BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10288_c0_seq2-m.108 5prime_partial 3-1580(+) 526 (+)
         (525 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|343429781|emb|CBQ73353.1| conserved hypothetical protein [Spo...   387   e-105   Sporisorium reilianum SRZ2
gi|388853819|emb|CCF52540.1| uncharacterized protein [Ustilago h...   382   e-103   Ustilago hordei
gi|392864120|gb|EJB10754.1| urea transporter [Coccidioides immit...   378   e-102   
gi|390596564|gb|EIN05965.1| hypothetical protein PUNSTDRAFT_9067...   370   e-100   Punctularia strigosozonata HHB-11173 SS5
gi|367041970|ref|XP_003651365.1| hypothetical protein THITE_2111...   364   4e-98   Thielavia terrestris NRRL 8126
gi|315047150|ref|XP_003172950.1| hypothetical protein MGYG_09089...   362   2e-97   Microsporum gypseum CBS 118893
gi|358393547|gb|EHK42948.1| hypothetical protein TRIATDRAFT_2470...   360   5e-97   Trichoderma atroviride IMI 206040
gi|406868486|gb|EKD21523.1| urea transporter [Marssonina brunnea...   357   5e-96   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|501308643|dbj|GAC97537.1| predicted urea transporter [Pseudoz...   356   1e-95   Pseudozyma hubeiensis SY62
gi|440469250|gb|ELQ38367.1| urea transport protein [Magnaporthe ...   354   3e-95   Magnaporthe oryzae Y34
gi|327306029|ref|XP_003237706.1| hypothetical protein TERG_02421...   353   6e-95   Trichophyton rubrum CBS 118892
gi|302664422|ref|XP_003023841.1| hypothetical protein TRV_02038 ...   352   2e-94   Trichophyton verrucosum HKI 0517
gi|440633300|gb|ELR03219.1| hypothetical protein GMDG_01202 [Geo...   352   2e-94   Pseudogymnoascus destructans 20631-21
gi|340519811|gb|EGR50049.1| hypothetical protein TRIREDRAFT_3412...   350   7e-94   Trichoderma reesei QM6a
gi|407918302|gb|EKG11573.1| Sodium/solute symporter [Macrophomin...   347   4e-93   Macrophomina phaseolina MS6
gi|402086111|gb|EJT81009.1| urea transporter [Gaeumannomyces gra...   343   9e-92   Gaeumannomyces graminis var. tritici R3-111a-1
gi|345566015|gb|EGX48962.1| hypothetical protein AOL_s00079g183 ...   342   2e-91   Arthrobotrys oligospora ATCC 24927
gi|408392233|gb|EKJ71591.1| hypothetical protein FPSE_08230 [Fus...   341   3e-91   Fusarium pseudograminearum CS3096
gi|322709553|gb|EFZ01129.1| urea transporter [Metarhizium anisop...   340   4e-91   
gi|400595550|gb|EJP63345.1| urea transporter [Beauveria bassiana...   340   6e-91   Beauveria bassiana ARSEF 2860
gi|302919081|ref|XP_003052786.1| predicted protein [Nectria haem...   340   8e-91   Nectria haematococca mpVI 77-13-4
gi|399166435|emb|CCE32710.1| uncharacterized protein CPUR_06574 ...   338   2e-90   Claviceps purpurea 20.1
gi|350297242|gb|EGZ78219.1| hypothetical protein NEUTE2DRAFT_154...   338   2e-90   Neurospora tetrasperma FGSC 2509
gi|336463537|gb|EGO51777.1| hypothetical protein NEUTE1DRAFT_125...   338   3e-90   Neurospora tetrasperma FGSC 2508
gi|50423383|ref|XP_460274.1| DEHA2E22396p [Debaryomyces hansenii...   338   3e-90   Debaryomyces hansenii CBS767
gi|500255736|gb|EON99074.1| putative urea transporter protein [T...   338   3e-90   Phaeoacremonium minimum UCRPA7
gi|443898725|dbj|GAC76059.1| hypothetical protein PANT_19d00093 ...   337   5e-90   Moesziomyces antarcticus T-34
gi|296414011|ref|XP_002836698.1| hypothetical protein [Tuber mel...   337   8e-90   Tuber melanosporum Mel28
gi|358384934|gb|EHK22531.1| hypothetical protein TRIVIDRAFT_1798...   334   3e-89   Trichoderma virens Gv29-8
gi|238882735|gb|EEQ46373.1| conserved hypothetical protein [Cand...   334   4e-89   Candida albicans WO-1
gi|68489472|ref|XP_711409.1| hypothetical protein CaO19.6656 [Ca...   334   4e-89   Candida albicans SC5314
gi|326471561|gb|EGD95570.1| hypothetical protein TESG_03046 [Tri...   333   1e-88   Trichophyton tonsurans CBS 112818
gi|378730007|gb|EHY56466.1| hypothetical protein HMPREF1120_0454...   333   1e-88   Exophiala dermatitidis NIH/UT8656
gi|239613852|gb|EEQ90839.1| urea transporter [Ajellomyces dermat...   332   1e-88   
gi|451852092|gb|EMD65387.1| hypothetical protein COCSADRAFT_3544...   332   1e-88   Bipolaris sorokiniana ND90Pr
gi|451997584|gb|EMD90049.1| hypothetical protein COCHEDRAFT_1022...   332   2e-88   Bipolaris maydis C5
gi|241955795|ref|XP_002420618.1| urea transporter, putative; ure...   330   5e-88   Candida dubliniensis CD36
gi|389637038|ref|XP_003716160.1| urea transporter [Magnaporthe o...   330   5e-88   Magnaporthe oryzae 70-15
gi|164429597|ref|XP_964341.2| hypothetical protein NCU11204 [Neu...   328   2e-87   
gi|171676089|ref|XP_001902998.1| hypothetical protein [Podospora...   327   6e-87   Podospora anserina S mat+
gi|512203105|gb|EPE31930.1| hypothetical protein GLAREA_12012 [G...   325   2e-86   Glarea lozoyensis ATCC 20868
gi|340975607|gb|EGS22722.1| hypothetical protein CTHT_0011960 [C...   325   2e-86   Chaetomium thermophilum var. thermophilum DSM 1495
