIGCILAACLIFCLTFLVGFSGLIASWSNVYPGPNNVNEDSSSTVLFLLVNRFC 320

Query: 230 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLI-ANVPAVYW 288
           P W++G+ +VL+V++SCAAYDTL +A  A  SNDIF N++ +  TR + ++ A V     
Sbjct: 321 PAWINGLMMVLSVALSCAAYDTLQTALVATVSNDIFRNKINVWWTRLILIVNAAVIGPVA 380

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFY 348
             K  DVL ++LIADL++A+ MP +LLG  D LYFLN  D                 ++Y
Sbjct: 381 SNKVNDVLILYLIADLVSAAIMPAMLLGFTDRLYFLNGFDVIIGGLGGILTVFLFGLVYY 440

Query: 349 H-NAKDGIELIGLPLGLY--ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRG 405
           + +A     L+ +  GLY     +  LG FI AP+ SI +T  +FGVR++ M++ +KI G
Sbjct: 441 NGDASSAGALLIINEGLYPSYNSFEALGTFIAAPVGSILWTIAAFGVRVLYMYIRSKITG 500

Query: 406 EEFVFPKKPEVVDTKKYAGNK 426
            EF   +KP+ +D    AGN+
Sbjct: 501 AEFSVFEKPKPLDPAVVAGNE 521



>gi|378730007|gb|EHY56466.1| hypothetical protein HMPREF1120_04548 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 541

 Score =  278 bits (711), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 158/429 (36%), Positives = 239/429 (55%), Gaps = 2/429 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y+  S +PL VFA+LGP+IRKKCPEGF LT++  +R+G    +Y+S +++  +F +M++
Sbjct: 82  VYSLASALPLLVFAYLGPIIRKKCPEGFVLTEWTRQRYGTITGLYLSALTLITIFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG++ L  VI    VTT+YT  GG R S ITDNIQG            
Sbjct: 142 ELSALQQIVNALTGLNGLPAVIVECAVTTIYTSLGGFRVSFITDNIQGGMVVALIIIACI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I + +ID S  L ++ LGWQL+YI+ VA+     F  GFW R F++K D++L 
Sbjct: 202 TVGVKTDINRDLIDRSGYLDASLLGWQLIYILSVAIITNDFFISGFWMRTFAAKTDKDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           + A   +  +  +L  +G+TG++A WAG+  G+   ES +AFF L   LP WV GI +V+
Sbjct: 262 IGAGVATGAVAVILTLVGVTGLLAGWAGIL-GDPPEESSIAFFLLLGQLPAWVVGIVLVM 320

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            + +S AA+D+L SA  +  SND+F N+L     R   +I   P V   LK   VL+++L
Sbjct: 321 TICLSTAAFDSLQSAMVSTGSNDLFRNKLNFWFIRAAVVIIIFPVVVVALKSPSVLQIYL 380

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGI-ELIG 359
           I+DL++AS++P +L+GL D  Y     +                 ++YH  +     LI 
Sbjct: 381 ISDLISASSIPCLLIGLSDRFYVWRGFEVVVGGLGGIVTVFLFGLVYYHGDRQAAGNLIL 440

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           L  GLY  D+S  GAF+ AP+    ++  +F +R+   W   K +G  F    KP     
Sbjct: 441 LEQGLYGNDWSAFGAFVAAPVGGFLWSLGAFALRIAIQWSMAKYKGTRFDAFDKPAAPSA 500

Query: 420 KKYAGNKFK 428
             Y G++ +
Sbjct: 501 AFYTGDQIR 509



>gi|477525718|gb|ENH77590.1| urea transporter [Colletotrichum orbiculare MAFF 240422]
          Length = 527

 Score =  277 bits (708), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 163/447 (36%), Positives = 248/447 (55%), Gaps = 6/447 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP+IR+K PEGF LT +  +R+G     Y+S M++  +F +M++
Sbjct: 76  VYALSSSLPLLIFAVLGPIIRRKTPEGFVLTAWTRQRYGTVAMFYLSFMTLVTLFLYMVA 135

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLT +D L  +I   I+TT+YT  GG R S ITDN+QG            
Sbjct: 136 ELSAIGQVVNTLTSLDGLPVMIVQCIITTIYTSLGGFRISFITDNLQGAMVVCLIVIVAV 195

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+ S+I+ S  LK   LGWQLLYI+P+ +     F  GFW R F+SK D++LR
Sbjct: 196 TMGVKAEIDTSLIETSGYLKPTLLGWQLLYILPICILTNDFFLSGFWLRTFASKTDKDLR 255

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVV 239
           +      +++  +L  +G+TG +AVW+G  P +   ES  +AFF L   LP WV GI +V
Sbjct: 256 IGVSVAVVIILCILTMVGVTGCVAVWSGALPLDGVAESGSVAFFLLLNQLPAWVVGIVLV 315

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           +  ++S AA+DTL SA  ++ SND+F NRL +   R   ++  +P V   LK   +L+++
Sbjct: 316 MVCTLSTAAFDTLQSAMVSSASNDLFRNRLNIWWIRAGVVVIIIPTVIIALKAPSILQIY 375

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELI 358
           LI+DL++AS +P ++ GL D  Y+    +                 I+Y  + +    L+
Sbjct: 376 LISDLVSASVIPVLVFGLTDRFYWWRGFEVVVGGLGGLLTVFIFGIIYYDGDTQKAGNLL 435

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVD 418
            +  GLY  D+SV GAF+ AP+ S  + F   G RL   +   K  G  F    +P  VD
Sbjct: 436 IISEGLYANDWSVFGAFVAAPVGSFLWGFAGLGCRLAFQYAMAKKNGRRFDALDRP--VD 493

Query: 419 TKKYAGNKFKDDTEIIQSSD-PDEIEI 444
           T  YA +      ++ + +D   ++EI
Sbjct: 494 T-PYAPDGVPRQVDVDEYADVTSDVEI 519



>gi|451997584|gb|EMD90049.1| hypothetical protein COCHEDRAFT_1022148 [Bipolaris maydis C5]
 gi|477592667|gb|ENI09737.1| hypothetical protein COCC4DRAFT_29696 [Bipolaris maydis ATCC 48331]
          Length = 530

 Score =  276 bits (707), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 153/438 (34%), Positives = 244/438 (55%), Gaps = 1/438 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +F  LGP+IR+KCPEGF LT++  +R+G    I++SL ++  MF +M++
Sbjct: 82  VYALSSSLPLLIFGALGPIIRRKCPEGFVLTEWTRQRYGAVAGIFLSLCTLITMFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQG            
Sbjct: 142 ELSALQQIVNLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFVTDNIQGAMVSGLIILGVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++S+ID S  LK + LGWQL+YI+PVA+     F  GFW R F+S+ D++L 
Sbjct: 202 AVGVETDIDRSLIDQSGYLKPSLLGWQLIYILPVAILTNDFFLSGFWMRTFASRTDKDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     ++ +  +L  LG+ GM+A W+G +   +   S LAFF L + LP WV G+ +V+
Sbjct: 262 IGVSLATMGILIILTLLGVGGMLAAWSGAYTIGDEANSSLAFFLLLEKLPAWVVGVILVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S AA+D+  SA  +  SND F N+L + V R   +    P V   L+  D+L++FL
Sbjct: 322 TVSLSTAAFDSFQSAMISTASNDFFRNKLNIWVIRAFVVAIIFPVVVVALRSPDILQIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIG 359
           I+DL++A+ +P +++GL +  Y+    D                 ++Y  +A    +L+ 
Sbjct: 382 ISDLVSAAVVPCLVIGLSERFYWYRGFDFVVGGLGGIFTIFLFGLVYYDGDATLASKLLL 441

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           L  GLY  D+S  GAF+ AP+  + + F +  +R+  +W   +I+G  F    +P     
Sbjct: 442 LEGGLYANDWSAFGAFVAAPVGGLLWAFGACALRISFLWAKARIQGRRFDAFDRPIPQSF 501

Query: 420 KKYAGNKFKDDTEIIQSS 437
            +       D   ++++S
Sbjct: 502 DRPGAFDNHDSDAVLENS 519



>gi|396469553|ref|XP_003838434.1| hypothetical protein LEMA_P113700.1 [Leptosphaeria maculans JN3]
 gi|312215002|emb|CBX94955.1| hypothetical protein LEMA_P113700.1 [Leptosphaeria maculans JN3]
          Length = 871

 Score =  276 bits (706), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 151/415 (36%), Positives = 234/415 (56%), Gaps = 1/415 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +F  LGP+IR+KCPEGF LT++  +R+G    +++S+ ++  MF +M++
Sbjct: 80  VYALSSALPLLIFGALGPIIRRKCPEGFVLTEWTRQRYGAVAGLFLSVCTLITMFLYMVA 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG++ L  VI    +TT+YT +GG + S +TDNIQG            
Sbjct: 140 ELSALQQIVTLLTGLNGLPVVIVECTITTIYTSFGGFKVSFLTDNIQGVMVLGLIIMGVI 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++S+ID S  L  + LGWQL+YI+PVA+     F  GFW R F++K D++L 
Sbjct: 200 AVGVETNIDRSLIDQSGYLNPSLLGWQLIYILPVAILTNDFFLSGFWMRTFAAKTDKDLW 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S  +  +L  LG+ G+++ W+G +   +     LAFF L + LP WV GIT+V+
Sbjct: 260 IGVSLASGGVLIILTLLGVAGLLSAWSGAYTIGDQENGSLAFFLLLEKLPAWVIGITLVM 319

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S AA+D+  SA  +  SND F N+L + V R   +    P V   L+  D+LR+FL
Sbjct: 320 TVSLSTAAFDSFQSAMISTGSNDFFRNKLNIWVIRACVVALIFPVVVVALRSPDILRIFL 379

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIG 359
           I+DL++A+ +P ++LGL +  Y+    D                 +FY  +      L+ 
Sbjct: 380 ISDLVSAAVVPCLVLGLSERFYWYRGFDFVIGGLGGIFTIFLFGLVFYDGDVTMAGNLLL 439

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
           L  GLY  D+SV GAF+ AP   + +   + G+R+  +W+  K RG  F    +P
Sbjct: 440 LESGLYADDWSVFGAFVAAPFGGLLWAMGACGLRISFLWIMAKARGRRFDALDRP 494



>gi|451852092|gb|EMD65387.1| hypothetical protein COCSADRAFT_35445 [Bipolaris sorokiniana
           ND90Pr]
          Length = 530

 Score =  276 bits (706), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 149/415 (35%), Positives = 236/415 (56%), Gaps = 1/415 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL VF  LGP+IR+KCPEGF LT++  +R+G    I++SL ++  MF +M++
Sbjct: 82  IYALSSSLPLLVFGALGPIIRRKCPEGFVLTEWTRQRYGAVAGIFLSLCTLITMFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG++ L  VI    +TT+YT  GG + S +TDNIQG            
Sbjct: 142 ELSALQQIVTLLTGLNGLPVVIVECAITTIYTSLGGFKVSFVTDNIQGAMVIGLIILGVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++S+ID S  LK + LGWQL+YI+PVA+     F  GFW R F+S+ D++L 
Sbjct: 202 AVGVETDIDRSLIDQSGYLKPSLLGWQLIYILPVAILTNDFFLSGFWMRTFASRTDKDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S+ +  +L  LG+ GM+A W+G +   +     LAFF L + LP WV G+ +V+
Sbjct: 262 IGVSLASMGILIILTLLGVGGMLAAWSGAYTIGDEANGSLAFFLLLEKLPAWVVGVVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            +S+S AA+D+  SA  +  SND F N+L + V R   +    P V   L+  D+L++FL
Sbjct: 322 TISLSTAAFDSFQSAMISTGSNDFFRNKLNIWVIRAFVVALIFPVVVVALRSPDILQIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIG 359
           I+DL++A+ +P +++GL +  Y+    D                 ++Y  +A    +L+ 
Sbjct: 382 ISDLVSAAVVPCLVIGLSERFYWYRGFDFVVGGLGGIFTIFLFGLVYYDGDATLASKLLL 441

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
           L  GLY  D+S  GAF+ AP+  + + F +  +R+  +W   +++G  F    +P
Sbjct: 442 LEGGLYANDWSAFGAFVAAPVGGLLWAFGACALRISFLWAKARVQGRRFDAFDRP 496



>gi|38567077|emb|CAE76374.1| hypothetical protein [Neurospora crassa]
          Length = 461

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 155/446 (34%), Positives = 253/446 (56%), Gaps = 24/446 (5%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PLFVFA LGP+IR+KCPEGF LT++  +R+G    +Y+S +++  +F +M++
Sbjct: 18  VYALASALPLFVFALLGPIIRRKCPEGFVLTEWTRQRYGTIAALYLSFVTLVTLFLYMVA 77

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELS +G ++  LTG++ L  +I   ++TT+Y           T NIQG            
Sbjct: 78  ELSGIGQVVEVLTGLNGLPVLIVECVITTIY-----------TYNIQGAMVIGLLVVASI 126

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+ S+I+ S LLK + LGWQLLYI+PVA+     F   FW R F+SK DR+L 
Sbjct: 127 AIGVETKIDTSLIEPSGLLKDSLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDRDLW 186

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGIT 237
           +     ++ +  ++  +G TG+IA W+G+WPG   E  L   +AFF L + LP WV G  
Sbjct: 187 IGITLAALFILIIITMIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGLLENLPAWVVGFV 246

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +V++V++S AA+D+L SA  ++ SND+F N+L +   R   ++  +P V   +K   +L+
Sbjct: 247 LVMSVTLSTAAFDSLQSAMVSSASNDLFRNKLSVWWIRVAVVLIIIPIVVLAIKAPSILQ 306

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           ++LI+DL++A+T+P +++GL D  Y+    +                +I+Y++A  G +L
Sbjct: 307 IYLISDLVSAATIPVLIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYNDAYKGAQL 366

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 417
           I L  G+Y   ++  GAF+ AP+  + + F +  +RL   WV  K +G  F    +P VV
Sbjct: 367 ILLEDGIYQEGWAAFGAFVAAPVGGLLWGFGALALRLAVQWVQAKRKGVRFDALDRPVVV 426

Query: 418 DTKKYAGNKFKDDTEIIQSSDPDEIE 443
           ++          D+E IQ     ++E
Sbjct: 427 ES----------DSEAIQYVAGGDLE 442



>gi|354547251|emb|CCE43985.1| hypothetical protein CPAR2_502100 [Candida parapsilosis]
          Length = 467

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 161/443 (36%), Positives = 249/443 (56%), Gaps = 10/443 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA  GP+IRKKCP+GF LT++V  RFG    +Y+S  +   MF FMI 
Sbjct: 23  VYTLCGAIPILGFAIFGPIIRKKCPDGFILTEWVRHRFGMITALYLSFFTCLTMFLFMIG 82

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+ + +  LTG++ L  VI    VTT+YT +GG R S ITDN QG            
Sbjct: 83  ELSAIRSAIEALTGLNALGAVIVECAVTTIYTFFGGFRVSFITDNFQGACVLILIIICAC 142

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 143 GMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 202

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWA-GLWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     + + F +   +G TG +AVW+  L  G++  E Y AFF L   +P W+    ++
Sbjct: 203 IGCSIAAFVAFVITSLVGTTGFLAVWSEDLQVGDD--EGYNAFFVLLSHMPRWLVAFVLI 260

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 298
             + +S   +D+L SA  +  SND+F N+L  N  R L +I   P V   +K  D +L++
Sbjct: 261 FCIVLSTCTFDSLQSAFVSTISNDVFRNKLHTNWARLLVVIMIFPIVVLAVKVADNILQI 320

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL +A+ +P + LGL +   +++   D                +++YH+AK+G +L
Sbjct: 321 YLIADLASAAVIPAVFLGLSNRYFWWMRGFDVMCGGLGALLGVFVFGTVYYHSAKEGGKL 380

Query: 358 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 416
           + +  GLY   D+   GAF++AP+  I F++++  VR+ +++V++KI G  F   ++PE 
Sbjct: 381 LLIWNGLYNPEDWGPFGAFVIAPVGGIVFSWIAAAVRIGAVYVYSKISGTPFTVLERPE- 439

Query: 417 VDTKKYAGNK--FKDDTEIIQSS 437
            +   Y  N+  +  DT I Q+S
Sbjct: 440 -EEPIYVDNQTTYGSDTNIEQTS 461



>gi|448515648|ref|XP_003867382.1| Dur3 urea transporter [Candida orthopsilosis Co 90-125]
 gi|380351721|emb|CCG21944.1| Dur3 urea transporter [Candida orthopsilosis]
          Length = 524

 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 158/443 (35%), Positives = 253/443 (57%), Gaps = 10/443 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA  GP+IRKKCP+GF LT++V  RFG    +Y+S  +   MF FMI 
Sbjct: 80  VYTLCGAIPILGFAIFGPIIRKKCPDGFILTEWVRHRFGMITALYISFFTCLTMFLFMIG 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+ + +  LTG++ L  VI    VTT+YT +GG R S ITDN QG            
Sbjct: 140 ELSAIRSAIEALTGLNALGAVIVECAVTTIYTFFGGFRVSFITDNFQGACVLILVIICAC 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 200 GMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     +++ F +   +G TG +AVW+G L  G++  E Y AFF L   +P W+    ++
Sbjct: 260 IGCSIAAVVTFVITSLVGTTGFLAVWSGDLQVGDD--EGYNAFFILLSHMPRWLVAFVLI 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 298
             + +S   +D+L SA  +  SND+F N+L  N +R L +I   P V   +K  D +L++
Sbjct: 318 FCIILSTCTFDSLQSAFVSTISNDVFRNKLHTNWSRLLVVIMIFPIVVLAVKVADNILQI 377

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL++A+ +P   LGL ++  +++   D                +++Y++AK+G +L
Sbjct: 378 YLIADLVSAAVIPAAFLGLSNTYFWWMRGFDVMCGGLGALLGVFVFGTVYYNSAKEGGKL 437

Query: 358 IGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 416
           + +  GLY + D+   GAF++AP+  + F++++  VR+ +++V++KIRG  F    +P+ 
Sbjct: 438 LLIWNGLYDSEDWGPFGAFVIAPVGGVVFSWVAAAVRISAVYVYSKIRGTPFTELDRPD- 496

Query: 417 VDTKKYAGNK--FKDDTEIIQSS 437
            +   Y  N+  +  D  + Q+S
Sbjct: 497 -EEPIYVDNQATYGADENVEQTS 518



>gi|448084999|ref|XP_004195745.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
 gi|359377167|emb|CCE85550.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
          Length = 524

 Score =  273 bits (698), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 161/419 (38%), Positives = 243/419 (57%), Gaps = 6/419 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  F +LGPLIRKKCP+GF LT++V  RFG    +Y+S  +   MF FMIS
Sbjct: 80  VYTLCGAIPIVGFGFLGPLIRKKCPDGFILTEWVRHRFGVITALYLSFFTCLTMFLFMIS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           EL+A+   + T+TG++ LA VI   +VT++YT  GG   S ITDN QG            
Sbjct: 140 ELAAIRTAIETMTGLNALAAVIVECVVTSIYTSIGGFHVSFITDNFQGVLVLLLVVICAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+S++D++L 
Sbjct: 200 GMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFMAGFWLRTFASRSDKDLI 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +       + F +   +G+TG +AVW+G L  G+EN ++  AFF L   +P WV    ++
Sbjct: 260 IGCSIAGFVTFVICSLVGVTGFLAVWSGDLEVGDENGQN--AFFILLSKMPAWVLAFVLI 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DVLRV 298
             V++S   +D+L SA  +  SND+F N+L +N TR + +I  VP +   +K   D+L +
Sbjct: 318 FCVALSTCTFDSLQSAMVSTISNDVFRNKLHINYTRIIVVIIIVPIIVLAIKVANDILTI 377

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL+++S +P ILLGL DS  +FL   D                 I+Y +A++G +L
Sbjct: 378 YLIADLVSSSIIPIILLGLSDSYFWFLRGFDVMFGGLGAILAVFVFGCIYYQSAEEGGKL 437

Query: 358 IGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 415
           + L  GLY   D+   GAF++AP+ SI    +S  VR+ + +++ K +G+ F    +PE
Sbjct: 438 LLLWNGLYDPEDWGPFGAFVIAPVGSILLALISASVRISATYLYCKWKGKSFHALDRPE 496



>gi|380471757|emb|CCF47122.1| hypothetical protein CH063_15636 [Colletotrichum higginsianum]
          Length = 454

 Score =  273 bits (698), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 158/452 (34%), Positives = 250/452 (55%), Gaps = 18/452 (3%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP+IR+K PEGF LT +  +R+G    +Y+S M++  +F +M++
Sbjct: 2   VYALSSSLPLLIFAVLGPIIRRKTPEGFVLTAWTRQRYGTVAMLYLSFMTLVTLFLYMVA 61

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LT +D L  +I   ++TT+YT  GG R S +TDN+QG            
Sbjct: 62  ELSAIGQVVNALTSLDGLPVMIVQCVITTIYTSLGGFRISFLTDNLQGAMVVCLIIIVAI 121

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+ S+I+ S LLK   LGWQLLYI+P+ +     F  GFW R F+SK D++LR
Sbjct: 122 TMGVKTDIDTSLIETSGLLKPTLLGWQLLYILPICILTNDFFLSGFWLRTFASKTDKDLR 181

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVV 239
           +      +++  +L  +G+TG++A W+G  P ++  ES  +AFF L + +P WV GI +V
Sbjct: 182 VGVSIAVVVILCILTMVGVTGLVAAWSGALPLDQISESGSVAFFLLLQRMPAWVVGIVLV 241

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           +  ++S AA+DTL SA  ++ SND+F NRL +   R   ++  +P V   LK   VL+++
Sbjct: 242 MVCTLSTAAFDTLQSAMVSSASNDLFRNRLNIWWIRAGVVVIIIPTVVIALKAPSVLQIY 301

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELI 358
           LI+DL++AS +P ++ GL D  Y+    +                 ++Y  +A+    L+
Sbjct: 302 LISDLVSASVIPVLVFGLTDRFYWWRGFEVVAGGLGGILTVFLFGLVYYDGDAQKAGNLL 361

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF------VFP- 411
            +  GLY  D+SV GAF+ AP+ S  + F + G RL   +   K  G  F      + P 
Sbjct: 362 IISEGLYANDWSVFGAFVAAPVGSFLWGFAALGCRLGFQYAMAKKSGRRFDALDRPIGPG 421

Query: 412 ------KKPEVVDTKKYAGNKFKDDTEIIQSS 437
                   P  V+  +YA      D E+++ +
Sbjct: 422 FTPEADGAPRYVERDEYAATS---DVEVVKPA 450



>gi|310794094|gb|EFQ29555.1| hypothetical protein GLRG_04699 [Glomerella graminicola M1.001]
          Length = 454

 Score =  273 bits (697), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 155/439 (35%), Positives = 243/439 (55%), Gaps = 4/439 (0%)

Query: 12  VFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVT 71
           VFA+LGP+IR+K PEGF LT +  +R+G    +Y+S M++  +F +M++ELSA+G ++  
Sbjct: 13  VFAFLGPIIRRKTPEGFVLTAWTRQRYGTVAMLYLSFMTLVTLFLYMVAELSAIGQVVNA 72

Query: 72  LTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKS 131
           LT +D L  +I   +VTT+YT  GG R S +TDN+QG                   I+ S
Sbjct: 73  LTSLDGLPVMIVQCVVTTIYTSLGGFRISFVTDNLQGAMVVCLIVIVGIAMGVKTDIDTS 132

Query: 132 VIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLF 191
           +I++S LLK   LGWQLLYI+PV +     F  GFW R F+SK DR+LR+       ++ 
Sbjct: 133 LIESSGLLKPTLLGWQLLYILPVCILTNDFFLSGFWLRTFASKTDRDLRVGVSIAVAVIL 192

Query: 192 PVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYD 250
            +L  +G+TG++A W+G  P ++  E+  +AFF L + +P WV G+ +V+  ++S AA+D
Sbjct: 193 CILTLVGVTGLVAAWSGALPLDQVAENGSVAFFLLLERMPAWVVGLVLVMVCTLSTAAFD 252

Query: 251 TLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTM 310
           +L SA  ++ SND+F NRL +   R   ++   P +   LK   VL+++LI+DL++AS +
Sbjct: 253 SLQSAMVSSASNDLFRNRLNIWWIRAAVVLVIAPTIVIALKAPSVLQIYLISDLVSASVI 312

Query: 311 PPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIGLPLGLYITDY 369
           P ++LGL D  Y+    +                 ++Y  +A     L+ L  GLY  D+
Sbjct: 313 PVLVLGLSDRFYWWRGFEVVAGGLGGILTVFLFGLVYYDGDASRAGNLLILSEGLYADDW 372

Query: 370 SVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGN--KF 427
           S  GAF+ AP+ S  + F + G RL   +V  +  G  F     P V      A    +F
Sbjct: 373 SAFGAFVAAPVGSFLWGFAALGCRLAFQYVAARRSGRRFDALDDPAVAPDAASADGAPRF 432

Query: 428 KDDTEIIQSSDPDEIEIRG 446
            +  E   +SD + ++  G
Sbjct: 433 VERDEYEATSDVEVVKPAG 451



>gi|388578764|gb|EIM19102.1| hypothetical protein WALSEDRAFT_61642 [Wallemia sebi CBS 633.66]
          Length = 564

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 157/441 (35%), Positives = 250/441 (56%), Gaps = 16/441 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y+  + +PL  F  L   +RKKCPEGF LT+F+  RFG    +++SL SI  ++ FM+SE
Sbjct: 83  YSLAASLPLLTFPPLAAQLRKKCPEGFVLTEFIRARFGVVASLFLSLCSIVTLYVFMLSE 142

Query: 62  LSAVGNILVTLTGVDK-------LAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXX 114
           ++++ +++ +LTG          + P+    +VT LYT +GG + SLITD IQ       
Sbjct: 143 MTSIYSVIQSLTGWSSETQNVWLIMPIFTEMMVTMLYTAWGGFKTSLITDTIQATLFILL 202

Query: 115 XXXXXXXXATSIRIEKSVIDN-SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                     ++ I+ S+I   S+LL+ + LGWQLLYI+PVA+ F   F   +WQR +++
Sbjct: 203 VIICTIAIGVTVEIDTSMIQQRSELLRGSQLGWQLLYILPVAIVFNNYFLSSYWQRCYAA 262

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG----EENLESYLAFFTLFKVL 229
           K  ++L +     +I++F +   +G +G+IA WA ++PG     E   S + F  + K  
Sbjct: 263 KTQKDLTIGCTLAAILIFCLTFLVGFSGLIAAWADVYPGPDSVNEESSSTVLFLLINKYC 322

Query: 230 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLI-ANVPAVYW 288
           P W+S + +VL+V++SCAAYDTL +A  A  SND+F N++ +   R + ++ A V A   
Sbjct: 323 PPWISALMLVLSVALSCAAYDTLQTALVATVSNDVFRNKINIWWIRLILVVNAAVIAPVA 382

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFY 348
             K  DVL ++LIADL++A+ MP +LLG  D LYFLN  D                 ++Y
Sbjct: 383 TNKVNDVLILYLIADLVSAAVMPAMLLGFTDKLYFLNGWDVTIGGLGGIFTVFLFGLVYY 442

Query: 349 H-NAKDGIELIGLPLGLYITD--YSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRG 405
             +AK    L+ +  GLY ++  +  LG FI AP+ SI +T  +FGVR++  ++ ++  G
Sbjct: 443 DGDAKSAAALLIINEGLYPSENSFECLGTFIAAPVGSILWTIAAFGVRVLYTYIRSRTTG 502

Query: 406 EEFVFPKKPEVVDTKKYAGNK 426
             F   +K + +D    AGN+
Sbjct: 503 SPFTVFEKTKPLDPYVVAGNE 523



>gi|459369699|gb|EMG48026.1| Urea transporter, putative (Urea/polyamine transporter, putative)
           [Candida maltosa Xu316]
          Length = 522

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 157/442 (35%), Positives = 253/442 (57%), Gaps = 8/442 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA +GPLIR++CP+GF LT++V  RFG    +Y+S  +   MF FMI 
Sbjct: 80  VYTICGAIPIVGFALVGPLIRRRCPDGFILTEWVRHRFGPITALYLSGFTCLTMFLFMIG 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+   + TLTG++ L  VI    VTT+YT +GG R S ITDN QG            
Sbjct: 140 ELSAIRGAIETLTGLNALGAVIVEVGVTTIYTFFGGFRVSFITDNFQGACVLILIIICAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+S++D++L 
Sbjct: 200 GMGSYIEIDTSKVGPSGLLKANKLGWQLVYILFVAILTNDCFMSGFWLRTFASRSDKDLW 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     ++++F V   +G  G +AVW+G L  G+EN   Y AFF L + +P W+    ++
Sbjct: 260 IGTSIAAVVVFVVCTLVGTPGFLAVWSGDLTVGDEN--GYNAFFILLEKMPRWLVAFVII 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DVLRV 298
             + +S   +D+L SA  +  SNDIF N+L  N  R + ++  VP V   +K   ++L++
Sbjct: 318 FCIVLSTCTFDSLQSAMVSTISNDIFRNKLHTNYVRGMLVLLMVPIVVLAVKVANNILQI 377

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL++A+ +P + LGL D+  +FL   D                +++Y +A++G +L
Sbjct: 378 YLIADLVSAAVIPSVFLGLADAWFWFLTGFDVMVGGFGALLGVFVFGTVYYGSAREGGKL 437

Query: 358 IGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE- 415
           + +  G+Y + D+   GAF++AP+    FT +   +RL ++++++K+ G EF    +PE 
Sbjct: 438 LLIWNGIYDSEDWGAFGAFVIAPVGGTIFTLICAALRLGALYLYSKVSGSEFTALDRPET 497

Query: 416 -VVDTKKYAGNKFKDDTEIIQS 436
            +V+ +   G    DD + ++ 
Sbjct: 498 VIVEHEPSKGLSQTDDDDSLKK 519



>gi|448080486|ref|XP_004194649.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
 gi|359376071|emb|CCE86653.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
          Length = 524

 Score =  270 bits (690), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 161/419 (38%), Positives = 241/419 (57%), Gaps = 6/419 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IPL  F +LGPLIRKKCP+GF LT++V  RFG    +Y+S  +   MF FMIS
Sbjct: 80  VYTLCGAIPLVGFGFLGPLIRKKCPDGFILTEWVRHRFGVVTSLYLSFFTCLTMFLFMIS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           EL+A+   + T+TG++ LA +I   +VT++YT  GG   S ITDN QG            
Sbjct: 140 ELAAIRTAIETMTGLNALAAIIVECVVTSIYTSIGGFHVSFITDNFQGALVLLLVVICAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+S++DR+L 
Sbjct: 200 GMGSYIDIDTSKVAPSGLLKANKLGWQLVYILFVAILTNDCFMAGFWLRTFASRSDRDLI 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     + + F +   +G+TG +AVW+G L  G+ N  S  AFF L   +P W+    ++
Sbjct: 260 IGCSLAAFVTFVICSLVGVTGFLAVWSGDLKVGDSNGSS--AFFILLSKMPAWLMAFVLI 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DVLRV 298
             VS+S   +D+L SA  +  SND+F N+L +N TR + +I  VP +   +K   ++L +
Sbjct: 318 FCVSLSTCTFDSLQSAMVSTISNDLFRNKLHINYTRIIVVIIIVPIIVLAIKVANNILTI 377

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL+++S +P ILLGL D   +FL   D                 I+Y +AK+G +L
Sbjct: 378 YLIADLVSSSIIPIILLGLSDRYFWFLRGFDVMFGGLGAILAVFVFGCIYYQSAKEGGKL 437

Query: 358 IGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 415
           + L  GLY   D+   GAF++AP+ SI    +S  VR+ + +++ K +G+ F    +PE
Sbjct: 438 LLLWNGLYNPEDWGPFGAFVIAPVGSILLALISASVRISASYLYCKWKGKSFHALDRPE 496



>gi|50554165|ref|XP_504491.1| YALI0E27984p [Yarrowia lipolytica]
 gi|49650360|emb|CAG80094.1| YALI0E27984p [Yarrowia lipolytica CLIB122]
          Length = 495

 Score =  270 bits (690), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 160/454 (35%), Positives = 246/454 (54%), Gaps = 16/454 (3%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +P+ +FA +GP++RK CP+GF LT++   R+G     Y++ ++I  M+ +M++
Sbjct: 23  VYGLSSALPMMLFAGVGPIVRKACPDGFVLTEWTRLRYGWLTSFYLTCLTIGTMYLYMVA 82

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           EL+AV   + TLTG+D L  +I  A+ T++YT  GG   S  TDN QG            
Sbjct: 83  ELAAVQAAIETLTGIDALPVLIVEAVFTSIYTAVGGFHTSFFTDNFQGGMMLVLMVIVCV 142

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  ++ S    S +L  N L  +L+YI+PVA++    F  GFW R F+SKN+ EL 
Sbjct: 143 GLGVYFHVDPSEPAKSGMLGPNLLANKLIYILPVAIATNDCFLSGFWMRTFASKNNVELF 202

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-------GEENLESYLAFFTLFKVLPDWV 233
            +    S ++  VL  +GLTG++AVWA L         G+E   S LAFF + K +P WV
Sbjct: 203 WACAIASSIVLIVLTVVGLTGLLAVWAKLEIDGQVFVYGDE--RSALAFFYVLKEMPGWV 260

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
            G TV   +S+S A+YD+  SA  +  SND F N++P+   R + L  N P +   LK  
Sbjct: 261 IGFTVAFVLSLSVASYDSSQSAMASTISNDFFRNKIPMVWVRLIVLCINAPVIVVALKAP 320

Query: 294 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 353
           +VL +FLIADL +A+ +P +  GL   +YF++  +                SI++ +A++
Sbjct: 321 NVLNIFLIADLFSAAVIPIMFCGLSKRMYFISGWEVIGGGFGGMLTVFIFGSIYFKSARE 380

Query: 354 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 413
           GI+LI L  GLY  D+S  GAF+ AP+ S+ + F    VRL  + +++ I G+ F    K
Sbjct: 381 GIKLIILLEGLYGDDWSAFGAFVAAPVGSLLWGFGILTVRLTVLKIYSLITGKPFTALDK 440

Query: 414 PEVVDTK----KYAGNKFKDDTE---IIQSSDPD 440
           P    T     +  G+   D+T    I+   DP+
Sbjct: 441 PSDDKTGIAVIREIGHVEDDNTSESIILDRKDPN 474



>gi|255732433|ref|XP_002551140.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240131426|gb|EER30986.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 530

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 239/412 (58%), Gaps = 6/412 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     +P+  FA +GPLIRKKCP+GF LT++V  RFG    +Y+S  +   MF FMI 
Sbjct: 78  VYTICGAVPILGFAAVGPLIRKKCPDGFILTEWVRHRFGVVTALYLSAFTCLTMFLFMIG 137

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+   + TLTG++ L  VI    VTT+YT +GG R S ITDN QG            
Sbjct: 138 ELSAIRGAIETLTGLNALGAVIVEVGVTTIYTFFGGFRVSFITDNFQGVCVLILLIICAC 197

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+K +I  S LLK N LGWQL+YI+ VA+     F  GFW R F+S++D++L 
Sbjct: 198 GMGSYIHIDKDLIGPSGLLKGNKLGWQLVYILFVAILTNDCFMSGFWLRTFASRSDKDLW 257

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     ++ +F +   +G+ G +AVW+G L  G++N   Y AFF L   +P+W+    ++
Sbjct: 258 IGTSIAAVAVFVICTLVGVPGFLAVWSGDLTVGDDN--GYNAFFILLAKMPNWLLAFVLI 315

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 298
             + +S   +D+L SA  +  SND+F N+L  N  R + ++  VP V   +K  D +L++
Sbjct: 316 FCIVLSTCTFDSLQSAMVSTISNDVFRNKLNTNWVRGMLVLLMVPIVVLAVKVADNILQI 375

Query: 299 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL++A+ +P I LGL DS  ++L   D                +++Y +AK+G +L
Sbjct: 376 YLIADLVSAAIIPSIFLGLADSWFWYLRGFDIMVGGFGALLGVFVFGTVYYDSAKEGGKL 435

Query: 358 IGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
           + +  G+Y   D+   GAF++AP+  + F  L+   R+ S++V++KI G +F
Sbjct: 436 LLIWNGIYDPEDWGAFGAFVIAPVGGVVFALLAAAARIGSLYVYSKITGNQF 487



>gi|326471561|gb|EGD95570.1| hypothetical protein TESG_03046 [Trichophyton tonsurans CBS 112818]
          Length = 509

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 160/443 (36%), Positives = 246/443 (55%), Gaps = 28/443 (6%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL  FA++GP+IR+K PE F LT++  +R+G    IY+S++++  +F +M++
Sbjct: 82  VYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLSILTMITLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+QG            
Sbjct: 142 ELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQGAMVVGLIIIAVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W R F+SK DR+LR
Sbjct: 202 TVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLWLRTFASKTDRDLR 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S ++  +LV +G TG++A W+G+WPG+      +AFF L + LP+WV GI +V+
Sbjct: 262 IGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLEKLPNWVVGIVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S AA+D+L SA  +  SND F N+LPL   R   ++  VP V   L+   VLR+FL
Sbjct: 322 TVALSTAAFDSLQSAMVSTASNDAFRNKLPLIYVRIGVVLCIVPVVVVALRSPSVLRIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P ++LGL D +Y+    +                 I   N          
Sbjct: 382 ISDLVSASAIPVLVLGLSDRMYWWTAFEVI---------------ILLQN---------- 416

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTK 420
             GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  F    +P +  + 
Sbjct: 417 --GLYANDWSAFGAFVAAPIGGLIFACIALGLRVGYKFVLSKTTGRHFDVFDRP-LPHSH 473

Query: 421 KYAGNKFKDDTEIIQSSDPDEIE 443
             AG    D  + I +     I 
Sbjct: 474 VPAGPMHLDQPDFIATGTDATIR 496



>gi|330917930|ref|XP_003298017.1| hypothetical protein PTT_08598 [Pyrenophora teres f. teres 0-1]
 gi|311328989|gb|EFQ93864.1| hypothetical protein PTT_08598 [Pyrenophora teres f. teres 0-1]
          Length = 524