gi|367021828|ref|XP_003660199.1| hypothetical protein MYCTH_2298...   325   3e-86   Myceliophthora thermophila ATCC 42464
gi|477525718|gb|ENH77590.1| urea transporter [Colletotrichum orb...   323   6e-86   Colletotrichum orbiculare MAFF 240422
gi|330917930|ref|XP_003298017.1| hypothetical protein PTT_08598 ...   322   1e-85   Pyrenophora teres f. teres 0-1
gi|320590557|gb|EFX03000.1| urea transport protein [Grosmannia c...   321   3e-85   Grosmannia clavigera kw1407
gi|477518870|gb|ENH71070.1| hypothetical protein FOC1_g10008443 ...   321   4e-85   Fusarium oxysporum f. sp. cubense race 1
gi|46129398|ref|XP_389060.1| hypothetical protein FG08884.1 [Fus...   320   5e-85   
gi|448515648|ref|XP_003867382.1| Dur3 urea transporter [Candida ...   320   7e-85   Candida orthopsilosis Co 90-125
gi|302505048|ref|XP_003014745.1| hypothetical protein ARB_07307 ...   319   1e-84   Arthroderma benhamiae CBS 112371
gi|482808759|gb|EOA85644.1| hypothetical protein SETTUDRAFT_1696...   318   3e-84   Setosphaeria turcica Et28A
gi|71017739|ref|XP_759100.1| hypothetical protein UM02953.1 [Ust...   318   3e-84   
gi|505755900|gb|EOR00094.1| putative urea active transporter 1 [...   317   4e-84   Wallemia ichthyophaga EXF-994
gi|402086110|gb|EJT81008.1| urea transporter, variant [Gaeumanno...   317   5e-84   Gaeumannomyces graminis var. tritici R3-111a-1
gi|448080486|ref|XP_004194649.1| Piso0_005156 [Millerozyma farin...   317   7e-84   Millerozyma farinosa CBS 7064
gi|346320510|gb|EGX90110.1| urea transporter [Cordyceps militari...   317   7e-84   Cordyceps militaris CM01
gi|448084999|ref|XP_004195745.1| Piso0_005156 [Millerozyma farin...   317   7e-84   Millerozyma farinosa CBS 7064
gi|342878048|gb|EGU79459.1| hypothetical protein FOXB_10044 [Fus...   315   3e-83   Fusarium oxysporum Fo5176
gi|388578764|gb|EIM19102.1| hypothetical protein WALSEDRAFT_6164...   314   4e-83   Wallemia mellicola CBS 633.66
gi|255732433|ref|XP_002551140.1| conserved hypothetical protein ...   314   4e-83   Candida tropicalis MYA-3404
gi|336264692|ref|XP_003347122.1| hypothetical protein SMAC_05421...   313   1e-82   Sordaria macrospora k-hell
gi|326481865|gb|EGE05875.1| hypothetical protein TEQG_04886 [Tri...   312   2e-82   Trichophyton equinum CBS 127.97
gi|459369699|gb|EMG48026.1| Urea transporter, putative (Urea/pol...   311   2e-82   Candida maltosa Xu316
gi|471566473|gb|EMR66770.1| putative urea transporter protein [E...   309   2e-81   Eutypa lata UCREL1
gi|512188743|gb|EPE04513.1| urea transporter [Ophiostoma piceae ...   305   2e-80   Ophiostoma piceae UAMH 11346
gi|322696792|gb|EFY88579.1| urea transporter [Metarhizium acridu...   304   5e-80   Metarhizium acridum CQMa 102
gi|406605512|emb|CCH43156.1| Sodium/glucose cotransporter 1 [Wic...   303   7e-80   Wickerhamomyces ciferrii
gi|396469553|ref|XP_003838434.1| hypothetical protein LEMA_P1137...   302   1e-79   Leptosphaeria maculans JN3
gi|258573539|ref|XP_002540951.1| conserved hypothetical protein ...   302   1e-79   Uncinocarpus reesii 1704
gi|154286680|ref|XP_001544135.1| conserved hypothetical protein ...   302   2e-79   Histoplasma capsulatum NAm1
gi|295663094|ref|XP_002792100.1| urea transport protein [Paracoc...   301   2e-79   
gi|126137249|ref|XP_001385148.1| urea transport protein [Scheffe...   301   2e-79   Scheffersomyces stipitis CBS 6054
gi|366999438|ref|XP_003684455.1| hypothetical protein TPHA_0B035...   301   3e-79   Tetrapisispora phaffii CBS 4417
gi|156847319|ref|XP_001646544.1| hypothetical protein Kpol_1055p...   298   4e-78   Vanderwaltozyma polyspora DSM 70294
gi|363755328|ref|XP_003647879.1| hypothetical protein Ecym_7216 ...   297   4e-78   Eremothecium cymbalariae DBVPG#7215
gi|50305545|ref|XP_452732.1| hypothetical protein [Kluyveromyces...   297   6e-78   Kluyveromyces lactis NRRL Y-1140
gi|255718783|ref|XP_002555672.1| KLTH0G14718p [Lachancea thermot...   295   2e-77   Lachancea thermotolerans CBS 6340
gi|429848401|gb|ELA23890.1| urea transporter [Colletotrichum glo...   295   2e-77   Colletotrichum gloeosporioides Nara gc5
gi|149237959|ref|XP_001524856.1| conserved hypothetical protein ...   294   5e-77   Lodderomyces elongisporus NRRL YB-4239
gi|344233479|gb|EGV65351.1| hypothetical protein CANTEDRAFT_1196...   291   3e-76   Candida tenuis ATCC 10573
gi|366987111|ref|XP_003673322.1| hypothetical protein NCAS_0A037...   291   5e-76   Naumovozyma castellii CBS 4309
gi|354547251|emb|CCE43985.1| hypothetical protein CPAR2_502100 [...   290   6e-76   Candida parapsilosis
gi|38567077|emb|CAE76374.1| hypothetical protein [Neurospora cra...   289   1e-75   Neurospora crassa
gi|50554165|ref|XP_504491.1| YALI0E27984p [Yarrowia lipolytica] ...   284   4e-74   Yarrowia lipolytica CLIB122
gi|116193701|ref|XP_001222663.1| hypothetical protein CHGG_06568...   281   5e-73   Chaetomium globosum CBS 148.51
gi|296804300|ref|XP_002843002.1| urea transport protein [Arthrod...   278   3e-72   Arthroderma otae CBS 113480
gi|453084248|gb|EMF12293.1| hypothetical protein SEPMUDRAFT_4620...   278   4e-72   Sphaerulina musiva SO2202
gi|494831159|gb|EON67651.1| hypothetical protein W97_06794 [Coni...   275   3e-71   Coniosporium apollinis CBS 100218
gi|365985345|ref|XP_003669505.1| hypothetical protein NDAI_0C060...   274   5e-71   Naumovozyma dairenensis CBS 421
gi|367008374|ref|XP_003678687.1| hypothetical protein TDEL_0A014...   274   5e-71   Torulaspora delbrueckii
gi|380471757|emb|CCF47122.1| hypothetical protein CH063_15636 [C...   274   6e-71   Colletotrichum higginsianum
gi|513034046|gb|AGO14012.1| AaceriAGR155Cp [Saccharomycetaceae s...   273   1e-70   Saccharomycetaceae sp. 'Ashbya aceri'
gi|310794094|gb|EFQ29555.1| hypothetical protein GLRG_04699 [Glo...   273   1e-70   Colletotrichum graminicola M1.001
gi|254567718|ref|XP_002490969.1| hypothetical protein [Komagatae...   272   2e-70   Komagataella phaffii GS115
gi|225685269|gb|EEH23553.1| conserved hypothetical protein [Para...   271   4e-70   
gi|398408051|ref|XP_003855491.1| hypothetical protein MYCGRDRAFT...   271   5e-70   Zymoseptoria tritici IPO323
gi|226294605|gb|EEH50025.1| urea transport protein [Paracoccidio...   270   9e-70   
gi|465795812|emb|CCV00245.1| unnamed protein product [Malassezia...   266   1e-68   Malassezia sympodialis ATCC 42132
gi|189202288|ref|XP_001937480.1| conserved hypothetical protein ...   266   2e-68   Pyrenophora tritici-repentis Pt-1C-BFP
gi|320581949|gb|EFW96168.1| urea transporter, putative urea/poly...   265   2e-68   
gi|452984112|gb|EME83869.1| hypothetical protein MYCFIDRAFT_1627...   263   9e-68   Cercospora fijiensis CIRAD86
gi|50551147|ref|XP_503047.1| YALI0D19866p [Yarrowia lipolytica] ...   261   3e-67   Yarrowia lipolytica CLIB122
gi|119192082|ref|XP_001246647.1| hypothetical protein CIMG_00418...   260   7e-67   
gi|50290383|ref|XP_447623.1| hypothetical protein [Candida glabr...   258   3e-66   Candida glabrata CBS 138
gi|303313113|ref|XP_003066568.1| hypothetical protein CPC735_057...   257   7e-66   Coccidioides posadasii C735 delta SOWgp
gi|164656775|ref|XP_001729515.1| hypothetical protein MGL_3550 [...   249   1e-63   Malassezia globosa CBS 7966
gi|261193629|ref|XP_002623220.1| urea transporter [Ajellomyces d...   247   5e-63   Blastomyces gilchristii SLH14081
gi|302309420|ref|NP_986821.2| AGR155Cp [Ashbya gossypii ATCC 108...   244   6e-62   Eremothecium gossypii ATCC 10895
gi|325094525|gb|EGC47835.1| urea transporter [Ajellomyces capsul...   240   8e-61   Histoplasma capsulatum H88
gi|302419953|ref|XP_003007807.1| urea transport protein [Vertici...   240   9e-61   Verticillium alfalfae VaMs.102
gi|240275165|gb|EER38680.1| urea transporter [Ajellomyces capsul...   239   2e-60   Histoplasma capsulatum H143
gi|403216744|emb|CCK71240.1| hypothetical protein KNAG_0G01820 [...   238   5e-60   Kazachstania naganishii CBS 8797
gi|225558773|gb|EEH07057.1| urea transporter [Ajellomyces capsul...   237   8e-60   Histoplasma capsulatum G186AR
gi|260943103|ref|XP_002615850.1| hypothetical protein CLUG_04732...   231   4e-58   Clavispora lusitaniae ATCC 42720
gi|485923385|gb|EOD48562.1| putative urea transporter protein [N...   231   4e-58   Neofusicoccum parvum UCRNP2
gi|344301867|gb|EGW32172.1| hypothetical protein SPAPADRAFT_6126...   229   2e-57   Spathaspora passalidarum NRRL Y-27907
gi|361125484|gb|EHK97525.1| putative Eukaryotic translation init...   226   2e-56   Glarea lozoyensis 74030
gi|507524472|ref|YP_008046085.1| solute symporter-like protein [...   217   9e-54   
gi|169594868|ref|XP_001790858.1| hypothetical protein SNOG_00164...   206   1e-50   Parastagonospora nodorum SN15
gi|496243989|ref|WP_008957374.1| sodium:solute symporter [Halomo...   193   9e-47   Halomonas sp. HAL1
gi|501087544|ref|WP_012137811.1| solute symporter-like protein [...   187   1e-44   Marinobacter lipolyticus
gi|490716886|ref|WP_004579451.1| solute symporter-like protein [...   186   2e-44   Marinobacter nanhaiticus
gi|219129440|ref|XP_002184897.1| predicted protein [Phaeodactylu...   184   6e-44   Phaeodactylum tricornutum CCAP 1055/1
gi|494264168|ref|WP_007153677.1| sodium:solute symporter [Marino...   183   1e-43   Marinobacter algicola
gi|512441197|ref|WP_016416980.1| sodium:solute symporter [Halomo...   182   2e-43   Halomonas anticariensis
gi|496591109|ref|WP_009288217.1| Sodium/solute symporter [Halomo...   182   2e-43   Halomonas
gi|494173757|ref|WP_007113484.1| sodium:solute symporter [Halomo...   181   4e-43   
gi|307544110|ref|YP_003896589.1| hypothetical protein HELO_1521 ...   180   1e-42   
gi|497407386|ref|WP_009721584.1| sodium:solute symporter [Halomo...   176   1e-41   Halomonas sp. TD01