 Score =  267 bits (682), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 147/434 (33%), Positives = 243/434 (55%), Gaps = 1/434 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL VF  LGP+IR+KCPEGF LT++  +R+G    +++S+ ++  MF +M++
Sbjct: 82  VYALSSALPLLVFGALGPIIRRKCPEGFVLTEWTRQRYGAVAGLFLSVCTLITMFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQG            
Sbjct: 142 ELSALQQIISLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFVTDNIQGIMVIGLIIMGVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I++S+ID S  L+ + LGWQL+YI+PVA+     F  GFW R F+++ D++L 
Sbjct: 202 AVGVETKIDRSLIDKSGYLEPSLLGWQLIYILPVAIMTNDFFLSGFWMRTFAARTDKDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S  +  +L  LG+ GM+A W+G +   +     LAFF L + LP WV G+ +V+
Sbjct: 262 IGVSLASGGVLIILTLLGVGGMLAAWSGAYTIGDEANRSLAFFLLLETLPAWVIGVVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            +S+S AA+D+  SA  +  SND F N+L + + R   +    P V   L+  D+L++FL
Sbjct: 322 TISLSAAAFDSFQSAMISTGSNDFFRNKLNIWIIRACVVALIFPVVVVALRSPDILQIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIG 359
           I+DL++A+ +P +++GL D  Y+    D                 ++Y  +     +L+ 
Sbjct: 382 ISDLVSAAVVPCLVIGLSDKFYWYRGFDFVVGGLGGVFTIFLFGLVYYDGDVTKAGKLLL 441

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           L  GLY  D+S  GAF+ AP   + + F +  +R+  +WV  +++G  F    +P  ++ 
Sbjct: 442 LEGGLYGNDWSAFGAFVAAPFGGLLWAFGACALRISFLWVRARVQGTRFDAFDRPISLNN 501

Query: 420 KKYAGNKFKDDTEI 433
             + G+   + + +
Sbjct: 502 DDHDGDAVLEHSSL 515



>gi|225685269|gb|EEH23553.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 456

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 144/362 (39%), Positives = 213/362 (58%)

Query: 54  MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 113
           +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S ITDNIQG     
Sbjct: 45  LFLYMVAELSALQQIVNALTGLNGLPTVIVQVMVTTIYTSLGGFKVSFITDNIQGAMVVG 104

Query: 114 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                     T   I++S+ID+S LL  + LGWQL+YI+P+A+     F   FW R F+S
Sbjct: 105 LVIIAVITVGTKTTIDRSLIDSSGLLDPSLLGWQLIYILPIAIFTNDFFLSNFWLRTFAS 164

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 233
           K+DR+LR+     S  +F +L  +G+TG++A W+G WPG     + +AFF L + LP WV
Sbjct: 165 KSDRDLRIGVSIASATVFCILTLVGVTGLLAAWSGAWPGNPPQRASIAFFLLLEKLPGWV 224

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
            GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK  
Sbjct: 225 VGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSP 284

Query: 294 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 353
            VL++FLI+DL++AS++P +  GL +  Y+    +                +I++ +AK+
Sbjct: 285 SVLQIFLISDLVSASSIPVLTFGLWEKAYWWKGFEVVVGGLGGIFSVFIFGAIYFKDAKE 344

Query: 354 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 413
           G +LI L  GLY  D+SV GAF+ APL  I F   + G+RL   ++ +K +   F    K
Sbjct: 345 GAKLILLGNGLYAQDWSVFGAFLAAPLGGILFGIAALGLRLGYQFLLSKYQHHRFDALDK 404

Query: 414 PE 415
           P 
Sbjct: 405 PS 406



>gi|189202288|ref|XP_001937480.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187984579|gb|EDU50067.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 440

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 145/429 (33%), Positives = 243/429 (56%), Gaps = 1/429 (0%)

Query: 6   SIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAV 65
           S +PL +F  LGP+IR+KCPEGF LT++  +R+G    +++S+ ++  MF +M++ELSA+
Sbjct: 3   SALPLLIFGALGPIIRRKCPEGFVLTEWTRQRYGAAAGLFLSVCTLITMFLYMVAELSAL 62

Query: 66  GNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATS 125
             I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQG                 
Sbjct: 63  QQIVNLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFVTDNIQGVMVIGLIIMGIIAVGVE 122

Query: 126 IRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVY 185
            +I++S+ID S  L+S+ LGWQL+YI+PVA+     F  GFW R F+++ D++L +    
Sbjct: 123 TKIDRSLIDKSGYLESSLLGWQLIYILPVAILTNDFFLSGFWMRTFAARTDKDLWIGVSL 182

Query: 186 GSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMS 245
            S+ +  +L  LG+ GM+A W+G +   +     LAFF L + LP WV G+ +V+ +S+S
Sbjct: 183 ASVGVLIILTLLGVGGMLAAWSGAYTIGDEANGSLAFFLLLETLPAWVVGVILVMTISLS 242

Query: 246 CAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLL 305
            AA+D+  SA  +  SND F N+L + + R   +    P V   L+  D+L++FLI+DL+
Sbjct: 243 TAAFDSFQSAMISTGSNDFFRNKLNIWIIRACVVALIFPVVVVALRSPDILQIFLISDLV 302

Query: 306 AASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIGLPLGL 364
           +A+ +P +++GL D  Y+    D                 ++Y  +A    +L+ L  GL
Sbjct: 303 SAAVVPCLVIGLSDRFYWYRGFDFVVGGLGGVFTIFLFGLVYYDGDATKAGKLLLLEGGL 362

Query: 365 YITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAG 424
           Y  D+S  GAF+ AP   + + F +  +R+  +W+  +++G  F    +P  ++   + G
Sbjct: 363 YGNDWSAFGAFVAAPFGGLLWAFGACALRISFLWIRARVQGTRFDAFDRPIPLNNDDHDG 422

Query: 425 NKFKDDTEI 433
           +   + + +
Sbjct: 423 DAVLEHSSV 431



>gi|226294605|gb|EEH50025.1| urea transport protein [Paracoccidioides brasiliensis Pb18]
          Length = 558

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/362 (39%), Positives = 213/362 (58%)

Query: 54  MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 113
           +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S ITDNIQG     
Sbjct: 147 LFLYMVAELSALQQIVNALTGLNGLPTVIVQVMVTTIYTSLGGFKVSFITDNIQGAMVVG 206

Query: 114 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                     T   I++S+ID+S LL  + LGWQL+YI+P+A+     F   FW R F+S
Sbjct: 207 LVIIAVITVGTKTTIDRSLIDSSGLLDPSLLGWQLIYILPIAIFTNDFFLSNFWLRTFAS 266

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 233
           K+DR+LR+     S  +F +L  +G+TG++A W+G WPG     + +AFF L + LP WV
Sbjct: 267 KSDRDLRIGVSIASGTVFCILTLVGVTGLLAAWSGAWPGNPPQRASIAFFLLLEKLPGWV 326

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
            GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK  
Sbjct: 327 VGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSP 386

Query: 294 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 353
            VL++FLI+DL++AS++P +  GL +  Y+    +                +I++ +AK+
Sbjct: 387 SVLQIFLISDLVSASSIPVLTFGLWEKAYWWKGFEVVVGGLGGIFSVFIFGAIYFKDAKE 446

Query: 354 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 413
           G +LI L  GLY  D+SV GAF+ APL  I F   + G+RL   ++ +K +   F    K
Sbjct: 447 GAKLILLGNGLYAQDWSVFGAFLAAPLGGILFGIAALGLRLGYQFLLSKYQHHRFDALDK 506

Query: 414 PE 415
           P 
Sbjct: 507 PS 508



>gi|406605512|emb|CCH43156.1| Sodium/glucose cotransporter 1 [Wickerhamomyces ciferrii]
          Length = 530

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 161/421 (38%), Positives = 244/421 (57%), Gaps = 1/421 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA    +P+ +F++LGP IRK+CP+GF LT++V  RFG    +Y+S  +I  +F FM+S
Sbjct: 80  VYALCGGLPMLLFSFLGPKIRKQCPDGFVLTEWVFHRFGPVAGLYLSACTILTLFLFMVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           +++++   + TLTG++ L  VI   +VT++YT  GG + S ITDNIQ             
Sbjct: 140 DVASLQYAINTLTGLNALPVVIVECVVTSIYTAIGGFKVSFITDNIQIATVFILIIIISC 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              T I I+ S I  S LLK N LGWQL+YI+ +A+    LF  GFW R F+SK D++L 
Sbjct: 200 AMGTYIDIDTSKIPESGLLKGNKLGWQLIYILVIAIFTNDLFMSGFWLRTFASKTDKDLW 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     + ++  + V +G+ G+IAVWAGL    ++  S  +FF +   LP WV G T+V 
Sbjct: 260 IGCSIAAFLMTCIAVIVGIPGIIAVWAGLVDVGDDGASGASFFIILTQLPSWVMGFTLVF 319

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DVLRVF 299
             ++S     +L SA T+  SNDIF N++P+   R + ++  VP +  GLK   DVL+++
Sbjct: 320 IAALSTCTIGSLQSALTSTISNDIFRNKIPIMYIRVIVVLIIVPVIVVGLKVADDVLQIY 379

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
            IADLL+A+ +P ILLGL    YFL   +                +I+Y NAKDG  L+ 
Sbjct: 380 FIADLLSAAVIPVILLGLSSYFYFLTVFEVIAGGLGGLLTVFIFGTIYYGNAKDGGLLLI 439

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           +  G+Y  D+S  GAF+ AP+ S+    +  G+RL+ + + +K  G+ F    KP+  DT
Sbjct: 440 VNNGIYGNDWSAFGAFVAAPVGSLLAASIMLGLRLLVLKLISKSSGKPFTALDKPKPKDT 499

Query: 420 K 420
           K
Sbjct: 500 K 500



>gi|366999438|ref|XP_003684455.1| hypothetical protein TPHA_0B03510 [Tetrapisispora phaffii CBS 4417]
 gi|357522751|emb|CCE62021.1| hypothetical protein TPHA_0B03510 [Tetrapisispora phaffii CBS 4417]
          Length = 565

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 168/464 (36%), Positives = 260/464 (56%), Gaps = 24/464 (5%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA    +P+FVF++LGPLIRKK P GF L+++V  RFG     Y+S  +I  M+ FM+S
Sbjct: 80  VYALAGGLPMFVFSFLGPLIRKKTPHGFILSEWVFHRFGIAAGWYLSACTILTMYLFMVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           EL+++   + TLTG+  L  VI   +VT++YT  GG + S +TD +Q             
Sbjct: 140 ELASLKYAVETLTGIKALPVVIIECVVTSIYTTVGGFKISFLTDTLQVSIVFILLIIVSC 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+KS I+ S LLK+N LGWQL+YI+ +A+    LF  GFW R F+S++D++L 
Sbjct: 200 AMGSYISIDKSKIEPSGLLKANRLGWQLIYILTIAIFTNDLFLNGFWLRTFASRSDKDLL 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     + +L  ++  +G+TG IAVWAG     +   S  AFF L   LP WV G T+V 
Sbjct: 260 IGCSIAAFLLTAIVTVVGVTGFIAVWAGFVEVADEENSGAAFFILLAQLPSWVMGFTLVF 319

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            + +S    D+L SA  +  SND+F N++P+  TR + ++  VP V  GL   DVL ++L
Sbjct: 320 VLILSTCTLDSLQSALVSTISNDVFRNKIPILYTRIIVVVIMVPVVVVGLIAEDVLSIYL 379

Query: 301 IADLLAASTMPPILLGL---IDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           I DLL++S +P ++LGL    DS ++  W +                +I+YH+A++G +L
Sbjct: 380 IVDLLSSSVVPVLVLGLWSKFDS-FWTAW-EVIGGGLAGIFGVWVYGTIYYHSAREGGKL 437

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 417
           + +  GLYI D+   GAF+VAP++S+  +F+   +RL S+ ++   + +  V  +  +V 
Sbjct: 438 LLIWNGLYIQDWGAFGAFVVAPVASMVISFIILAIRLYSIKLY---QADTTVGHRFRDVC 494

Query: 418 D-------------TKKYAGNKF---KDDTEIIQSSDPDEIEIR 445
           D             T KY  NK     D +E I  S    +EI+
Sbjct: 495 DSLGKITGITWLYRTTKYWDNKLIKELDYSEAISDSSEGIVEIQ 538



>gi|46129398|ref|XP_389060.1| hypothetical protein FG08884.1 [Fusarium graminearum PH-1]
          Length = 511

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 151/415 (36%), Positives = 239/415 (57%), Gaps = 12/415 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P+ +F +LGP+IR++CPEGF LT++  +R+G    +Y+S MS+  +F +M+S
Sbjct: 82  VYALASALPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGIITMLYLSFMSMVTLFLYMVS 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LTG+D L  +I    +TT+YT             +QG            
Sbjct: 142 ELSAIGQVVQALTGLDPLPVMIVQCAITTIYTYV-----------VQGTMVVGLVIIAAI 190

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++ +ID S L K N LGWQLLYI+PVAV     F   FW R F+SK D++LR
Sbjct: 191 TIGAKTEIQRPLIDESGLTKPNLLGWQLLYILPVAVLTNDFFLSSFWLRTFASKTDKDLR 250

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     +I++  VL  +G TG+IAVW+G  P  ++     +AFF L + LP WV GI +V
Sbjct: 251 IGTTIATIVILCVLTLVGSTGLIAVWSGALPLADKAGSGSVAFFVLLETLPSWVVGIVLV 310

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           + V+MS AA+D+L SA  ++ SND+F N+L +   R + ++  +P +   LK   VL+++
Sbjct: 311 MVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAIVVLIIIPVIAIALKAPSVLQIW 370

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI DL++A+T+P +++GL++  Y+    +                 ++Y NAK+  EL+ 
Sbjct: 371 LITDLISAATIPVLVIGLVEKFYWWRGFEVVVGGLGGILTVFIFGCVYYGNAKEAGELLL 430

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
           +  GLY  D+S  GAF+ AP+ S+ +   +  VR+   +V  K+RG  F    +P
Sbjct: 431 VQKGLYGNDWSAFGAFVAAPVGSLLWGCGAMVVRITFQYVHAKVRGHRFDALDRP 485



>gi|50551147|ref|XP_503047.1| YALI0D19866p [Yarrowia lipolytica]
 gi|49648915|emb|CAG81239.1| YALI0D19866p [Yarrowia lipolytica CLIB122]
          Length = 504

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 153/424 (36%), Positives = 237/424 (55%), Gaps = 5/424 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +P+ +FAW+GP++R++CP+GF LT++   R+G     Y+S ++I  M+ +M++
Sbjct: 2   VYTISSALPMMLFAWVGPIVRRECPDGFVLTEWTRYRYGWLTSFYLSCLTIGTMYLYMVA 61

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSAV   + TL GVD L  +I  AI T++YT  GG   S  TDNIQG            
Sbjct: 62  ELSAVQAAIETLAGVDALPVLIVEAIFTSIYTAVGGFHTSFFTDNIQGGMVLILLIIVCV 121

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  ++ S    S +L+ N L  +L+YI+PVA++    F  GFW R F+SKN+REL 
Sbjct: 122 GLGVYFHVDPSEPKKSGMLEPNLLANKLIYILPVAIATNDCFLSGFWMRTFASKNNRELF 181

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGL-WPGEE----NLESYLAFFTLFKVLPDWVSG 235
            +    +++   +L  LGLTG++AVWA +   GE+    +  S  AFF +   +P WV G
Sbjct: 182 WACAIATVLTLVILTVLGLTGLLAVWAKMVVDGEQFVYGDERSANAFFYVLLEMPGWVIG 241

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 295
            T+   +S+S AAYD+ +SA  +  SND F N++P+   R + L  N P +   +K  +V
Sbjct: 242 FTIAFTLSLSVAAYDSNVSAMASTISNDFFRNKVPMVWVRLIVLCINAPVIVVAIKAPNV 301

Query: 296 LRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGI 355
           L +FLIADL +A+ +P +  GL   +YF+   +                SI++ NA +GI
Sbjct: 302 LNIFLIADLFSAAVIPIMFCGLSRKMYFITGWEVIGGGFGGMITVFIFGSIYFKNAHEGI 361

Query: 356 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 415
           +L+ L  GLY  D+S  GAF+ AP+ SI + F    +RL  + +++ I  + F    KP+
Sbjct: 362 KLLILLQGLYGDDWSAFGAFVAAPVGSILWGFGILIIRLTVLKIYSMISKKPFTALDKPD 421

Query: 416 VVDT 419
              T
Sbjct: 422 PTQT 425



>gi|322696792|gb|EFY88579.1| urea transporter [Metarhizium acridum CQMa 102]
          Length = 463

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 151/414 (36%), Positives = 235/414 (56%), Gaps = 23/414 (5%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P+ +F  LGP+IR+KCPEGF LT++  +R+G     Y+S M++  +F +M++
Sbjct: 71  IYALASALPMLIFGALGPIIRRKCPEGFVLTEWTRQRYGTVAMFYLSFMTLVTLFLYMVA 130

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G + VTL                      GG + S +TD IQG            
Sbjct: 131 ELSALGQV-VTL----------------------GGFKISFLTDVIQGGMVVGLIIIATI 167

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++ +ID+S LL+ + LGWQLLYI+PVAV     F   FW R FSSK+D++L 
Sbjct: 168 TVGAKTEIKRELIDSSHLLEPSLLGWQLLYILPVAVLTNDFFLSNFWLRTFSSKSDKDLW 227

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +      +++  +L  +G TG+IA W+G WPGE   E  LAFF L + LP WV GI +V+
Sbjct: 228 VGVSVAMVVILCILTLVGCTGLIAAWSGAWPGEPEQEGSLAFFLLLQQLPSWVVGIILVM 287

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S AA+D+L SA  ++ SND+F NRL +   R + ++  +P V   L+   +L+++L
Sbjct: 288 VVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWYIRGMVVLIIIPVVVVALRASSILQIYL 347

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DLL+A+T+P + LGL D LY+    +                +++Y +A+ G +L+ +
Sbjct: 348 ISDLLSAATIPVLCLGLSDRLYWWRGFEVVVGGLGGILTVFIFGAVYYKDAEQGAQLLLI 407

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
             GLY  D+S  GAF+ AP+  I + F +  +RL   ++  ++R E F    +P
Sbjct: 408 QNGLYANDWSTFGAFVAAPVGGIVWGFGALALRLSFQYIKARLRRERFDALDRP 461



>gi|471566473|gb|EMR66770.1| putative urea transporter protein [Eutypa lata UCREL1]
          Length = 522

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 155/446 (34%), Positives = 257/446 (57%), Gaps = 10/446 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S  PL +FA L P+IR+KCPEGF LT++  +RFG    +Y+  +++  +F +M++
Sbjct: 77  VYAISSSFPLLIFAALVPIIRRKCPEGFVLTEWARQRFGIVTALYLGALTLLTLFLYMVA 136

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LTG+  L  +I   ++TT+YT  GG   S +TDN+QG            
Sbjct: 137 ELSAIGQVINALTGLYGLPVIIVECVITTIYTSLGGFTISFLTDNVQGAMVCCLIIIAAV 196

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                + I+  ++  S LL ++ +GWQ++YI+P+A+     F   FW RAF+S+ D++L 
Sbjct: 197 TVGVKVDIQPDLVKGSPLLDASLIGWQIIYILPIAILTNQFFLANFWLRAFASRTDKDLW 256

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE-SYLAFFTLFKVLPDWVSGITVV 239
           +     S ++F VL+ +G TG+IAVW+G +PG+   E   +AFF L + LP+WV GI +V
Sbjct: 257 VGLGIASFVIFCVLLLVGFTGLIAVWSGAFPGDPPAEDGSIAFFLLLEQLPNWVVGIVIV 316

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           + V++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P V   ++   +L+++
Sbjct: 317 MVVTLSTAAFDSLQSAMVSSASNDVFRNRLNIWWIRAGVVLIIIPVVVIAIQAPGILQIY 376

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI+DLL+A+ +P +++GL +  YF    +                +I+Y +AK G ELI 
Sbjct: 377 LISDLLSAAVIPVLVIGLSERFYFWRGFEVVVGGLGGILTVFIFGTIYYDSAKQGGELIL 436

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF-VFPKKPEVVD 418
           L  GLY  D+   GAF+ AP+  + +  ++   RL    + +KI G  F  F +  EV  
Sbjct: 437 LQQGLYTGDWGAFGAFVAAPVGGVVWGCIALAFRLTIQLLQSKIAGRRFDAFDRPIEV-- 494

Query: 419 TKKYAGNKFKDDTEIIQSSDPDEIEI 444
            ++Y  +   +D  I    + DE+ +
Sbjct: 495 QRQY--DSLPEDAAI----NGDEVPM 514



>gi|482808759|gb|EOA85644.1| hypothetical protein SETTUDRAFT_169663 [Setosphaeria turcica Et28A]
          Length = 528

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 157/441 (35%), Positives = 245/441 (55%), Gaps = 7/441 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL VF  LGP+IR+KCPEGF LT++  +R+G    I++S  ++  MF +M++
Sbjct: 82  VYALASALPLLVFGALGPIIRRKCPEGFVLTEWTRQRYGVVAGIFLSACTLITMFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG+  L  VI    VTT+YT  GG + S +TDNIQG            
Sbjct: 142 ELSALQQIVTLLTGLKGLPVVIVECAVTTIYTSLGGFKVSFVTDNIQGVMVIGLIIMGVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I++S+ID S  L+ + LGWQL+YI+PVAV     F  GFW R F+S+ D++L 
Sbjct: 202 AVGVETHIDRSLIDKSGYLEPSLLGWQLIYILPVAVLTNDFFLSGFWMRTFASRTDKDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S+ +  +L  LG+ GM+A W+G +   +     LA F L   LP WV G+ +V+
Sbjct: 262 IGVSLASMGILIILTLLGVAGMLAAWSGAYKIGDAATGSLALFLLLNQLPSWVVGVVLVM 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            +S+SCAA+D+  SA  +  SND F N+L + V R   +    P V   L+  D+L++FL
Sbjct: 322 TISLSCAAFDSFQSAMISTGSNDFFRNKLNIWVIRACVVALIFPVVVVALRSPDILQIFL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIG 359
           I+DL++A+ +P +++GL D  Y+    D                 ++Y  +     +L+ 
Sbjct: 382 ISDLVSAAVVPCLVIGLSDRFYWYRGFDFVVGGLGGIFTIFLFGLVYYDGDVTLAGKLLL 441

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF-VFPKK-PEVV 417
           L  GLY  D+S  GAF+ AP+  + + F + G+R+  +WV  +++G  F  F +  P+ +
Sbjct: 442 LEGGLYGNDWSAFGAFVAAPVGGLLWAFGACGLRIGFLWVRARVQGRRFDAFDRPIPQPI 501

Query: 418 DTKKYAGNKFKDDTEIIQSSD 438
           D        F D   +I++S 
Sbjct: 502 DRP----GAFDDHDAVIENSS 518



>gi|126137249|ref|XP_001385148.1| urea transport protein [Scheffersomyces stipitis CBS 6054]
 gi|126092370|gb|ABN67119.1| urea transport protein [Scheffersomyces stipitis CBS 6054]
          Length = 520

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 153/422 (36%), Positives = 237/422 (56%), Gaps = 6/422 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA +GPLIRKKCP+GF LT++V  RFG    +Y+S  +   MF FM+ 
Sbjct: 80  VYTLCGAIPIVGFALVGPLIRKKCPDGFILTEWVRARFGIVTALYLSFFTCLTMFLFMVG 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+   + TLTG+D L  VI   IVTT+YT  GG + S ITDN QG            
Sbjct: 140 ELSAIRGAIETLTGLDALGAVIVECIVTTIYTSIGGFKISFITDNFQGALVIILIIICGA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+S+ D++L 
Sbjct: 200 GMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFLSGFWLRTFASRTDKDLW 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     +   F +   +G TG +AVW+G L   ++N   Y AFF L   +P W+    ++
Sbjct: 260 IGTSIAAFATFAICTLVGTTGFLAVWSGDLEVSDDN--GYNAFFILLAKMPRWIVAFVLI 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 298
             + +S   +D+L S   +  SND+F N+L +N TR L ++  VP V   +K  D +L++
Sbjct: 318 FCICLSTCTFDSLQSGMVSTISNDVFRNKLHINYTRGLVVLVMVPIVVLAVKVADNILQI 377

Query: 299 FLIADLLAASTMPPILLGLIDSLY-FLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL++A+ +P + LGL D+ + ++   D                +++Y  A++G +L
Sbjct: 378 YLIADLVSAAIIPAVFLGLSDTCFWYIRGFDVMCGGLGALIGVFIFGTVYYGTAREGAKL 437

Query: 358 IGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 416
           + +  G+Y   D+   GAF++AP   +  TF +  +R+ + +V+ K+ G  F    KPE+
Sbjct: 438 LLIWNGIYDPEDWGAFGAFVIAPFGGLVITFAAAALRIGAAYVYAKVSGNTFSALDKPEI 497

Query: 417 VD 418
           V+
Sbjct: 498 VE 499



>gi|119192082|ref|XP_001246647.1| hypothetical protein CIMG_00418 [Coccidioides immitis RS]
          Length = 490

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 207/361 (57%)

Query: 54  MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 113
           +F +M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDN+QG     
Sbjct: 84  LFLYMVAELSALQQIVNALTGLNGLPAVIVQVAVTTIYTSLGGFKVSFMTDNLQGAMVVG 143

Query: 114 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                     T   I++S+ID+S  L ++ LGWQL+YI+PVA+     F   FW R F+S
Sbjct: 144 LIIIGVITVGTKTTIDRSLIDSSGYLNASLLGWQLIYILPVAILTNDFFLSNFWLRTFAS 203

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 233
           K DR+LR+     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV
Sbjct: 204 KTDRDLRIGVSIASFTVLCILVLVGCTGLLAAWSGAWPGDPPQSGSIAFFLLLERLPSWV 263

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
            GI +V+ V +S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V   LK  
Sbjct: 264 VGIVLVMTVVLSTAAFDSLQSAMVSTASNDLFRNKLPLIYIRVGVVLCIIPVVVVALKSP 323

Query: 294 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 353
            VL++FLI+DL++AS +P ++LGL D  YF    +                +I+Y +A +
Sbjct: 324 SVLQIFLISDLVSASAIPVLILGLWDKCYFWKGFEVIAGGLGGILSVFIFGTIYYGSAYE 383

Query: 354 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 413
           G  LI L  GLY  D+S  GAF+ AP+    F  ++FG R+   +V  KI+G  F    K
Sbjct: 384 GGRLILLENGLYAEDWSAFGAFVAAPVGGFIFALIAFGSRIAYQFVIAKIQGRRFDAFDK 443

Query: 414 P 414
           P
Sbjct: 444 P 444



>gi|50305545|ref|XP_452732.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641865|emb|CAH01583.1| KLLA0C11913p [Kluyveromyces lactis]
          Length = 529

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 155/450 (34%), Positives = 249/450 (55%), Gaps = 9/450 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y+    +P+F+FA+ GP+IRKKCP+GF LT++V+ RFG     Y+S  +I  +F FM+S
Sbjct: 82  VYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFGIICGWYLSACTIITIFLFMVS 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           EL+++   + +LT +  L  +I   +VTT+YT  GG   S ITD IQ             
Sbjct: 142 ELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHISFITDTIQVSIVFILLIIVSC 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + + I+KS+I  S LLK+++LGWQL+YI+ VA+     F  GFW R F+++ D++L 
Sbjct: 202 AMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTNDFFMSGFWLRTFAARTDKDLM 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     +++L   +  +G+TGMIAVWAG  P  +   S  AFF +   +P WV G  +  
Sbjct: 262 IGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSGAAFFIVLTQMPGWVIGFVLAF 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V +S    D+L SA  +  SNDIF N+LP+   R + ++  VP V  GL   DVL ++L
Sbjct: 322 VVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRGIVVLIMVPVVVVGLIADDVLTIYL 381

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I DLL++S +P ++LGL     FL   +                +++Y + ++G +L+ +
Sbjct: 382 IVDLLSSSVVPILMLGLSSKFDFLTAWEIIGGGFGGLLSVWIFGTVYYDSPREGGKLLLI 441

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK-------IRGEEFVFPKK 413
             GLY  D++  GAF+VAP   + F F    VR I +++  K       +  ++F++  +
Sbjct: 442 WNGLYADDWAAFGAFVVAPFGGLIFGFFVLFVRTIIVYIDCKKNNKPFDLYSKKFIYRHE 501

Query: 414 PEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 443
            EV  T    G+K K  T + +  + + +E
Sbjct: 502 GEVQSTTT-DGDK-KSFTSVERELETESVE 529



>gi|156847319|ref|XP_001646544.1| hypothetical protein Kpol_1055p41 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117222|gb|EDO18686.1| hypothetical protein Kpol_1055p41 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 573

 Score =  261 bits (666), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 152/405 (37%), Positives = 234/405 (57%), Gaps = 5/405 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA    +P+F+FA+LGPLIRKK P GF LT++V  RFG     Y+S  +I  ++ F++S
Sbjct: 80  VYALSGGLPMFLFAFLGPLIRKKTPNGFVLTEWVFHRFGLLAGWYLSACTILTVYLFLVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E++++   + TLTG++ L  +I   +VT++YT  GG   S +TD IQ             
Sbjct: 140 EVASLKYAIETLTGINALPVIIIECVVTSIYTSIGGFNISFLTDTIQVSIVFILLIIVAC 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + + I+KS+I  S LLK+N LGWQL+YI+PVAV    LF  GFW R F+++++++L 
Sbjct: 200 AMGSYVDIDKSLIGPSGLLKANKLGWQLVYILPVAVFTNDLFMSGFWLRTFAARSNKDLL 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +       +L   +  +G+TG IAVWAG     +   S  AFF L   LP WV G T+V 
Sbjct: 260 IGCSIACFILVAFVTVVGVTGFIAVWAGFVSVADQENSGAAFFILLAQLPSWVMGFTLVF 319

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            + +S    D+L SA  +  SNDIF N+LP+ + R + +   VP V  GL   DVL ++L
Sbjct: 320 ILVLSTCTLDSLQSALVSTVSNDIFRNKLPILIVRGIVIAIMVPVVVVGLIAQDVLTIYL 379

Query: 301 IADLLAASTMPPILLGL---IDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           I DLL++S +P +++GL   +D+++   W +                SI+YH+AK+G +L
Sbjct: 380 IVDLLSSSVVPVLVIGLWSKMDNIW-TAW-EVISGGVGGILGVFIFGSIYYHSAKEGGKL 437

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 402
           + +  GLY+ D+S  GAF+VAP + I  +      RL S+ ++  
Sbjct: 438 LIISNGLYVDDWSTFGAFVVAPGAGIVTSLGVLAFRLSSIRLYNS 482



>gi|255718783|ref|XP_002555672.1| KLTH0G14718p [Lachancea thermotolerans]
 gi|238937056|emb|CAR25235.1| KLTH0G14718p [Lachancea thermotolerans CBS 6340]
          Length = 535

 Score =  260 bits (664), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 154/452 (34%), Positives = 242/452 (53%), Gaps = 8/452 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA    +P+F+FA+ GP+IR+K P GF LT++V +R+G+   +Y+S  +I  ++ FM+S
Sbjct: 80  VYALAGGLPMFLFAFFGPVIRRKVPNGFVLTEWVFQRYGKVCGLYLSACTILTLYLFMVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           EL+++   + +LT V  L  VI   +VTT+YT  GG   S ITD++Q             
Sbjct: 140 ELASLKFCIQSLTTVRALPVVIVECVVTTIYTTVGGFHISFITDSMQVSVVFALLVVVAC 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S I  S LLK N LGWQL+YI+ VA+     F  GFW R F++++DR+L 
Sbjct: 200 AMGSYIHIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDFFMSGFWLRTFAARSDRDLL 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +      ++L  ++  +G+TG IAVWAGL    +      +FF L   +PDWV G  +  
Sbjct: 260 IGCSLAFVVLVIMVSLIGVTGFIAVWAGLVDVADQDLGGSSFFVLLTAMPDWVMGFVLAF 319

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           AV +S    D+L SA  +  SND+F N+LPL   R L  +  VP V  GL   DVL +FL
Sbjct: 320 AVVLSTCTLDSLQSALVSTISNDVFRNKLPLVYARGLVALIMVPVVVVGLIAEDVLSIFL 379

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI-- 358
           I DLL+++ +P ++LGL    +FL+  +                +++Y + ++G  L+  
Sbjct: 380 IVDLLSSAVVPVLMLGLSSRFFFLSAWEVVGGGLGGIFAVWIFGTVYYDSPREGGRLLLV 439

Query: 359 --GL----PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPK 412
             GL      G+Y  D+S  GAF+VAP   I   FL   +R    +   ++   +F   K
Sbjct: 440 SNGLYGQDSKGVYGNDWSAFGAFVVAPFGGILVGFLILAIRTAVNYTRCRMHNLKFNMYK 499

Query: 413 KPEVVDTKKYAGNKFKDDTEIIQSSDPDEIEI 444
           K  +V+  ++     ++D  I ++      E+
Sbjct: 500 KTALVEEPEHNEPVLEEDATIKKTFTSRTSEV 531



>gi|303313113|ref|XP_003066568.1| hypothetical protein CPC735_057930 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240106230|gb|EER24423.1| hypothetical protein CPC735_057930 [Coccidioides posadasii C735
           delta SOWgp]
 gi|320036548|gb|EFW18487.1| urea transporter [Coccidioides posadasii str. Silveira]
          Length = 403

 Score =  258 bits (658), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 141/357 (39%), Positives = 204/357 (57%)

Query: 58  MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 117
           M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDN+QG         
Sbjct: 1   MVAELSALQQIVNALTGLNGLPAVIVQVAVTTIYTSLGGFKVSFMTDNLQGAMVVGLIII 60

Query: 118 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
                 T   I++S+ID+S  L ++ LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 61  GVITVGTKTTIDRSLIDSSGYLNASLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 120

Query: 178 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 237
           +LR+     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 121 DLRIGVSIASFTVLCILVLVGCTGLLAAWSGAWPGDPPQSGSIAFFLLLERLPSWVVGIV 180

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +V+ V +S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V   LK   VL+
Sbjct: 181 LVMTVVLSTAAFDSLQSAMVSTASNDLFRNKLPLIYIRVGVVLCIIPVVVVALKSPSVLQ 240

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +FLI+DL++AS +P ++LGL D  YF    +                +I+Y +A +G  L
Sbjct: 241 IFLISDLVSASAIPVLILGLWDKCYFWKGFEVIAGGLGGILSVFIFGTIYYGSAYEGGRL 300

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
           I L  GLY  D+S  GAF+ AP+    F  ++FG R+   +V  KI+G  F    KP
Sbjct: 301 ILLENGLYAEDWSAFGAFVAAPVGGFIFALIAFGSRIAYQFVIAKIQGRRFDAFDKP 357



>gi|494831159|gb|EON67651.1| hypothetical protein W97_06794 [Coniosporium apollinis CBS 100218]
          Length = 479

 Score =  257 bits (656), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 156/423 (36%), Positives = 248/423 (58%), Gaps = 6/423 (1%)

Query: 19  LIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKL 78
           +IR+KCPEGF LT++  +R+G    + +SL ++  +F +M++ELSA+  I+  LTG+D L
Sbjct: 45  IIRRKCPEGFVLTEWTRQRYGAVTALLLSLATLVTLFLYMVAELSALQQIVSALTGLDGL 104

Query: 79  APVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDL 138
             VI   +VTT+YT  GG + S ITDNIQG                +  I+KS++D+S L
Sbjct: 105 PAVIVQCVVTTIYTSLGGFKVSFITDNIQGAMVVGLIIIGVITVGVNTEIDKSLVDSSGL 164

Query: 139 LKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLG 198
           L+S+ LGWQLLYI+PVA+     F  GFW R F+S+ D++LR+     ++ +  +L F+G
Sbjct: 165 LESSLLGWQLLYILPVAIFTNVFFISGFWLRTFASRTDKDLRIGTGIATVAVAIILAFVG 224

Query: 199 LTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTA 258
            TG++A W+G WPG+   +  ++FF L   LP WV GI +V+ VS+S AA+D+  SA  +
Sbjct: 225 STGLLAAWSGAWPGDPPQDGAISFFLLLGQLPAWVVGIVLVMVVSLSTAAFDSFQSAMVS 284

Query: 259 NFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLI 318
           N SNDIF NRL +   R   ++  VP V   LK  D+L ++LI+DL++AS +P +++GL 
Sbjct: 285 NGSNDIFRNRLNIWFIRLSVVLIIVPVVVVALKSPDILTIYLISDLVSASLVPVLVIGLS 344

Query: 319 DSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVA 378
           D  Y+    +                +++Y +A  G +LI L  GLY  D+   GAF+ A
Sbjct: 345 DRCYWWRGFEVVVGALGGIFTVFLFGTVYYGDAGRGAKLILLEGGLYAEDWGAFGAFVAA 404

Query: 379 PLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSD 438
           P+ ++ +   +F +R+  +++  K++G  F    +P   D  ++AG      T+ + +  
Sbjct: 405 PVGALLWALAAFILRIAFLFIKAKVQGRRFDAFDRPIPADPGRFAG------TDALSTGT 458

Query: 439 PDE 441
            DE
Sbjct: 459 GDE 461



>gi|453084248|gb|EMF12293.1| hypothetical protein SEPMUDRAFT_46200, partial [Mycosphaerella
           populorum SO2202]
          Length = 475

 Score =  257 bits (656), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 147/410 (35%), Positives = 238/410 (58%), Gaps = 4/410 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP+IR+KCP+GF LTQ+ LER+G    +Y+S  S A ++ +M++
Sbjct: 23  VYALSSGLPLLIFAALGPIIRRKCPDGFVLTQWTLERYGLITSLYLSFFSCATIWLYMVA 82

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  ++  LTG++ L  +I  A +TT YT  GG R S +TDNIQG            
Sbjct: 83  ELSALQQVVNLLTGLNGLPALIVQAAITTTYTALGGFRVSFVTDNIQGAMVLLFLIVGTI 142

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
               ++ I++S+I  S+ L+ + LGWQLLYI+PVA+     F   FW RAF++K D++L 
Sbjct: 143 AIGVTVDIDRSLIPVSNYLEPSLLGWQLLYILPVAILTNDFFLSNFWLRAFAAKTDKDLY 202

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     ++ +  +   +G++G+IA W+G+  G     S +  FTL + LP WV GI +V+
Sbjct: 203 IGVSIAAVAVTIITTLVGVSGLIAGWSGVL-GNPPEASGIELFTLLETLPTWVVGIVLVM 261