gi|384254250|gb|EIE27724.1| NAD(P)-binding protein [Coccomyxa su...   175   3e-41   Coccomyxa subellipsoidea C-169
gi|385331874|ref|YP_005885825.1| solute symporter-like protein [...   174   5e-41   
gi|346977478|gb|EGY20930.1| urea transport protein [Verticillium...   174   8e-41   Verticillium dahliae VdLs.17
gi|223993879|ref|XP_002286623.1| predicted protein [Thalassiosir...   165   3e-38   Thalassiosira pseudonana CCMP1335
gi|158321712|ref|YP_001514219.1| Na+/solute symporter [Alkaliphi...   163   1e-37   
gi|325185496|emb|CCA19979.1| Solute:Sodium Symporter (SSS) Famil...   163   1e-37   Albugo laibachii Nc14
gi|348678595|gb|EGZ18412.1| hypothetical protein PHYSODRAFT_3322...   163   1e-37   Phytophthora sojae
gi|428175810|gb|EKX44698.1| hypothetical protein GUITHDRAFT_8737...   162   2e-37   Guillardia theta CCMP2712
gi|323455936|gb|EGB11803.1| hypothetical protein AURANDRAFT_6101...   162   2e-37   Aureococcus anophagefferens
gi|294900101|ref|XP_002776900.1| Osmoregulated proline transport...   162   3e-37   Perkinsus marinus ATCC 50983
gi|323456367|gb|EGB12234.1| hypothetical protein AURANDRAFT_6136...   162   3e-37   Aureococcus anophagefferens
gi|385305452|gb|EIF49423.1| urea urea polyamine [Dekkera bruxell...   162   3e-37   Brettanomyces bruxellensis AWRI1499
gi|328771326|gb|EGF81366.1| hypothetical protein BATDEDRAFT_3491...   156   2e-35   Batrachochytrium dendrobatidis JAM81
gi|495594848|ref|WP_008319427.1| sodium/proline symporter [Halof...   152   4e-34   Haloferax mucosum
gi|348678575|gb|EGZ18392.1| hypothetical protein PHYSODRAFT_3010...   151   6e-34   Phytophthora sojae
gi|485631099|gb|EOD26242.1| hypothetical protein EMIHUDRAFT_2368...   150   7e-34   Emiliania huxleyi CCMP1516
gi|344212553|ref|YP_004796873.1| sodium-solute symporter putativ...   150   8e-34   
gi|495587964|ref|WP_008312543.1| sodium-solute symporter putativ...   150   1e-33   Haloarcula amylolytica
gi|348689995|gb|EGZ29809.1| hypothetical protein PHYSODRAFT_3099...   149   2e-33   Phytophthora sojae
gi|303282763|ref|XP_003060673.1| Na+/solute symporter [Micromona...   148   4e-33   Micromonas pusilla CCMP1545
gi|401395637|ref|XP_003879646.1| hypothetical protein NCLIV_0010...   148   4e-33   Neospora caninum Liverpool
gi|494484685|ref|WP_007274158.1| sodium-solute symporter [Halofe...   147   7e-33   Haloferax sulfurifontis
gi|491681725|ref|WP_005537864.1| sodium-solute symporter putativ...   147   1e-32   Haloarcula argentinensis
gi|490652117|ref|WP_004517111.1| sodium-solute symporter putativ...   146   1e-32   Haloarcula vallismortis
gi|145345452|ref|XP_001417224.1| SSS family transporter: sodium ...   146   1e-32   Ostreococcus lucimarinus CCE9901
gi|495848440|ref|WP_008573019.1| sodium-solute symporter [Halofe...   146   1e-32   Haloferax
gi|491109342|ref|WP_004968441.1| sodium-solute symporter [Halofe...   146   2e-32   Haloferax denitrificans
gi|389848875|ref|YP_006351112.1| sodium/proline symporter [Halof...   145   4e-32   
gi|493648470|ref|WP_006600045.1| sodium-solute symporter [Halofe...   144   6e-32   Haloferax alexandrinus
gi|490163169|ref|WP_004061823.1| sodium-solute symporter [Halofe...   144   8e-32   Haloferax lucentense
gi|494345167|ref|WP_007188843.1| sodium-solute symporter putativ...   144   8e-32   Haloarcula californiae
gi|491113813|ref|WP_004972271.1| sodium-solute symporter [Halofe...   144   9e-32   Haloferax gibbonsii
gi|495819990|ref|WP_008544569.1| sodium:solute transporter famil...   143   1e-31   Candidatus Pelagibacter sp. HTCC7211
gi|428171596|gb|EKX40511.1| hypothetical protein GUITHDRAFT_7539...   142   3e-31   Guillardia theta CCMP2712
gi|55378520|ref|YP_136370.1| sodium-solute symporter [Haloarcula...   142   3e-31   
gi|332283893|ref|YP_004415804.1| sodium transporter family prote...   141   4e-31   
gi|495372393|ref|WP_008097106.1| sodium-solute symporter [Halofe...   141   5e-31   Haloferax prahovense
gi|292494311|ref|YP_003533454.1| sodium-solute symporter [Halofe...   141   5e-31   
gi|491096221|ref|WP_004957825.1| sodium-solute symporter putativ...   141   5e-31   Haloarcula sinaiiensis
gi|308802840|ref|XP_003078733.1| unnamed protein product [Ostreo...   141   6e-31   Ostreococcus tauri
gi|313117273|ref|YP_004044256.1| Na+/proline symporter [Halogeom...   139   1e-30   
gi|490728987|ref|WP_004591385.1| sodium-solute symporter putativ...   139   2e-30   Haloarcula japonica
gi|495289883|ref|WP_008014637.1| Na+/solute symporter [Haloterri...   139   2e-30   
gi|71083513|ref|YP_266232.1| sodium/solute transporter family [C...   138   3e-30   
gi|494055010|ref|WP_006997107.1| sodium:solute transporter famil...   137   6e-30   Candidatus Pelagibacter ubique
gi|494805783|ref|WP_007541191.1| sodium/proline symporter [Halof...   137   7e-30   Haloferax larsenii
gi|452837940|gb|EME39881.1| hypothetical protein DOTSEDRAFT_6579...   137   8e-30   Dothistroma septosporum NZE10
gi|495600235|ref|WP_008324814.1| sodium/proline symporter [Halof...   137   8e-30   Haloferax elongans
gi|221507030|gb|EEE32634.1| hypothetical protein TGVEG_093120 [T...   137   9e-30   
gi|167042009|gb|ABZ06745.1| putative Sodium:solute symporter fam...   135   2e-29   uncultured marine microorganism HF4000_141F21
gi|167042081|gb|ABZ06816.1| putative sodium:solute symporter fam...   134   5e-29   uncultured marine microorganism HF4000_141I21
gi|491920183|ref|WP_005672666.1| sodium:solute symporter [Lautro...   134   7e-29   Lautropia mirabilis
gi|159478048|ref|XP_001697116.1| hypothetical protein CHLREDRAFT...   133   1e-28   Chlamydomonas reinhardtii
gi|330813504|ref|YP_004357743.1| sodium:solute transporter famil...   133   1e-28   
gi|257051772|ref|YP_003129605.1| Na+/solute symporter [Halorhabd...   131   4e-28   
gi|495593381|ref|WP_008317960.1| Na+/proline symporter [Leptolyn...   130   1e-27   Leptolyngbya sp. PCC 6406
gi|496768627|ref|WP_009366258.1| sodium:proline symporter [Halog...   130   1e-27   Halogranum salarium
gi|497072234|ref|WP_009458289.1| sodium:solute symporter family ...   128   3e-27   
gi|452206656|ref|YP_007486778.1| sodium/solute symporter [Natron...   128   4e-27   
gi|237842017|ref|XP_002370306.1| sodium:solute symporter family ...   127   7e-27   Toxoplasma gondii ME49
gi|221482350|gb|EEE20705.1| sodium/proline symporter, putative [...   127   7e-27   
gi|385803739|ref|YP_005840139.1| sodium/proline symporter [Haloq...   127   8e-27   
gi|110668293|ref|YP_658104.1| sodium/proline symporter [Haloquad...   127   9e-27   
gi|406706436|ref|YP_006756789.1| sodium:solute symporter [alpha ...   126   2e-26   
gi|493057507|ref|WP_006114744.1| sodium/proline symporter [Halor...   125   2e-26   
gi|489896677|ref|WP_003800124.1| sodium:solute symporter [Alcali...   125   4e-26   Alcaligenes faecalis
gi|401410997|ref|XP_003884946.1| conserved hypothetical protein ...   122   2e-25   Neospora caninum Liverpool
gi|237829741|ref|XP_002364168.1| hypothetical protein TGME49_108...   122   4e-25   Toxoplasma gondii ME49
gi|221481082|gb|EEE19490.1| conserved hypothetical protein [Toxo...   121   7e-25   
gi|301099137|ref|XP_002898660.1| Solute:Sodium Symporter (SSS) F...   120   1e-24   Phytophthora infestans T30-4
gi|496388369|ref|WP_009097359.1| sodium:solute symporter [Halomo...   119   2e-24   
gi|495436760|ref|WP_008161455.1| sodium:solute symporter [Achrom...   119   2e-24   Achromobacter arsenitoxydans
gi|493251055|ref|WP_006218923.1| sodium:solute symporter [Achrom...   119   3e-24   Achromobacter piechaudii
gi|311105765|ref|YP_003978618.1| sodium:solute symporter family ...   118   4e-24   
gi|493260372|ref|WP_006224090.1| sodium:solute symporter [Achrom...   118   6e-24   Achromobacter piechaudii
gi|493564321|ref|WP_006517691.1| Na+/proline symporter [Leptolyn...   117   8e-24   Leptolyngbya sp. PCC 7375
gi|495661125|ref|WP_008385704.1| Na+/proline symporter [Halosarc...   117   9e-24   Halogeometricum pallidum
gi|91776138|ref|YP_545894.1| Na+/solute symporter [Methylobacill...   117   1e-23   
gi|485648251|gb|EOD41160.1| hypothetical protein EMIHUDRAFT_1993...   116   2e-23   Emiliania huxleyi CCMP1516
gi|399546779|ref|YP_006560087.1| Sodium/pantothenate symporter [...   114   1e-22   
gi|374333905|ref|YP_005090592.1| sodium transporter family prote...   113   1e-22   
gi|494589580|ref|WP_007348174.1| sodium:solute symporter [Marino...   112   2e-22   Marinobacter sp. ELB17
gi|493500829|ref|WP_006455347.1| transporter, SSS family, putati...   107   1e-20   Synechococcus sp. PCC 7335
gi|496121833|ref|WP_008846340.1| Na+/solute symporter [Glaciecol...    96   2e-17   Aliiglaciecola lipolytica
gi|302828314|ref|XP_002945724.1| hypothetical protein VOLCADRAFT...    95   6e-17   Volvox carteri f. nagariensis
gi|344233258|gb|EGV65131.1| hypothetical protein CANTEDRAFT_1135...    94   7e-17   Candida tenuis ATCC 10573
gi|495015305|ref|WP_007741316.1| sodium-solute symporter putativ...    92   3e-16   Halococcus thailandensis
gi|490154212|ref|WP_004052888.1| sodium-solute symporter putativ...    90   1e-15   Halococcus morrhuae
gi|492986221|ref|WP_006079325.1| sodium-solute symporter putativ...    88   8e-15   
gi|328771325|gb|EGF81365.1| hypothetical protein BATDEDRAFT_2427...    84   1e-13   Batrachochytrium dendrobatidis JAM81
gi|493966265|ref|WP_006909607.1| urea transporter [Cyanobium sp....    79   4e-12   
gi|495978123|ref|WP_008702702.1| sodium/solute transporter famil...    77   1e-11   Rhodopirellula maiorica
gi|56460634|ref|YP_155915.1| Na+/proline symporter [Idiomarina l...    76   2e-11   
gi|496394523|ref|WP_009103513.1| sodium/solute transporter famil...    75   5e-11   Rhodopirellula sp. SWK7