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S +A+D+L SA  +  SND F N+L +   RF  ++  +P V   LK   VL+++L
Sbjct: 262 VVTLSISAFDSLQSALISTGSNDFFRNKLNIWWVRFFVVLLIIPTVVVALKSPSVLQIYL 321

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHN--AKDGIELI 358
           I+D+++A+ +P +++GL    YF    +                 ++Y    ++ G  LI
Sbjct: 322 ISDIISAAMIPCLVIGLSSKFYFWRGFEVVVGGLGGILSVFLFGLVYYDGDVSRAGSLLI 381

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
            L  GLY +D+SV G F+ AP+  + +   +F  R+  +W   K++G  F
Sbjct: 382 -LSDGLYASDWSVFGVFVAAPVGGLLWALAAFVARISVLWTVAKVKGHRF 430



>gi|465795812|emb|CCV00245.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 545

 Score =  253 bits (645), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 158/430 (36%), Positives = 240/430 (55%), Gaps = 10/430 (2%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YAF +I P++ F  LGPLIR+ CP+GFTL++++  RFG    ++ +L+ I +MFCFMI E
Sbjct: 26  YAFATIAPVWAFGLLGPLIRRVCPDGFTLSEYIRRRFGWPVGVFSALVFIGFMFCFMIVE 85

Query: 62  LSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           L+  G I+ T+   + K+ P + IAI TT+YT YGG +ASL TDN               
Sbjct: 86  LNTYGLIVQTIVPSMSKIIPPLIIAITTTIYTMYGGFKASLWTDNFNAVVVVVFIIIGAV 145

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
             +  + ++   + +  LL +++ G +L YI+ V++ FA +F++GFWQRAF+SK +  L 
Sbjct: 146 MFSVKLDLDSERVHDPRLLGAHAFGGELWYILTVSIVFAQMFNQGFWQRAFASKTNMGLY 205

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLESYLAFFTLFKVLPDWVSGITV 238
           +S    SI LF +   +G+ G +A WA +   P +E+ +   A F     +P WV G+ +
Sbjct: 206 VSVALASIPLFAICFLVGMAGPLAYWAHVQELPNDED-DGSNALFNALLYMPKWVHGLVL 264

Query: 239 VLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRV 298
           VL   +S +AYDT  SA  +   +D+F  RL +   R L L+ NVP V   L  +D+L+V
Sbjct: 265 VLTGVLSSSAYDTFQSAQISVIQSDLFLGRLNIWWCRVLLLLLNVPCVVLALIQIDILQV 324

Query: 299 FLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIEL 357
           FLIADL   + +P + +GLI      N  D                +I+YH +A  G +L
Sbjct: 325 FLIADLAGLAVIPAVFMGLIPGFDVFNGFDVVVGGCGGFLTVFVFGTIYYHGDAIRGGQL 384

Query: 358 IGLPLGLY-----ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPK 412
           IGLP GLY      +DYSV+GAF+ AP+  + F   S G+R++  W + +   + F   +
Sbjct: 385 IGLPDGLYGVDADASDYSVIGAFLAAPVGDLCFALASCGLRILVGWAYARYTNQPFTMLQ 444

Query: 413 KPEVVDTKKY 422
           K E     KY
Sbjct: 445 KREEYRMDKY 454



>gi|363755328|ref|XP_003647879.1| hypothetical protein Ecym_7216 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356891915|gb|AET41062.1| hypothetical protein Ecym_7216 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 517

 Score =  252 bits (644), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 158/443 (35%), Positives = 237/443 (53%), Gaps = 13/443 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +P++VFA  GP I+KKCP GF LT++V +R+G    +Y+S  +I  +F FM+S
Sbjct: 80  VYALTSALPMYVFAVFGPQIKKKCPNGFMLTEWVFQRYGTVAGLYLSACTILTLFLFMVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E++++   + TLT    LA VI   +VTT+YT  GG   S ITD++Q             
Sbjct: 140 EIASLKQAVETLTKGGGLAVVIVECVVTTIYTTIGGFNISFITDSLQTLVFLFIWIISAI 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                +++++S+I+ S LLK   LGWQL+YI+ VA+     F  GFW R F++K+D++L 
Sbjct: 200 AFGCYVKVDRSLIEPSGLLKPTRLGWQLIYILTVAIFTNDFFLSGFWLRTFAAKSDKDLL 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     + +L    V +G TG++AVW G  P G E+  S  AFF L   LP W+ G+ + 
Sbjct: 260 IGCSLAAGILVFFFVVVGFTGILAVWGGYVPIGSEDPGS--AFFVLLSELPSWIMGLVLT 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
             + +S    D+L SA  +  SND+F N+LPL  TR +  I  +P V  GL   DVL +F
Sbjct: 318 FVLVLSTCTLDSLQSALVSTISNDLFKNKLPLMYTRAIVGIVMIPVVIVGLIATDVLTIF 377

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 359
           LI DLL+++ +P ++LGL   + FL   +                + +Y N +DG  L+ 
Sbjct: 378 LIVDLLSSAVVPVLMLGLWSKMDFLTAWEIIGGGLGGLFCVFLFGTAYYGNTRDGGRLLL 437

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 419
           +  GLY  D+   GA + AP  S+   F    +R  S  ++ + R       KKP  V T
Sbjct: 438 ISDGLYKNDWGAFGAMVAAPFGSLLVGFSILAIR--SAVIYLRCRTT-----KKPFTVFT 490

Query: 420 KK--YAGNKF-KDDTEIIQSSDP 439
           +K  Y    + K D   I S  P
Sbjct: 491 RKIVYHDQIYSKQDDVSITSKSP 513



>gi|398408051|ref|XP_003855491.1| hypothetical protein MYCGRDRAFT_36927, partial [Zymoseptoria
           tritici IPO323]
 gi|339475375|gb|EGP90467.1| hypothetical protein MYCGRDRAFT_36927 [Zymoseptoria tritici IPO323]
          Length = 474

 Score =  251 bits (641), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 238/419 (56%), Gaps = 2/419 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PLF+FA L P+IR+KCPEGF LT++  +R+G    +Y+S  ++A M+ +M++
Sbjct: 23  VYALSSGLPLFIFAVLAPIIRRKCPEGFVLTEWTRQRYGSVTSLYLSFFTLATMWLYMVA 82

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  ++  LTG++ L  VI    VTT+YT  GG R S +TDNIQG            
Sbjct: 83  ELSALQQVVNLLTGLNGLPAVIVQCAVTTIYTAAGGFRVSFVTDNIQGAMVLLFIIIGTI 142

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
             AT++ I++S I  S  L +N LGWQLLYI+PVA+     F   FW RAF++K D++L 
Sbjct: 143 SIATTVDIDRSSIPASGYLNANLLGWQLLYILPVAILTNDFFLSQFWMRAFAAKTDKDLW 202

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     ++ +  +   +G++G++A W+G+  G   + S +  FTL   LP WV G+ +V+
Sbjct: 203 IGVSIAAVAVTCITTLIGVSGLVAGWSGVL-GTPPVPSGIELFTLLNTLPAWVVGVILVM 261

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S +A+D+  SA  +  SND+F N+L   + R + +I  VP +   LK   VL+++L
Sbjct: 262 VVTLSTSAFDSFQSAIISTGSNDLFRNKLNTWIVRAIVVIIIVPTMIVALKSPSVLQIYL 321

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIG 359
           I+DLL+AS  P +++GL    Y     +                 ++Y  +A    EL+ 
Sbjct: 322 ISDLLSASITPCLVIGLSSKAYCWRGFEVVIGGLGGILSVFFFGLVYYDGDAHKAGELLI 381

Query: 360 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVD 418
           L  GLY  D+S  GAF+ AP+  + F   +F +R+  +W+  K  G  F    +P   D
Sbjct: 382 LSGGLYGDDWSAFGAFVAAPVGGLLFAISAFLLRIGVLWLKAKASGTRFTALDRPTAPD 440



>gi|296804300|ref|XP_002843002.1| urea transport protein [Arthroderma otae CBS 113480]
 gi|238845604|gb|EEQ35266.1| urea transport protein [Arthroderma otae CBS 113480]
          Length = 513

 Score =  250 bits (638), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 147/379 (38%), Positives = 210/379 (55%), Gaps = 23/379 (6%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +PL  FA++GP+IR+K PE                        +  +F +M++
Sbjct: 158 VYGLSSALPLLAFAFVGPIIRRKFPE-----------------------VLITLFLYMVA 194

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  I+  LTG+D L  VI   +VTT+YT  GG + S +TDNIQG            
Sbjct: 195 ELSALQQIVTALTGLDGLPAVIVQVVVTTIYTSLGGFQVSFLTDNIQGGMVVGLIIIAVI 254

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+KS+ID+S LLK   LGWQL+YI+PVA+     F   FW R F+SK DR+LR
Sbjct: 255 TVGARTNIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDRDLR 314

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S  +  +LV +G TG++A W+G+WPG+      +AFF L + LP WV GI +V+
Sbjct: 315 IGISIASFAVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLEKLPSWVVGIVLVM 374

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            VS+S AA+D+L SA  +  SNDIF N+LPL   R   ++  +P V   L+   VL++FL
Sbjct: 375 TVSLSTAAFDSLQSAMVSTASNDIFQNKLPLIYVRIGVVLCIIPVVVVALRSPSVLQIFL 434

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I+DL++AS +P ++LGL D LY+    +                +I+Y NA +G +LI L
Sbjct: 435 ISDLVSASAIPVLVLGLSDKLYWWTAFEVIIGGLGGILSVFIFGTIYYGNATEGGKLILL 494

Query: 361 PLGLYITDYSVLGAFIVAP 379
             GLY  D+S  G     P
Sbjct: 495 QNGLYANDWSAFGIITPTP 513



>gi|320581949|gb|EFW96168.1| urea transporter, putative urea/polyamine transporter, putative
           [Ogataea parapolymorpha DL-1]
          Length = 463

 Score =  249 bits (636), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 149/421 (35%), Positives = 236/421 (56%), Gaps = 11/421 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+F+F+  GP+IR++CPEGF LT++V +RFG    +Y+S  +I  MF FM+S
Sbjct: 23  VYTISGAIPIFLFSLFGPMIRRRCPEGFVLTEWVFQRFGPVTALYLSAFTIFTMFLFMLS 82

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           EL+A+   +  LTG+D    ++   +VTT+YT  GG   S ITD  Q             
Sbjct: 83  ELTAIEYAIEALTGLDATPAMVVECVVTTIYTFLGGFHVSFITDAFQAAFVLVLLVIGVV 142

Query: 121 XXATSIRIEKSVIDNSD--LLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRE 178
             ATSI I+  +   ++  LL +N LGW LLYI+PVA+     F  GFW R F++K D++
Sbjct: 143 GYATSIHIDMDLKHATEDQLLHANKLGWMLLYILPVAIITNDCFLSGFWLRTFAAKTDKD 202

Query: 179 LRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGIT 237
           L + A   +++   V   +GL G++AVW G +   +EN  +  AFF L   + +WV G+ 
Sbjct: 203 LYIGASIAAVVAGIVCTLVGLPGILAVWTGDMKVYDENGSN--AFFILVSKMDNWVIGVI 260

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV-YWGLKDLDVL 296
           ++ ++ +S A +D+L SATT++ SND F N++ +   RF+ ++  VP++        +VL
Sbjct: 261 LIFSIGISTATFDSLQSATTSSISNDFFRNKVNIMWVRFIVILVMVPSIVVAVKAAANVL 320

Query: 297 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIE 356
           +++LIADL++AS +P I LGL     FL  +D                +I+Y NAK+G  
Sbjct: 321 QIYLIADLVSASVIPIIFLGLSKRFDFLRGLDVMVGGLGALVAVFIYGTIYYGNAKEGAR 380

Query: 357 LIGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 415
           L+ +  G+Y   D+   GAF++AP+      F    +R+  + +  KI G +    + PE
Sbjct: 381 LLLIWNGIYSDKDWGAFGAFVIAPIGGCLIGFACAAIRISVLKIKDKITGID----RLPE 436

Query: 416 V 416
           V
Sbjct: 437 V 437



>gi|366987111|ref|XP_003673322.1| hypothetical protein NCAS_0A03750 [Naumovozyma castellii CBS 4309]
 gi|342299185|emb|CCC66933.1| hypothetical protein NCAS_0A03750 [Naumovozyma castellii CBS 4309]
          Length = 579

 Score =  248 bits (634), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 151/415 (36%), Positives = 231/415 (55%), Gaps = 8/415 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA    +P+FVFAWLGPLIRKK P+GF LT++V  RFG     Y+S  +I  ++ F++S
Sbjct: 80  VYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLICGWYLSACTILTVYLFLVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E++++   + T+T +  L  +I   +VTT+YT  GG   S ITD +Q             
Sbjct: 140 EVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISFITDFLQVSTVFVLLIIVAC 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I++S+I  S LLK N LGWQL+YI+  A+     F  GFW R F+S++D++L 
Sbjct: 200 AMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTNDFFMSGFWLRTFASRSDKDLM 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +      ++L      +G+TG IAVWAGL    +   S  AFF L   LP WV G T+V 
Sbjct: 260 IGCSVACVILVVFCTVVGVTGFIAVWAGLVQVADEENSGAAFFILLAQLPTWVMGFTMVF 319

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
              +S    D+L SA  +  SND+F NRL +   R + ++  VP V  GL   +VL ++L
Sbjct: 320 VTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWVRGIVVLIMVPVVVVGLIAENVLNIYL 379

Query: 301 IADLLAASTMPPILLGL---IDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           I DLL++S +P ++LG     D L+   W +                +++YH+A++G  L
Sbjct: 380 IVDLLSSSVVPVLVLGFWSKFDDLW-TAW-EVIGGGLGGILSVWIFGTVYYHSAREGGRL 437

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPK 412
           + +  GLY+ D+S  GAF+VAP   + F+     +RLI + ++   + EE +F +
Sbjct: 438 LLISNGLYVDDWSTFGAFVVAPGGGLVFSGFILVIRLICVRLY---KDEEGLFHR 489



>gi|261193629|ref|XP_002623220.1| urea transporter [Ajellomyces dermatitidis SLH14081]
 gi|239588825|gb|EEQ71468.1| urea transporter [Ajellomyces dermatitidis SLH14081]
          Length = 417

 Score =  248 bits (632), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 204/351 (58%)

Query: 58  MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 117
           M++ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDN+QG         
Sbjct: 1   MVAELSALQQIITALTGLDGLPVVIVEVAVTTIYTSLGGFKVSFVTDNLQGAMVVGLIII 60

Query: 118 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
                 T + I+++++++S  L+ + LGWQL+YI+P+A+     F   FW R F+SK DR
Sbjct: 61  AVITVGTEVNIDRALVESSGFLEPSLLGWQLIYILPIAILTNDFFLSNFWLRTFASKTDR 120

Query: 178 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 237
           +LR+     S  +F +L  +G++G++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 121 DLRIGVSIASGAIFCILTLVGVSGLLAAWSGAWPGDPPQLGSIAFFLLLEKLPAWVVGIV 180

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P +   L    VL+
Sbjct: 181 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVIVVALMSPSVLQ 240

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +FLI+DL++AS++P ++ GL D +Y+    +                +I+Y +A  G +L
Sbjct: 241 IFLISDLVSASSIPVLVFGLWDKVYWWTGFEVVVGGLGGIFSVFIFGTIYYGDAHAGAKL 300

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
           I L  GLY  D+SV GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 301 ILLENGLYAKDWSVFGAFLAAPLGGILFAIAALILRLGYHYLLAKSQHRRF 351



>gi|344233479|gb|EGV65351.1| hypothetical protein CANTEDRAFT_119625 [Candida tenuis ATCC 10573]
          Length = 518

 Score =  247 bits (631), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 156/440 (35%), Positives = 241/440 (54%), Gaps = 12/440 (2%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  F + GP+IRKKCP+GF L+++V  RFG    +Y+SL +   MF +M++
Sbjct: 80  VYTICGAIPIASFGFFGPIIRKKCPDGFILSEWVRHRFGIVTALYLSLFTCLTMFLYMVA 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELS+V   + TLTG+D L  VI   +VTT+YT  GG + S ITDN QG            
Sbjct: 140 ELSSVSLAIETLTGLDALGAVIVECVVTTIYTSVGGFKVSFITDNFQGALVLLLIIICAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S I  S LL++N LGW+L+Y+  VAV     F   FW R F+SK+DR L 
Sbjct: 200 GMGSYIDIDTSKIGPSHLLQANKLGWELIYVFFVAVGTNAFFLNSFWLRTFASKSDRGLA 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 239
           +     ++++  +   +G+ G +AVW+G L  G+EN    +AFF L   +P W+    ++
Sbjct: 260 IGTSVSAVIVMVICTLVGVPGFLAVWSGDLTVGDEN--GSMAFFILLAKMPGWIIAFVLI 317

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 298
             +++S   +D+L SA  +  SNDIF NRL     R + +I  VP V   +K  D +L++
Sbjct: 318 FTITISTCTFDSLQSAFVSTISNDIFRNRLKTIWVRAMVVIMIVPIVVLAVKVADNILQI 377

Query: 299 FLIADLLAASTMPPILLGLIDSLY-FLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +LIADL+++S +P I LGL D  + FL  +D                +++Y  AK+G +L
Sbjct: 378 YLIADLISSSIIPIIFLGLSDRFFWFLTGVDVMVGGLGALVAIFIFGTVYYGTAKEGGKL 437

Query: 358 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP-- 414
           + +  GLY   D+   GAF++AP   I    +    R+ ++WV+ KI  + F   ++P  
Sbjct: 438 LLIWNGLYDAEDWGAFGAFVIAPFGGILIALVCVVARVGAIWVYCKITKKPFTALQRPVP 497

Query: 415 -EVVDTK---KYAGNKFKDD 430
            E+V+ +    Y     K D
Sbjct: 498 VEIVEEEFDSAYGSTNAKSD 517



>gi|164656775|ref|XP_001729515.1| hypothetical protein MGL_3550 [Malassezia globosa CBS 7966]
 gi|159103406|gb|EDP42301.1| hypothetical protein MGL_3550 [Malassezia globosa CBS 7966]
          Length = 589

 Score =  245 bits (625), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 155/424 (36%), Positives = 239/424 (56%), Gaps = 12/424 (2%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YAF +I PL+ FA+ GPLIR  CP+GFTL +FV  RFG    I+ +++ I +MFCFMI E
Sbjct: 15  YAFSTIAPLWAFAFFGPLIRHYCPDGFTLAEFVRRRFGWVIGIFSAMVFIGFMFCFMIVE 74

Query: 62  LSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           L+    I+ ++   + K+ P + IA+ TT+YT YGG +ASL TDN               
Sbjct: 75  LNTYSVIVRSIQPDISKVIPPLIIALTTTIYTTYGGFKASLWTDNFNAIVVIVFIIIGAV 134

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                + I+K ++ +S +L ++ LG +L YI+ +++ F+ +F++GFWQRAF+SK +  L 
Sbjct: 135 MFGKRLDIDKDLMHDSGMLGAHRLGGELWYILTISIIFSQMFNQGFWQRAFASKTNTGLY 194

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP----GEENLESY----LAFFTLFKVLPDW 232
           LS    +I LF +   +G+ G +A W+ + P      E+   Y     A F     +P W
Sbjct: 195 LSVAMATIPLFAICFLVGMAGPLAYWSHVQPPLNTSTEDTSLYDDGSNALFRALLYMPKW 254

Query: 233 VSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKD 292
           V G+ +VL   +S +AYDT  SA  +   +D+  +R+ +   R + ++ NVP V   + D
Sbjct: 255 VHGLVLVLTGVLSSSAYDTFQSAMISVIESDLLLSRVNIWWCRLILIMFNVPCVALAVID 314

Query: 293 LDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NA 351
           +D+L+VFL+ADL   + +P + LGL   L  LN  D                +I+Y+ +A
Sbjct: 315 IDILQVFLVADLAGLAVIPSVFLGLAPRLDVLNGFDLVVGGCGGFLTVFVFGTIYYNGDA 374

Query: 352 KDGIELIGLPLGLY--ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFV 409
            +G +LIGLP GLY    DYSV+GAF+ APL  + FT  S G R++  W++ +I    F 
Sbjct: 375 IEGGQLIGLPNGLYGDPDDYSVIGAFLAAPLGGMGFTLASCGTRILLGWLYARITNTPFT 434

Query: 410 FPKK 413
             +K
Sbjct: 435 MLRK 438



>gi|429848401|gb|ELA23890.1| urea transporter [Colletotrichum gloeosporioides Nara gc5]
          Length = 458

 Score =  241 bits (616), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/393 (34%), Positives = 212/393 (53%), Gaps = 37/393 (9%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP+IR+K PEGF LT +  +R+G    +Y+S M++  +F +M++
Sbjct: 82  VYALSSSLPLLIFAVLGPIIRRKTPEGFVLTAWTRQRYGTIAMLYLSFMTLVTLFLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LT +D L  +I   ++TT+YT  GG + S ITDN+QG            
Sbjct: 142 ELSAIGQVVNALTSLDGLPVMIVQCVITTIYTSLGGFKISFITDNLQGAMVVCLIIIVAI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+ S+ID S LLK   LGWQLLYI+P+ +     F  GFW R F+SK DR+LR
Sbjct: 202 TMGVKTEIDTSLIDTSGLLKPTLLGWQLLYILPICILTNDFFLSGFWLRTFASKTDRDLR 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVV 239
           +       ++  VL  +G+TG++A W+G  P ++  +S  +AFF L + LP WV GI +V
Sbjct: 262 IGVSIAVAVILCVLTMVGVTGLVAAWSGALPLDQIADSGSVAFFLLLQQLPAWVVGIVLV 321

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           +  ++S AA+D+L SA   +                                   VL+++
Sbjct: 322 MVCTLSTAAFDSLQSAMAPS-----------------------------------VLQIY 346

Query: 300 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELI 358
           LI+DL++AS +P ++ GL+D  Y+    +                 +FY  +A+    L+
Sbjct: 347 LISDLVSASVIPVLVFGLVDRFYWWRGFEVVVGGLGGILTVFLFGLVFYEGDAQKAANLL 406

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFG 391
            +  GLY  D+SV GAF+ AP+ S  + F + G
Sbjct: 407 IISEGLYADDWSVFGAFVAAPVGSFLWGFGALG 439



>gi|325094525|gb|EGC47835.1| urea transporter [Ajellomyces capsulatus H88]
          Length = 428

 Score =  240 bits (613), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 207/355 (58%)

Query: 54  MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 113
           +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG     
Sbjct: 7   LFLYMVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVG 66

Query: 114 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                     T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+S
Sbjct: 67  LIVIAVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFAS 126

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 233
           K DR+LR+     S  +F +L  +G+TG++A W+G WPG       +AFF L + LP WV
Sbjct: 127 KTDRDLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGNPPQLGSIAFFLLLEQLPGWV 186

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
            GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK  
Sbjct: 187 VGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSP 246

Query: 294 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 353
            VL++FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  
Sbjct: 247 SVLQIFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHA 306

Query: 354 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
           G +LI L  GLY  D+S  GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 307 GAKLILLGNGLYAEDWSAFGAFVAAPLGGILFGIGALLLRLSYHYLLAKWQHRRF 361



>gi|240275165|gb|EER38680.1| urea transporter [Ajellomyces capsulatus H143]
          Length = 428

 Score =  239 bits (610), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 206/355 (58%)

Query: 54  MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 113
           +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG     
Sbjct: 7   LFLYMVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVG 66

Query: 114 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                     T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+S
Sbjct: 67  LIVIAVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFAS 126

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 233
           K DR+LR+     S  +F +L  +G+TG++A W+G WPG       +AFF L + LP WV
Sbjct: 127 KTDRDLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGNPPQLGSIAFFLLLEQLPGWV 186

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
            GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK  
Sbjct: 187 VGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSP 246

Query: 294 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 353
            VL++FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  
Sbjct: 247 SVLQIFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHA 306

Query: 354 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
           G +LI L  GLY  D+S  GAF+ APL  I F   +  +RL    +  K +   F
Sbjct: 307 GAKLILLGNGLYAEDWSAFGAFVAAPLGGILFGIGALLLRLSYHHLLAKWQHRRF 361



>gi|367008374|ref|XP_003678687.1| hypothetical protein TDEL_0A01440 [Torulaspora delbrueckii]
 gi|359746344|emb|CCE89476.1| hypothetical protein TDEL_0A01440 [Torulaspora delbrueckii]
          Length = 554

 Score =  238 bits (607), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 145/407 (35%), Positives = 224/407 (55%), Gaps = 3/407 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA    +P+F+FA+LGP+IRKK P GF LT++V  RFG     Y+   +I  +F FM+S
Sbjct: 80  VYALAGGLPMFLFAFLGPIIRKKTPNGFVLTEWVFHRFGLLTGWYLGACTILTVFLFMVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E++++   + T+ G+  L  +I   +VTT+YT  GG   S ITD +Q             
Sbjct: 140 EVASLKYAIETIAGIKALPVIIIECVVTTIYTTIGGFHISFITDTLQVSVVFVLLIIVAC 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                + I+ S+I+ S LLK+N LGWQL+YI+  A+     F  GFW R F+S+++++L 
Sbjct: 200 AMGKYVHIDSSMIEPSGLLKANKLGWQLVYILTFAIFTNDFFMSGFWLRTFASRSNKDLM 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +      ++L   +  +G+TG IAVWAGL    +   S  AFF L   LP WV G T+V 
Sbjct: 260 IGCSIACVILVVFVTVIGVTGFIAVWAGLISVADEENSGAAFFILLAQLPSWVMGFTLVF 319

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V +S    D+L SA  ++ SND+F N++P+   R L L+  VP V  GL   DVL ++L
Sbjct: 320 VVVLSTCTLDSLQSALVSSVSNDVFRNKIPIMYVRGLVLLVMVPVVVVGLIAEDVLSIYL 379

Query: 301 IADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
           I DLL++S +P ++ GL      Y+  W +                +++Y + ++G +L+
Sbjct: 380 IVDLLSSSVVPVLVFGLSKRFEKYWTGW-EVVGGGLGGILATWIFGTVYYDSPEEGGKLL 438

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRG 405
            +  GLY  D+   GAF+VAP   I F F    +RL  + +++   G
Sbjct: 439 LITNGLYADDWGTFGAFVVAPFGGIAFGFFIMLIRLDCVKLYSNKDG 485



>gi|225558773|gb|EEH07057.1| urea transporter [Ajellomyces capsulatus G186AR]
          Length = 418

 Score =  237 bits (604), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 205/351 (58%)

Query: 58  MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 117
           M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG         
Sbjct: 1   MVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVGLIVI 60

Query: 118 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
                 T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 61  AVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 120

Query: 178 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 237
           +LR+     S  +F +L  +G+TG++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 121 DLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGDPPQLGSIAFFLLLEQLPGWVVGIV 180

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK   VL+
Sbjct: 181 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSPSVLQ 240

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           +FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  G +L
Sbjct: 241 IFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHAGAKL 300

Query: 358 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
           I L  GLY  D+S  GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 301 ILLGNGLYGEDWSAFGAFVAAPLGGILFGIGALLLRLSYHYLLAKRQHRRF 351



>gi|254567718|ref|XP_002490969.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238030766|emb|CAY68689.1| Hypothetical protein PAS_chr2-1_0088 [Komagataella pastoris GS115]
 gi|328352498|emb|CCA38897.1| Sodium-coupled monocarboxylate transporter 2 [Komagataella pastoris
           CBS 7435]
          Length = 539

 Score =  236 bits (602), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 143/441 (32%), Positives = 237/441 (53%), Gaps = 7/441 (1%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y     +P+F F++ GPLIR+KCPEGF LT++  +RFG     Y+SL +I  MF FM++E
Sbjct: 80  YTIVGALPIFFFSFWGPLIRRKCPEGFVLTEWTFQRFGSVTGYYLSLATILTMFLFMVAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           LSA+   +  LTG+D L  VI   IVTT+YT  GG + S  TDN Q              
Sbjct: 140 LSAIKFAVEALTGLDGLPVVIVECIVTTIYTSIGGFQVSFSTDNYQACVVLVLAVIGVIG 199

Query: 122 XATSIRIEKSVIDNSD--LLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 179
            A ++ I+  +   ++  LL +N LGWQLLYI+ +A++    F  GFW R F++K +++L
Sbjct: 200 FALNVNIDPELKRETESYLLGANKLGWQLLYILFIAIATCDCFISGFWLRTFAAKTNKDL 259

Query: 180 RLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITV 238
            +     SI+   +   +GL G+  VW G +  G    E YL+FF +   + +W+ G+ +
Sbjct: 260 MIGTGIASIVAMTICTLVGLPGIFGVWTGDVVIGSP--EGYLSFFIMVSTMGNWMIGLIL 317

Query: 239 VLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV-YWGLKDLDVLR 297
           + ++ +S   +D+L S  T+   ND    R+PL   R ++++  VP++        DVL+
Sbjct: 318 IFSIVLSTCTFDSLQSGLTSTIVNDFGRGRMPLWAARVITILVMVPSIVVAVKVADDVLK 377

Query: 298 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 357
           ++ IADL+++S +P + +GL    YF +  +                +++Y +A +G +L
Sbjct: 378 IYFIADLISSSVIPSLFIGLSTRFYFWSGWEVVGGGFAGLFFVWVFGTVYYGDAAEGGKL 437

Query: 358 IGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 416
           + +  G+Y + D+   GAF+VAP  S+    +  GVRL  + V++ I+G  F    +PE 
Sbjct: 438 LLIWNGIYDSEDWGPFGAFVVAPGVSLVGGLIICGVRLAVLKVYSNIKGTPFTALDRPEK 497

Query: 417 VDTKKYAGNKFKDDTEIIQSS 437
           +     A     D  E+ + +
Sbjct: 498 LGFGGVAIGDSSDIEEVYEET 518



>gi|365985345|ref|XP_003669505.1| hypothetical protein NDAI_0C06030 [Naumovozyma dairenensis CBS 421]
 gi|343768273|emb|CCD24262.1| hypothetical protein NDAI_0C06030 [Naumovozyma dairenensis CBS 421]
          Length = 573

 Score =  234 bits (597), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 147/381 (38%), Positives = 214/381 (56%), Gaps = 3/381 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     +P+FVFA+LGPLIRKK P GF LT++V  RFG     Y+S  +I  ++ F++S
Sbjct: 80  VYTIAGGLPMFVFAFLGPLIRKKTPNGFVLTEWVFHRFGLICGWYLSACTILTVYLFLVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E++++   + T+T +  L  +I   IVTT+YT  GG   S ITD++Q  A          
Sbjct: 140 EVASLKYAIETMTQIKALPVIIIECIVTTIYTTIGGFNISFITDSLQVSAVFVLLIIVAC 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I++S I  S LLKSN LGWQL+YI+  A+     F  GFW R F+S++D++L 
Sbjct: 200 AMGSYIDIDRSKIGPSGLLKSNKLGWQLIYILVFAIFTNDFFMSGFWLRTFASRSDKDLI 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +       +L      +G+TG IAVWAGL    +   S  AFF L   LP WV G T+V 
Sbjct: 260 IGCSIACFILVIFCTVIGVTGFIAVWAGLISVNDEENSGAAFFILLSELPSWVMGFTIVF 319

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           +V +S    D+L SA  +  SNDIF N+LP+   R + ++   P V  GL   DVL ++L
Sbjct: 320 SVILSTCTLDSLQSALVSTISNDIFRNKLPIMYVRGIVVLIMFPVVVVGLIAEDVLNIYL 379

Query: 301 IADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
           I DLL++S +P +++GL   L   +  W +                +I+Y +A++G  L+
Sbjct: 380 IVDLLSSSVVPVLVVGLWSKLDNIWSAW-EVVGGGLSGIFSVWVFGTIYYGSAREGGRLL 438

Query: 359 GLPLGLYITDYSVLGAFIVAP 379
            +  GLYI D+S  GAF VAP
Sbjct: 439 LISNGLYINDWSTFGAFCVAP 459



>gi|485923385|gb|EOD48562.1| putative urea transporter protein [Neofusicoccum parvum UCRNP2]
          Length = 349

 Score =  231 bits (588), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 203/345 (58%)

Query: 49  MSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG 108
           M++  +F +M++ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDNIQG
Sbjct: 1   MTLITLFLYMVAELSALQQIVTALTGLDGLPAVIVECAVTTIYTSLGGFKVSFVTDNIQG 60

Query: 109 WAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQ 168
                              I++S+ID+S  L+S+ LGWQL+YI+PVA+     F  GFW 
Sbjct: 61  VMVLGLIIIGVITVGVETHIDRSLIDSSGYLESSLLGWQLIYILPVAILTNDFFISGFWL 120

Query: 169 RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKV 228
           R F+S+ DR+LR+     ++++  +L  +G TG++A W+G+WPG+   E  +AFFTL   
Sbjct: 121 RTFASRTDRDLRIGTTIATVVVTIILTLVGCTGLLAAWSGVWPGDPPQEGSIAFFTLLAT 180

Query: 229 LPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYW 288
           LP WV GI +V+ V++S AA+D+  SA  +  SND+F N LPL   R   + A VP V  
Sbjct: 181 LPAWVVGIVLVMVVALSTAAFDSFQSAMVSTGSNDLFRNALPLWCIRAAVVAAIVPVVVV 240

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFY 348
            L+   VL+V+LI+DL++AS +P +++GL D+ ++ +  +                +++Y
Sbjct: 241 ALRSPSVLQVYLISDLVSASLVPVLVVGLCDACWWWSGAEVVVGGLGGIFTVFLFGTVYY 300

Query: 349 HNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 393
            NA+DG  LI L  GLY  D+S  GAF+ AP+        S GV 
Sbjct: 301 CNARDGGRLILLENGLYGDDWSAFGAFVAAPVGDAVCGAGSAGVE 345



>gi|344301867|gb|EGW32172.1| hypothetical protein SPAPADRAFT_61262 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 392

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 134/359 (37%), Positives = 205/359 (57%), Gaps = 6/359 (1%)

Query: 54  MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 113
           MF FM+ ELSA+   L TLTGV+ LA VI   +VTT+YT +GG R S ITDN QG     
Sbjct: 1   MFLFMVGELSAISGALETLTGVNALAAVIVECVVTTIYTFFGGFRISFITDNFQGACVLI 60

Query: 114 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                     + I I+ S +  S LLKSN LGWQL+YI+ VA+     F  GFW R F+S
Sbjct: 61  LLIICAAGMGSYIEIDPSKVGPSGLLKSNKLGWQLVYILFVAIVTNDCFLSGFWLRTFAS 120

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDW 232
           K D++L +     + + F +   +G+ G +AVW+G L  G++  E Y AFF L   +P W
Sbjct: 121 KTDKDLWIGTSLAAFVTFVITTLVGVPGFLAVWSGDLTVGDD--EGYNAFFILLAKMPRW 178

Query: 233 VSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKD 292
           +    ++  V +S   +D+L SA  +  SND+F N+L L+ TR + ++  VP V   +K 
Sbjct: 179 LVAFVIIFCVVLSTCTFDSLQSAMVSTISNDVFRNKLQLHWTRCIVILVMVPIVVLAVKV 238

Query: 293 LD-VLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHN 350
            D +L+++LIADL++A+ +P + LGL DS  +FL   D                +++Y +
Sbjct: 239 ADNILQIYLIADLVSAAIIPALFLGLSDSWFWFLRGFDIMCGGLGALLGVFIFGTVYYGS 298

Query: 351 AKDGIELIGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 408
           A++G +L+ +  G+Y + D+   GAF++AP   I  T ++ GVR+   + ++K  G+ F
Sbjct: 299 AREGGKLLLIWNGIYSSEDWGAFGAFVIAPFGGILITLVAAGVRIAGAYCYSKATGKPF 357



>gi|513034046|gb|AGO14012.1| AaceriAGR155Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 502

 Score =  228 bits (580), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 220/393 (55%), Gaps = 2/393 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +P++VFA+ GPLI++ CP+GF LT++VL RFGR   +Y+S  ++  ++ FM+S
Sbjct: 80  VYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAALYLSACTMLTLYLFMVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E+ ++   +  L+ +  +  VI   +VTT+YT  GG   S +TD++Q             
Sbjct: 140 EIVSLRLAVEALSNIKPIPVVIVQCVVTTIYTAIGGFHISFVTDSLQATVVLLLLIVCAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              TS++++ + I  S LL+ + LGWQL+YI+ +A+     F  GFW R F+++++R+L 
Sbjct: 200 AVGTSVKVDPARIGPSGLLRPSRLGWQLVYILTIAIFTNDFFMSGFWLRTFAARSNRDLL 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     + +L  VL+ +G+TG++AVWAG  P  +   +  +FF L   LP WV+G+ +  
Sbjct: 260 IGCSLAAALLAIVLLLIGVTGLLAVWAGYAPVADAESA--SFFLLIAELPAWVNGVVLAF 317

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V +S    D+  SA  +  SND+F NRL     R    +  VP V  GL   D+L ++L
Sbjct: 318 VVVLSTCTLDSFQSALVSTVSNDLFRNRLRPIYARAAVAVVMVPVVVVGLLATDILAIYL 377

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I DLL+A+ +P +LLG       ++  +                +I+YH+A++G  L+ +
Sbjct: 378 IVDLLSAAVVPVMLLGFWPRFARMSAYEVIGGGLGGLLCVFIFGAIYYHSAREGGRLLII 437

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 393
             GLY  D+   GA + AP+ S+ F  + F VR
Sbjct: 438 ANGLYADDWGTFGAMVAAPVGSLLFAGIIFLVR 470



>gi|116193701|ref|XP_001222663.1| hypothetical protein CHGG_06568 [Chaetomium globosum CBS 148.51]
 gi|88182481|gb|EAQ89949.1| hypothetical protein CHGG_06568 [Chaetomium globosum CBS 148.51]
          Length = 372