>gi|343429781|emb|CBQ73353.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 550

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 211/525 (40%), Positives = 321/525 (61%), Gaps = 9/525 (1%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           MLS   +N L+Y  L  F+ +G+YAGYK  +N +D+LS L TQ+ + L  NWFAS++ SS
Sbjct: 1   MLSVQQANALVYSTLCGFMLVGLYAGYK-VRNTNDFLSGLRTQSVLPLTLNWFASNMSSS 59

Query: 62  ILYSFPEVGTI--AGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGR 119
           +L+ +P++  I  AG+LG++ Y F ++ PL+ FAWLGPLIR+ CP+GFTL +++  RFG 
Sbjct: 60  LLFGYPQLAVIPNAGVLGLVAYCFATVAPLWFFAWLGPLIRRVCPDGFTLAEYIRRRFGW 119

Query: 120 FNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRAS 179
              +   L+ + +MFCFM+ EL+  G+ +  L GV+     + +AI TT+YT YGG +AS
Sbjct: 120 PVGVLSGLIFVGFMFCFMLVELNTYGSAVNLLGGVNPTIAALIVAISTTIYTAYGGFKAS 179

Query: 180 LITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFAT 239
           L TDN+                  ++ I+ + +++S LL+   LG +L YI+P A+ F+ 
Sbjct: 180 LWTDNVNAVIILIFIVIASIAVGVNLDIDHARVESSGLLRPQQLGGELWYILPAALIFSQ 239

Query: 240 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLES 297
           +F++GFWQRAF+SKN++ L LS ++ +I LF V + +G+ G +A W+GL+  P  E+ + 
Sbjct: 240 MFNQGFWQRAFASKNNKTLYLSVIFATIPLFAVCMLVGMAGPLAWWSGLFNGPTAED-DG 298

Query: 298 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 357
            L FF +   LP+W++GI +VL   +S +AYDT  SA  +   ND+F  RL +   R + 
Sbjct: 299 SLTFFYILATLPNWLTGIVIVLCGCLSSSAYDTFQSAQISTIQNDVFLGRLNIWWCRAIL 358

Query: 358 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXX 417
           ++ NVP+V   +K++D+L VFLIADL A + +P  LLGL+  LYFLN +D          
Sbjct: 359 VLINVPSVVLAVKNIDILEVFLIADLAAIACIPAFLLGLVPQLYFLNGVDAVGGAVGGFF 418

Query: 418 XXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 477
                 +IF+ +A  GI LI LP GLY+ DYSVLGAF  APL S+ +TF +  +R    W
Sbjct: 419 TVFIFGTIFFGSASKGIALISLPTGLYVDDYSVLGAFFAAPLGSLGWTFATCAIRAGVTW 478