 Score =  227 bits (578), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 121/271 (44%), Positives = 173/271 (63%), Gaps = 2/271 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP+IR+KCP+GF LT++  +R+G    +Y+S MS+  +F +MIS
Sbjct: 82  VYALSSALPLLIFAALGPIIRRKCPQGFVLTEWTRQRYGTVAALYLSFMSLVTLFLYMIS 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++  LTG+D L  +I   IVTT+YT  GG + S  TDNIQG            
Sbjct: 142 ELSAIGQVVNLLTGIDGLPVLIVECIVTTIYTSVGGFKVSFFTDNIQGAMVMGLILIATI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                 +I+ S+I++S L K + LGWQLLYI+PVA+     F   FW R F+SK DR+L 
Sbjct: 202 TIGVETKIDTSLIESSGLTKPSLLGWQLLYILPVAILTNDFFLSHFWLRTFASKTDRDLW 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN--LESYLAFFTLFKVLPDWVSGITV 238
           L      + +  ++  +G TG+IA WAGLWPG E+  ++  +AFF L   LP+WV G+ V
Sbjct: 262 LGISGAVVGVLVIVTLVGSTGLIAAWAGLWPGPEDAPVDGSVAFFALLMQLPNWVVGVVV 321

Query: 239 VLAVSMSCAAYDTLISATTANFSNDIFNNRL 269
           V+AV++S AA+D+  SA   + SND+F N+L
Sbjct: 322 VMAVTLSTAAFDSFQSAMVTSASNDLFRNKL 352



>gi|361125484|gb|EHK97525.1| putative Eukaryotic translation initiation factor eIF-1 [Glarea
           lozoyensis 74030]
          Length = 517

 Score =  226 bits (577), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 140/368 (38%), Positives = 207/368 (56%), Gaps = 4/368 (1%)

Query: 51  IAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWA 110
           +A MF +M++ELSA+  I+  LTG+D L  VI   +V T+YT  GG + S ITDNIQG  
Sbjct: 1   MATMFLYMVAELSALQQIMTALTGMDGLPMVIVQCVVATIYTSLGGFKISFITDNIQGAM 60

Query: 111 XXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRA 170
                            I+ S+ID+S L +++ LGWQLLYI+PVAV     F   FW RA
Sbjct: 61  VVCLIIIATITIGVKTDIDTSLIDSSGLTQASLLGWQLLYILPVAVLTNDFFLSNFWIRA 120

Query: 171 FSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVL 229
           F+SK D++L +     ++++  +L  +G TG+IAVW+G L P +      +AFF L + L
Sbjct: 121 FASKTDKDLWIGISIAAVVVLIILTLIGCTGLIAVWSGALGPDDIESSGSIAFFLLLERL 180

Query: 230 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWG 289
           P WV GI +V+ VS+S AA+D+  SA  +  SND+F N+L +   R   ++  VP +   
Sbjct: 181 PAWVVGIVLVMVVSLSTAAFDSFQSAMVSMGSNDLFRNKLNIWFIRAAVVLLIVPVIILA 240

Query: 290 LKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH 349
           LK   +L+++LI+DL +AS++P ++LGL D  Y+    +                +I+Y 
Sbjct: 241 LKAPSILQIYLISDLFSASSIPVLILGLSDRFYWWRGFEVVVGGLGGIITVFIFGTIYYG 300

Query: 350 NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFV 409
           NA+ G +LI L  GLY  D+SV GAF+ AP+  + +    FG  + S   F+        
Sbjct: 301 NAQAGADLILLEGGLYANDWSVFGAFVAAPVGGLLW---GFGAFVPSTHTFSYFSPSTIS 357

Query: 410 FPKKPEVV 417
            P KPE V
Sbjct: 358 TPSKPETV 365



>gi|50290383|ref|XP_447623.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526933|emb|CAG60560.1| unnamed protein product [Candida glabrata]
          Length = 559

 Score =  223 bits (569), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 144/404 (35%), Positives = 226/404 (55%), Gaps = 3/404 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA    +P+FVFA+LGPLIRKK P GF LT++V  RFG     Y+S  +I  ++ F++S
Sbjct: 80  VYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLLCGWYLSACTILTVYLFLVS 139

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E++++   + TLT ++ L  +I   +VTT+YT  GG   S +TD++Q             
Sbjct: 140 EVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMTDSLQVSIVFILLVIVAA 199

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I++ +I  S LLK N LGWQL+YI+ VA+     F  GFW R F+S+++++L 
Sbjct: 200 AMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDFFMSGFWLRTFASRSNKDLL 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +       +L   +  +G+TG IAVWAGL P  +   S  AF+ L   LP W+ G T+V 
Sbjct: 260 IGCSLACFILVTFVTVVGVTGFIAVWAGLLPARDQENSGAAFYLLLAQLPSWIIGFTLVF 319

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
              +S    D+L SA  +  SND+F N+L + + R + +   VP V  GL   DVL ++L
Sbjct: 320 VAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLVRGIVVAIMVPVVVVGLIAQDVLSIYL 379

Query: 301 IADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
           I DLL++S +P +++GL   L   +  W +                +++YH+AK+G  L+
Sbjct: 380 IVDLLSSSVVPVLVVGLWGKLDEIWSAW-EVIGGGCAGILGVWIFGTVYYHSAKEGGRLL 438

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 402
            +  GLY  D+   GAF+VAP + +  + +   +RL  M ++ K
Sbjct: 439 LISNGLYADDWGAFGAFVVAPGAGLVCSVIILAIRLSLMKLYKK 482



>gi|452984112|gb|EME83869.1| hypothetical protein MYCFIDRAFT_162760, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 364

 Score =  218 bits (554), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 176/284 (61%), Gaps = 1/284 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LGP+IR+KCP+GF LTQ+  +R+G    +Y+S  S A ++ +M++
Sbjct: 82  VYALSSGLPLLIFAALGPIIRRKCPDGFVLTQWTRQRYGTITSLYLSFFSCATIWLYMVA 141

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+  ++  LTG++ L  VI    VTT+YT  GG R S +TDNIQG            
Sbjct: 142 ELSALQQVIKLLTGMNGLPAVIVQCAVTTIYTAAGGFRVSFVTDNIQGAMVLLFLIVGVI 201

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
             A ++ I+ S+I  S  L++N LGWQLLYI+PVA+     F  GFW RAF++K D++L 
Sbjct: 202 TIAVTVDIDTSLIPVSGYLEANLLGWQLLYILPVAILTNDFFLSGFWLRAFAAKTDKDLY 261

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     ++ +  +   +G++G+IA W+G+  G   + + +  FTL K LP WV GI +V+
Sbjct: 262 IGVSIAAVAVALITTLVGVSGLIAGWSGVL-GVPPVATGIELFTLLKTLPAWVVGIILVM 320

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVP 284
            V++S +A+D+L SA  +  SND F N+L +   R + ++  +P
Sbjct: 321 VVTLSISAFDSLQSALISTGSNDFFRNKLNIWWIRLIVVVLIIP 364



>gi|302419953|ref|XP_003007807.1| urea transport protein [Verticillium albo-atrum VaMs.102]
 gi|261353458|gb|EEY15886.1| urea transport protein [Verticillium albo-atrum VaMs.102]
          Length = 512

 Score =  214 bits (544), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 140/418 (33%), Positives = 220/418 (52%), Gaps = 30/418 (7%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LG +IR+K PEGF LT++  +R+G    +Y+S  ++  +F ++ +
Sbjct: 78  VYALSSSLPLLIFAALGSIIRRKTPEGFVLTEWTRQRYGTAAMLYLSAATLFTLFLYLTA 137

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLTGV++L  ++    VTT+YT  GG + S +TDNIQG            
Sbjct: 138 ELSAIGQVVTTLTGVNQLPVMLVQVAVTTIYTSLGGFKISFVTDNIQGGMVICLIVIAAA 197

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+ S+I  S+ LK   LGWQLLYI+PV +     F   +W RAF+SK D++L 
Sbjct: 198 TIGALTDIDTSLIRESEFLKPTLLGWQLLYILPVCILTNNFFLSNYWLRAFASKTDKDLW 257

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           +     S+    +L +  L  ++       PG                 P WV G+ +V+
Sbjct: 258 IGV---SLATTVILGYFRLGCLLHS-----PGSS---------------PSWVIGVVLVM 294

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V+MSC+A+DTL SA  ++ SND+F NRL +   R   L+  +PA+   L+   VL+++L
Sbjct: 295 VVTMSCSAFDTLQSAMVSSASNDLFRNRLNIWWIRAGILLIIIPAIVIALEAPSVLQIYL 354

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFY----HNAKDGIE 356
           I+DL++A  +P + +GL +  Y+    +                 I+Y    H A +   
Sbjct: 355 ISDLVSACIVPVLCIGLSNKCYWWRGFEVIVGGLGGILTSFLFGVIYYDGDVHRAGN--- 411

Query: 357 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 414
           L+ +  GLY  D+SV G F+ AP+ SI + F +   RL   ++  K  G  F    +P
Sbjct: 412 LLLISEGLYADDWSVFGVFVAAPVGSIVWGFAALACRLSFQYIQAKRSGCRFDALDRP 469



>gi|260943103|ref|XP_002615850.1| hypothetical protein CLUG_04732 [Clavispora lusitaniae ATCC 42720]
 gi|238851140|gb|EEQ40604.1| hypothetical protein CLUG_04732 [Clavispora lusitaniae ATCC 42720]
          Length = 311

 Score =  213 bits (542), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 112/275 (40%), Positives = 158/275 (57%), Gaps = 1/275 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y     IP+  FA +GP+IRKKCP+GF +T++V  RFG    +YVS  +   MF FMI 
Sbjct: 23  VYTLSGAIPIVGFAIMGPMIRKKCPDGFIMTEWVRRRFGIVTALYVSFFTCLTMFLFMIG 82

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E+SAV + + TLTG++ L  VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 83  EVSAVKSAIETLTGLNGLGAVIVECVVTTIYTAFGGFRVSFITDNFQGVLVVLLVVICAA 142

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              + I I+ S I  S LL +N LGWQLLYI+PVA+     F  GFW R F+SK DR+L 
Sbjct: 143 GMGSYIDIDTSKIGPSHLLDANKLGWQLLYILPVAIITNDCFMAGFWLRTFASKTDRDLW 202

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           + A   S + F +   +G TG +AVWAG +    + +   AFF +   +P W+    ++ 
Sbjct: 203 IGAGIASFVTFAICTLVGTTGFLAVWAG-YIDVNDEDGGNAFFIMLSHMPRWLIAFVLIF 261

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTR 275
            + +S   +D+L SA  +  SND+F N+L +   R
Sbjct: 262 VICLSTCTFDSLQSAMVSTISNDVFRNKLDMIYVR 296



>gi|169594868|ref|XP_001790858.1| hypothetical protein SNOG_00164 [Phaeosphaeria nodorum SN15]
 gi|160700958|gb|EAT91659.2| hypothetical protein SNOG_00164 [Phaeosphaeria nodorum SN15]
          Length = 395

 Score =  206 bits (525), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 207/385 (53%), Gaps = 1/385 (0%)

Query: 54  MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 113
           MF +M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQG     
Sbjct: 1   MFLYMVAELSALQQIVTLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFLTDNIQGVMVLG 60

Query: 114 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                         I++S+ID S  LK + LGWQL+YI+PVA+     F  GFW R F++
Sbjct: 61  LIIMGVIAVGVETNIDRSLIDQSGYLKPSLLGWQLIYILPVAILTNDFFLSGFWLRTFAA 120

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 233
           + D++L +     S  +  +L  +G+ G++A W+G     +    Y++ F L + LP WV
Sbjct: 121 RTDKDLWIGVSLASFGVLVILTLVGVAGLLAAWSGALQLGDAEGGYISLFLLLQQLPSWV 180

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
            G+ +V+ +S+S AA+D+  SA  +  SND+F N+L + V R   ++  +P V   L+  
Sbjct: 181 VGVVLVMVMSLSTAAFDSFQSAMVSTGSNDLFRNKLNIWVIRGCVVLIIIPVVVVALRSP 240

Query: 294 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAK 352
           D+L++FLI+DL++A+ +P +++GL +  Y+    D                 ++Y  +  
Sbjct: 241 DILQIFLISDLVSAAVVPCLVIGLSEKFYWYRGFDFVIGGLGGIFTIFLFGLVYYDGDVT 300

Query: 353 DGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPK 412
              +L+ L  GLY  D+S  GAF+ AP   + + F +  +R+  +W+  +++G  F    
Sbjct: 301 QAGKLLLLENGLYANDWSAFGAFVAAPFGGLLWAFGACALRIGFLWIMARVKGHRFDAFD 360

Query: 413 KPEVVDTKKYAGNKFKDDTEIIQSS 437
           KP    T +      +++  +++  
Sbjct: 361 KPVPRHTARLGAFDEQENDAVLEHG 385



>gi|403216744|emb|CCK71240.1| hypothetical protein KNAG_0G01820 [Kazachstania naganishii CBS
           8797]
          Length = 565

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 133/402 (33%), Positives = 222/402 (55%), Gaps = 4/402 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA    +P+++FA+LGPLIRKK P GF LT++V  R+G     Y+SL ++  +F F + 
Sbjct: 83  VYAIIGSLPMYLFAFLGPLIRKKTPNGFLLTEWVFHRYGLICSWYLSLCTLLTLFLFAVG 142

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           + S++   +V LTG+D L  +I  A++TT YT  GG   S +TD+ Q +           
Sbjct: 143 DFSSLKICVVALTGMDPLPVIIAEAVITTCYTTIGGFGISFLTDSFQVYIGISLMLILGY 202

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                  I+   + +  LL +N LGWQL+YI+ +A+    LF  GFW R F+S++DR+L+
Sbjct: 203 GIRGYTTIDMEKVASVGLLSTNKLGWQLVYILTIAIFTNDLFLNGFWLRTFASRSDRDLK 262

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           ++     I+L    +F+G  G +AV AGL    +   S  AFF L   LP++   + ++ 
Sbjct: 263 IACTVSCIVLTIFCIFVGSAGFLAVGAGLLDSNDP-NSGSAFFLLLNALPEFFLQVALIS 321

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V++S  + D+  S   +  SND+F N+L +   R + +I  +P V   L   ++L +++
Sbjct: 322 FVTLSVCSLDSQQSCLVSTISNDLFRNKLKIKWARLMVIIIIIPIVLLSLFAENILSIYM 381

Query: 301 IADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 358
             DLL++S +P +++G I  L  Y+ +W +                + +Y + K+G++L+
Sbjct: 382 FVDLLSSSVIPTLVVGFIPDLEAYWTSW-EVIGGGFGGLFCTFLFGTFYYSDFKEGVKLL 440

Query: 359 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 400
            +  GLY  D+S  GAF+ APL  I  + L  GVRL ++ +F
Sbjct: 441 LIWNGLYAEDWSTFGAFVTAPLGGIIVSLLIMGVRLYAIELF 482



>gi|302309420|ref|NP_986821.2| AGR155Cp [Ashbya gossypii ATCC 10895]
 gi|299788351|gb|AAS54645.2| AGR155Cp [Ashbya gossypii ATCC 10895]
 gi|374110070|gb|AEY98975.1| FAGR155Cp [Ashbya gossypii FDAG1]
          Length = 563

 Score =  197 bits (500), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 140/393 (35%), Positives = 225/393 (57%), Gaps = 2/393 (0%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +Y   S +P++VFA+ GPLI++ CP+GF LT++VL RFGR   +Y+S  +I  ++ FM+S
Sbjct: 141 VYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAALYLSACTILTLYLFMVS 200

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E+ ++   +  L+ +  +  V+   +VTT+YT  GG   S +TD++Q             
Sbjct: 201 EIVSLRLAVQALSNIKPIPVVVVQCVVTTIYTAIGGFHISFVTDSLQATVVLLLVVVGAV 260

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              TS++I+ + I  S LL+ + LGWQL+YI+ VA+     F  GFW R F+++++R+L 
Sbjct: 261 AVGTSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTNDFFMSGFWLRTFAARSNRDLL 320

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
           L     +++L  VL+ +G+TG++AVWAG  P   +L+S  +FF L   LP W +G+ + L
Sbjct: 321 LGCSLAAVLLAVVLLLVGVTGLLAVWAGYAP-VADLDS-ASFFLLLAALPAWANGVVLAL 378

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
            V +S    D+  SA  +  SND+F NRLP    R    +  VP V  GL   D+L ++L
Sbjct: 379 VVVLSTCTLDSFQSALVSTISNDLFRNRLPPLYARAAVAVVMVPVVVVGLLATDILAIYL 438

Query: 301 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 360
           I DLL+A+ +P +LLG       L+  +                +I+Y +A++G  L+ +
Sbjct: 439 IVDLLSAAVVPVMLLGFWPRAARLSAWELIGGGLGGLLCVFVFGAIYYRSAREGGRLLII 498

Query: 361 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 393
             GLY+ D+   GA +VAPL S+ F  + F +R
Sbjct: 499 ANGLYVDDWGTFGAMVVAPLGSLLFAAIIFALR 531



>gi|507524472|ref|YP_008046085.1| solute symporter-like protein [Spiribacter salinus M19-40]
 gi|511292660|ref|WP_016352927.1| solute symporter-like protein [Spiribacter salinus]
 gi|507224482|gb|AGM40620.1| solute symporter-like protein [Spiribacter salinus M19-40]
          Length = 461

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 113/324 (34%), Positives = 179/324 (55%), Gaps = 16/324 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS +P  V   +GP IR++ P G +LT+F   RFG   + +VS++S+ YM CF+ +E
Sbjct: 76  YALGSALPFVVLGVIGPTIRRQLPAGRSLTEFAASRFGGAMRRWVSILSVLYMLCFLAAE 135

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+A+G I   L+G+D    ++ +A+ T +YT  GGLRASL+TD  Q W            
Sbjct: 136 LTAIGAITTLLSGLDGRYVIVGVALATLIYTAIGGLRASLLTDRWQAWLLVGLVGLVAFA 195

Query: 122 XATSIRIE------KSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
                          S + N+ L  + SLG  L  I  +AV+ A LFH+G+WQR +++++
Sbjct: 196 ALALAPARPGEAAPTSTLPNTGL--AASLGVALTLI--IAVTAANLFHQGYWQRVWAARD 251

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 235
           DR L+ +A+ G      V+  LG  G++A   GL  G   +     FF L    P W++ 
Sbjct: 252 DRALKTAALVGGASTVGVVAVLGGAGILAGLRGLPLGSPPIP----FFALLSEAPQWLAL 307

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 295
             +VLA+++  ++ DTL +A  +    +  +  + L   R+LS +  +P V   L+++ V
Sbjct: 308 PALVLAITLVASSVDTLQNALVSLGVTE--SQAMGLTGARWLSALLMLPVVGLALQEISV 365

Query: 296 LRVFLIADLLAASTMPPILLGLID 319
           LR+FLIADLL A+ + P+L GL +
Sbjct: 366 LRLFLIADLLCATAVVPLLSGLSE 389



>gi|496243989|ref|WP_008957374.1| sodium:solute symporter [Halomonas sp. HAL1]
 gi|350600213|gb|EHA16283.1| hypothetical protein HAL1_07285 [Halomonas sp. HAL1]
          Length = 459

 Score =  166 bits (419), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 104/316 (32%), Positives = 169/316 (53%), Gaps = 6/316 (1%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS +P  V    GP IR+  PEG ++ +F    +G   + +V+L+S+ YM CF+ +E
Sbjct: 77  YALGSALPFIVLGLYGPKIRRALPEGRSIAEFAEACYGPGVRRWVTLVSVGYMACFLAAE 136

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+A+G I   L+ V     +I +A+ T +YT  GGLRASL TD  Q W            
Sbjct: 137 LTAIGAITALLSDVPPALVIIGVALTTLVYTAVGGLRASLATDRWQAWLLLALLLAVGSV 196

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
               +    S      +  +++L   L  +  +AV+ A LFH+G+WQR +++++D+ L  
Sbjct: 197 TLWRLPTMPSEATLPSIPVTSALSVALTLV--IAVTAANLFHQGYWQRVWAARDDQSLGR 254

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLA 241
            A  G  M   V++ +G  GM+A  +G+  GE  +     FF L    P W++   +VLA
Sbjct: 255 GAWLGGGMTVVVVMLIGGLGMLATMSGVPLGEPPMP----FFALLTEAPAWLTLPALVLA 310

Query: 242 VSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLI 301
           V++  ++ DTL +   +   +      + +   R++++   +P V   L+ L VLR+FLI
Sbjct: 311 VTLVASSVDTLQNGIASLVVSRSEQRGVSIAAARWVTIALMMPVVVIALQGLSVLRLFLI 370

Query: 302 ADLLAASTMPPILLGL 317
           ADLL A+ + P+LLGL
Sbjct: 371 ADLLCAAIVVPVLLGL 386



>gi|219129440|ref|XP_002184897.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403682|gb|EEC43633.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 578

 Score =  163 bits (413), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 105/325 (32%), Positives = 179/325 (55%), Gaps = 12/325 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y+  S  P  V  WLGP++R +  E F+ T F L+R+GR  QI ++ +S+ YMF F+++E
Sbjct: 103 YSTASSFPAVVICWLGPMVRARSTEAFSTTDFGLQRYGRVMQISIAAISVFYMFIFIVAE 162

Query: 62  LSAVGNILVTLTGVDK----LAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 117
           L+A+ NI   LTG +     +   I I + T +YT   GL AS++TD  QG         
Sbjct: 163 LTAISNIFALLTGNNSKIYGIGITIAIGVFTIIYTTLAGLPASIVTDRFQG--GIVALLI 220

Query: 118 XXXXXATSIRIEKSVIDNSDLLKSNSL--GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
                A +I  E  +  +   L SN    G +    + +A+  A LF++G WQR +++++
Sbjct: 221 IMLTLAVTISDENRITRDEFALASNFTIQGLKAAVTLVIAILCAELFNQGTWQRVWAAES 280

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE--SYLAFFTLFKVLPDWV 233
              +R     GS M+F +++F G+ GMIA +A      +N E  ++LAFF L   L +  
Sbjct: 281 IPVMRRGFAIGSAMVFLIMMFFGVMGMIA-YAKDPESYDNFEKFAFLAFFDLLLPLGNGW 339

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFN-NRLPLNVTRFLSLIANVPAVYWGLKD 292
             + ++L  +++ ++ D+L +  T+ F++D+      P+   R L +  NVPA++   + 
Sbjct: 340 HVLVLILVTALAASSIDSLQNGLTSVFAHDLLKVGWNPIWAARALMVAVNVPAIWLASRK 399

Query: 293 LDVLRVFLIADLLAASTMPPILLGL 317
            DV+ +FL+ADL+ A+++ P+ LGL
Sbjct: 400 WDVIALFLVADLVCATSVFPVFLGL 424



>gi|501087544|ref|WP_012137811.1| solute symporter-like protein [Marinobacter lipolyticus]
 gi|499161817|gb|EON92887.1| solute symporter-like protein [Marinobacter lipolyticus SM19]
          Length = 454

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 171/310 (55%), Gaps = 11/310 (3%)

Query: 9   PLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNI 68
           P  VFA+ GP IR+  P+G ++ +F    +G   + YVSL+S+ YM CF+ +EL+A+G I
Sbjct: 84  PFIVFAFCGPAIRRLLPQGRSIGEFAQACYGNGVRRYVSLISVLYMLCFVTAELTAIGAI 143

Query: 69  LVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI-R 127
              L+ V+    V+ +A  T +YT +GGLRASL+TD    W               +I R
Sbjct: 144 TSLLSNVNGNLAVVAVASATLIYTAWGGLRASLVTDQ---WQAFLLIALLIIVGVVAINR 200

Query: 128 IEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGS 187
           + +  +D+S  +   S    +   + +AV+ A LFH+G+WQR +S+++   L+  A +G 
Sbjct: 201 LPEISLDHSPSVPVGS-ALSVALTLVIAVTAANLFHQGYWQRLWSARDTSSLQRGAFFGG 259

Query: 188 IMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCA 247
           I+   V+  +G  G+ A  +G   G   +     FF +    P W++   +VLA+++  +
Sbjct: 260 IITIAVVALVGSMGIAAAMSGTDLGNPPIP----FFAMLSGAPAWLTIPALVLALTLVAS 315

Query: 248 AYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAA 307
           + DTL +A  +    +     L L   R+++++  +P V   L+ + VLR+FLIADLL A
Sbjct: 316 SVDTLQNALASLAVTE--KKGLSLTAARWITVLLMIPVVLVALQGISVLRLFLIADLLCA 373

Query: 308 STMPPILLGL 317
           + + P+L+GL
Sbjct: 374 TAVIPVLMGL 383



>gi|384254250|gb|EIE27724.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
          Length = 878

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/323 (32%), Positives = 181/323 (56%), Gaps = 9/323 (2%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA  S +P+ +  +LGP+++++ P+  + T F+  R+GR  QI+V+L+ +  M   M +E
Sbjct: 87  YALASGLPILIQGFLGPIVQRRKPDLLSFTDFINHRYGRVVQIWVALLMLLNMGIAMTAE 146

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
            +AVG++   + G +++  V+ I +V+ +YT YGGL  S+ITD  Q              
Sbjct: 147 YTAVGDLFELVIGTERVPIVVIIGVVSMIYTAYGGLYISIITDQWQAALGLTLAAILVIW 206

Query: 122 XATSIR--IEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 179
            A + R  + + + DN   L  N+ G   + +MP+++  A++F E  WQR ++S +D +L
Sbjct: 207 TAVTFRGPLPRPLPDN---LAINNEGLSSIAVMPISLFSASVFSEAIWQRCWASASDAKL 263

Query: 180 RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW-PGEENLESYLAFFTLF--KVLPDWVSGI 236
           R+ A++G++ +  V+   G  G +AVW+GLW P   +       F L   K    W++ I
Sbjct: 264 RVGAIWGALQVTVVVFIFGFGGFLAVWSGLWQPSGPDDPGNTILFALLNAKGQQVWITVI 323

Query: 237 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 296
             VLA +MS +A D+L +A   N S   F   LPL   R L +I +VP +   L+   ++
Sbjct: 324 VAVLAATMSESAIDSLQNAIVDNISGS-FLKGLPLIWIRVLVIILSVPVIIVSLQGYGII 382

Query: 297 RVFLIADLLAASTMPPILLGLID 319
            +FL+A+L+  ++  P+LLGL++
Sbjct: 383 NLFLLANLITTTSTLPVLLGLLE 405



>gi|494264168|ref|WP_007153677.1| sodium:solute symporter [Marinobacter algicola]
 gi|149359352|gb|EDM47813.1| Na+/solute symporter [Marinobacter algicola DG893]
          Length = 456

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 171/309 (55%), Gaps = 9/309 (2%)

Query: 9   PLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNI 68
           P  VFA+ GP IR+  PEG ++ +F    +G   + YVSL+S+ YM CF+ +EL+A+G I
Sbjct: 84  PFIVFAFCGPAIRRYLPEGRSIGEFAQACYGTSVRRYVSLISVLYMLCFLTAELTAIGAI 143

Query: 69  LVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRI 128
              L+GV+    V+ +A+ T +YT +GGLRAS++TD  Q +             A     
Sbjct: 144 TSLLSGVNGNLAVLGVAVATLIYTTWGGLRASIVTDQWQAF-LLIGLLAIVGFVAMDRLP 202

Query: 129 EKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSI 188
           E  + D       ++LG  L  +  +AV+ A LFH+G+WQR +S+++   LR  A+ G +
Sbjct: 203 ELQMADAPSAPVGSALGVALTLV--IAVTAANLFHQGYWQRLWSARDISALRSGALLGGL 260

Query: 189 MLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAA 248
           +   V+  +G  G+ A  +G   G   +     FF L    P W++   +VLA+++  ++
Sbjct: 261 VTIIVVAVVGGLGIAAAMSGADLGSPPIP----FFALLSGAPAWLTIPALVLALTLVASS 316

Query: 249 YDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAAS 308
            DTL +A  +    +     L +   R+++++  +P V   L+ + VLR+FLIADLL A+
Sbjct: 317 VDTLQNALASLAVTE--KQGLSITSARWVTVLLMIPVVIVALQGVSVLRLFLIADLLCAT 374

Query: 309 TMPPILLGL 317
            + P+L+GL
Sbjct: 375 AVIPVLMGL 383



>gi|512441197|ref|WP_016416980.1| sodium:solute symporter [Halomonas anticariensis]
 gi|511273970|gb|EPC02107.1| sodium:solute symporter [Halomonas anticariensis FP35 = DSM 16096]
          Length = 459

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 173/318 (54%), Gaps = 8/318 (2%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G+ +P  VFA  GP IR+  PEG ++ +F   R+G   + YVSL+S+ YM  F+ +E
Sbjct: 77  YAIGAALPFIVFAACGPSIRRYLPEGRSIGEFAQHRYGMGVRRYVSLLSVLYMAVFLAAE 136

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+A+  I   L+ +     VI +A+ T +YT  GGLRASL TD  Q W            
Sbjct: 137 LTAINGITTLLSDMSGSVVVIGVALSTLVYTALGGLRASLATDRWQAWLLIALLGVVGWV 196

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
               +    S  +   +   ++L   L  +  +AV+ A LFH+G+WQR ++++N   L  
Sbjct: 197 GWQRLPALPSDANLPSVPAGSALSVALTLV--IAVTAANLFHQGYWQRVWAARNGHALGR 254

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLA 241
            A+ G ++   V+  +G  G++A  +G   GE  +     FF L    P W+  + +VLA
Sbjct: 255 GAILGGLITVAVVAVVGGLGILAAMSGTPLGEPPMP----FFALLTEAPQWLMLLALVLA 310

Query: 242 VSMSCAAYDTLIS--ATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           V++  ++ DTL +  A+ A    +  + R+ L   R++++   VP V   L++L VLR+F
Sbjct: 311 VTLVASSVDTLQNGIASLAVSEGEGGSRRVSLATARWITVALMVPVVIVALQNLSVLRLF 370

Query: 300 LIADLLAASTMPPILLGL 317
           LIADLL A+ + P+LLGL
Sbjct: 371 LIADLLCATAVVPVLLGL 388



>gi|496591109|ref|WP_009288217.1| Sodium/solute symporter [Halomonas titanicae]
 gi|445564478|gb|ELY20598.1| Sodium/solute symporter [Halomonas titanicae BH1]
          Length = 470

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 106/316 (33%), Positives = 170/316 (53%), Gaps = 6/316 (1%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS +P  V    GP IR+  PEG ++ +F    +G   + +V+L+SIAYM CF+ +E
Sbjct: 77  YALGSALPFIVLGLYGPKIRRALPEGRSIAEFAEACYGPGVRRWVTLVSIAYMACFLAAE 136

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+A+G I   L+ V     +I +A+ T +YT  GGLRASL TD  Q W            
Sbjct: 137 LTAIGAITALLSDVPPALVIIGVALTTLIYTAAGGLRASLATDRWQAWLLLVLLCVVGGM 196

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
               +    +      +  +++L   L  +  +AV+ A LFH+G+WQR +++++D+ L  
Sbjct: 197 ALWRLPTIPNEAALPAIPITSALSVALTLV--IAVTAANLFHQGYWQRVWAAQDDQSLGR 254

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLA 241
            A  G  M   V++ +G  G++A  +G+  GE  +     FF L    P W++   +VLA
Sbjct: 255 GAWLGGAMTVVVVMVIGGLGVLAAMSGVPLGEPPMP----FFALLSDAPVWLTLPALVLA 310

Query: 242 VSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLI 301
           V++  ++ DTL +   +          + L   R+++++  VP V   L+ L VLR+FLI
Sbjct: 311 VTLVASSVDTLQNGIASLVVARSEQQGVSLVAARWVTVVVMVPVVLIALQGLSVLRLFLI 370

Query: 302 ADLLAASTMPPILLGL 317
           ADLL A+ + P+LLGL
Sbjct: 371 ADLLCAAIVVPVLLGL 386



>gi|490716886|ref|WP_004579451.1| solute symporter-like protein [Marinobacter nanhaiticus]
 gi|478770607|gb|ENO15155.1| solute symporter-like protein [Marinobacter nanhaiticus D15-8W]
          Length = 455

 Score =  154 bits (389), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 101/319 (31%), Positives = 177/319 (55%), Gaps = 14/319 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G+ +P  VFA+ GP IR+  P G ++ +F    +G   + +V+L+S+ YM CF+ +E
Sbjct: 76  YALGAALPFIVFAFCGPAIRRHLPHGRSIGEFAQTCYGTGMRRWVALISVLYMLCFLTAE 135

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+AVG I   LT ++    ++ +A  T +YT +GGLRASL+TD    W            
Sbjct: 136 LTAVGAITGLLTDLNGNVAILGVAGATLIYTAWGGLRASLVTDR---WQALLLVGLILVV 192

Query: 122 XATSIRIEKSVIDNSDLLKS---NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRE 178
              ++    S +D + +  +   ++LG  L  ++  AV+ A LFH+G+WQR +++++   
Sbjct: 193 GFVALPGLPSPVDRTPMPSAPIGSALGVALTLVL--AVTAANLFHQGYWQRVWAARDGAA 250

Query: 179 LRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITV 238
           L   A+ G ++   V+  +G  G+ A  +G+  G   +     FF L    PDW++ + +
Sbjct: 251 LGQGAILGGVITIAVVALVGGLGVTAAMSGVDLGSPPIP----FFALLSQAPDWLALVAL 306

Query: 239 VLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRV 298
           +LA+++  ++ DTL +   +    +   + L L+  R++++   VP V   L+   VLR+
Sbjct: 307 ILALTLVASSVDTLQNGLASLAVTE--KSGLSLSAARWITVGLMVPVVLIALQGYSVLRL 364

Query: 299 FLIADLLAASTMPPILLGL 317
           FLIADLL A+ + P+L+GL
Sbjct: 365 FLIADLLCATAVIPVLMGL 383



>gi|494173757|ref|WP_007113484.1| sodium:solute symporter [Halomonas boliviensis]
 gi|357970128|gb|EHJ92575.1| hypothetical protein KUC_2532 [Halomonas boliviensis LC1]
          Length = 463

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 108/320 (33%), Positives = 170/320 (53%), Gaps = 14/320 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS +P  V    GP IR+  PEG ++ +F    +G   + +V+L+SIAYM CF+ +E
Sbjct: 77  YALGSALPFIVLGLYGPKIRRALPEGRSIAEFAEACYGPGVRRWVTLVSIAYMACFLAAE 136

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+A+G I   L+ V     +I +A+ T +YT  GGLRASL TD  Q W            
Sbjct: 137 LTAIGAITALLSDVPPALVIIGVALTTLIYTAAGGLRASLATDRWQAWLLLILLCVVGGM 196

Query: 122 XATSIRIEKSVIDNSDLLKS----NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
               +      I N   L S    ++L   L  +  +AV+ A LFH+G+WQR +++++D+
Sbjct: 197 ALWRL----PTIPNETALPSIPVTSALSVALTLV--IAVTAANLFHQGYWQRVWAAQDDQ 250

Query: 178 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 237
            L   A  G  M   V++ +G  G++A  + +  GE  +     FF L    P W++   
Sbjct: 251 SLGRGAWLGGAMTVVVVMVIGGLGVLAAMSDVSLGEPPMP----FFALLSDAPIWLTLPA 306

Query: 238 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 297
           +VLAV++  ++ DTL +   +          + L   R+++++  +P V   L+ L VLR
Sbjct: 307 LVLAVTLVASSVDTLQNGIASLVVARSEQRGVSLVAARWVTVVVMIPVVLIALQGLSVLR 366

Query: 298 VFLIADLLAASTMPPILLGL 317
           +FLIADLL A+ + P+LLGL
Sbjct: 367 LFLIADLLCAAIVVPVLLGL 386



>gi|497407386|ref|WP_009721584.1| sodium:solute symporter [Halomonas sp. TD01]
 gi|338766491|gb|EGP21410.1| hypothetical protein GME_01569 [Halomonas sp. TD01]
          Length = 462

 Score =  150 bits (379), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 173/322 (53%), Gaps = 17/322 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS +P  V    GP IR+  PEG ++ +F    +G+  + +V L+S+AYM CF+ +E
Sbjct: 77  YALGSALPFIVLGLYGPKIRRALPEGRSIAEFAHACYGKGVRHWVLLVSVAYMGCFLAAE 136

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+A+G I   L+ V     +I +A+ T +YT  GGLRASL TD  Q W            
Sbjct: 137 LTAIGAITALLSDVPPALVIIGVALTTLVYTVIGGLRASLATDRWQAWLLLALLLAV--- 193

Query: 122 XATSIRIEK-SVIDNSDLLKSNSLGWQL--LYIMPVAVSFATLFHEGFWQRAFSSKNDRE 178
              S+ I +   + N  ++ S  +   L     + +AV+ A LFH+G+WQR +++++D+ 
Sbjct: 194 --GSVAIWRLPTMPNDAVMPSIPIASALSVALTLVIAVTAANLFHQGYWQRVWAAQDDQS 251

Query: 179 LRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITV 238
           L   A  G  M   V++ +G  GM+A  +G   G+  +     FF L    P WV+   +
Sbjct: 252 LGRGAWLGGGMTVMVVMVIGGVGMMAAMSGASLGDPPIP----FFALLTDAPAWVALPAL 307

Query: 239 VLAVSMSCAAYDTL---ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 295
           VLAV++  ++ DTL   I++       +   +   L   R++++   VP V   L+ L V
Sbjct: 308 VLAVTLVTSSVDTLQNGIASLIVGRGGE--RHTASLTTARWITVAMMVPVVLIALQGLSV 365

Query: 296 LRVFLIADLLAASTMPPILLGL 317
           LR+FLIADLL A+ + P+LLGL
Sbjct: 366 LRLFLIADLLCAAIVVPVLLGL 387



>gi|307544110|ref|YP_003896589.1| hypothetical protein HELO_1521 [Halomonas elongata DSM 2581]
 gi|503096465|ref|WP_013331276.1| sodium:solute symporter [Halomonas elongata]
 gi|307216134|emb|CBV41404.1| hypothetical protein HELO_1521 [Halomonas elongata DSM 2581]
          Length = 468

 Score =  149 bits (375), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 108/319 (33%), Positives = 176/319 (55%), Gaps = 12/319 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS +P  V +  GP+IR+  PEG ++ +F    +G+  + +V+L+SI YM CF+ +E
Sbjct: 77  YALGSALPFIVLSLYGPVIRRYLPEGRSIGEFAEACYGQGVRRWVTLVSILYMACFLAAE 136

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+A+G I   L+ V     V+ +A+VT +YT  GGLRASL TD    W            
Sbjct: 137 LTAIGAIASLLSEVPAGLVVMGVAVVTLVYTAVGGLRASLATDR---WQGWLLLALLVLV 193

Query: 122 XATSIRIEKSVIDNSDLLKS---NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRE 178
               + +   + +N+ +  +   N+L   L  I  +AV+ A LFH+G+WQR ++++ +  
Sbjct: 194 AGVVVWVLPPLPENASMPTTPSVNALSVALTLI--IAVTAAELFHQGYWQRVWAAETNGA 251

Query: 179 LRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITV 238
           L   A+ G + +  V++ +G  G++A   GL  GE  +     FF L    P W++   +
Sbjct: 252 LGRGALLGGVGVLLVVMVIGGLGILAAMHGLPLGEPPIP----FFALLAEAPGWLAVPAL 307

Query: 239 VLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRV 298
           VLAV++  ++ DTL +A  +          L +   R  +++  VP V   L++L VLR+
Sbjct: 308 VLAVTLVASSVDTLQNAIASLVVAGSGRRGLSIGSARLATVVLMVPVVVVALQELSVLRL 367

Query: 299 FLIADLLAASTMPPILLGL 317
           FLIADLL A+T+ P+LLG+
Sbjct: 368 FLIADLLCAATVVPVLLGV 386



>gi|385331874|ref|YP_005885825.1| solute symporter-like protein [Marinobacter adhaerens HP15]
 gi|495449986|ref|WP_008174680.1| sodium:solute symporter [Marinobacter manganoxydans]
 gi|311695024|gb|ADP97897.1| solute symporter-like protein [Marinobacter adhaerens HP15]
 gi|357225226|gb|EHJ03733.1| hypothetical protein KYE_14777 [Marinobacter manganoxydans MnI7-9]
          Length = 454

 Score =  148 bits (374), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 101/309 (32%), Positives = 167/309 (54%), Gaps = 9/309 (2%)

Query: 9   PLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNI 68
           P  VFA+ GP IR+  PEG ++ +F    +G   + YVS +S+ YM CF+ +EL+A+G I
Sbjct: 84  PFIVFAFCGPAIRRFLPEGRSIGEFANACYGNGVRRYVSTISVLYMLCFLTAELTAIGAI 143

Query: 69  LVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRI 128
              L+G+D    VI +AI T +YT  GGLRAS++TD  Q               A     
Sbjct: 144 TSLLSGIDGGIVVIGVAITTLVYTAVGGLRASIVTDQWQ-ALLLIGLLAIVSFVAVGKLP 202

Query: 129 EKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSI 188
           + +     D+  S +L   L  +  +AV+ A LFH+G+WQR +S+++   L   A+ G +
Sbjct: 203 DAAPAALPDIPASAALSVALTLV--IAVTAANLFHQGYWQRLWSARDTDALSRGALLGGV 260

Query: 189 MLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAA 248
           +   V+  +G  G++A  +G   G   +     FF L    P W++   ++LA+++  ++
Sbjct: 261 VTIAVVAVVGGLGILAAMSGADLGSPPIP----FFALLADAPAWLALPALILAITLVASS 316

Query: 249 YDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAAS 308
            DTL +A  +    +     L +   R+ +++  +P V   L+ + VLR+FLIADLL A+
Sbjct: 317 VDTLQNALASLAVTE--KQGLSIVSARWFTVLLMIPVVLVALQGISVLRLFLIADLLCAT 374

Query: 309 TMPPILLGL 317
            + P+L+GL
Sbjct: 375 AVLPVLMGL 383



>gi|323456367|gb|EGB12234.1| hypothetical protein AURANDRAFT_61365 [Aureococcus anophagefferens]
          Length = 1212

 Score =  147 bits (372), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 174/338 (51%), Gaps = 32/338 (9%)

Query: 2    YAFGSIIPLFVFAWLGPLIRK--KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMI 59
            Y+  S  P  +  WLGP I+       GF+ T F L R+GR   ++V  +S  YM+ +M+
Sbjct: 730  YSTASAFPAVLLCWLGPRIKTVVGAASGFSATDFALSRYGRLMHLHVCCISCFYMYIYMV 789

Query: 60   SELSAVGNILVTLTG-----------VDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG 108
            +EL+++GN+  TL G             K+A  IC+A+ T  YT   GL AS++TD  QG
Sbjct: 790  AELTSIGNVYATLVGKSVAGDDSENFTTKIA--ICVALFTWAYTALAGLPASILTDKFQG 847

Query: 109  WAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQ 168
                           T    E S  +  D     S G++ L  + +A+  A LF++G WQ
Sbjct: 848  VVITCVVIMLLVATTTLKSNEVSKQEYDDATGWFSKGFEALVTLWIAICSAELFNQGNWQ 907

Query: 169  RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIA---------VWAGLWPGEENLESY 219
            R +++++D+++++  + G++++  V++F G+ G IA          W  L        +Y
Sbjct: 908  RVWAARSDKDMKIGFLAGAVLVTLVMLFFGVMGTIAYARDRESYDTWQKL--------AY 959

Query: 220  LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 279
            L+FF L + LP +   +T+ L  +++ ++ DTL +   +  S D+   +L  N +R + +
Sbjct: 960  LSFFDLLRNLPRFWHYVTLALLTTLAASSLDTLQNGIASVLSRDLLKQKLNTNWSRLVVV 1019

Query: 280  IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
              N+ A+       +V+ +FL+ADL+ A+ + P+ LGL
Sbjct: 1020 GFNIAAIIQASDRFEVVPLFLVADLVCATAVFPLFLGL 1057



>gi|346977478|gb|EGY20930.1| urea transport protein [Verticillium dahliae VdLs.17]
          Length = 345

 Score =  147 bits (371), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 109/179 (60%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA  S +PL +FA LG +IR+K PEGF LT++  +R+G    +Y+S  ++  +F ++ +
Sbjct: 68  VYALSSSLPLLIFAALGSIIRRKTPEGFVLTEWTRQRYGTAAMLYLSAATLFTLFLYLTA 127

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           ELSA+G ++ TLTGV++L  ++    VTT+YT  GG + S +TDNIQG            
Sbjct: 128 ELSAIGQVVTTLTGVNQLPVMLVQVAVTTIYTSLGGFKISFVTDNIQGGMVICLIVIAAA 187

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 179
                  I+ S+I  S+ LK   LGWQLLYI+PV +     F   +W RAF+SK D++L
Sbjct: 188 TIGALTDIDTSLIRESEFLKPTLLGWQLLYILPVCILTNNFFLSNYWLRAFASKTDKDL 246



>gi|323455936|gb|EGB11803.1| hypothetical protein AURANDRAFT_61010 [Aureococcus anophagefferens]
          Length = 1097

 Score =  147 bits (371), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 174/338 (51%), Gaps = 32/338 (9%)

Query: 2   YAFGSIIPLFVFAWLGPLIRK--KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMI 59
           Y+  S  P  +  WLGP I+       GF+ T F L R+GR   ++V  +S  YM+ +M+
Sbjct: 615 YSTASAFPAVLLCWLGPRIKTVVGAASGFSATDFALSRYGRLMHLHVCCISCFYMYIYMV 674

Query: 60  SELSAVGNILVTLTG-----------VDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG 108
           +EL+++GN+  TL G             K+A  IC+A+ T  YT   GL AS++TD  QG
Sbjct: 675 AELTSIGNVYATLVGKSVAGDDSEHFTTKIA--ICVALFTWAYTALAGLPASILTDKFQG 732

Query: 109 WAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQ 168
                          T    E S  +  D     S G++ L  + +A+  A LF++G WQ
Sbjct: 733 VVITCVVIMLLVATTTLKSNEVSKQEYDDATGWFSKGFEALVTLWIAICSAELFNQGNWQ 792

Query: 169 RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIA---------VWAGLWPGEENLESY 219
           R +++++D+++++  + G++++  V++F G+ G IA          W  L        +Y
Sbjct: 793 RVWAARSDKDMKIGFLAGAVLVTLVMLFFGVMGTIAYARDRESYDTWQKL--------AY 844

Query: 220 LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 279
           L+FF L + LP +   +T+ L  +++ ++ DTL +   +  S D+   +L  N +R + +
Sbjct: 845 LSFFDLLRNLPRFWHYVTLALLTTLAASSLDTLQNGIASVLSRDLLKQKLNTNWSRLVVV 904

Query: 280 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
             N+ A+       +V+ +FL+ADL+ A+ + P+ LGL
Sbjct: 905 GFNIAAIIQASDRFEVVPLFLVADLVCATAVFPLFLGL 942



>gi|385305452|gb|EIF49423.1| urea urea polyamine [Dekkera bruxellensis AWRI1499]
          Length = 272

 Score =  145 bits (366), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 81/227 (35%), Positives = 131/227 (57%), Gaps = 3/227 (1%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           +YA    +P+ +F++ GP+IRK+CP+GF LT++  +RFG    +Y+SL ++  MF +M+S
Sbjct: 23  VYAITGAVPIVLFSYFGPMIRKRCPDGFVLTEWCRQRFGVITALYLSLFTLLTMFLYMVS 82

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           EL+A+   +  LTG+D    V+   +VTT+YT  GG + S  TD++Q             
Sbjct: 83  ELTAIDEAINALTGLDATPCVVVECVVTTIYTFLGGFKVSFATDSLQAGFVMVLLVVGVI 142

Query: 121 XXATSIRIEKSVIDN--SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRE 178
             AT++ I++ +     S +L +N LGW LLYI+ VA+     F  GFW R F+++ DR+
Sbjct: 143 GYATNVHIDQKIKQETASQMLDANKLGWMLLYILFVAILTNDAFLSGFWLRTFAARTDRD 202

Query: 179 LRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTL 225
           L ++    + +   V    GL G+ AVW G+    ++ E Y AF+ L
Sbjct: 203 LLIACSIAAFVCALVCTLAGLPGIYAVWTGVLKVGDD-EGYNAFYIL 248



>gi|223993879|ref|XP_002286623.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220977938|gb|EED96264.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 614

 Score =  145 bits (365), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 100/342 (29%), Positives = 179/342 (52%), Gaps = 27/342 (7%)

Query: 2   YAFGSIIPLFVFAWLGPLIRK-KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           Y+  S  P  +   +GP IR     E F  T F L R+GR  Q+ ++ +S+ YMF +++S
Sbjct: 111 YSGASAFPAIIICMIGPRIRAITGEEAFCTTDFGLVRYGRLMQLSIAAISVFYMFIYLVS 170

Query: 61  ELSAVGNILVTLTGVDKLAP---------VICIAIVTTLYTGYGGLRASLITDNIQGWAX 111
           E++++ N+   + G+D  +           I +A+ T  YT   GL AS++TD  Q +  
Sbjct: 171 EMTSISNVYGLIVGLDTFSDDTVKYTTSIAISLAVFTWFYTSVAGLPASIVTDKFQAYLM 230

Query: 112 XXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQL-----LYIMPVAVSFATLFHEGF 166
                       ++   E  V      + SN   W L        + +A++ A +F++G 
Sbjct: 231 FGLVFILLIVACSN--SENQVSKEEFAVASN---WTLDGLAAAVTLFIAIACAEMFNQGN 285

Query: 167 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE--SYLAFFT 224
           WQR +++K+  ++R    +GS+++F +++F G+ GM+A +A      +N E  +YLAFF 
Sbjct: 286 WQRVWAAKSVPDMRKGFAWGSLLVFLLMMFFGIMGMLA-YANDPDAYDNWEKFAYLAFFD 344

Query: 225 LFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLN----VTRFLSLI 280
           L   L  +   + +++  +++ ++ DTL +A  + FS+D+    L  N    VTRF+ ++
Sbjct: 345 LLAPLNTFFHVLVLIIVTALAASSVDTLQTAIASMFSSDLIRFGLSDNASRFVTRFILVL 404

Query: 281 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 322
            N+PAV    K  DV+ +FL+ADL+  + + P+ LGL+   Y
Sbjct: 405 INIPAVILSSKRFDVIGLFLVADLVCGTAVLPVFLGLMTEDY 446



>gi|428175810|gb|EKX44698.1| hypothetical protein GUITHDRAFT_87377 [Guillardia theta CCMP2712]
          Length = 646

 Score =  144 bits (362), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 166/327 (50%), Gaps = 12/327 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA  + IP+ + A+ G +++ K P   +L  F+L RFG   ++   ++++  M  FM++E
Sbjct: 91  YAVATGIPIIMQAYFGDIVQTKFPNANSLGDFILLRFGPTAKLATIIVTLINMSIFMLAE 150

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
            + VG +     G      +I +A++TT+YT YGGL  S++TD +QG             
Sbjct: 151 FTTVGGLFSDFVGSVSYPIIIIVAVLTTIYTVYGGLLVSIVTDQVQGIISVLLTIILTIY 210

Query: 122 XATSIR--IEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 179
            A + R  +  +      +L  N  G+  ++ MP++++ AT+F+EG WQR +++++   L
Sbjct: 211 VAATFRRDLPANFGPYEPMLGPNLSGYSSIFTMPISLAAATVFNEGMWQRVWAAEDHTAL 270

Query: 180 RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLP--------D 231
           +   +     +  V+   G  G++AVW GL    EN    L  F LFK  P        +
Sbjct: 271 KRGGIIACFAIVFVVFIFGFGGLLAVWGGL-VDYENTNPNLYIFQLFKSDPSAPNAHVEN 329

Query: 232 WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLK 291
           ++  + +VLA  M+ +A D+L +   A  S+     + PL   R   L+ N+  V + L 
Sbjct: 330 FIEVLVLVLAAVMNESAIDSLQNGLAATISSHFLRGK-PLLWARICVLLINIIIVPFALA 388

Query: 292 DLDVLRVFLIADLLAASTMPPILLGLI 318
           +  VL +FL+ ++L     PP+++G I
Sbjct: 389 NYSVLSIFLLGNMLGVCWFPPVIMGGI 415



>gi|328771326|gb|EGF81366.1| hypothetical protein BATDEDRAFT_34916 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 523

 Score =  138 bits (348), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 122/447 (27%), Positives = 204/447 (45%), Gaps = 28/447 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA  + +PL + A++G  +RK  P   ++  +   RFG   ++ + ++ +  +   +++E
Sbjct: 93  YALFTGLPLVMLAFMGTYLRKNVPHATSIASYGRWRFGTGIELLIMIIVVLNLGIALLAE 152

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
            SA+G I     GV    P++ + IVT  YT  GGL  S++TD  Q              
Sbjct: 153 YSAIGGIFQDFFGVPSWVPILVVGIVTMSYTATGGLYVSIVTDQWQAIMALVLFAITIIY 212

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
              S     S+    D L + ++GWQ    + +++  AT F E  WQR ++++++R LR+
Sbjct: 213 MGVSFH-GTSLPKLPDYLGATTVGWQSFITLGISLISATFFSEAMWQRVWAAESERSLRI 271

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG----IT 237
            A+ GS M   V+   GL  M+A W+G    ++N  S   +F  F+ L  + S     + 
Sbjct: 272 GAIIGSSMSTVVVAVFGLGSMLAYWSGRATADDN--SNFGYFLAFRDLNGYTSAAILVVV 329

Query: 238 VVLAVSMSCAAYDTLISATTANFSN--DIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 295
           +++AV M+ +A D+  +A T    +    F  + P    R L ++ NVP +Y G   L V
Sbjct: 330 ILIAVIMNESAVDSFQNAITDAVVSVFGSFGVKFPTMGARLLVILFNVPIMYIGTLGLSV 389

Query: 296 LRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGI 355
           L VFLI +++      P++ GLI +   LN I                  + Y     G 
Sbjct: 390 LGVFLIGNMITTCMFFPLVAGLIPA---LNRIISSFSVCLACLFSFFSVMV-YGKIMTGD 445

Query: 356 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE---FVFPK 412
              GL L  + T Y V  AF+ A +SSI +  +  G+ L     F K+ G E     FP 
Sbjct: 446 ISTGL-LTYFYTVYDV-NAFLTASVSSIVWLVVFTGIDL----AFRKLTGREMPNLPFPS 499

Query: 413 KPEVVDTKKYAGNKFKDDTEIIQSSDP 439
           K  +  + +      K   E+ ++  P
Sbjct: 500 KAALAFSTR------KSIVEVPEAQGP 520



>gi|158321712|ref|YP_001514219.1| Na+/solute symporter [Alkaliphilus oremlandii OhILAs]
 gi|501110941|ref|WP_012160530.1| Na+/solute symporter [Alkaliphilus oremlandii]
 gi|158141911|gb|ABW20223.1| Na+/solute symporter [Alkaliphilus oremlandii OhILAs]
          Length = 466

 Score =  137 bits (345), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 101/334 (30%), Positives = 165/334 (49%), Gaps = 22/334 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y  G     F F  + P +R   PEG TL  +VL+R+G    +   L+S+ YMF  +I+E
Sbjct: 80  YGIGVASLYFAFLVISPKVRTYLPEGSTLNDYVLKRYGFKMYLLTVLLSLFYMFVHLIAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+A+G +   L GV  L   + + I T +YT YGGLRA++ TD IQ              
Sbjct: 140 LTAIGLVAYELAGVPLLYTALFVGIGTLIYTAYGGLRAAMFTDMIQMILIVFLLIMVTVG 199

Query: 122 X-----ATSIRIEKSVIDNSDLLK-SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
                      I  +  +  DL    N  G +    + +AV  A LF++G+WQR ++SK+
Sbjct: 200 IVHYGGGVGTIISSAKTNAPDLFSFRNWGGIEYGLTLCIAVFAANLFNQGYWQRVYASKD 259

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTL-FKVLPDWVS 234
           ++ LR S +   I+  PV++  G  G++++  G+          +A F+L +K LP  + 
Sbjct: 260 NKTLRKSLIVCIIIALPVMLITGFLGIVSMGLGIGSSPS-----VALFSLIYKFLPSQLI 314

Query: 235 GITVVLAVSMSCAAYDTLISATTANF---SNDIFN-----NRLPLNVTRFLSLIANVPAV 286
               +LA+ +  +  DTL++A  A F   S  IF      + LP    R + ++  +PA+
Sbjct: 315 VAVFILALVLVMSTVDTLLNAIVATFALDSQQIFKKVKSESLLPF--ARMMMVVLMIPAI 372

Query: 287 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDS 320
           +   +   VL +F +ADL+ A  + PI  GL ++
Sbjct: 373 FIAARGYSVLYLFFVADLVCAGVVFPIFFGLFNT 406



>gi|145345452|ref|XP_001417224.1| SSS family transporter: sodium ion/solute [Ostreococcus lucimarinus
           CCE9901]
 gi|144577451|gb|ABO95517.1| SSS family transporter: sodium ion/solute [Ostreococcus lucimarinus
           CCE9901]
          Length = 577

 Score =  137 bits (345), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 98/330 (29%), Positives = 164/330 (49%), Gaps = 18/330 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMI 59
           Y+F S  P  +  ++ P I+    +  GF++T F L RFGR  Q+  + MS  Y+F F+ 
Sbjct: 101 YSFASASPAILMIFIAPTIKAFVGDKNGFSVTDFALTRFGRCMQLVAAFMSTMYLFIFLC 160

Query: 60  SELSAVGNILVTLTGV---------DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWA 110
           +E+S + N+    + V         D +   +C+  +T  YT   GL AS+ITD +QG  
Sbjct: 161 AEISTIANVAALFSDVQGAESKYSRDVILGTVCV--ITLSYTMIAGLPASVITDRVQG-- 216

Query: 111 XXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRA 170
                           + E +      + KS + G+ ++  + +A   A LF+ G WQR 
Sbjct: 217 VMITGFMLLFSCVVLAKNEVTATQMRAVSKSTTNGFVVMITLIIATLGAELFNAGQWQRV 276

Query: 171 FSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE--SYLAFFTLFKV 228
           +++++ ++LR     G+ M+F V+ F G+ G+ AV A      ++     YLAFF L + 
Sbjct: 277 YAARSTQDLRKGLALGAGMIFVVMWFFGILGVTAV-AKYRADFDDFSRLHYLAFFELAEG 335

Query: 229 LPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYW 288
           L      I ++ A S+  ++ D++ +  T+    DI N  LP N  R +    NV A++ 
Sbjct: 336 LAKGWHVIILIFATSLCVSSVDSIQNGLTSVLYRDILNYDLPANSVRVICAALNVGAIFV 395

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGLI 318
            +  +DVL +FL+ DL+ A   P + LGLI
Sbjct: 396 AVDKIDVLSLFLMVDLVCALAAPALYLGLI 425



>gi|303282763|ref|XP_003060673.1| Na+/solute symporter [Micromonas pusilla CCMP1545]
 gi|226458144|gb|EEH55442.1| Na+/solute symporter [Micromonas pusilla CCMP1545]
          Length = 588

 Score =  136 bits (343), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 96/325 (29%), Positives = 164/325 (50%), Gaps = 12/325 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMI 59
           Y  GS  P  +   + P I+K   +  GF++T F L+RFGR  Q+  + MS+ YMF  + 
Sbjct: 101 YTMGSTSPALLLIAIAPAIKKFVGDKNGFSVTDFALQRFGRLTQLVAAFMSVMYMFISLC 160

Query: 60  SELSAVGNI---LVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXX 116
           +EL ++ N+       T   +   +  +A+VT  YT   G  AS+ITD IQG        
Sbjct: 161 AELGSIANVATLFADRTSYTRKVVLCVVALVTMSYTMAAGFPASVITDRIQGVMIISFML 220

Query: 117 XXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 176
                      +  S +D+  +  S + G+ ++  + +A+  A LF+ G WQR +++K+ 
Sbjct: 221 FFAIFLMAENPVTPSEMDS--VSHSRTSGFVVMVTLIIAIISAELFNAGQWQRVYAAKST 278

Query: 177 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES---YLAFFTLFKVLPDWV 233
            +LR     G+ ++F V+ F G+ G++A  A  +  + N  +   YLA+F L + L    
Sbjct: 279 VDLRKGLALGAGLIFIVMWFFGVLGVVA--AAKYNDDFNAYTKFHYLAYFYLVENLAKGW 336

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
             I ++ A S+  ++ D++ +  T+    DI    LP+N  R + L  N+ A+      +
Sbjct: 337 HFIVLIFATSLCVSSVDSIQNGLTSVMYRDIKKFGLPVNSVRVVCLALNIGAIVVAADKI 396

Query: 294 DVLRVFLIADLLAASTMPPILLGLI 318
           DVL +FL+ DL+ A   P + LG+I
Sbjct: 397 DVLSLFLMVDLVCAVAAPALYLGMI 421



>gi|348678595|gb|EGZ18412.1| hypothetical protein PHYSODRAFT_332209 [Phytophthora sojae]
          Length = 481

 Score =  134 bits (337), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 95/322 (29%), Positives = 150/322 (46%), Gaps = 21/322 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y    +  + V A +GP  R    E  T+T  V +RFG   Q+Y+ L+S+ Y F  + SE
Sbjct: 81  YTLSGVCGMLVLAVVGPYTRSALGENVTMTDVVAQRFGYVMQVYIGLISVFYQFISLASE 140

Query: 62  LSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           L+ V  +    +     L P++ +  +T LY   GGLRASL TD  QG            
Sbjct: 141 LTCVAQLTTMFSPNAHSLIPILVVVFLTNLYLIIGGLRASLATDVWQGIGVIALLAVVCI 200

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                + I +     +++      G++ L  + +AV+ + LF  GFWQR +++ +D  LR
Sbjct: 201 AMCFHVAIPEGAWSRTNVAAFTVEGFETLVTLVIAVTASNLFFTGFWQRVYAAYDDHTLR 260

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAF---FTLFKVLPDWVSG-- 235
            +A     ++ P  V L L GM+              SYLA+      F +L D   G  
Sbjct: 261 KAAFMACGIIIPFTVALALAGMV--------------SYLAYPDGVLFFAILMDMGRGWE 306

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 295
           + +V+ ++M  +     I    A      F  +L L   R +  + NVPA+  G +  D+
Sbjct: 307 VLIVIVIAMLASGVSDSIQIGIAAELTTCF-PKLSLLHARIIVALLNVPAIVIGYQQYDI 365

Query: 296 LRVFLIADLLAASTMPPILLGL 317
           L +FLIADLL  + + P+LLG+
Sbjct: 366 LNLFLIADLLCTAAVGPMLLGV 387



>gi|294900101|ref|XP_002776900.1| Osmoregulated proline transporter, putative [Perkinsus marinus ATCC
           50983]
 gi|239884101|gb|EER08716.1| Osmoregulated proline transporter, putative [Perkinsus marinus ATCC
           50983]
          Length = 515

 Score =  132 bits (332), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 101/335 (30%), Positives = 167/335 (49%), Gaps = 27/335 (8%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKC--------PEGFTLTQFVLERFGRFNQIYVSLMSIAY 53
           YA   ++P+ +   LG  IR K          EG+  T ++L RFGR  Q+Y  L+SI  
Sbjct: 92  YALACVVPMAIIWILGVRIRAKLNSYMSAGGSEGYAATDWILARFGRLVQVYAVLVSIFI 151

Query: 54  MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 113
           M+  M +E +AVG ++   +G+      + +A++T  YT   GL  S++TD  QG A   
Sbjct: 152 MWISMTAEYTAVGQVIEIFSGIPVWLSTLSVAVITLSYTLVAGLPVSILTDMAQGLAAVG 211

Query: 114 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 173
                    ATS  +  +  + + +    +LG + L  + +A+    L     WQR +++
Sbjct: 212 LIVFAVV--ATSTNVTVTTANWNAVANFTTLGLESLITLVLAILGFQLLDMVVWQRVWAA 269

Query: 174 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEE--------NLESY---LAF 222
           KND  LR+  + G  ++F  ++  G+ GM+A        ++         L  Y   LAF
Sbjct: 270 KNDFNLRMGLLLGGSLVFLTMLAFGILGMLA------EAQDRARPVPHLTLHPYTKALAF 323

Query: 223 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 282
           F L  VLP+   G  VVLA+ +S ++ D+L SA  + F+ +       LN  R L ++ N
Sbjct: 324 FDLLGVLPNAAVGAVVVLAICLSTSSVDSLQSALLSVFAAEFVKRGWSLNWGRLLLVLMN 383

Query: 283 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           +PA+   ++ + V+ +FL+ADL+AA+   P   GL
Sbjct: 384 IPAIALAMRGISVINLFLVADLVAATICMPAYCGL 418



>gi|344212553|ref|YP_004796873.1| sodium-solute symporter putative [Haloarcula hispanica ATCC 33960]
 gi|503807004|ref|WP_014040998.1| sodium:proline symporter [Haloarcula hispanica]
 gi|343783908|gb|AEM57885.1| sodium-solute symporter putative [Haloarcula hispanica ATCC 33960]
          Length = 502

 Score =  129 bits (325), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 161/329 (48%), Gaps = 16/329 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F+ +E
Sbjct: 81  YAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++ +   L  +  V      + I     +YT YGGL AS++TD +Q              
Sbjct: 141 MTGIAGALALVADVPLWQTSLLIGGFVLVYTAYGGLLASIVTDTVQTLVILPLLAVGFGG 200

Query: 122 XATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAFSSKN 175
              S+        +V+     L     G  L + + VA +   A + ++G WQR +++  
Sbjct: 201 ALLSLGGTSEFHATVVSADPTLLDPGFGPGLEFGLYVAFALLGANMLNQGVWQRVYAADG 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLPDWVS 234
           +R LR      ++++ P+L+  GL G+ A   GL    E+  + +AFF  + +  P WV+
Sbjct: 261 ERALRRGLGIAAVVVVPMLLLAGLFGIAAAGLGL---TESGSASIAFFLVVAEAFPTWVT 317

Query: 235 GITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVPAVYW 288
              VVLAV +  ++ DT+ +A  +  + D+       + R      R L++   + A++ 
Sbjct: 318 LAIVVLAVLLVMSSADTMFNAIASVVTADLARLLDDPDQRTLWLGGRGLTVAVALAAMFI 377

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGL 317
           G +   VL++FL ADLLAA    P L GL
Sbjct: 378 GAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|308802840|ref|XP_003078733.1| unnamed protein product [Ostreococcus tauri]
 gi|116057186|emb|CAL51613.1| unnamed protein product [Ostreococcus tauri]
          Length = 630

 Score =  129 bits (324), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 92/329 (27%), Positives = 168/329 (51%), Gaps = 15/329 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMI 59
           Y+  S  P  V  ++ P I+    +  GF++T F L R+GR  Q+  + +S+ YMF  + 
Sbjct: 158 YSVASASPALVMIFIAPTIKAFVGDKNGFSVTDFALSRYGRSMQLVSAFISVMYMFISLC 217

Query: 60  SELSAVGNILVTLT----GVDKLAP---VICIAIVTTLYTGYGGLRASLITDNIQGWAXX 112
           +EL+ + N+    +      D+ A    ++ + ++T  YT   GL AS+ITD +QG    
Sbjct: 218 AELTTIANVSALFSDDYGATDEKARTTVLVTVCVITLTYTMLAGLPASVITDRLQGVMIT 277

Query: 113 XXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFS 172
                         R+ K+  + +   KS   G+ ++  + +AV  A LF+ G WQR ++
Sbjct: 278 GFMLLFTVILLADNRVTKAQYERAS--KSTDEGFVVMITLIIAVLSAELFNAGQWQRVYA 335

Query: 173 SKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEE---NLESYLAFFTLFKVL 229
           +K+  +LR     G+ ++F V+ F G+ G++++ A  +   E      +YL FF L + L
Sbjct: 336 AKSTADLRKGLALGAGLIFFVMWFFGVLGVVSL-AKYYDDYEVSYTKYAYLGFFYLAESL 394

Query: 230 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWG 289
                 + ++ A S+  ++ D++ +  T+    D+ N  +P+NV R +    NV A++  
Sbjct: 395 NKGWHVLILIFATSLCVSSVDSIQNGLTSVLYRDVLNFGVPVNVIRVVCAALNVGAIFVA 454

Query: 290 LKDLDVLRVFLIADLLAASTMPPILLGLI 318
           +  +DVL +FL+ DL+ A   P + LGL+
Sbjct: 455 IDKIDVLSLFLMVDLVCALGAPALYLGLM 483



>gi|452837940|gb|EME39881.1| hypothetical protein DOTSEDRAFT_65790 [Dothistroma septosporum
           NZE10]
          Length = 410

 Score =  129 bits (323), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 111/419 (26%), Positives = 186/419 (44%), Gaps = 80/419 (19%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMS----IAYMFC 56
           +YA  + +PL +FA LGP++RKKCPEGF LT++  +R+G    +Y+S +      A +  
Sbjct: 32  VYALTARLPLLLFATLGPILRKKCPEGFVLTEWTRQRYGAVPALYLSFLGELDDCATVRL 91

Query: 57  FMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXX 116
           +M++ELSA+  ++  LTG+  L  VI     TT++T  GG R S +T+N+QG        
Sbjct: 92  YMVAELSALQQVVNLLTGLSGLPAVIIQCFTTTVHTTAGGFRISFVTENVQG-------- 143

Query: 117 XXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 176
                                                VA+     F  GFW RAF+ K D
Sbjct: 144 ------------------------------------DVAILANDFFLCGFWMRAFALKTD 167

Query: 177 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGI 236
           ++L +     ++++  V V + +TG+IA W+G                +F V P  +   
Sbjct: 168 KDLSIGVSISAVVVIVVTVLVDVTGVIAGWSG----------------VFGVSPMPI--- 208

Query: 237 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 296
            +V+ +++S +A+D   SA  +  S+  F N L + V R + +I  V  V   LK    L
Sbjct: 209 -LVMVMTISTSAFDFPRSALISTGSDAFFRNTLDICVVRLIVVILIVATVVVALKSPSTL 267

Query: 297 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIE 356
           ++FLI+D+++ S +P +++GL    YF    +                S  +      + 
Sbjct: 268 QIFLISDVISTSIIPRLVIGLTSRAYFWRGFEVVVGRLGRILAVASWESFEFDRGDVCLR 327

Query: 357 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 415
           L+ L    Y T + +L            F+ + +  ++   W   KI G  FV   + E
Sbjct: 328 LVCLWGLRYCTGWRLL------------FSIIEYAGKIGFEWAMAKIHGTRFVALDRDE 374



>gi|495587964|ref|WP_008312543.1| sodium-solute symporter putative [Haloarcula amylolytica]
 gi|445765873|gb|EMA17010.1| sodium-solute symporter putative [Haloarcula amylolytica JCM 13557]
          Length = 502

 Score =  129 bits (323), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 99/328 (30%), Positives = 158/328 (48%), Gaps = 14/328 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F+ +E
Sbjct: 81  YAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++ +   L  +  V      + I     +YT YGGL AS++TD +Q              
Sbjct: 141 MTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAVGFGG 200

Query: 122 XATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAFSSKN 175
              S+        +V+     L     G  L + + VA +   A + ++G WQR +++  
Sbjct: 201 ALLSLGGTSEFHATVVSADPTLLDPGFGPGLEFGLYVAFALLGANMLNQGVWQRVYAADG 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 235
           +R LR      ++++ P+L+  GL G+ A  AGL   E    S   F  + +  P WV+ 
Sbjct: 261 ERALRRGLGIAAVVVVPMLLLAGLFGIAA--AGLGLTESGSASIAFFLVVAEAFPTWVTL 318

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVPAVYWG 289
             VVLAV +  ++ DT+ +A  +  + D+       + R      R L++   + A++ G
Sbjct: 319 AIVVLAVLLVMSSADTMFNAIASVVTADLARLLDDPDQRTLWLGGRGLTVAVALAAMFIG 378

Query: 290 LKDLDVLRVFLIADLLAASTMPPILLGL 317
            +   VL++FL ADLLAA    P L GL
Sbjct: 379 AQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|428171596|gb|EKX40511.1| hypothetical protein GUITHDRAFT_75395, partial [Guillardia theta
           CCMP2712]
          Length = 447

 Score =  126 bits (316), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/332 (28%), Positives = 163/332 (49%), Gaps = 24/332 (7%)

Query: 3   AFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFG---RFNQIYVSLMSIAYMFCFMI 59
           A G+ +PL V ++ G +++ K P   +   F+  RFG   +   I V+L+++A M   M+
Sbjct: 93  AIGTGVPLIVQSYFGSMVQSKYPTVNSFGDFITARFGPTAKLACIGVALINMAVM---ML 149

Query: 60  SELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX 119
           +E + +G +     G +    ++ +A VTT+YT YGGL  S++TD +QG           
Sbjct: 150 AEFTTIGGLFRDFVGTEGFPIILIVATVTTVYTMYGGLLVSIVTDQVQGITSVVLITTIS 209

Query: 120 XXXATSIRIE--KSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
              A + + E   +       L  N  G+  + +MP ++  + +F+EG WQR +++K+ +
Sbjct: 210 IYVAATFKRELPPNFGSLKQSLGPNQSGYSSILVMPASLMSSVMFNEGMWQRVWAAKDPQ 269

Query: 178 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGL---WPGEENLESYLAFFTLFKVLPD--- 231
            L+   V   + +  V+   GL G +A W GL     G  NL  YL  F +FK  P+   
Sbjct: 270 SLKRGGVLACLAVVSVVFLFGLGGFLAAWGGLIDFQTGNPNL--YL--FQVFKSSPNQNN 325

Query: 232 -----WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 286
                ++  + +VLA  M+ +A D++ +   A  S      + PL   R   L+  V  V
Sbjct: 326 VHVNQFIEVLVLVLAAVMNESAIDSVQNGLAATISTQFLRGK-PLIWARGCVLVITVIIV 384

Query: 287 YWGLKDLDVLRVFLIADLLAASTMPPILLGLI 318
            + L +  VL +FL+  +LA   + P++LG I
Sbjct: 385 PFALANYAVLSIFLLPSILAVCWLFPVMLGGI 416



>gi|491681725|ref|WP_005537864.1| sodium-solute symporter putative [Haloarcula argentinensis]
 gi|445767761|gb|EMA18854.1| sodium-solute symporter putative [Haloarcula argentinensis DSM
           12282]
          Length = 502

 Score =  126 bits (316), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 98/329 (29%), Positives = 161/329 (48%), Gaps = 16/329 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F+ +E
Sbjct: 81  YAIGSAIPLVLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++ +   L  +  V      + I     +YT YGGL AS++TD +Q              
Sbjct: 141 MTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAVGFGG 200

Query: 122 XATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAFSSKN 175
              S+        +V+     L   + G  L + + VA +   A + ++G WQR +++  
Sbjct: 201 ALLSLGGTSEFHATVVSADPTLLDPTFGPGLQFGLYVAFALLGANMLNQGVWQRVYAADG 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLPDWVS 234
           +  LR      ++++ P+L+  GL G+ A   GL    E+  + +AFF  + +  P WV+
Sbjct: 261 EGALRRGLGIAAVVVVPMLLLAGLFGIAAAGLGL---TESGSASIAFFLVVAEAFPTWVT 317

Query: 235 GITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVPAVYW 288
              VVLAV +  ++ DT+ +A  +  + D+       + R      R L++   + A++ 
Sbjct: 318 LAIVVLAVLLVMSSADTMFNAIASVVTADLARLLDDPDQRTLWLGGRGLTVAVALAAMFI 377

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGL 317
           G +   VL++FL ADLLAA    P L GL
Sbjct: 378 GAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|495819990|ref|WP_008544569.1| sodium:solute transporter family protein [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082653|gb|EDZ60079.1| sodium:solute transporter family protein [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 480

 Score =  125 bits (315), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 165/326 (50%), Gaps = 17/326 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G+  P+    +LG  IRK+ P+G +L +F+ ++FG+     + LM+I YMF F+ +E
Sbjct: 84  YALGTAFPMIFLIYLGKKIRKEFPKGSSLIEFMRKKFGKSLFKLILLMTIFYMFIFLCAE 143

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ----GWAXXXXXXX 117
           ++AV  ++  ++G +     I +   T  YT YGGLRAS+ TDNIQ    G         
Sbjct: 144 VTAVAVLINYISGTELWITAIIVLFATLTYTLYGGLRASIFTDNIQMIVIGILLLISVTY 203

Query: 118 XXXXXATSIRIEKSVIDNSDLL-KSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 176
                 +          N  LL +S S  +       +AV+   LFH+G WQR +++K+ 
Sbjct: 204 IISFTGSEFSFAYIEQKNPQLLSRSYSPNYTAGLTFFIAVAATNLFHQGNWQRVYAAKDY 263

Query: 177 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSG 235
           + L+   +   +++ P++ F+G  GM++     +  + +    L FFT L +   + +S 
Sbjct: 264 QTLKKGLIIAFLIIVPIVFFMGFAGMVS-----FSIDSSARPDLGFFTLLLREQTEILSL 318