Query: 478 VFTKIRGEEFVFPKKPEVVDTKKYA--GNKFKDDTEIIQSSDPDE 520
           V+ +  G +F   +  E  D  K+A   ++  D   I  S +P +
Sbjct: 479 VYCRYTGHKFTVFEYRE-FDVSKFALPEDRPADFHGIHGSGNPHD 522



>gi|388853819|emb|CCF52540.1| uncharacterized protein [Ustilago hordei]
          Length = 553

 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 208/523 (39%), Positives = 312/523 (59%), Gaps = 5/523 (0%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           ML    +N L+Y  L  FL +G++AGYK  +N +D+LS L TQ+   L  NW AS++ SS
Sbjct: 1   MLPTSQANALVYSTLCGFLLVGLFAGYK-VRNTTDFLSGLRTQSVFPLTLNWIASNMSSS 59

Query: 62  ILYSFPEVGTI--AGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGR 119
           + + +P++  I  AG+LG+  Y F ++ PL+VFAWLGP IR+ CP+GFTL++++  R+G 
Sbjct: 60  LFFGYPQLAVIPNAGILGLAAYCFSTVAPLWVFAWLGPQIRRICPDGFTLSEYIRRRYGW 119

Query: 120 FNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRAS 179
              +  +L+ + +MFCFM+ EL+  G+ +  L GV+     + IA++TT+YT YGG +AS
Sbjct: 120 PVGVLSALIFVGFMFCFMLVELNTYGSTVNVLGGVNPTIAALVIALITTIYTAYGGFKAS 179

Query: 180 LITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFAT 239
           L TDN                   ++ I+ + +++S LLK   LG +L YI+  A+ F+ 
Sbjct: 180 LYTDNANAIIIMIFIVIASIAVGVNLDIDHARVESSGLLKPQRLGGELWYILTAALVFSQ 239

Query: 240 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGE-ENLESY 298
           +F++GFWQR F+SKN++ L LS  + +I LF +   +G+ G +A W+GL+ G     +  
Sbjct: 240 MFNQGFWQRVFASKNNKALYLSVAFATIPLFAICFIVGMAGPLAWWSGLFDGPTAEDDGS 299

Query: 299 LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 358
           L FF +   LP+WV+GI +VLA  +S +AYDT  SA  +   ND+F  RL +   R + +
Sbjct: 300 LTFFYIINTLPNWVTGIVIVLAGCLSSSAYDTFQSAQISTIQNDVFLGRLNIWWCRLILV 359

Query: 359 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXX 418
             NVP+V   +K++D+L VFLIADL   + +P  LLGLI  LYFLN +D           
Sbjct: 360 CINVPSVVLAVKNIDILEVFLIADLAGIACIPAFLLGLIPKLYFLNGVDAVGGAVGGFLT 419

Query: 419 XXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
                + FY NA DGI+LIGLP GLY+ D+SVLGAF  APL SI +TF +  +R    W+
Sbjct: 420 VFLFGTAFYGNAADGIKLIGLPNGLYLDDFSVLGAFFAAPLGSIGWTFATCAIRAGLTWL 479

Query: 479 FTKIRGEEF-VFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDE 520
           + +  G E+ VF  +   V       ++  D   I  S +PD+
Sbjct: 480 YCRYTGNEYKVFEYREFDVSKWALPEDRPADFHGIHGSGNPDD 522



>gi|392864120|gb|EJB10754.1| urea transporter [Coccidioides immitis RS]
          Length = 541

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 201/487 (41%), Positives = 293/487 (60%), Gaps = 1/487 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL  G+Y  Y  + + K  +L+S GTQ A+ L  N+ AS +GS IL+++
Sbjct: 9   SNALIYLTYGAFLIAGLYIAYLLRKQTKGQFLASNGTQKALPLALNFIASGLGSGILFTY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ G+++Y   S +PL VF +LGP+IRKKCPEGF LT++  ER+G    IY+S
Sbjct: 69  PEIATIAGVQGLVVYGLSSSLPLLVFGYLGPIIRKKCPEGFVLTEWTRERYGVVTAIYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           L+++  +F +M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDN+Q
Sbjct: 129 LLTLITLFLYMVAELSALQQIVNALTGLNGLPAVIVQVAVTTIYTSLGGFKVSFMTDNLQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G               T   I++S+ID+S  L ++ LGWQL+YI+PVA+     F   FW
Sbjct: 189 GAMVVGLIIIGVITVGTKTTIDRSLIDSSGYLNASLLGWQLIYILPVAILTNDFFLSNFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R F+SK DR+LR+     S  +  +LV +G TG++A W+G WPG+      +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGVSIASFTVLCILVLVGCTGLLAAWSGAWPGDPPQSGSIAFFLLLE 308

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP WV GI +V+ V +S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V 
Sbjct: 309 RLPSWVVGIVLVMTVVLSTAAFDSLQSAMVSTASNDLFRNKLPLIYIRVGVVLCIIPVVV 368

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             LK   VL++FLI+DL++AS +P ++LGL D  YF    +                +I+
Sbjct: 369 VALKSPSVLQIFLISDLVSASAIPVLILGLWDKCYFWKGFEVIAGGLGGILSVFIFGTIY 428

Query: 427 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 486
           Y +A +G  LI L  GLY  D+S  GAF+ AP+    F  ++FG R+   +V  KI+G  
Sbjct: 429 YGSAYEGGRLILLENGLYAEDWSAFGAFVAAPVGGFIFALIAFGSRIAYQFVIAKIQGRR 488

Query: 487 FVFPKKP 493
           F    KP
Sbjct: 489 FDAFDKP 495



>gi|390596564|gb|EIN05965.1| hypothetical protein PUNSTDRAFT_90679 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 495