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSND-----IFNNRLP-LNVTRFLSLIANVPAVYWG 289
           I V L ++++ +  DTL++A ++ F  D      FN +   L ++++  +  +V      
Sbjct: 319 IIVTLGLALTISTVDTLVNAISSLFVVDGKATFNFNKKTDYLKLSKYFIIFLSVITFIVA 378

Query: 290 LKDLDVLRVFLIADLLAASTMPPILL 315
            K  D+L +FL+ADL   + +  + L
Sbjct: 379 SKGYDILYLFLLADLFCCAFVLTVFL 404



>gi|490652117|ref|WP_004517111.1| sodium-solute symporter putative [Haloarcula vallismortis]
 gi|445755364|gb|EMA06754.1| sodium-solute symporter putative [Haloarcula vallismortis ATCC
           29715]
          Length = 502

 Score =  125 bits (314), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 101/330 (30%), Positives = 159/330 (48%), Gaps = 18/330 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F+ +E
Sbjct: 81  YAIGSAIPLVLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++ +   L  +  V      + I     +YT YGGL AS++TD +Q              
Sbjct: 141 MTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAIGFGG 200

Query: 122 XATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAFSSKN 175
              S+        +V+     L     G  L + + VA +   A + ++G WQR +++  
Sbjct: 201 ALLSLGGTSEFHATVVSADPTLLDPGFGPGLEFGLYVAFALLGANMLNQGVWQRVYAADG 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 235
           +  LR      ++++ P+L+  GL G+ A  AGL   E    S   F  + +  P WV+ 
Sbjct: 261 EDTLRRGMGIAAVVVVPMLLLSGLFGIAA--AGLGLTESGSASIAFFLVVAEAFPTWVTL 318

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL---PLNVT-----RFLSLIANVPAVY 287
             VVLAV +  ++ DT+ +A  +  + D+   RL   P   T     R L++   + A++
Sbjct: 319 AIVVLAVLLVMSSADTMFNAIASVVTADL--ARLLDDPDQQTLWLGGRGLTVAVALAAIF 376

Query: 288 WGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            G +   VL++FL ADLLAA    P L GL
Sbjct: 377 IGAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|495594848|ref|WP_008319427.1| sodium/proline symporter [Haloferax mucosum]
 gi|445744445|gb|ELZ95923.1| sodium/proline symporter [Haloferax mucosum ATCC BAA-1512]
          Length = 509

 Score =  125 bits (314), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 117/411 (28%), Positives = 193/411 (46%), Gaps = 31/411 (7%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y  G  +P+ V++ LGP IR+  P G +LT++   R+G     +V ++S  YMF F+ +E
Sbjct: 80  YGIGEAVPMLVYSKLGPRIRRLIPHGHSLTEYAHARYGTAMYAFVLVVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD IQ              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASITTDAIQAVVVFPLLLLAVGG 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              S+    + +D     N  LL   SL G Q    +  A+  A L ++ +WQR ++S +
Sbjct: 200 ALVSLGGPTAALDGITETNPALLDLGSLAGLQFGLALAFAILGAELINQTWWQRIYASDS 259

Query: 176 ----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK-VLP 230
               +R  R +AV   +++F V  F G+  +            N  + +AFF L +   P
Sbjct: 260 EQTVERSFRSAAVANGLVVF-VTAFFGIVAVGNADVVTNVTSSNYNADVAFFVLLQDAFP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVP 284
           +W+    V+LA+ +  ++ DTL +A ++  + DI       ++R     +R L+++  + 
Sbjct: 319 EWLVLAAVLLALLLVMSSIDTLFNALSSLVTADIARVLSSPSDRQLAVGSRALTVVVALA 378

Query: 285 AVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXX 344
           A+Y  L+   VLR+F  ADLL A+   P++ GL     +   I                 
Sbjct: 379 AIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL-----YSTRITGPGALASSLSGLAVGL 433

Query: 345 SIF--YHNAKDGIELIG--LPLG--LYITDYSVLGAFIVAPLSSIFFTFLS 389
           + F     A  GI L+G  LP    LY+T +   GAF+V+ ++S+    LS
Sbjct: 434 AYFPDLRGAITGIPLVGSHLPSADPLYLTSFG--GAFLVSMVASLIAARLS 482



>gi|401395637|ref|XP_003879646.1| hypothetical protein NCLIV_001050 [Neospora caninum Liverpool]
 gi|325114053|emb|CBZ49611.1| hypothetical protein NCLIV_001050 [Neospora caninum Liverpool]
          Length = 2887

 Score =  124 bits (312), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 92/324 (28%), Positives = 163/324 (50%), Gaps = 18/324 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRK-KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           Y+F   +P  V  W  PL+++    +GF+ T ++L R+GR  Q+  + +S+ +MF  +  
Sbjct: 94  YSFACGLPYVVVLWFAPLVKRLTLTDGFSGTDYLLSRYGRAVQVGATAISLLFMFFALSG 153

Query: 61  ELSAVGNILVTLTGVDK-----LAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXX 115
           EL+ VG   +T+  V K      A V+ +A+VT  YT YGGLRAS++TD  QG       
Sbjct: 154 ELTTVG---ITMNAVTKGAFPVFAAVVPVAVVTLAYTTYGGLRASILTDVYQGVLVVGLV 210

Query: 116 XXXXXXXATSIRIEKSV----IDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAF 171
                    + R    V    + +    +    G   +++  +  SF  LF +G WQR +
Sbjct: 211 VPLLVTVFVTARDATGVGFPALASPAAFRDYIAG--AVFLFSIWPSF--LFDQGIWQRVW 266

Query: 172 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLP 230
           ++K+ R++R++     ++ F  + FLG+ G+      L   +E  E  ++ F  L + LP
Sbjct: 267 AAKSLRDVRIAFGLAGVVAFACVFFLGMVGIACREQALSHAQERNEGNVSVFGYLAETLP 326

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGL 290
               G+  VLAV+   ++ DT  +A  + F+ D+  ++   N  R L ++ N+PA+    
Sbjct: 327 AGWVGVLTVLAVTCVASSADTYQTALASVFAQDLIRSKRSFNWARVLIVLLNIPAIIVAA 386

Query: 291 KDLDVLRVFLIADLLAASTMPPIL 314
             LD+L + + A++L    + P+L
Sbjct: 387 LQLDLLTLNMTANVLCVIAVGPML 410



>gi|71083513|ref|YP_266232.1| sodium/solute transporter family [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|499601231|ref|WP_011281965.1| sodium/solute transporter family [Candidatus Pelagibacter ubique]
 gi|71062626|gb|AAZ21629.1| sodium:solute transporter family [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 482

 Score =  124 bits (310), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 97/326 (29%), Positives = 167/326 (51%), Gaps = 31/326 (9%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G+  P+     LG  IR   P+G TL +F+ +RFG+     + LM++ YMF F+ +E
Sbjct: 84  YALGTAFPMIFLISLGKKIRTDFPKGSTLIEFLRKRFGKSLFKLILLMTVFYMFVFLCAE 143

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++AV  ++  ++G +     + I I T  YT YGGLRAS+ TDNIQ              
Sbjct: 144 ITAVAILINYISGTELWVTSLIILIATLAYTLYGGLRASIFTDNIQMIVIVALLLISVFY 203

Query: 122 XAT--------SIRIEKS-VIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFS 172
             +        S   EKS  + ++  + + + G        +AV+   LFH+G WQR ++
Sbjct: 204 LTSFTGDQFSFSFIKEKSPHLLSASYIPNYTAGLTFF----IAVAATNLFHQGNWQRVYA 259

Query: 173 SKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPD 231
           +KN+  L+ S +   I++ P++ F+G +G++AV A        +   L FF+ L     +
Sbjct: 260 AKNNEVLKKSLIVAFIVIIPIVFFMGFSGLVAVSA-----NPKVIPDLGFFSLLLSEQTE 314

Query: 232 WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV---TRFLSL------IAN 282
           ++S I V+L +S++ +  DTL++A +   S  + + +  LN+   T +L+L      + +
Sbjct: 315 FLSLIIVILGLSLTISTVDTLVNAIS---SLIVVDGKATLNLNKKTNYLTLSKYFIVVLS 371

Query: 283 VPAVYWGLKDLDVLRVFLIADLLAAS 308
           + A     K   VL +FL+ADL   +
Sbjct: 372 IIAFVIASKGFSVLYLFLLADLFCCA 397



>gi|494055010|ref|WP_006997107.1| sodium:solute transporter family protein [Candidatus Pelagibacter
           ubique]
 gi|91717870|gb|EAS84520.1| sodium:solute transporter family protein [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 482

 Score =  123 bits (309), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 166/326 (50%), Gaps = 31/326 (9%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G+  P+     LG  IR   P+G TL +F+ +RFG+     + LM++ YMF F+ +E
Sbjct: 84  YALGTAFPMIFLISLGKKIRTDFPKGSTLIEFLRKRFGKSLFKLILLMTVFYMFVFLCAE 143

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++AV  ++  ++G +     + I I T  YT YGGLRAS+ TDNIQ              
Sbjct: 144 VTAVAILINYISGTELWVTSLIILIATLAYTLYGGLRASIFTDNIQ-MIVIVALLLISVF 202

Query: 122 XATSIRIEKSVIDNSDLLKSNSLGWQLLYIMP---------VAVSFATLFHEGFWQRAFS 172
             TS + ++    +   +K  S     +  +P         +AV+   LFH+G WQR ++
Sbjct: 203 YLTSFKGDQ---FSFSFIKEKSPHLLSVSYIPNYTAGLTFFIAVAATNLFHQGNWQRVYA 259

Query: 173 SKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPD 231
           +KN+  L+ S +   I++ P++ F+G +G++AV A        +   L FF+ L     +
Sbjct: 260 AKNNEVLKKSLIVAFIVIIPIVFFMGFSGLVAVSA-----NPKVIPDLGFFSLLLSEQTE 314

Query: 232 WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV---------TRFLSLIAN 282
           ++S I V+L +S++ +  DTL++A +   S  + + +  LN+         +++  ++ +
Sbjct: 315 FLSLIIVILGLSLTISTVDTLVNAIS---SLIVVDGKATLNLNKKTNYLTFSKYFIVVLS 371

Query: 283 VPAVYWGLKDLDVLRVFLIADLLAAS 308
           + A     K   VL +FL+ADL   +
Sbjct: 372 IIAFIIASKGFSVLYLFLLADLFCCA 397



>gi|494345167|ref|WP_007188843.1| sodium-solute symporter putative [Haloarcula californiae]
 gi|445769530|gb|EMA20604.1| sodium-solute symporter putative [Haloarcula californiae ATCC
           33799]
          Length = 502

 Score =  122 bits (307), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 100/329 (30%), Positives = 161/329 (48%), Gaps = 16/329 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F+ +E
Sbjct: 81  YAIGSAIPLVLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++ +   L  +  V      + I     +YT YGGL AS++TD +Q              
Sbjct: 141 MTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAVGFGG 200

Query: 122 XATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAFSSKN 175
              S+        +V+     L   + G  L + + VA +   A + ++G WQR +++  
Sbjct: 201 ALLSLGGTSEFHATVVSADPTLLDPTFGPGLQFGLYVAFALLGANMLNQGVWQRVYAADG 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLPDWVS 234
           +R LR       +++ P+L+  GL G+ A   GL    E+  + +AFF  L +  P WV+
Sbjct: 261 ERALRRGMGIAGLVVVPMLLLSGLFGIAAAGLGL---TESGSASIAFFLVLAEAFPTWVT 317

Query: 235 GITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVPAVYW 288
              VVLAV +  ++ DT+ +A  +  + D+       + R      R L++   + A++ 
Sbjct: 318 LAVVVLAVLLVMSSADTMFNAIASVVTADLARLLDDPDQRTLWLGGRGLTVAVALAAMFI 377

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGL 317
           G +   VL++FL ADLLAA    P L GL
Sbjct: 378 GAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|348678575|gb|EGZ18392.1| hypothetical protein PHYSODRAFT_301074 [Phytophthora sojae]
          Length = 528

 Score =  122 bits (306), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 90/316 (28%), Positives = 155/316 (49%), Gaps = 11/316 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA   ++ + V A +GP  R    E  T+T  V  RFG   Q+YV  +S+ Y F  + SE
Sbjct: 125 YALSGVVGMIVLALVGPYTRSALGENVTMTDVVSHRFGYIMQVYVGFISMFYQFICLASE 184

Query: 62  LSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
            + +  +   ++     +  ++ +A +T LY   GGLRASL TD  QG            
Sbjct: 185 YTCIAQLTTMMSPNAHPIVTILIVAFLTNLYLVIGGLRASLATDVWQGIGVVFLVAVVCV 244

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                + I +    ++++    + G++ L  + +AV+ + LF  GFWQR +++ +D  LR
Sbjct: 245 AMFFHVSIPEGAWSSTNVAAFTTAGFETLVTLVIAVTASNLFFTGFWQRVYAAYDDNTLR 304

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 240
            +A+  S ++    V L + GM++  A  +P     +  L F  L  +   W   I VV+
Sbjct: 305 KAALIASAIIALFTVALAMAGMVSYLA--YP-----DGSLFFAVLIDMGRGWQVLIVVVI 357

Query: 241 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 300
           A+ +S    D++     A  +      +L L  +R + ++ N PA+  G +  D+L ++L
Sbjct: 358 AM-LSSGVSDSIQMGLAAELTTCF--PKLSLMHSRVICVLLNAPAIAIGYQQYDILTLYL 414

Query: 301 IADLLAASTMPPILLG 316
           IADLL  + + P+LLG
Sbjct: 415 IADLLCTAAVGPMLLG 430



>gi|495848440|ref|WP_008573019.1| sodium-solute symporter [Haloferax sp. ATCC BAA-646]
 gi|445710004|gb|ELZ61827.1| sodium-solute symporter [Haloferax sp. ATCC BAA-646]
 gi|445710118|gb|ELZ61940.1| sodium-solute symporter [Haloferax sp. ATCC BAA-645]
 gi|445719176|gb|ELZ70858.1| sodium-solute symporter [Haloferax sp. ATCC BAA-644]
          Length = 509

 Score =  122 bits (305), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 163/334 (48%), Gaps = 20/334 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR+  PEG +LT++   R+G     +V ++S  YMF F+ +E
Sbjct: 80  YAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGTAMYAFVLVVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIATDAVQAVIVIPLLLLAFVG 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    + ID     N  LL   ++ G Q    +  A+  A L ++ +WQR +++ +
Sbjct: 200 ALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAILGAELINQTWWQRIYAADS 259

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF-KVLP 230
                R  R +A+    ++F V  F G+  +        P      +  AFF L  +  P
Sbjct: 260 SETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPASAGYNADAAFFVLLGEAFP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSLIANV 283
           +W+    V+LA+ +  ++ DTL +A ++  + D+        + RL L  +R L++   V
Sbjct: 319 EWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEPSDRRLALG-SRALTIAVAV 377

Query: 284 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 378 AAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|494484685|ref|WP_007274158.1| sodium-solute symporter [Haloferax sulfurifontis]
 gi|445744769|gb|ELZ96241.1| sodium-solute symporter [Haloferax sulfurifontis ATCC BAA-897]
          Length = 509

 Score =  122 bits (305), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 163/334 (48%), Gaps = 20/334 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR   PEG +LT++   R+G     +V L+S  YMF F+ +E
Sbjct: 80  YAVGEAVPMLVYARLGPRIRDLIPEGHSLTEYAHARYGTAMYAFVLLVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIATDAVQAVVVIPLLLLAFAG 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    + ID     N  LL   ++ G Q    +  A+  A L ++ +WQR +++ +
Sbjct: 200 ALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAILGAELINQTWWQRIYAADS 259

Query: 176 ----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF-KVLP 230
               +R  R +A+    ++F +  F G+  +        P      +  AFF L  +  P
Sbjct: 260 SETVERSFRTAALANGAIVF-ITAFFGVVAVGNAAVVTDPASAGYNADAAFFVLLGEAFP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSLIANV 283
           +W+    V+LA+ +  ++ DTL +A ++  + D+        + RL L  +R L++   +
Sbjct: 319 EWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEPSDRRLALG-SRALTIAVAI 377

Query: 284 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 378 AAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|332283893|ref|YP_004415804.1| sodium transporter family protein [Pusillimonas sp. T7-7]
 gi|503507058|ref|WP_013741719.1| sodium:solute symporter [Pusillimonas sp. T7-7]
 gi|330427846|gb|AEC19180.1| sodium transporter family protein [Pusillimonas sp. T7-7]
          Length = 479

 Score =  122 bits (305), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 164/348 (47%), Gaps = 46/348 (13%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y  G+  P ++   LG  +R+  P+G TLT+FV+ R+G+       ++ + YMF  + +E
Sbjct: 80  YGLGAASPRWLMIPLGRRMRELIPQGHTLTEFVIVRYGKPMYGLALIIMMFYMFITLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPV---ICIAIV---TTLYTGYGGLRASLITDNIQ-------- 107
           ++A+  +      V  LAPV   +  AIV   T LYT YGGLRAS+ TD +Q        
Sbjct: 140 ITAIAKL------VQLLAPVPLWVTAAIVMGSTLLYTSYGGLRASIFTDKVQMAVIVPLL 193

Query: 108 ------GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLK-SNSLGWQLLYIMPVAVSFAT 160
                 GW               +  IE   I    LL  ++ +G +  +   VA+    
Sbjct: 194 LVLLVLGW---------QATGGLAPAIEGLQIKAPQLLSLTDPVGVKAGFTFFVAILLTG 244

Query: 161 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYL 220
           LFH+G WQR +S+K+ R +R   + G +   P +  +GL G+   + GL  G     S  
Sbjct: 245 LFHQGNWQRVYSAKDTRSMRRGFLLGGLFAGPFIFVMGLFGL--AFVGL--GHTGDSSVA 300

Query: 221 AFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI------FNNRLPLNVT 274
            F  L   +P W +   + L +++  +  DT ISA ++  + D+       N R  + ++
Sbjct: 301 LFSVLLGHIPGWFAIALIPLGLALVMSTADTTISAVSSLIAVDVRRLTPAINKRALMALS 360

Query: 275 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 322
           R+L  +  +P +    +   VL +FL+ADL  ++   P+  GL +  Y
Sbjct: 361 RWLIFLLAIPVMIVAAQGYSVLYLFLLADLFCSAAAFPVFFGLFNRRY 408



>gi|55378520|ref|YP_136370.1| sodium-solute symporter [Haloarcula marismortui ATCC 43049]
 gi|499543045|ref|WP_011223828.1| sodium:proline symporter [Haloarcula marismortui]
 gi|55231245|gb|AAV46664.1| sodium-solute symporter putative [Haloarcula marismortui ATCC
           43049]
          Length = 502

 Score =  121 bits (304), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 160/329 (48%), Gaps = 16/329 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F+ +E
Sbjct: 81  YAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++ +   L  +  V      + I     +YT YGGL AS++TD +Q              
Sbjct: 141 MTGIAGALALVADVPLWQTSLLIGGFVLVYTAYGGLLASIVTDTVQTLVILPLLAVGFGG 200

Query: 122 XATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAFSSKN 175
              S+        +V+     L     G  L + + VA +   A + ++G WQR +++  
Sbjct: 201 ALLSLGGTSEFHATVVSADPTLLDPGFGPGLEFGLYVAFALLGANMLNQGVWQRVYAADG 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLPDWVS 234
           D  LR      ++++ P+L+  GL G+ A   GL    E+  + +AFF  + +  P WV+
Sbjct: 261 DGALRRGMGIAAVVVVPMLLLSGLFGIAAAGLGL---TESGSASIAFFLVVAEAFPTWVT 317

Query: 235 GITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVPAVYW 288
              VVLAV +  ++ DT+ +A  +  + D+       + R      R L++   + A++ 
Sbjct: 318 LAVVVLAVLLVMSSADTMFNAIASVVTADLARLLDDPDQRTLWLGGRGLTVAVALAAMFI 377

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGL 317
           G +   VL++FL ADLLAA    P L GL
Sbjct: 378 GAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|495289883|ref|WP_008014637.1| Na+/solute symporter [Haloterrigena limicola]
 gi|445664725|gb|ELZ17430.1| Na+/solute symporter [Haloterrigena limicola JCM 13563]
          Length = 505

 Score =  121 bits (303), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 165/337 (48%), Gaps = 26/337 (7%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+  ++ +GP IR+  P G +LT++   R+G     +V L+S  YMF F+ +E
Sbjct: 75  YAIGEALPMLAYSRVGPRIREVIPNGHSLTEYAHARYGTAMYAFVLLVSCLYMFVFLAAE 134

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD+IQ              
Sbjct: 135 LTGIAGALSLVAGVPQWQTAVLVGGFVLLYTSYGGLRASIFTDSIQALLVLPLLVVAFAG 194

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              S+     + D     N  LL    + G Q    +  A+  A L ++ +WQR +++++
Sbjct: 195 AIVSLGGAGEIHDGIASTNPSLLDPGFIPGLQFGLALAFAILGAELINQLWWQRIYAAED 254

Query: 176 ----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY---LAFFTLFK- 227
               +R  R + +   +++F      GL G++A        +    +Y   +AFF L + 
Sbjct: 255 GQTVERGFRNATIANGLIVF----LAGLFGLVAAGNADVVTDVTSSAYNADIAFFVLLQT 310

Query: 228 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI-------FNNRLPLNVTRFLSLI 280
             P+W+    V+LA+ +  ++ DTL +A ++  + D+        +  L L   R L+++
Sbjct: 311 AFPEWIVLAVVLLALLLVMSSVDTLFNALSSIVTADLPRLLSDPDDRSLKLG-ARLLTIV 369

Query: 281 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
             V A+Y  L+   VLR+F +ADLL A+   P+L GL
Sbjct: 370 VAVSAIYVSLRARSVLRLFFLADLLGAAVAFPLLYGL 406



>gi|325185496|emb|CCA19979.1| Solute:Sodium Symporter (SSS) Family putative [Albugo laibachii
           Nc14]
          Length = 462

 Score =  121 bits (303), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 92/320 (28%), Positives = 160/320 (50%), Gaps = 16/320 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y   S + + + A +GP  R+   +G TL++ +L R+G   Q Y++++S  Y F  + SE
Sbjct: 83  YTLSSCLAMLILACVGPRTRRLLCDGVTLSECILHRYGHIMQTYIAIISFLYQFLSLASE 142

Query: 62  LSAVGNILVTLTGVDK-LAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
            + VG +   L+   K +  ++ +A++T LYT  GG+ ASL TD  QG            
Sbjct: 143 FTCVGQLTAILSPDAKPIVVILTVAVITNLYTLVGGMLASLATDVWQGVGVLSLVLLVCI 202

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
              +S     +V+  +     ++ G++ L  + +AV+ + LF  GFWQR +++ +D  LR
Sbjct: 203 VMISSTTTPANVLSVAVF---DTSGFETLVTLCIAVTSSNLFFSGFWQRVYAAADDATLR 259

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPD-WVSGITVV 239
            + +Y      P  V L + GM++     +PGE      + FF+L   +   W   + +V
Sbjct: 260 KACLYACGFCIPFTVALAVAGMVSSLK--YPGE------IYFFSLLLNMGTVWQVFVMMV 311

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 299
           +    S A+    +  T    SN      L L   R + ++ NV A++  L++  VL +F
Sbjct: 312 IVSLASSASDSLQMGITAELVSN---FPSLSLFHARVICVMLNVSAIFVALQNYSVLTLF 368

Query: 300 LIADLLAASTMPPILLGLID 319
           LI+DLL  +++ P+LL L D
Sbjct: 369 LISDLLCTASVGPMLLALWD 388



>gi|491109342|ref|WP_004968441.1| sodium-solute symporter [Haloferax denitrificans]
 gi|445754912|gb|EMA06306.1| sodium-solute symporter [Haloferax denitrificans ATCC 35960]
          Length = 509

 Score =  120 bits (302), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 161/334 (48%), Gaps = 20/334 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR   PEG +LT++   R+G     +V L+S  YMF F+ +E
Sbjct: 80  YAVGEAVPMLVYARLGPRIRDLIPEGHSLTEYAHARYGTAMYAFVLLVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIATDAVQAVVVIPLLLLAFVG 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    + ID     N  LL   ++ G Q    +  A+  A L ++ +WQR +++ +
Sbjct: 200 ALVALGGPAATIDGITATNPALLDLGAVAGLQFGLALAFAILGAELINQTWWQRIYAADS 259

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF-KVLP 230
                R  R +A+    ++F +  F G+  +        P      +  AFF L  +  P
Sbjct: 260 SETVGRSFRTAALANGAIVF-ITAFFGVVAVGNAAVVTDPASAGYNADAAFFVLLGEAFP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSLIANV 283
           +W+    V+LA+ +  ++ DTL +A ++  + D+        + RL    +R L++   V
Sbjct: 319 EWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEPSDRRLAFG-SRALTIAVAV 377

Query: 284 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 378 AAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|491096221|ref|WP_004957825.1| sodium-solute symporter putative [Haloarcula sinaiiensis]
 gi|445764745|gb|EMA15889.1| sodium-solute symporter putative [Haloarcula sinaiiensis ATCC
           33800]
          Length = 502

 Score =  120 bits (300), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 161/329 (48%), Gaps = 16/329 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F+ +E
Sbjct: 81  YAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++ +   L  +  V      + I     +YT YGGL AS++TD +Q              
Sbjct: 141 MTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAVGFGG 200

Query: 122 XATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAFSSKN 175
              S+        +V+     L   + G  L + + VA +   A + ++G WQR +++  
Sbjct: 201 ALLSLGGTSEFHATVVSADPTLLDPTFGPGLQFGLYVAFALLGANMLNQGVWQRVYAADG 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLPDWVS 234
           +  LR      ++++ P+L+  GL G+ A   GL    E+  + +AFF  L +  P WV+
Sbjct: 261 EGALRRGMGIAALVVVPMLLLSGLFGIAAAGLGL---TESGSASIAFFLVLAEAFPTWVT 317

Query: 235 GITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVPAVYW 288
              VVLAV +  ++ DT+ +A  +  + D+       + R      R L++   + A++ 
Sbjct: 318 LAVVVLAVLLVMSSADTMFNAIASVVTADLARLLDDPDQRTLWLGGRGLTVAVALAAMFI 377

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGL 317
           G +   VL++FL ADLLAA    P L GL
Sbjct: 378 GAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|330813504|ref|YP_004357743.1| sodium:solute transporter family [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|503460508|ref|WP_013695169.1| sodium:solute symporter [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486599|gb|AEA81004.1| sodium:solute transporter family [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 492

 Score =  120 bits (300), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 95/331 (28%), Positives = 163/331 (49%), Gaps = 23/331 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G   P       G  +RK  PEG +LTQFV  R+G      V ++S+ Y+F ++ +E
Sbjct: 78  YALGQATPFLAMTVFGKRLRKIMPEGNSLTQFVYARYGSKMLKIVLVLSLFYVFIYLCAE 137

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++A+  I+  + GV+     + I I T +YT  GGL+ S+ITD +Q              
Sbjct: 138 VTAIAKIVNLIAGVELWKTSLLILISTLIYTLRGGLKISIITDKLQFIIISIFLILIFYY 197

Query: 122 XATS--IRIEKSVIDNSDLLKSNSL-------GWQLLYIMPVAVSFATLFHEGFWQRAFS 172
              S  + I   +I     LK+ +L       G+       +AV    LF +G WQR ++
Sbjct: 198 LFISGEVNISSELIS----LKAGNLIDPKYFSGYTAGITFFIAVFATNLFDQGIWQRVYA 253

Query: 173 SKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDW 232
           +K+D++L  S V    ++ PV++ LG  G++AV      G+    S + F  L K    W
Sbjct: 254 AKSDQDLHKSFVSSFFIVLPVILILGFCGIVAVSL----GQAKDPSIVIFSLLLKNGTVW 309

Query: 233 VSGITVVLAVSMSCAAYDTLISATTANF---SNDIFNNR---LPLNVTRFLSLIANVPAV 286
           +S   +VLA+++  ++ DTLI+A ++ F   S  I  ++     L++++   ++ +    
Sbjct: 310 LSISILVLALTLVISSMDTLINAISSLFIIESKKIIRSKSSDFYLSISKIFLILISCLVF 369

Query: 287 YWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
               + + VL +FL+ADLL  +   P+  G+
Sbjct: 370 MIASQGMSVLYMFLLADLLCCAAAIPVFYGM 400



>gi|167042009|gb|ABZ06745.1| putative Sodium:solute symporter family protein [uncultured marine
           microorganism HF4000_141F21]
          Length = 484

 Score =  119 bits (299), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 83/263 (31%), Positives = 148/263 (56%), Gaps = 11/263 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y+ G+  P+  F +LG  IRK  P G TLT+F+  +FG+     + +++I YMF F+ +E
Sbjct: 85  YSLGTAFPMIAFIFLGTKIRKVFPRGHTLTEFIHYKFGKNLFKLILILTIFYMFIFLCAE 144

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX-- 119
           ++AV  ++  ++G         + + T +YT YGGLRAS++TDNIQ +            
Sbjct: 145 VTAVSMLVNYISGTPLWLTATLVIVTTLVYTLYGGLRASILTDNIQFFIVIILLLICAYY 204

Query: 120 --XXXATSIRIEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 176
                + SI  +    ++  LL S  +  +       +AV+   LFH+G WQR F++KN+
Sbjct: 205 LFSLNSDSISFQVIQTNSQHLLSSKYIPNYTAGLTFFIAVAATNLFHQGNWQRVFAAKNN 264

Query: 177 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSG 235
           + L+ S +   I++ P++ F+G++G+IA+       +  +   LAFF+ L K   +++S 
Sbjct: 265 KVLKKSLLISFIIIIPIVFFMGISGIIAISL-----DSAVNPDLAFFSILLKNKTEFLSV 319

Query: 236 ITVVLAVSMSCAAYDTLISATTA 258
           I ++LAVS++ +  DTL++A ++
Sbjct: 320 IIIILAVSLAISTIDTLVNAISS 342



>gi|490163169|ref|WP_004061823.1| sodium-solute symporter [Haloferax lucentense]
 gi|445725920|gb|ELZ77538.1| sodium-solute symporter [Haloferax lucentense DSM 14919]
          Length = 509

 Score =  119 bits (298), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 162/334 (48%), Gaps = 20/334 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR+  PEG +LT++   R+G     +V L+S  YMF F+ +E
Sbjct: 80  YAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGTAMYAFVLLVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIATDAVQAVVVIPLLLLAFAG 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    + ID     N  LL   ++ G Q    +  A+  A L ++ +WQR +++ +
Sbjct: 200 ALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAILGAELINQTWWQRIYAADS 259

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF-KVLP 230
                R  R +A+    ++F V  F G+  +        P      +  AFF L  +  P
Sbjct: 260 SETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPASAGYNADAAFFVLLGEAFP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSLIANV 283
           +W+    V+LA+ +  ++ DTL +A ++  + D+        + RL L  +R L++    
Sbjct: 319 EWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEPSDRRLALG-SRALTIAVAA 377

Query: 284 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 378 AAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|348689995|gb|EGZ29809.1| hypothetical protein PHYSODRAFT_309973 [Phytophthora sojae]
          Length = 442

 Score =  119 bits (298), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/318 (29%), Positives = 152/318 (47%), Gaps = 15/318 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y    I  + V   +GP IR    +  T+T  V  RFG   +IY+  +S+ Y F  + SE
Sbjct: 81  YTLSCISGMVVLGVVGPYIRSAVGDNITMTDVVSNRFGYVMRIYIGGISLFYQFICLASE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICI---AIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXX 118
            + +   L T+   D   P+I I   A +T LY   GGLRASL TD  QG          
Sbjct: 141 YTCIAQ-LTTMMSPDA-HPIITILLVAFLTNLYLTIGGLRASLATDVWQGIDVVALVGLV 198

Query: 119 XXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRE 178
                  + I +     +++    + G+++L  + +AV+ + LF  GFWQR +++ +DR 
Sbjct: 199 CIAMFVHVSIPEGAWKKTNVAAFTTSGFEVLVTLVIAVTASNLFITGFWQRVYTAVDDRT 258

Query: 179 LRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITV 238
           L  +A   SI+L    V L + GM++  A  +P     E  L F  L  +   W   I +
Sbjct: 259 LYKAAFMASIILTVFTVALAMAGMVSYLA--YP-----EGDLFFAILIDMGRGWQVLIII 311

Query: 239 VLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRV 298
           V+A+ ++    D+L     A  +      +L L   R + ++ N PA+  G +  D++ +
Sbjct: 312 VIAM-LASGVSDSLQVGIAAELTTCF--PKLTLLQARIICVLLNAPAIAIGYQQYDIMTL 368

Query: 299 FLIADLLAASTMPPILLG 316
           +LIADLL    + P+LLG
Sbjct: 369 YLIADLLCTIAVGPMLLG 386



>gi|493648470|ref|WP_006600045.1| sodium-solute symporter [Haloferax alexandrinus]
 gi|445744183|gb|ELZ95662.1| sodium-solute symporter [Haloferax alexandrinus JCM 10717]
          Length = 509

 Score =  119 bits (297), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 162/334 (48%), Gaps = 20/334 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR+  PEG +LT++   R+G     +V L+S  YMF F+ +E
Sbjct: 80  YAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGTAMYAFVLLVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIATDAVQAVVVIPLLLLAFAG 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    + ID     N  LL   ++ G Q    +  A+  A L ++ +WQR +++ +
Sbjct: 200 ALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAILGAELINQTWWQRIYAADS 259

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF-KVLP 230
                R  R +A+    ++F V  F G+  +        P      +  AFF L  +  P
Sbjct: 260 SETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPASAGYNADAAFFVLLGEAFP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSLIANV 283
           +W+    V+LA+ +  ++ DTL +A ++  + D+        + RL L  +R L++    
Sbjct: 319 EWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEPSDRRLALG-SRALTIAVAA 377

Query: 284 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 378 AAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|491113813|ref|WP_004972271.1| sodium-solute symporter [Haloferax gibbonsii]
 gi|445733395|gb|ELZ84965.1| sodium-solute symporter [Haloferax gibbonsii ATCC 33959]
          Length = 509

 Score =  119 bits (297), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 99/334 (29%), Positives = 164/334 (49%), Gaps = 20/334 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR+  PEG +LT++   R+G     +V L+S  YMF F+ +E
Sbjct: 80  YAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGSAMYAFVLLVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIATDAVQAVIVIPLLLLAFAG 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    + ID     N  LL   ++ G Q    +  A+  A L ++ +WQR +++ +
Sbjct: 200 TLVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAILGAELINQTWWQRIYAADS 259

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF-KVLP 230
                R  R +A+    ++F V  F G+  +        P      +  AFF L  +  P
Sbjct: 260 SETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPASAGYNADAAFFVLLGEAFP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSLIANV 283
           +W+    V+LA+ +  ++ DTL +A ++  + D+        + RL L  +R L+++  V
Sbjct: 319 EWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEPSDRRLALG-SRALTVVVAV 377

Query: 284 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 378 AAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|490728987|ref|WP_004591385.1| sodium-solute symporter putative [Haloarcula japonica]
 gi|445782306|gb|EMA33153.1| sodium-solute symporter putative [Haloarcula japonica DSM 6131]
          Length = 502

 Score =  119 bits (297), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 97/329 (29%), Positives = 162/329 (49%), Gaps = 16/329 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F+ +E
Sbjct: 81  YAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++ + + L  +  V      + I     +YT YGGL AS++TD +Q              
Sbjct: 141 MTGIASALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAVGFGG 200

Query: 122 XATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAFSSKN 175
              S+        +V+     L   + G  L + + VA +   A + ++G WQR +++  
Sbjct: 201 ALLSLGGTSEFHATVVSADPTLLDPTFGPGLEFGLYVAFALLGANMLNQGVWQRVYAADG 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLPDWVS 234
           +  LR      ++++ P+L+  GL G+ A   GL    E+  + +AFF  + +  P WV+
Sbjct: 261 EGALRRGMGIAAVVVVPMLLLSGLFGIAATGLGL---TESGSASIAFFLVVAEAFPQWVT 317

Query: 235 GITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVPAVYW 288
              VVLAV +  ++ DT+ +A  +  + D+       + R      R L++   + A++ 
Sbjct: 318 LAVVVLAVLLVMSSADTMFNAIASVVTADLARLLDDPDQRTLWLGGRGLTVAVALGAIFI 377

Query: 289 GLKDLDVLRVFLIADLLAASTMPPILLGL 317
           G +   VL++FL ADLLA+    P L GL
Sbjct: 378 GAQGYSVLQLFLTADLLASGVFVPFLAGL 406



>gi|167042081|gb|ABZ06816.1| putative sodium:solute symporter family protein [uncultured marine
           microorganism HF4000_141I21]
          Length = 484

 Score =  118 bits (295), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 83/263 (31%), Positives = 148/263 (56%), Gaps = 11/263 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y+ G+  P+  F +LG  IRK  P G TLT+F+  +FG+     + +++I YMF F+ +E
Sbjct: 85  YSLGTAFPMIAFIFLGTKIRKVFPRGHTLTEFIHYKFGKNLFKLILILTIFYMFIFLCAE 144

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX-- 119
           ++AV  ++  ++G         + + T +YT YGGLRAS++TDNIQ +            
Sbjct: 145 VTAVSMLVNYISGTPLWLTATLVIVTTLVYTLYGGLRASILTDNIQFFIVIILLLICAYY 204

Query: 120 --XXXATSIRIEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 176
                + SI  +    ++  LL S  +  +       +AV+   LFH+G WQR F++KN+
Sbjct: 205 LFSLNSDSISFQVIQTNSQYLLSSKYIPNYTAGLTFFIAVAATNLFHQGNWQRVFAAKNN 264

Query: 177 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSG 235
           + L+ S +   I++ P++ F+G++G+IA+       +  +   LAFF+ L K   +++S 
Sbjct: 265 KVLKKSLLISFIIIIPIVFFMGISGIIAI-----SLDSAVNPDLAFFSILLKDKTEFLSV 319

Query: 236 ITVVLAVSMSCAAYDTLISATTA 258
           I ++LAVS++ +  DTL++A ++
Sbjct: 320 IIIILAVSLAISTIDTLVNAISS 342



>gi|495372393|ref|WP_008097106.1| sodium-solute symporter [Haloferax prahovense]
 gi|445711601|gb|ELZ63391.1| sodium-solute symporter [Haloferax prahovense DSM 18310]
          Length = 509

 Score =  116 bits (290), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 162/334 (48%), Gaps = 20/334 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR+  PEG +LT++   R+G     +V L+S  YMF F+ +E
Sbjct: 80  YAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGSAMYAFVLLVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIATDAVQAVVVIPLLLLAFAG 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    + ID     N  LL   ++ G Q    +  A+  A L ++ +WQR +++ +
Sbjct: 200 ALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAILGAELINQTWWQRIYAADS 259

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF-KVLP 230
                R  R +A+    ++F V  F G+  +        P      +  AFF L  +  P
Sbjct: 260 SETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPASAGYNADAAFFVLLGEAFP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSLIANV 283
           +W+    V+LA+ +  ++ DTL +A ++  + D+        +  L L  +R L+++   
Sbjct: 319 EWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEPSDRHLALG-SRALTVVVAA 377

Query: 284 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 378 AAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|292494311|ref|YP_003533454.1| sodium-solute symporter [Haloferax volcanii DS2]
 gi|490140807|ref|WP_004041156.1| sodium:proline symporter [Haloferax volcanii]
 gi|291369368|gb|ADE01598.1| sodium-solute symporter putative [Haloferax volcanii DS2]
 gi|445582492|gb|ELY36833.1| sodium-solute symporter [Haloferax volcanii DS2]
          Length = 509

 Score =  116 bits (290), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 97/334 (29%), Positives = 162/334 (48%), Gaps = 20/334 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR+  PEG +LT++   R+G     +V L+S  YMF F+ +E
Sbjct: 80  YAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGTAMYAFVLLVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIATDAVQAVVVIPLLLLAFAG 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    + ID     N  LL   ++ G Q    +  A+  A L ++ +WQR +++ +
Sbjct: 200 ALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAILGAELINQTWWQRIYAADS 259

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF-KVLP 230
                R  R +A+    ++F V  F G+  +        P      +  AFF L  +  P
Sbjct: 260 SETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPASAGYNADAAFFVLLGEAFP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSLIANV 283
           +W+    V+LA+ +  ++ DTL +A ++  + D+        +  L L  +R L+++   
Sbjct: 319 EWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEPSDRHLALG-SRALTVVVAA 377

Query: 284 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 378 AAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|159478048|ref|XP_001697116.1| hypothetical protein CHLREDRAFT_175912 [Chlamydomonas reinhardtii]
 gi|158274590|gb|EDP00371.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 485

 Score =  115 bits (289), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 92/342 (26%), Positives = 162/342 (47%), Gaps = 25/342 (7%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           MYAF S +P+ + A  G  I+KK P+  T+  FV +R+G   +    ++S+  M   +++
Sbjct: 89  MYAFASGLPIIIIALFGARIQKKHPDVCTMPDFVGKRYGPVARTTCVVISLINMAIVLLA 148

Query: 61  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
           E + +G +     G      VI + ++T  YT YGG+  S++TD  QG            
Sbjct: 149 EYTTIGILFKYFVGSVDYPIVIVVGVLTMFYTAYGGVYISIVTDQAQGIMTSLFIMILII 208

Query: 121 XXATSIRIEK--------SVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFS 172
             A + R E         +  +    L +N  G+  ++ MP ++  AT+F E  WQ+ ++
Sbjct: 209 YTAITYRPENLPKPLPNDTTYETGWPLGANKFGYSAIFSMPCSLMAATVFSEAMWQKVWA 268

Query: 173 SKNDRELRLSAVYG-SIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK---- 227
           S + + +      G ++ +F V +F G  G +A WAG     E+ +  L  F LF     
Sbjct: 269 STDRKSVVFGGFVGFALTMFAVFIF-GFGGWLAAWAGYV--TEDTDPNLYLFQLFADERD 325

Query: 228 --------VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 279
                    +  W+  ++++LA +M+ AA D+L +  T+  +   F  +  +   R + L
Sbjct: 326 SATPGASVTIQSWIGVVSLILATTMNEAAVDSLQNGITSVLAYHFFKGQHTV-FPRIIVL 384

Query: 280 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSL 321
           + N+P +   L+   VL +FLI ++L       I LGL+D L
Sbjct: 385 LINIPLIIISLQGFKVLALFLITNMLTTCMFLLIGLGLVDRL 426



>gi|389848875|ref|YP_006351112.1| sodium/proline symporter [Haloferax mediterranei ATCC 33500]
 gi|490157777|ref|WP_004056446.1| sodium:proline symporter [Haloferax mediterranei]
 gi|388246181|gb|AFK21125.1| sodium/proline symporter [Haloferax mediterranei ATCC 33500]
 gi|445753959|gb|EMA05374.1| sodium/proline symporter [Haloferax mediterranei ATCC 33500]
          Length = 509

 Score =  115 bits (288), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 162/337 (48%), Gaps = 26/337 (7%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR+  P G +LT++   R+G     +V L+S  YMF F+ +E
Sbjct: 80  YAIGEAVPMLVYAKLGPRIRRLIPHGHSLTEYAHARYGTAMYAFVLLVSALYMFIFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +     LYT YGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIATDAVQAVIVLPLLLLAFVG 199

Query: 122 XATSIRIEKSVIDN------SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    + +D         L      G Q    +  A+  A L ++ +WQR ++S +
Sbjct: 200 ALVALGGPSAALDGITTANPGLLDLGALAGLQFGLALAFAILGAELINQTWWQRIYASDS 259

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG---LWPGEENLESYLAFFTLFK- 227
           +    R  R +A+   +++F    F    G+IAV            N  + +AFF L + 
Sbjct: 260 EETVTRSFRNAALTNGLVVFVTAFF----GIIAVGNADVITDVTSSNYNADVAFFVLLQD 315

Query: 228 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSLI 280
             P+W+    V+LA+ +  ++ DTL +A ++  + D+        + RL    +R L+++
Sbjct: 316 AFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLSSPSDRRLAFG-SRTLTVV 374

Query: 281 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
             + A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 375 VALAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|452206656|ref|YP_007486778.1| sodium/solute symporter [Natronomonas moolapensis 8.8.11]
 gi|505221751|ref|WP_015408853.1| sodium/solute symporter [Natronomonas moolapensis]
 gi|452082756|emb|CCQ36026.1| sodium/solute symporter [Natronomonas moolapensis 8.8.11]
          Length = 525

 Score =  114 bits (286), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 96/327 (29%), Positives = 154/327 (47%), Gaps = 13/327 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS IPL +F  +G  IR   P G +LT+F   RFG    ++V ++S+ YMF F+ +E
Sbjct: 81  YAVGSTIPLLLFIPVGSRIRSVMPSGHSLTEFAYARFGAAMYLFVLVVSVFYMFVFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG------WAXXXXX 115
           ++ +   L  + GV +    + +     +YT YGGL AS++TD IQ        A     
Sbjct: 141 MTGIAGALSLVAGVPQWQTALLVGGFVLVYTVYGGLVASIVTDTIQTLVVLPLLAVGFGG 200

Query: 116 XXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
                     I       D + L      G +    +  A+  A + ++G WQR +++  
Sbjct: 201 ALVALGGTGEIHAAAVAADATLLDPGFRPGVEFGIYVAFAILGANMLNQGIWQRVYAADG 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 235
           +  LR      ++++ P+++  GL G+ A   GL     +  S   F  L    P WV+ 
Sbjct: 261 ETSLRRGFGAAAVVVVPMILLAGLFGVAAAALGLT--GPDTASVAFFLVLEAAFPTWVTL 318

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSNDI-----FNNRLPLNVTRFLSLIANVPAVYWGL 290
             VVL V +  ++ DT+ +A  +  + D+      + R      R L++   V A++ G 
Sbjct: 319 AVVVLVVLLVMSSADTMFNAIASVVTADLARLVDADQRTLWLGGRGLTVAVAVGAIFIGA 378

Query: 291 KDLDVLRVFLIADLLAASTMPPILLGL 317
           +   VLR+FL ADLLAA+   P L GL
Sbjct: 379 QGYSVLRLFLSADLLAAAVFFPFLAGL 405



>gi|485631099|gb|EOD26242.1| hypothetical protein EMIHUDRAFT_236819 [Emiliania huxleyi CCMP1516]
 gi|485634815|gb|EOD29566.1| hypothetical protein EMIHUDRAFT_233786 [Emiliania huxleyi CCMP1516]
          Length = 554

 Score =  114 bits (284), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 95/389 (24%), Positives = 175/389 (44%), Gaps = 73/389 (18%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y   +++P+ +F W+GP++RK  P G T + +V  R+G    +Y +L+S+ Y+  ++ +E
Sbjct: 88  YTLSTLVPIAIFGWIGPIMRKHLPFGCTFSDYVQLRYGSLVNVYCTLVSLLYLCLYLTAE 147

Query: 62  LSAVGNILVTLT------------GVD------KLAPVICIAIVTTLYTGYGGLRASLIT 103
            SA+G+ ++ L             GV       KL  V+ +++ T LYT   GL  SL+T
Sbjct: 148 FSAIGDAVLALCDPADVYDAAAAGGVTDKGHRLKLGLVLGVSLCTLLYTAIAGLPVSLVT 207

Query: 104 DNIQGWA--------XXXXXXXXXXXXATSIRIEK-SVIDNSDLLKSNSLG------WQL 148
           D +QG                        S R E+ +     D   + + G      +++
Sbjct: 208 DKVQGVGIFLFTFLVCIAAFTADSGADGRSDRWEEVTTTGTGDPAATGAGGSTYGNSFKM 267

Query: 149 LYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG 208
            +I+  AV+ A + H GF QR +++++  +LR  A+ G ++  P++V  G+ GM++    
Sbjct: 268 AFILISAVTCANMMHSGFQQRVWAAEDQAKLRKGAIGGILLTIPLMVLYGVVGMVSYREY 327

Query: 209 ---LWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANF----- 260
              L+P      S+  F+ L ++   W     V+L   M  ++ DT+ +   A F     
Sbjct: 328 GPFLFP---QFPSFAGFYALNELNVGW-QVCAVILTTMMVASSADTIQTGVAAIFKPFTT 383

Query: 261 ------------SNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR----------- 297
                         +     + LN     +++ NVPA+       D LR           
Sbjct: 384 YVLVRDWKALPSEAEAPRTIVALNFV-LAAVVVNVPAIVISTHRGDALRTRPRSGCDAHL 442

Query: 298 ----VFLIADLLAASTMPPILLGLIDSLY 322
               +F++ADL+ A+ + P+L+GL D ++
Sbjct: 443 SVLSLFVLADLVCATCVVPVLMGLNDRIH 471



>gi|401410997|ref|XP_003884946.1| conserved hypothetical protein [Neospora caninum Liverpool]
 gi|325119365|emb|CBZ54918.1| conserved hypothetical protein [Neospora caninum Liverpool]
          Length = 598

 Score =  113 bits (283), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 108/404 (26%), Positives = 180/404 (44%), Gaps = 31/404 (7%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFM 58
           +YA    +P+++F   GP++R++  +   F LT +V  RFGR  QI  +++S   +   M
Sbjct: 191 LYAVAIAVPMWIFMLAGPMVREEMKKHVAFGLTDYVHVRFGRSMQIVTAVVSFFSIMVAM 250

Query: 59  ISELSAVGNILVTLTGV-DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 117
             EL+ V     TL     +LA ++ +A+VT  YT + G  ASL+TD  Q +        
Sbjct: 251 AGELAFVAAAAQTLAPAFPRLAVILSVAVVTFAYTAFAGTNASLVTDKFQSFLLPLLLSI 310

Query: 118 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
                    ++ ++   ++           +L ++    ++A     G WQR  S K  R
Sbjct: 311 VLVAPCLHSQVSEATWKDAATWTPEGAFSGVLMVLSCCPAYA--MDPGMWQRVLSGKGTR 368

Query: 178 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWA-------GLWPGEENLESYLAFFTLFKVLP 230
           E+R   + GS+++ P +  LGLTG++A          G    E+NL S   FF +   L 
Sbjct: 369 EVRWGLLGGSLLVLPTIALLGLTGILARATAVALEAQGYTVNEDNLVSAPFFFLVLPSLS 428

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGL 290
             +  +  +LAV ++  + DT  SA  +  + ++   RL       +SL+AN+PAV    
Sbjct: 429 RGLVAVVFILAVILTAGSVDTFQSALPSLVAVELNAKRLSFGWGLLVSLVANIPAVLLAF 488

Query: 291 K-DLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH 349
                 +++ LI +LL A+  PPI LGL      L  +                 SIF+ 
Sbjct: 489 SWTESFIQLMLIGNLLTAAIFPPIFLGLCKRTTALGSV---------VGSIAGAVSIFFS 539

Query: 350 -------NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFT 386
                  +A      I LPLG+   D S +  F++ P ++   T
Sbjct: 540 GLIFTRGDASMAARWIVLPLGM--DDPSAVYTFLIVPATAALVT 581



>gi|495600235|ref|WP_008324814.1| sodium/proline symporter [Haloferax elongans]
 gi|445733213|gb|ELZ84788.1| sodium/proline symporter [Haloferax elongans ATCC BAA-1513]
          Length = 511

 Score =  113 bits (283), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 99/335 (29%), Positives = 158/335 (47%), Gaps = 22/335 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR+  P+G +LT++   R+G     +V ++S  YMF F+ +E
Sbjct: 80  YAIGEAVPMAVYAKLGPRIRELMPDGHSLTEYAHARYGDAMYAFVLVVSALYMFIFVAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV      I +      YT YGGL AS+ TD +Q              
Sbjct: 140 LTGIAGALAFVAGVPHWQTAILVGGAVLAYTTYGGLEASMFTDTVQALVVFPLLIVALVG 199

Query: 122 XATSIR-----IEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              S+       E     N  LL    + G Q    +  A+  A L ++ +WQR ++ K+
Sbjct: 200 VLVSLGGVGPVYEGVAATNPALLDPGFVPGLQFGIALAFAILGAELVNQTWWQRIYAGKS 259

Query: 176 ----DRELR-LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK-VL 229
                R  R  + V G+++    LV +   G   + A +     N +  +AFF L +  +
Sbjct: 260 SETVSRGFRNATVVNGAVVFLAALVGVVAVGHADIVADVTSAGYNAD--VAFFVLLESAV 317

Query: 230 PDWVSGITVVLAVSMSCAAYDTLISATT-------ANFSNDIFNNRLPLNVTRFLSLIAN 282
           P WV    V++A+ +  ++ DTL +A +       A    D  + +L L    F  L+A 
Sbjct: 318 PSWVVLAVVLVALLLVMSSVDTLFNALSCLVTVDLARMLPDSSDKQLTLGARAFTILVA- 376

Query: 283 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           + AVY  L+   VLR+F +ADLL A+   P++ GL
Sbjct: 377 LAAVYVSLRAQSVLRLFFLADLLGAAVAFPLVYGL 411



>gi|494805783|ref|WP_007541191.1| sodium/proline symporter [Haloferax larsenii]
 gi|445728902|gb|ELZ80502.1| sodium/proline symporter [Haloferax larsenii JCM 13917]
          Length = 511

 Score =  113 bits (282), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 99/335 (29%), Positives = 157/335 (46%), Gaps = 22/335 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+ V+A LGP IR+  P+G +LT++   R+G     +V ++S  YMF F+ +E
Sbjct: 80  YAIGEAVPMAVYAKLGPRIRELMPDGHSLTEYAHARYGDAMYAFVLVVSALYMFIFVAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV      I +      YT YGGL AS+ TD +Q              
Sbjct: 140 LTGIAGALAFVAGVPHWQTAILVGGAVLAYTTYGGLEASMFTDTVQALVVFPLLIVALVG 199

Query: 122 XATSIR-----IEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              S+       E     N  LL    + G Q    +  A+  A L ++ +WQR ++ K 
Sbjct: 200 VLVSLGGVGPVYEGVAATNPALLDPGFVPGLQFGIALAFAILGAELVNQTWWQRIYAGKT 259

Query: 176 ----DRELR-LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK-VL 229
                R  R  + V G+++    LV +   G   + A +     N +  +AFF L +  +
Sbjct: 260 SETVSRGFRNATVVNGAVVFLAALVGVVAVGHADIVADVTSAGYNAD--VAFFVLLESAV 317

Query: 230 PDWVSGITVVLAVSMSCAAYDTLISATT-------ANFSNDIFNNRLPLNVTRFLSLIAN 282
           P WV    V++A+ +  ++ DTL +A +       A    D  + +L L    F  L+A 
Sbjct: 318 PSWVVLAVVLVALLLVMSSVDTLFNALSCLVTVDLARMLPDSSDKQLTLGARAFTVLVA- 376

Query: 283 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           + AVY  L+   VLR+F +ADLL A+   P++ GL
Sbjct: 377 LAAVYVSLRAQSVLRLFFLADLLGAAVAFPLVYGL 411



>gi|257051772|ref|YP_003129605.1| Na+/solute symporter [Halorhabdus utahensis DSM 12940]
 gi|506268677|ref|WP_015788452.1| sodium:proline symporter [Halorhabdus utahensis]
 gi|256690535|gb|ACV10872.1| Na+/solute symporter [Halorhabdus utahensis DSM 12940]
          Length = 507

 Score =  112 bits (279), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 98/335 (29%), Positives = 157/335 (46%), Gaps = 24/335 (7%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+  +A +GP +R   P+G +LT++   R+G     +V  +S  YMF F+ +E
Sbjct: 80  YAIGEALPMLAYAKIGPRVRAVIPDGHSLTEYAHARYGASMYAFVLAVSGLYMFVFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  +  V +    + +     LYTGYGGLRAS+ TD +Q              
Sbjct: 140 LTGISRALAMVADVPQWQTAVLVGGFVLLYTGYGGLRASIFTDTLQAIIVMPLLVIAAAG 199

Query: 122 XATSIRIEKSVIDNSDLLKSNSL------GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    +V D         L      G Q    +  A+  A L ++ +WQR ++  +
Sbjct: 200 AVFALGGPGAVYDGIVATDPTLLDPGFWPGLQFGLALSFAILGAELINQTWWQRIYAGSD 259

Query: 176 DRE-----LRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF-KVL 229
                   LR S   G I+L  V  F G+  + A  A +    E   + L+FF L  +  
Sbjct: 260 SETVERGFLRASLANGLIVL--VAAFFGV--IAAGHANVVTASEGYNADLSFFLLLNESF 315

Query: 230 PDWVSGITVVLAVSMSCAAYDTLISA----TTANFS---NDIFNNRLPLNVTRFLSLIAN 282
           P+W+    V+LA+ +  ++ DTL +A     TA+     +D  +  L L    F  +IA 
Sbjct: 316 PEWLVLAVVLLALLLVMSSVDTLFNALSSLVTADLPRLIDDPDDRTLALGARAFTVVIA- 374

Query: 283 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           V A+Y  L+   V+R+F +ADLL A+   P+L GL
Sbjct: 375 VAAIYVSLRARSVIRLFFLADLLGAAVAFPLLYGL 409



>gi|221482350|gb|EEE20705.1| sodium/proline symporter, putative [Toxoplasma gondii GT1]
 gi|221502757|gb|EEE28471.1| hypothetical protein TGVEG_106540 [Toxoplasma gondii VEG]
          Length = 541

 Score =  110 bits (275), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 157/321 (48%), Gaps = 11/321 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRK-KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           YAF   +P  +  W  P +++    +GF+ T ++L R+GR  Q   + +S+ YMF  +  
Sbjct: 94  YAFACGLPYVLLLWFAPHVKRLTLTDGFSGTDYLLSRYGRLVQAAATTISLLYMFFALSG 153

Query: 61  ELSAVGNIL--VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXX 118
           EL+ VG  +  VT       A VI +A+VT  YT YGGLRAS++TD  QG          
Sbjct: 154 ELTTVGVTMNAVTNGAFPVFAGVIPVAVVTLAYTTYGGLRASILTDVYQGLLVVGLVVPL 213

Query: 119 XXXXATSIRIEKSVIDNSDLLKSNSLGWQLL----YIMPVAVSFATLFHEGFWQRAFSSK 174
                ++ R +   +DN+  + + S   Q +    ++  +  SF  L  +G WQR ++++
Sbjct: 214 LIIVFSTAR-DNMFVDNAATVAAPSGYSQYIAGGVFLFSIWPSF--LLDQGIWQRVWAAR 270

Query: 175 NDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWV 233
           +  ++R++    + + F  +   G+ G+      L    +  E  ++ F  L + LP   
Sbjct: 271 SLTDIRIAFAGAAFVAFSCVFLFGMVGIACRDQALSQAMQRQEENVSIFGYLAETLPAGW 330

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
            G+  VLA++   ++ DT  +A    F+ D+  ++   N  R L ++ N+PA+      L
Sbjct: 331 VGVLTVLAITCVASSADTYQTALAVVFAQDLLRSKRSFNWARVLIVLLNIPAILVASLQL 390

Query: 294 DVLRVFLIADLLAASTMPPIL 314
           D+L + + A++L      P+L
Sbjct: 391 DLLTLNMTANVLCVVAAGPLL 411



>gi|237842017|ref|XP_002370306.1| sodium:solute symporter family domain-containing protein
           [Toxoplasma gondii ME49]
 gi|211967970|gb|EEB03166.1| sodium:solute symporter family domain-containing protein
           [Toxoplasma gondii ME49]
          Length = 541

 Score =  110 bits (275), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 157/321 (48%), Gaps = 11/321 (3%)

Query: 2   YAFGSIIPLFVFAWLGPLIRK-KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 60
           YAF   +P  +  W  P +++    +GF+ T ++L R+GR  Q   + +S+ YMF  +  
Sbjct: 94  YAFACGLPYVLLLWFAPHVKRLTLTDGFSGTDYLLSRYGRLVQAAATTISLLYMFFALSG 153

Query: 61  ELSAVGNIL--VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXX 118
           EL+ VG  +  VT       A VI +A+VT  YT YGGLRAS++TD  QG          
Sbjct: 154 ELTTVGVTMNAVTNGAFPVFAGVIPVAVVTLAYTTYGGLRASILTDVYQGLLVVGLVVPL 213

Query: 119 XXXXATSIRIEKSVIDNSDLLKSNSLGWQLL----YIMPVAVSFATLFHEGFWQRAFSSK 174
                ++ R +   +DN+  + + S   Q +    ++  +  SF  L  +G WQR ++++
Sbjct: 214 LIIVFSTAR-DNMFVDNAATVAAPSGYSQYIAGGVFLFSIWPSF--LLDQGIWQRVWAAR 270

Query: 175 NDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWV 233
           +  ++R++    + + F  +   G+ G+      L    +  E  ++ F  L + LP   
Sbjct: 271 SLTDIRIAFAGAAFVAFSCVFLFGMVGIACRDQALSQAMQRQEENVSIFGYLAETLPAGW 330

Query: 234 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 293
            G+  VLA++   ++ DT  +A    F+ D+  ++   N  R L ++ N+PA+      L
Sbjct: 331 VGVLTVLAITCVASSADTYQTALAVVFAQDLLRSKRSFNWARVLIVLLNIPAILVASLQL 390

Query: 294 DVLRVFLIADLLAASTMPPIL 314
           D+L + + A++L      P+L
Sbjct: 391 DLLTLNMTANVLCVVAAGPLL 411



>gi|496768627|ref|WP_009366258.1| sodium:proline symporter [Halogranum salarium]
 gi|399239614|gb|EJN60540.1| hypothetical protein HSB1_11430 [Halogranum salarium B-1]
          Length = 488

 Score =  110 bits (275), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 104/332 (31%), Positives = 168/332 (50%), Gaps = 22/332 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS +PLF +A LGP IR+  PEG +LT++   R+G     YV L+++AYMF F+ +E
Sbjct: 81  YAVGSALPLFCYASLGPRIRQLVPEGHSLTEYAYARYGTVFAAYVLLVTVAYMFVFLAAE 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
            + +  +   L GV        +  +   YT YGGLRAS++TD IQ              
Sbjct: 141 FTGIALVFARLAGVPGWQTATLVGTIVLAYTAYGGLRASIVTDRIQTLVVLPLLFVGVVA 200

Query: 122 XATSIRIEKSVIDNSDLLKSN--SLGW----QLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    +V+ +    +    SLG+    +    + VA+  A L ++ +WQR ++ ++
Sbjct: 201 TLVALGGPTAVVSSVTSTRPELLSLGYLPGIEFGVYVTVAILGAELLNQAWWQRIYAGRD 260

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPD 231
           D    R  R++A     ++  V +F    G +A   G      +    L F  + +VLPD
Sbjct: 261 DETVKRSFRVAAACVVPLVLVVGLF----GPVAAARGFVSTPSDASVAL-FLVVERVLPD 315

Query: 232 WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFN------NRLPLNVTRFLSLIANVPA 285
           W   + V+LA+ +  ++ DTL +A  +  + D+        +RL   V R ++ +  V A
Sbjct: 316 WAVLVFVLLALVLVVSSADTLFNAIASVVTVDVPRFVEMPADRL-TTVARLVTGLVAVAA 374

Query: 286 VYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           V  G +   VL +FL+ADLLAA+T  P+LLGL
Sbjct: 375 VVVGAQGYSVLTLFLLADLLAAATFGPLLLGL 406



>gi|385803739|ref|YP_005840139.1| sodium/proline symporter [Haloquadratum walsbyi C23]
 gi|504368979|ref|WP_014556081.1| sodium:proline symporter [Haloquadratum walsbyi]
 gi|339729231|emb|CCC40465.1| sodium/solute symporter [Haloquadratum walsbyi C23]
          Length = 523

 Score =  110 bits (274), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 91/333 (27%), Positives = 162/333 (48%), Gaps = 18/333 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P++V++ +GP IR+  P G +LT++   R+G     +V  +S  YMF F+ +E
Sbjct: 80  YAVGEAVPMYVYSRVGPRIRELIPSGHSLTEYARARYGTAMYAFVVGVSGLYMFVFVAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  +  V +      +     LYTGYGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALAFVADVPQWQTATLVGGFVLLYTGYGGLRASIFTDTVQAVVVIPLLAVAFIA 199

Query: 122 XATSIRIEKSVIDN---SD---LLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    SV+ N   +D   L  + + G+Q    +  A+  A L ++ +WQR ++  +
Sbjct: 200 TVFALGGPSSVLGNITAADPGLLDPTAAAGFQFGLALAFAILGAELLNQTWWQRIYAGTD 259

Query: 176 DREL----RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK-VLP 230
              +    R + V   +++F +  FLG+           P      + +AFF L +  +P
Sbjct: 260 SESIAVAFRRATVLNGLIVF-IAAFLGVVAAGHTDIVTNPTSAAYNADVAFFVLLETAVP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVP 284
           +WV  + V+LA+S+  ++ DTL +A ++  + D+        +R    + R  +L     
Sbjct: 319 EWVILVVVLLALSLVMSSVDTLFNALSSLITVDLARIYPGSTDRQLRWIARGFTLCIAFA 378

Query: 285 AVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           A+Y  ++   VLR+F +ADLL  +   P++ GL
Sbjct: 379 AIYVSVRAQSVLRLFFLADLLGTALAFPLVYGL 411



>gi|406706436|ref|YP_006756789.1| sodium:solute symporter [alpha proteobacterium HIMB5]
 gi|504766341|ref|WP_014953443.1| sodium:solute symporter [alpha proteobacterium HIMB5]
 gi|406652212|gb|AFS47612.1| sodium:solute symporter [alpha proteobacterium HIMB5]
          Length = 477

 Score =  110 bits (274), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 170/337 (50%), Gaps = 31/337 (9%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G+  P+  F +LG  IRK   +G T+ +FV ++FG+     V LMSI YMF F+ +E
Sbjct: 83  YALGTAFPMIAFIFLGKKIRKDFKKGSTIIEFVRKKFGKSLFKLVLLMSIFYMFIFLCAE 142

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+AV  ++  ++G +       I I T +YT YGGLRAS+ TDNIQ              
Sbjct: 143 LTAVAFLINYISGTELWITSFIIIISTLVYTLYGGLRASIFTDNIQMIVIFILLIVSFNY 202

Query: 122 X--------ATSIRIEKS-VIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFS 172
                    + S   EKS  + +++ + S + G        +AV+   LFH+G WQR ++
Sbjct: 203 ILNINADQFSFSFIKEKSPHLVSANYIPSYTAGITFF----IAVAATNLFHQGNWQRVYA 258

Query: 173 SKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPD 231
           +KN   L+ S +    ++ P++ F+G +G++AV          +   L FFT L      
Sbjct: 259 AKNYETLKKSLLVSFFIIVPIVFFMGFSGLVAV-----SINSKVIPDLGFFTLLLNENTK 313

Query: 232 WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLN---------VTRFLSLIAN 282
           ++S + +VLA++++ +  DTLI+A +   S  + + +  LN         +++++ +  +
Sbjct: 314 YISLLIIVLALALTISTVDTLINAIS---SLIVVDGKATLNLDKKTDYLKLSKYIIVGLS 370

Query: 283 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLID 319
           + A +   K   +L +FL+ADL   + +  I     D
Sbjct: 371 LIAFFVASKGFSILYLFLLADLFCCAFVFTIFYSFYD 407



>gi|221507030|gb|EEE32634.1| hypothetical protein TGVEG_093120 [Toxoplasma gondii VEG]
          Length = 2070

 Score =  110 bits (274), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 88/331 (26%), Positives = 152/331 (45%), Gaps = 19/331 (5%)

Query: 1    MYAFGSIIPLFVFAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFM 58
            +YA    +PL++  + GP++R++      F LT +V  RFGR  QI  +++S       M
Sbjct: 1650 LYAVAIALPLWILMYAGPIVREEMQRHVAFGLTDYVHRRFGRSMQIVTAVVSFFSTVMAM 1709

Query: 59   ISELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 117
              EL+ +     TL     +LA ++ +A+VT  YT + G  ASL TDN+QG         
Sbjct: 1710 AGELAFLAAAAQTLAPSFPRLAVILSVAMVTFTYTAFLGTNASLETDNLQGILLPLLLLI 1769

Query: 118  XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
                     ++ +     +    +      +L ++    ++A    +G WQR  +    R
Sbjct: 1770 VPICAFMHSQVSQDAWKAAATWTAEGASSGVLMVLSCCPAYA--MDQGMWQRVMTGSGSR 1827

Query: 178  ELRLSAVYGSIMLFPVLVFLGLTGMIAVWA-------GLWPGEENLESYLAFFTLFKVLP 230
            E+R     GS+++   +  LG+TG++A          G    E++L +   FF +   L 
Sbjct: 1828 EVRFGLFGGSLLVLMTVSLLGVTGIVARATAVTLETQGFTVDEDSLVAAPFFFLILPSLS 1887

Query: 231  DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV---- 286
              +  +  VLAV ++  + DT  SA  +  + ++    +  +    +S IAN PAV    
Sbjct: 1888 RGLVAVVFVLAVILTVGSVDTFQSALPSLVAGELNTKGVSFDWALLVSFIANFPAVLLAY 1947

Query: 287  YWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            +W       +++ LI +LL A+  PPI LGL
Sbjct: 1948 HW---TESFIQLLLIGNLLTAAIFPPIFLGL 1975



>gi|110668293|ref|YP_658104.1| sodium/proline symporter [Haloquadratum walsbyi DSM 16790]
 gi|499890880|ref|WP_011571614.1| sodium:proline symporter [Haloquadratum walsbyi]
 gi|109626040|emb|CAJ52490.1| sodium/solute symporter [Haloquadratum walsbyi DSM 16790]
          Length = 523

 Score =  110 bits (274), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 91/333 (27%), Positives = 162/333 (48%), Gaps = 18/333 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P++V++ +GP IR+  P G +LT++   R+G     +V  +S  YMF F+ +E
Sbjct: 80  YAVGEAVPMYVYSRVGPRIRELIPSGHSLTEYARARYGTAMYAFVVGVSGLYMFVFVAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  +  V +      +     LYTGYGGLRAS+ TD +Q              
Sbjct: 140 LTGIAGALAFVADVPQWQTATLVGGFVLLYTGYGGLRASIFTDTVQAVVVIPLLAVAFIA 199

Query: 122 XATSIRIEKSVIDN---SD---LLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    SV+ N   +D   L  + + G+Q    +  A+  A L ++ +WQR ++  +
Sbjct: 200 TVFALGGPSSVLGNITAADPGLLDPTAAAGFQFGLALAFAILGAELLNQTWWQRIYAGTD 259

Query: 176 DREL----RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK-VLP 230
              +    R + V   +++F +  FLG+           P      + +AFF L +  +P
Sbjct: 260 SESIAVAFRRATVLNGLIVF-IAAFLGVVAAGHTDIVTNPTSAAYNADVAFFVLLETAVP 318

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVP 284
           +WV  + V+LA+S+  ++ DTL +A ++  + D+        +R    + R  +L     
Sbjct: 319 EWVILVVVLLALSLVMSSVDTLFNALSSLITVDLARIYPGSTDRQLRWIARGFTLCIAFA 378

Query: 285 AVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           A+Y  ++   VLR+F +ADLL  +   P++ GL
Sbjct: 379 AIYVSVRAQSVLRLFFLADLLGTALAFPLVYGL 411



>gi|313117273|ref|YP_004044256.1| Na+/proline symporter [Halogeometricum borinquense DSM 11551]
 gi|492947951|ref|WP_006056036.1| sodium:proline symporter [Halogeometricum borinquense]
 gi|312294164|gb|ADQ68595.1| Na+/proline symporter [Halogeometricum borinquense DSM 11551]
 gi|445570976|gb|ELY25534.1| Na+/proline symporter [Halogeometricum borinquense DSM 11551]
          Length = 526

 Score =  108 bits (269), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 166/337 (49%), Gaps = 26/337 (7%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y  G  +P+  ++ LGP IR+  PEG +LT++   R+G     +V ++S+ YMF F+ +E
Sbjct: 80  YGIGEAVPMLAYSRLGPRIRELIPEGHSLTEYAYARYGGAMYAFVIVVSVLYMFVFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + G+ +    + +     LYTGYGGLRAS+ TD IQ              
Sbjct: 140 LTGISLALNHVAGIPQWQTAVLVGGFVLLYTGYGGLRASIFTDTIQTMVILPLLVLSVAA 199

Query: 122 XATSI----RIEKSVID-NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++     I + V++ N+ LL    + G +    +  AV  A L ++ +WQR +++ +
Sbjct: 200 VILTLGGPGAIHQGVVEANATLLDPGFVPGLRFGIALVFAVLGAELVNQTWWQRIYAATD 259

Query: 176 ----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG---LWPGEENLESYLAFFTLFK- 227
               +R  R + V   +    +LV   L G++AV         G EN  + +AFF L + 
Sbjct: 260 SGVLERGFRTATVANGL----ILVLATLLGVVAVGNADVVTQLGSENYNAGIAFFVLLEG 315

Query: 228 VLPDWVSGITVVLAVSMSCAAYDTLISA----TTANFS---NDIFNNRLPLNVTRFLSLI 280
           V  +W+    ++LA+++  +  DTL +A     TA+     ND  +  L L       ++
Sbjct: 316 VFGEWLVLGVLLLALTLVMSTADTLFNALSSLVTADLPRLLNDPDDRTLRLGARAVTVVV 375

Query: 281 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           A   A+   L+   VLR+F +ADLL A+   P++ GL
Sbjct: 376 AVA-AIAVSLRARSVLRLFFVADLLGAAVGFPLVYGL 411



>gi|493057507|ref|WP_006114744.1| sodium/proline symporter [Halorubrum coriense]
 gi|445691497|gb|ELZ43684.1| sodium/proline symporter [Halorubrum coriense DSM 10284]
          Length = 495

 Score =  108 bits (269), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 95/335 (28%), Positives = 162/335 (48%), Gaps = 23/335 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G  +P+  +A +GP IRK  P+G +LT++   R+G     ++ ++S  YMF F+ +E
Sbjct: 69  YAVGEAVPMLAYARIGPQIRKLIPDGHSLTEYAHARYGTAMYAFILVVSALYMFVFVSAE 128

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +   L  + GV +    + +  V  LYTGYGGL AS++TD +Q              
Sbjct: 129 LTGIAGALSLVAGVPQWQTAVLVGGVVLLYTGYGGLTASIVTDTVQALLVIPLLVATFIA 188

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++     V D     N  LL    + G Q    +  A+  A L ++ +WQR ++ ++
Sbjct: 189 VLVTVGGVGPVYDGVTAANPALLDPGFIPGLQFGLALSFAILGAELINQTWWQRVYAGES 248

Query: 176 D----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVL-- 229
           D    R  R ++V   +++F   +F    G++AV +           Y A   LF +L  
Sbjct: 249 DDVVRRGFRTASVANGVLVFLAALF----GIVAVGSTDIVTNVTSAGYNADVALFVLLEE 304

Query: 230 --PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI-----FNNRLPLNVTRFLSLIAN 282
             P+ V     +LA+ +  ++ DTL +A  +  + D+      ++R  L  +R  ++   
Sbjct: 305 AFPEPVVLGVTLLALLLVISSVDTLFNALASLVAVDLGRLTATDDRWLLLASRLFTVAVA 364

Query: 283 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           + AVY  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 365 LAAVYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 399



>gi|497072234|ref|WP_009458289.1| sodium:solute symporter family protein 2 [Alcaligenes sp. HPC1271]
 gi|422887781|gb|EKU30178.1| sodium:solute symporter family protein 2 [Alcaligenes sp. HPC1271]
          Length = 537

 Score =  107 bits (268), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 160/333 (48%), Gaps = 16/333 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS+ P      LG  +R+  P G +L++FV+ R+GR       ++ + YMF  M +E
Sbjct: 138 YAIGSMSPRLAMIPLGKRMRELLPRGHSLSEFVIARYGRPMYALTLVIMLFYMFISMTAE 197

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++A+  ++  +  +        + + T +YT YGGLRAS+ TD +Q +            
Sbjct: 198 ITAMSKMITLIAPIPLWVTASIVLLATLIYTSYGGLRASIFTDKVQMFVILPMLFLIVMF 257

Query: 122 XATSIRIEKSVIDNSDLLK------SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++     + DN  L        S+ +G +      VA+    LFH+G WQR +++K+
Sbjct: 258 GWQAVGGPVQLFDNVKLEAPRLIELSDPVGVKAGLTFFVAILLTGLFHQGNWQRIYAAKD 317

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 235
            + +R   + G + + P +  +GL G+  V  G  PG+ ++     F  +   +P W   
Sbjct: 318 TKSMRRGFLLGGLFVAPFIFLMGLFGLAFVGLG-SPGDSSVA---LFNVILPHVPVWFLV 373

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL------IANVPAVYWG 289
           + + L +S+  ++ DT ISA ++  + D+       N  + +SL      I ++P +Y  
Sbjct: 374 LLIPLGLSLVMSSADTAISAVSSLIAVDLSRIMPHRNTAQMMSLARSLIWICSIPVLYAS 433

Query: 290 LKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 322
            +   VL +FL+ADLL ++   P+  GL    Y
Sbjct: 434 SQGFSVLYLFLLADLLCSAAAFPVFFGLYSRRY 466



>gi|493564321|ref|WP_006517691.1| Na+/proline symporter [Leptolyngbya sp. PCC 7375]
 gi|425762470|gb|EKV03323.1| Na+/proline symporter [Leptolyngbya sp. PCC 7375]
          Length = 502

 Score =  107 bits (267), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 84/330 (25%), Positives = 162/330 (49%), Gaps = 17/330 (5%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y  GS   + +F  +GP +R   P+G +L ++V  RFG      V  + + YMF ++ +E
Sbjct: 82  YCLGSAGAVALFFVVGPRLRHLMPQGHSLNEYVKYRFGGPMYWLVEAVIVFYMFIYLSAE 141

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+A+   L  +  V      + +     +YT  GGL  +++TD +Q              
Sbjct: 142 LTAIAKALQLVADVPLGVTALVVITAVFIYTTVGGLGTTILTDVVQFVVIVPLLLICAGV 201

Query: 122 XATSIRIEKS----VIDNSDLLK-SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 176
              ++    +    V    +LL   N  G +    + +A+  A +F++G WQR ++ ++ 
Sbjct: 202 IVVALGGSDAFGAVVAQQPELLSLGNIGGIRFGATLMIAIVAAEVFNQGNWQRVYACRDS 261

Query: 177 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK--VLPDWVS 234
           + +R + +  ++++ P++   GL G++AV   L   + ++    A F L     +P WV 
Sbjct: 262 QTVRRAFLGSAVIILPLIFIAGLLGVLAV--PLAEVQPDIIGETALFGLLNQLAMPGWVV 319

Query: 235 GITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLP-------LNVTRFLSLIANVPAVY 287
              +VLA+++  ++ DT+++   + F+ D+    LP       L V+R L+++  VPA+ 
Sbjct: 320 VSVIVLALALVMSSLDTMLNGIASVFTLDLM-RMLPDPSANNVLRVSRILTVLVGVPAIA 378

Query: 288 WGLKDLDVLRVFLIADLLAASTMPPILLGL 317
              +   VL +F +ADL+ A+ + P+L GL
Sbjct: 379 IAAQGYSVLYLFFVADLICAAVLFPMLYGL 408



>gi|489896677|ref|WP_003800124.1| sodium:solute symporter [Alcaligenes faecalis]
 gi|393165696|gb|EJC65745.1| sodium:solute symporter family protein 2 [Alcaligenes faecalis
           subsp. faecalis NCIB 8687]
          Length = 479

 Score =  105 bits (262), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 88/333 (26%), Positives = 158/333 (47%), Gaps = 16/333 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS+ P      LG  +R+  P G +L++FV+ R+GR       L+ + YMF  M +E
Sbjct: 80  YAIGSMSPRLAMIPLGKRMRELLPRGHSLSEFVIARYGRPMYALTLLIMLFYMFISMTAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++A+  ++  +  +        + + T +YT YGGLRAS+ TD +Q              
Sbjct: 140 ITAMSKMITLIAPIPLWVTASIVLLATLIYTSYGGLRASIFTDKVQMLVILPMLFLIVMF 199

Query: 122 XATSIRIEKSVIDNSDLLK------SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    ++ D+  L        S+ +G +      VA+    LFH+G WQR +++K+
Sbjct: 200 GWQAVGGPVNLFDSVKLQAPRLIELSDPVGMKAGMTFFVAILLTGLFHQGNWQRIYAAKD 259

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 235
            + +R   + G + + P +  +GL G+   + GL  G     S   F  +   +P W   
Sbjct: 260 TQSMRRGFLLGGLFVAPFIFLMGLFGL--AFVGL--GSHGDSSVALFNVILPHVPVWFLV 315

Query: 236 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL------IANVPAVYWG 289
           + + L +S+  ++ DT ISA ++  + D+       N  + +SL      + ++P +Y  
Sbjct: 316 LLIPLGLSLVMSSADTAISAVSSLIAVDLGRIMPHRNTAQMMSLARSLIWVCSIPVLYAS 375

Query: 290 LKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 322
            +   VL +FL+ADLL ++   P+  GL    Y
Sbjct: 376 SQGFSVLYLFLLADLLCSAAAFPVFFGLYSRRY 408



>gi|491920183|ref|WP_005672666.1| sodium:solute symporter [Lautropia mirabilis]
 gi|319743287|gb|EFV95692.1| transporter, SSS family [Lautropia mirabilis ATCC 51599]
          Length = 500

 Score =  104 bits (260), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 99/340 (29%), Positives = 163/340 (47%), Gaps = 40/340 (11%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS+ PL     LG  +R+  P G TLT+F+L R+GR        + + Y+F  + +E
Sbjct: 83  YALGSMSPLVAMLLLGRRMRQLMPHGHTLTEFLLTRYGRPMYALTLAIMVFYVFIELTAE 142

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ-------------- 107
           ++A+  ++  L  V        +     LYT  GGLRAS+ TD +Q              
Sbjct: 143 ITAISMLMTLLAPVPMGLTATVVMGTVLLYTAVGGLRASIFTDKVQILIIVPMLLALVAI 202

Query: 108 GWAXXXXXXXXXXXXATSIRIEKS--VIDNSDL--LKSNSLGWQLLYIMPVAVSFATLFH 163
           GW              TS   EK+  ++D  D   LK+ +  +       VA+    +FH
Sbjct: 203 GW-----HVSGGASGVTSRLAEKAPALLDFGDAGGLKAGATFF-------VAILLTGIFH 250

Query: 164 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 223
           +G WQR +++++ ++++   + G + + P ++ +GL G+   W  + PG E   S   F 
Sbjct: 251 QGNWQRIYAARSIQDMQRGFLLGGLFVVPFILLMGLFGL--AWVAMEPGGE--ASVALFA 306

Query: 224 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSND---IFNNRLP---LNVTRFL 277
            +   LP WV+   + L +++  ++ DT ISA T+  + D   +     P   L + R L
Sbjct: 307 LVMPNLPAWVALAFIPLGLALVMSSADTAISAITSIIAVDGARLLPQARPARLLRLARIL 366

Query: 278 SLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            L+  +P V    + L VL +FL+ADLL A+   P+ LGL
Sbjct: 367 VLVLAIPVVVVAAQGLSVLYLFLLADLLCAAAAFPVFLGL 406



>gi|374333905|ref|YP_005090592.1| sodium transporter family protein [Oceanimonas sp. GK1]
 gi|504056584|ref|WP_014290578.1| sodium:solute symporter [Oceanimonas sp. GK1]
 gi|372983592|gb|AEX99841.1| sodium transporter family protein [Oceanimonas sp. GK1]
          Length = 478

 Score =  102 bits (254), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 93/342 (27%), Positives = 164/342 (47%), Gaps = 34/342 (9%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G + P  V   LG  IR+  P G TLT+FVL R+GR    +V ++ + Y+F  + + 
Sbjct: 80  YALGVLAPRLVMIPLGKRIRELMPAGHTLTEFVLGRYGRGMYGFVLVIMLFYLFISLTAG 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ-------------- 107
           L+A+  ++  L  V   A    +   T LYT YGGLR ++ TD +Q              
Sbjct: 140 LTAIAQMVALLAPVPLWATAGIVMAATLLYTLYGGLRVTIFTDRVQMLVILPFLLTLIVL 199

Query: 108 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 167
           GW                  ++++     D L +  L   L + +  AV    LF++G W
Sbjct: 200 GWQATGGLAPVLAG------LQQTAPHLLDPLDTTGLKSGLTFFL--AVVLTGLFYQGTW 251

Query: 168 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 227
           QR F++++++ +R   +   ++ FP++  +GL G+  V   L PG+ ++     F  L  
Sbjct: 252 QRVFAARDNKVIRNGFILSGVLSFPIIFIMGLFGLAFVGLAL-PGDGSVA---LFSVLMP 307

Query: 228 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLP-------LNVTRFLSLI 280
            +P W +   +   +++  ++ D+ IS  T+    D+    LP       L ++R+L ++
Sbjct: 308 NMPLWFAIGLLPFGLALIMSSADSTISGLTSMLVVDL-RRLLPQTSVHTLLGLSRWLIVL 366

Query: 281 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 322
            ++P +Y   +   VL +FL+ADLL  +   P+  G  ++LY
Sbjct: 367 VSIPVLYVASQGYSVLYLFLLADLLCCAAAFPVFFGFYNALY 408



>gi|399546779|ref|YP_006560087.1| Sodium/pantothenate symporter [Marinobacter sp. BSs20148]
 gi|504685906|ref|WP_014873008.1| sodium:solute symporter [Marinobacter sp. BSs20148]
 gi|399162111|gb|AFP32674.1| Sodium/pantothenate symporter [Marinobacter sp. BSs20148]
          Length = 479

 Score =  101 bits (252), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 92/342 (26%), Positives = 167/342 (48%), Gaps = 34/342 (9%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G++ P  +   LG  IR   PEG TLT+FVL R+GR    +V ++ + Y+F  + + 
Sbjct: 80  YALGALAPRLIMIPLGKRIRTLMPEGHTLTEFVLGRYGRVMYGFVLVIMVFYLFISLTAG 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ-------------- 107
           L+A+  ++  L  V        +   T LYT YGGLR ++ TD +Q              
Sbjct: 140 LTAIAKMVSLLAPVPLWLTASIVMGATLLYTLYGGLRVTIFTDRVQMLVILPFLALLIGF 199

Query: 108 GWAXXXXXXXXXXXXATSIR-IEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 166
           GW             A +++ +++      D L  N L   L + +  AV    LF++G 
Sbjct: 200 GWQATGGL-------APALQGLQEKAPHLLDPLDINGLKSGLTFFL--AVVLTGLFYQGA 250

Query: 167 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 226
           WQR F++++++ +R   +   ++ FP++  +GL G+  V  GL PG+ ++     F  L 
Sbjct: 251 WQRIFAARDNKVIRNGFIISGLLSFPIIFIMGLFGLAFVGLGL-PGDGSVA---LFSVLL 306

Query: 227 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI------FNNRLPLNVTRFLSLI 280
             +P W +   +   +++  ++ D+ IS  T+    D+        N   L+++R+L ++
Sbjct: 307 ADVPVWFAIGLLPFGLALIMSSADSTISGLTSIMVIDLRRLLPKLGNHSLLSLSRWLIVL 366

Query: 281 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 322
            ++P ++   +   VL +FL+ADLL  +   P+  G  ++ Y
Sbjct: 367 LSIPVLFVAAQGYSVLYLFLLADLLCCAAAFPVFFGFYNARY 408



>gi|496388369|ref|WP_009097359.1| sodium:solute symporter [Halomonas sp. GFAJ-1]
 gi|359297406|gb|EHK61641.1| sodium transporter family protein [Halomonas sp. GFAJ-1]
          Length = 481

 Score =  100 bits (250), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 97/342 (28%), Positives = 165/342 (48%), Gaps = 34/342 (9%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YAFGS++P  V   LG  +R+  PEG  LT+FV+ R+GR    +  ++ + Y+F  + + 
Sbjct: 81  YAFGSMVPRLVMIPLGRRMRELIPEGHGLTEFVIHRYGRTMYAFTLVIMLFYLFILLAAG 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ-------------- 107
           L+AV  ++  L  +        + + T +YT YGGLRAS+ TD +Q              
Sbjct: 141 LTAVARMVGLLAPIPLWVTASVVMVATLIYTFYGGLRASIYTDKLQMVVIMPLLGLLLVF 200

Query: 108 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 167
           GW             A S      ++  SD+     +   L + +  AV+   LF++G W
Sbjct: 201 GWQAAGGVAPTLAGLAES---APQLLQVSDI---GGIRAGLTFFL--AVALTGLFYQGTW 252

Query: 168 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 227
           QR +++K+ + LR       +  F V+  +GL G+  V  GL    E   S   F  L  
Sbjct: 253 QRIYAAKDTKVLRRGFWISGVCSFIVVALMGLFGLAFVGLGL----EGDGSVALFSVLLA 308

Query: 228 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLP-------LNVTRFLSLI 280
            +P W +   V L +++  ++ D+ ISAT++  + D+    LP       ++++R+L ++
Sbjct: 309 DVPLWFALALVPLGLALVMSSADSTISATSSIIAVDM-GRLLPNASSASLMSMSRWLIVL 367

Query: 281 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 322
           A +P  +   +   VL +FL+ADLL ++   P+  GL    Y
Sbjct: 368 AAIPVTWVASQGYSVLYLFLLADLLCSAAAFPVFFGLFYRRY 409



>gi|494589580|ref|WP_007348174.1| sodium:solute symporter [Marinobacter sp. ELB17]
 gi|126630788|gb|EBA01402.1| sodium:solute transporter family protein [Marinobacter sp. ELB17]
          Length = 479

 Score =  100 bits (249), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 91/342 (26%), Positives = 167/342 (48%), Gaps = 34/342 (9%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G++ P  +   LG  IR   PEG TLT+FVL R+GR    +V ++ + Y+F  + + 
Sbjct: 80  YALGALAPRLIMIPLGKRIRTLMPEGHTLTEFVLGRYGRIMYGFVLVIMVFYLFISLTAG 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ-------------- 107
           L+A+  ++  L  V        +   T LYT YGGLR ++ TD +Q              
Sbjct: 140 LTAIAKMVSLLAPVPLWLTASIVMGATLLYTLYGGLRVTIFTDRVQMLVILPFLALLIGF 199

Query: 108 GWAXXXXXXXXXXXXATSIR-IEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 166
           GW             A +++ +++      + L  N L   L + +  AV    LF++G 
Sbjct: 200 GWQATGGL-------APALQGLQEKAPHLLNPLDINGLKSGLTFFL--AVVLTGLFYQGT 250

Query: 167 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 226
           WQR F++++++ +R   +   ++ FP++  +GL G+  V  GL PG+ ++     F  L 
Sbjct: 251 WQRVFAARDNKVIRNGFILSGLLSFPIIFIMGLFGLAFVGLGL-PGDGSVA---LFSVLL 306

Query: 227 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI------FNNRLPLNVTRFLSLI 280
             +P W +   +   +++  ++ D+ IS  T+    D+        N   L+++R+L ++
Sbjct: 307 ADVPVWFAIGLLPFGLALIMSSADSTISGLTSIMVIDLRRLLPKLGNHSLLSLSRWLIVL 366

Query: 281 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 322
            ++P ++   +   VL +FL+ADLL  +   P+  G  ++ Y
Sbjct: 367 LSIPVLFVAAQGYSVLYLFLLADLLCCAAAFPVFFGFYNARY 408



>gi|237829741|ref|XP_002364168.1| hypothetical protein TGME49_108990 [Toxoplasma gondii ME49]
 gi|211961832|gb|EEA97027.1| hypothetical protein TGME49_108990 [Toxoplasma gondii ME49]
          Length = 617

 Score = 98.6 bits (244), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 88/331 (26%), Positives = 152/331 (45%), Gaps = 19/331 (5%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFM 58
           +YA    +PL++  + GP++R++      F LT +V  RFGR  QI  +++S       M
Sbjct: 197 LYAVAIALPLWILMYAGPIVREEMQRHVAFGLTDYVHRRFGRSMQIVTAVVSFFSTVMAM 256

Query: 59  ISELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 117
             EL+ +     TL     +LA ++ +A+VT  YT + G  ASL TDN+QG         
Sbjct: 257 AGELAFLAAAAQTLAPSFPRLAVILSVAMVTFTYTAFLGTNASLETDNLQGILLPLLLLI 316

Query: 118 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
                    ++ +     +    +      +L ++    ++A    +G WQR  +    R
Sbjct: 317 VPICAFMHSQVSQDAWKAAATWTAEGASSGVLMVLSCCPAYA--MDQGMWQRVMTGSGSR 374

Query: 178 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWA-------GLWPGEENLESYLAFFTLFKVLP 230
           E+R     GS+++   +  LG+TG++A          G    E++L +   FF +   L 
Sbjct: 375 EVRFGLFGGSLLVLMTVSLLGVTGIVARATAVTLETQGFTVDEDSLVAAPFFFLILPSLS 434

Query: 231 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV---- 286
             +  +  VLAV ++  + DT  SA  +  + ++    +  +    +S IAN PAV    
Sbjct: 435 RGLVAVVFVLAVILTVGSVDTFQSALPSLVAGELNTKGVSFDWALLVSFIANFPAVLLAY 494

Query: 287 YWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           +W       +++ LI +LL A+  PPI LGL
Sbjct: 495 HW---TESFIQLLLIGNLLTAAIFPPIFLGL 522



>gi|221481082|gb|EEE19490.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 616

 Score = 97.8 bits (242), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 86/331 (25%), Positives = 151/331 (45%), Gaps = 19/331 (5%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFM 58
           +YA    +PL++  + GP++R++      F LT +V  RFGR  QI  +++S       M
Sbjct: 196 LYAVAIALPLWILMYAGPIVREEMQRHVAFGLTDYVHRRFGRSMQIVTAVVSFFSTVMAM 255

Query: 59  ISELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 117
             EL+ +     TL     +LA ++ +A+VT  YT + G  ASL TDN+QG         
Sbjct: 256 AGELAFLAAAAQTLAPSFPRLAVILSVAMVTFTYTAFLGTNASLETDNLQGILLPLLLLI 315

Query: 118 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
                    ++ +     +    +      +L ++    ++A    +G WQR  +    R
Sbjct: 316 VPICAFMHSQVSQDAWKAAATWTAEGASSGVLMVLSCCPAYA--MDQGMWQRVMTGSGSR 373

Query: 178 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENL----ESYLAFFTLFKVLPDWV 233
           E+R     GS+++   +  LG+TG++A    +    +      +S +A    F +LP   
Sbjct: 374 EVRFGLFGGSLLVLMTVSLLGVTGIVARATAVTLETQGFTVDKDSLVAAPFFFLILPSLS 433

Query: 234 SGITVVLAVS---MSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV---- 286
            G+  V+ V    ++  + DT  SA  +  + ++    +  +    +S IAN PAV    
Sbjct: 434 RGLVAVVFVLAVILTVGSVDTFQSALPSLVAGELNTKGVSFDWALLVSFIANFPAVLLAY 493

Query: 287 YWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
           +W       +++ LI +LL A+  PPI LGL
Sbjct: 494 HW---TESFIQLLLIGNLLTAAIFPPIFLGL 521



>gi|91776138|ref|YP_545894.1| Na+/solute symporter [Methylobacillus flagellatus KT]
 gi|499799273|ref|WP_011480007.1| sodium:solute symporter [Methylobacillus flagellatus]
 gi|91710125|gb|ABE50053.1| Na+/solute symporter [Methylobacillus flagellatus KT]
          Length = 483

 Score = 95.9 bits (237), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 141/304 (46%), Gaps = 34/304 (11%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA G++ P      LG  +R+  P G +LT+F++ R+G+   +    + + Y+F  M +E
Sbjct: 80  YAIGAMSPRLAMIPLGKRMRELMPSGHSLTEFLIARYGKPMYLLALTIMLFYLFIAMSAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ-------------- 107
           ++A+  ++  L  V   A    +   T LYT YGGLRAS+ TD +Q              
Sbjct: 140 ITAIAKMVTLLAPVPLWATAAIVLGFTLLYTTYGGLRASIFTDKVQIVIIIPLLAALVFI 199

Query: 108 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 167
           GW                 +++ +     DL     +   L +   VA+    +FH+G W
Sbjct: 200 GWQATGGIAPIAE------KLQHTAPQLIDLEDIGGIKAGLTFF--VAILLTGIFHQGNW 251

Query: 168 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 227
           QR +S+K+   +R   + G I++ P +  +GL G+   +  + P  ++  S   F  +  
Sbjct: 252 QRIYSAKDIPTMRNGFLLGGILVVPFIFIMGLFGL--AFMAMTPDGDS--SVALFSVIMP 307

Query: 228 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLP-------LNVTRFLSLI 280
            +P W++   + L +S+   + DT ISA ++  + DI    +P       + ++R+L L+
Sbjct: 308 NIPLWLAVALIPLGISLVMCSVDTAISAISSIVAVDI-GRVMPRSSAASLMRLSRWLVLL 366

Query: 281 ANVP 284
             +P
Sbjct: 367 VAIP 370



>gi|344233258|gb|EGV65131.1| hypothetical protein CANTEDRAFT_113558 [Candida tenuis ATCC 10573]
          Length = 249

 Score = 95.1 bits (235), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 127/248 (51%), Gaps = 12/248 (4%)

Query: 193 VLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDT 251
           +   +G+ G +AVW+G L  G+EN    +AFF L   +P W+    ++  +++    +D+
Sbjct: 3   ICTLVGVPGFLAVWSGDLTVGDEN--GSMAFFILLAKMPGWIIAFVLIFTITICTCTFDS 60

Query: 252 LISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRVFLIADLLAASTM 310
           L SA  +  SNDIF NR      R + +I  VP V   +K  D +L+++LIADL+++S +
Sbjct: 61  LQSAFVSTISNDIFRNRFKTIWARAMVVIMIVPIVVLAVKVADNILQIYLIADLISSSII 120

Query: 311 PPILLGLIDSLY-FLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLY-ITD 368
           P I LGL D  + FL  +D                +++Y  AK+G +L+ +  GLY   D
Sbjct: 121 PIIFLGLSDRFFWFLTGVDVMVGGLGALVAIFIFGTVYYGTAKEGGKLLLIWNGLYDPED 180

Query: 369 YSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP---EVVDTK---KY 422
           +   GAF +AP   I    +    R+ ++WV+ KI  + F   ++P   E+V+ +    Y
Sbjct: 181 WGAFGAFEIAPFGGILIALVCVVARVGAIWVYCKITKKPFRALQRPVPVEIVEEEFDSAY 240

Query: 423 AGNKFKDD 430
                K D
Sbjct: 241 GSTNAKSD 248



>gi|301099137|ref|XP_002898660.1| Solute:Sodium Symporter (SSS) Family [Phytophthora infestans T30-4]
 gi|262104733|gb|EEY62785.1| Solute:Sodium Symporter (SSS) Family [Phytophthora infestans T30-4]
          Length = 353

 Score = 94.4 bits (233), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 101/204 (49%), Gaps = 1/204 (0%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA   +I + V A +GP  R    E  T+T  V  RFG   Q+YV  +S+ Y F  + SE
Sbjct: 81  YALSGVIGMIVLAQVGPYTRSALGENVTMTDVVSNRFGYVMQVYVGFISMFYQFICLASE 140

Query: 62  LSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 120
            +++  +   ++     +  ++ +A +T LY   GGLRASL TD  QG            
Sbjct: 141 YTSIAQLTTMMSPNAHPIVTILIVAFLTNLYLVIGGLRASLATDVWQGIGVVALVAVVCV 200

Query: 121 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 180
                + I      ++++    S G++ L  + +AV+ + LF  GFWQR +++ +D  LR
Sbjct: 201 AMFVHVSIPSGAWSSTNVAAFTSAGFETLVTLVIAVTASNLFFTGFWQRVYAAYDDNTLR 260

Query: 181 LSAVYGSIMLFPVLVFLGLTGMIA 204
            +A   SI++    V L + GM++
Sbjct: 261 KAAYIASIIIALFTVALAMAGMVS 284



>gi|493500829|ref|WP_006455347.1| transporter, SSS family, putative [Synechococcus sp. PCC 7335]
 gi|196190635|gb|EDX85599.1| transporter, SSS family, putative [Synechococcus sp. PCC 7335]
          Length = 538

 Score = 90.5 bits (223), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 98/384 (25%), Positives = 173/384 (45%), Gaps = 74/384 (19%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGR------FNQ------------ 43
           Y  GS   +F+F ++GP +R+  P G +L ++V  RFG+      F Q            
Sbjct: 78  YCIGSAAAVFMFFFVGPRLRQIMPWGHSLNEYVRYRFGQPIKQPPFEQPLGQSSPGQPSS 137

Query: 44  ------------------------------------IYVSLMSIAYMFCFMISELSAVGN 67
                                               + VS+M + YMF ++ +EL+A+  
Sbjct: 138 ERTLSDHTVGERTPKHTPNQRDQTASSNLWGQAMYLLTVSVM-LLYMFVYLAAELTAIAQ 196

Query: 68  ILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI- 126
           +L  +  V  L   + +     +YT YGGL+ +++TD  Q                 S+ 
Sbjct: 197 VLQLVANVPLLVTSLVVIAAVFIYTTYGGLKVTILTDAAQFILIVPLLLICFIATVASLG 256

Query: 127 ----RIEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
                      D    L   +L G +    + +A+  A LF++G WQR ++ K+D+ +R 
Sbjct: 257 GWSGAFGPVAQDLPAFLSLGNLDGLRFGATLMIAIIAAELFNQGNWQRVYACKDDQTVRR 316

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVL--PDWVSGITVV 239
           + +  ++++ P+L   GL G+IA  AG      +L    AFF L + L    W+ G  V+
Sbjct: 317 AFLGSALVILPLLFLSGLLGIIA--AGF-----DLSGTTAFFDLLQALEISGWLLGSIVL 369

Query: 240 LAVSMSCAAYDTLISATTANFSNDIFN-NRLP---LNVTRFLSLIANVPAVYWGLKDLDV 295
           LAV++  ++ DTL++  +A F+ D+   +R P   L ++R L++   + AV    +   V
Sbjct: 370 LAVALVMSSLDTLLNGISAVFTVDLLRLSRQPAQVLMISRILTVAVGLLAVPIAAQGYSV 429

Query: 296 LRVFLIADLLAASTMPPILLGLID 319
           L +F +ADL+ A+ + PI+  L +
Sbjct: 430 LYLFFVADLICAALLFPIVFSLYN 453



>gi|492986221|ref|WP_006079325.1| sodium-solute symporter putative [Halococcus saccharolyticus]
 gi|445791894|gb|EMA42513.1| sodium-solute symporter putative [Halococcus saccharolyticus DSM
           5350]
          Length = 571

 Score = 86.3 bits (212), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 92/322 (28%), Positives = 161/322 (50%), Gaps = 14/322 (4%)

Query: 8   IPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGN 67
           +PL +F  +G  +R+  P+G +LT++V  R+G +   Y  L+++ YMF  + + ++A  +
Sbjct: 87  VPLLLFVSVGVRLREYLPQGHSLTEYVYARYGTWMYGYALLIAVFYMFISLAAGMTAAAD 146

Query: 68  ILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI- 126
            L  + GV        I     +YTGYGGL AS+ TD +Q                  + 
Sbjct: 147 ALAFVAGVPGWVTASVIGGFVLVYTGYGGLVASIFTDTVQTLVILPLLTLSFAAVVVGLG 206

Query: 127 ---RIEKSVI-DNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 181
               I ++++  N  LL    + G      + +A++ A++F++G WQR F++ +D  LR 
Sbjct: 207 GTGEIHRAIVASNPHLLDPGFVPGLAFGGYVVIAITGASVFNQGRWQRVFAAADDDALRR 266

Query: 182 SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVS-GITVVL 240
                +++  P+++  GL G+ A   GL  G+    S   F  +   LP+W + G+ V++
Sbjct: 267 GFAVAAVVTVPMILLAGLLGVAAAGLGLI-GDAG-PSVALFVVVAAALPEWATLGVVVLV 324

Query: 241 AVSMSCAA---YDTLISATTANFSN--DIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 295
            + ++  A   ++ L S  TA+ S   D  + R      R L++I  + A+  G +   V
Sbjct: 325 VLLVTSTADTLFNGLASIVTADLSRVLDDPDERTLQYAARGLTIIVALAAIVVGAQGYSV 384

Query: 296 LRVFLIADLLAASTMPPILLGL 317
           L +FL+ADLL A+T  P L GL
Sbjct: 385 LELFLLADLLGAATFVPFLHGL 406



>gi|495015305|ref|WP_007741316.1| sodium-solute symporter putative [Halococcus thailandensis]
 gi|445801467|gb|EMA51801.1| sodium-solute symporter putative [Halococcus thailandensis JCM
           13552]
          Length = 516

 Score = 85.9 bits (211), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 100/331 (30%), Positives = 162/331 (48%), Gaps = 20/331 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS +PL +F  +G  +R+  P+G +LT++V  R+G +   Y  L+++ YMF   IS 
Sbjct: 81  YAIGSAVPLVLFISVGVRLREYLPQGHSLTEYVYGRYGAWMYGYALLIAVFYMF---ISL 137

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTT---LYTGYGGLRASLITDNIQGWAXXXXXXXX 118
            + +      L  V  + P I  AI+     +YTGYGGL AS+ TD +Q           
Sbjct: 138 AAGMTAAADALAFVADVPPWITAAIIGGFVLVYTGYGGLVASIFTDTVQTLVILPLLTLS 197

Query: 119 XXXXATSI----RIEKSVID-NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFS 172
                  +     I +++   N  LL    + G      + +A++ +++F++G WQR F+
Sbjct: 198 FAAVVVGLGGTGAIHQAIASANPHLLDLGFVPGLAFGGYVVIAITGSSVFNQGRWQRVFA 257

Query: 173 SKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDW 232
           + +D  LR      +++  P+++  GL G+ A   GL  G+    S   F  +   LP+W
Sbjct: 258 AADDTSLRRGFAIAAVVTVPMIMLAGLLGVSAAGLGLM-GDAG-PSVALFVAIAAALPEW 315

Query: 233 VSGITVVLAVSMSCAAYDTLI----SATTANFSN--DIFNNRLPLNVTRFLSLIANVPAV 286
            +   VVL V +  +  DTL     S  TA+ S   D  + R      R L+++  + A+
Sbjct: 316 ATLGVVVLVVLLVTSTTDTLFNGIASIVTADLSRVLDDPDERTLQYAARALTVVVAIAAI 375

Query: 287 YWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
             G +   VL +FL+ADLL A+T  P L GL
Sbjct: 376 AVGAQGYSVLELFLLADLLGAATFIPFLHGL 406



>gi|495661125|ref|WP_008385704.1| Na+/proline symporter [Halosarcina pallida]
 gi|445679162|gb|ELZ31636.1| Na+/proline symporter [Halosarcina pallida JCM 14848]
          Length = 530

 Score = 85.5 bits (210), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 89/334 (26%), Positives = 158/334 (47%), Gaps = 22/334 (6%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           Y  G   P+  ++ LGP IR+  PEG +LT++   R+G     +V ++S  YMF F+ +E
Sbjct: 80  YGLGEAAPMLAYSRLGPRIRELIPEGHSLTEYAYARYGGAMYAFVVVISALYMFVFLAAE 139

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           L+ +      + GV +      +A    LYT YGGLRAS+ TD +Q +            
Sbjct: 140 LTGISLAFHYVAGVPQWQTATLVAGFVLLYTAYGGLRASIATDAVQLFVVLPLLVGSVAA 199

Query: 122 XATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
              ++    +V D     N  LL    + G +    +  AV  A L ++ +WQR ++  +
Sbjct: 200 LLFALGGTGAVYDGIADANPALLDPGYVPGLRFGAALVFAVLGAELLNQTWWQRIYAGDD 259

Query: 176 ----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVW-AGLWPGEENLESYLAFFTLFK-VL 229
               +R  R++ V        +L+   L G++AV  +G+        + +AFF L     
Sbjct: 260 SETVERSFRVATVANGF----ILLLATLLGVVAVGNSGVLTQGAEYNAGVAFFVLLDGAF 315

Query: 230 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI------FNNRLPLNVTRFLSLIANV 283
            +W+    ++LA+ +  +  D+L +A ++  + D+       ++R      R ++++  V
Sbjct: 316 SEWLVLGVLLLALLLVTSTADSLFNALSSLVTADLPRAMDDPDDRTLRLAARLVTVVVAV 375

Query: 284 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 317
            AV   L+   VL +F +ADLL A+   P++ GL
Sbjct: 376 AAVAVSLRARSVLSLFFVADLLGAAVGIPLVYGL 409



>gi|490154212|ref|WP_004052888.1| sodium-solute symporter putative [Halococcus morrhuae]
 gi|445795862|gb|EMA46382.1| sodium-solute symporter putative [Halococcus morrhuae DSM 1307]
          Length = 516

 Score = 84.0 bits (206), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 96/328 (29%), Positives = 159/328 (48%), Gaps = 14/328 (4%)

Query: 2   YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 61
           YA GS +PL +F  +G  +R+   +G +LT++V  R+G +   Y  L+++ YMF  + + 
Sbjct: 81  YAIGSAVPLLLFISVGVRLREYLSQGHSLTEYVYGRYGAWMYGYALLIAVFYMFISLAAG 140

Query: 62  LSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXX 121
           ++A  + L  +  V        I     +YTGYGGL AS+ TD +Q              
Sbjct: 141 MTAAADALAFVADVPPWITATIIGGFVLVYTGYGGLVASIFTDTVQTLVILPLLTLSFAA 200

Query: 122 XATSI----RIEKSVID-NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 175
               +     I +++   N  LL    + G      + +A++ +++F++G WQR F++ +
Sbjct: 201 VVVGLGGTGAIHQAIASANPHLLDLGFVPGLAFGGYVVIAITGSSVFNQGRWQRVFAAAD 260

Query: 176 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 235
           D  LR      +++  P+++  GL G+ A   GL  G+    S   F  +   LPDW + 
Sbjct: 261 DASLRRGFAIAAVVTVPMILLAGLLGVSAAGLGLM-GDAG-PSVALFVAIAAALPDWATL 318

Query: 236 ITVVLAVSMSCAAYDTLI----SATTANFSN--DIFNNRLPLNVTRFLSLIANVPAVYWG 289
             VVL V +  +  DTL     S  TA+ S   D  + R      R L+++  + A+  G
Sbjct: 319 GVVVLVVLLVTSTTDTLFNGIASIVTADLSRVLDDPDERTLQYAARALTVVVAIAAIAVG 378

Query: 290 LKDLDVLRVFLIADLLAASTMPPILLGL 317
            +   VL +FL+ADLL A+T  P L GL
Sbjct: 379 AQGYSVLELFLLADLLGAATFIPFLHGL 406



>gi|485648251|gb|EOD41160.1| hypothetical protein EMIHUDRAFT_199381 [Emiliania huxleyi CCMP1516]
          Length = 536

 Score = 81.3 bits (199), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 145/334 (43%), Gaps = 19/334 (5%)

Query: 1   MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF-------GRFNQIYVSLMSIAY 53
           MYA      +   A++G   R   PE  +L  F+  RF       GR  Q     M++  
Sbjct: 94  MYAVACGGAVVSMAYIGGAARALYPEACSLPDFMRRRFSGRAAASGRLAQGLAVTMNLFN 153

Query: 54  MFCFMISELSAVGNILVTLTGVD---KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWA 110
           M   + +E +    +L + +G+     L  +I +A+ T  YT  GGL  S++TD +Q  A
Sbjct: 154 MCVALAAEYTTFLELLRSYSGLPFRIALCLLIAMALATLAYTIAGGLFVSIMTDRLQAIA 213

Query: 111 XXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFA-TLFHEGFWQR 169
                       A+ +  +     + +L      G+  +  MP+ +     LF E  WQR
Sbjct: 214 ALSLVGVLLVFTASVVPWDGLPPLSPELKGYTYSGYSSILTMPLGLLVGGALFSEAMWQR 273

Query: 170 AFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVL 229
            ++ +  R +  +A      +  V+ F G  G +AVW+G    E N+  Y  FF +F   
Sbjct: 274 VWAIEERRAMARAAWTAGFAVAAVIFFFGFVGFLAVWSGKATAETNMNLY--FFAIFNDS 331

Query: 230 P-----DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVP 284
           P     +    ++++ A  MS  A D++ +A  A   + +   R PL  TR   ++ N  
Sbjct: 332 PIASLTNLPGYLSMLCACIMSAGAADSMQNAIAATVGSSLLRGR-PLWTTRACVVLCNAA 390

Query: 285 AVYWGLKDLDVLRVFLIADLLAASTMPPILLGLI 318
            +      + VL +FL ++L A   MP +++ LI
Sbjct: 391 LLLVACASVPVLSLFLTSNLAATCLMPSVMMSLI 424



>gi|328771325|gb|EGF81365.1| hypothetical protein BATDEDRAFT_24273 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 582

 Score = 77.0 bits (188), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/347 (22%), Positives = 147/347 (42%), Gaps = 45/347 (12%)

Query: 8   IPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGN 67
           +PL +   LGP  R K P+  ++  F   RFG    I V+++S+  M   + +EL ++ N
Sbjct: 150 LPLLLAGILGPTFRSKLPQATSIAAFAKWRFGAEFGILVTIVSLITMATTLATELQSLSN 209

Query: 68  ILVTLTGV---DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXAT 124
           + + + G+    +  P+IC   +  LY    GL AS+ +   Q                 
Sbjct: 210 MYIQVLGLPFEKRSGPIICAGTIPLLYILMNGLSASMSSVQFQSLFAMLIFMLTLLYLGA 269

Query: 125 SIR-----IEKSVIDNSDLLKSN--SLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 177
             R     +  + +D +   +++  SLG QL        + + +F +  WQ  +S+++D 
Sbjct: 270 VFRPGDMDVIPAYLDTTAKGQASFISLGSQL--------TSSAMFSDAMWQLVWSAQSDA 321

Query: 178 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGL----WPGEENLE-SYLAFFTLFK----- 227
            +R+S+    I+   V     +   +A W GL    W    +   S +AFF   +     
Sbjct: 322 TIRISSSVACILASSVTFIFSIFSFLAGWLGLVTHSWDATSSTSNSGIAFFQALRMATPK 381

Query: 228 -------VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL------PLNVT 274
                  V P W++ +  +   +++     + +SA      N I +  L        ++ 
Sbjct: 382 NDPQFTPVGPAWLATLICMAGTALNA----SFVSAYQVGLVNTITSVVLVRGFCPSTHLA 437

Query: 275 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSL 321
           RF+ L  N+P +   +  +DV      A L+A   + P L+G+++SL
Sbjct: 438 RFILLAVNIPIIVASVALIDVAAWACCARLIATCFLAPTLMGMLESL 484