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/467 (41%), Positives = 289/467 (61%), Gaps = 7/467 (1%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +GS IL+++P++G +AGL GV++YAF S +PL  F +LG  IRK CP GF LT++  ERF
Sbjct: 1   MGSGILFTYPQIGVVAGLQGVLVYAFASSLPLLTFPYLGGKIRKLCPHGFVLTEYTRERF 60

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +++S  S+  MF +M+SEL+A+  ++ +LTG++ +   I   ++T LYT +GG R
Sbjct: 61  GITTALFLSFFSVVTMFIYMVSELTAITGVINSLTGLNAIPATIVEVVITMLYTAWGGFR 120

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            SL+TD +QG                +IRI++++I+ S LLK+N LGWQLLYI+PVA+ +
Sbjct: 121 TSLVTDYVQGVLILVLLVVCSAAMGANIRIDRALIEESGLLKANLLGWQLLYILPVAIVW 180

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES 297
              F  G+WQRAF+SK +R+L +     +I++F +L  +G TG+IAVW+ L+PG E  + 
Sbjct: 181 NNFFLSGYWQRAFASKTNRDLWIGCSGAAIIVFVMLTIVGFTGLIAVWSRLYPGYEGDDG 240

Query: 298 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 357
              FF +   LP WV G  +V A+S+SCAAYDTL +A  A  SND+F N+L +   R L 
Sbjct: 241 SFTFFEILATLPAWVVGFVLVFAISLSCAAYDTLQNAIVATISNDVFRNKLNIWWVR-LV 299

Query: 358 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXX 417
           LI NVPAV    K+L++L ++LI+DL++A+ MPPI LGLI  LYFLN  D          
Sbjct: 300 LIVNVPAVVVATKNLNILVLYLISDLVSAAIMPPIFLGLIPRLYFLNSFDIIIGGVGGFF 359

Query: 418 XXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 477
                 +I+Y++AK G  ++ L  G+Y  D+S  GAF+ AP+ SI +TF +F +R  + +
Sbjct: 360 TVFIWGAIYYNDAKKGAGVLILQAGIYADDWSTFGAFVAAPVGSILWTFGAFALRAGATY 419

Query: 478 VFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIEIR 524
           ++ +  G  F       V D ++    +F ++      S PDE E+ 
Sbjct: 420 LYARRTGAHF------GVFDKREIDVARFAEEAAQAGISVPDEAELE 460



>gi|367041970|ref|XP_003651365.1| hypothetical protein THITE_2111546 [Thielavia terrestris NRRL 8126]
 gi|346998627|gb|AEO65029.1| hypothetical protein THITE_2111546 [Thielavia terrestris NRRL 8126]
          Length = 538

 Score =  364 bits (934), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 200/523 (38%), Positives = 323/523 (61%), Gaps = 18/523 (3%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV   +FL +G    +K K+++KS++L+   TQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNAIIYVTYGLFLLVGTGVAWKFKSQSKSEFLAGNRTQTALPLALNFIASALGSGILFAY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           P++ T+AG+ GV++YA  S +PL +FA LGP+IR+KCPEGF LT++  +R+G F  +Y+S
Sbjct: 69  PQLATLAGVQGVVVYALSSALPLLIFAALGPIIRRKCPEGFVLTEWTRQRYGTFAALYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
            M++  +F +M+SELSA+G ++  LTG+D L  +I   IVTT+YT  GG + S  TDNIQ
Sbjct: 129 FMTLVTLFLYMVSELSAIGQVVNLLTGLDGLPVLIVECIVTTVYTSMGGFKISFFTDNIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                  +I+ S+ID+S L K++ LGWQLLYI+PVA+     F   FW
Sbjct: 189 GAMVLGLILIATITIGVETKIDTSLIDSSGLTKASLLGWQLLYILPVAILTNDFFLSNFW 248

Query: 247 QRAFSSKNDRELRL---SAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG--EENLESYLAF 301
            R F+SK DR+L L    AV G+++   ++  +G TG++A WAG+WPG  ++ ++  +AF
Sbjct: 249 LRTFASKTDRDLWLGISGAVVGTLI---IVTLVGATGLVAAWAGIWPGPADDPVDGSVAF 305

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L + LP WV GI +V++V++S AA+D+L SA   + SND+F NRL + + R   ++  
Sbjct: 306 FALLEQLPSWVVGIVLVMSVTLSTAAFDSLQSAMVTSASNDLFRNRLNIWLIRAGVVLVM 365

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXX 421
           +P V   ++   +L+++LI+DL++A+++P +++GL D+ Y+    +              
Sbjct: 366 IPVVVIAIRAPSILQIYLISDLVSAASIPVLMIGLCDACYWWRGFEVVVGGLGGLFTVFL 425

Query: 422 XXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 481
             +++Y NA+ G EL+ L  GLY  D+   GAF+ AP+  + + F + G+RL   ++  +
Sbjct: 426 FGTVYYGNAQLGAELMLLEQGLYTADWGAFGAFVAAPVGGLLWGFGALGLRLGIQYIRAR 485

Query: 482 IRGEEFVFPKKP-------EVVDTKKYAGNKFKDDTEIIQSSD 517
            +GE F    +P        VVD +      F +++EI  SSD
Sbjct: 486 AKGERFDALDRPLATGGPRPVVDPEVGGNAGFGEESEI--SSD 526



>gi|315047150|ref|XP_003172950.1| hypothetical protein MGYG_09089 [Arthroderma gypseum CBS 118893]
 gi|311343336|gb|EFR02539.1| hypothetical protein MGYG_09089 [Arthroderma gypseum CBS 118893]
          Length = 536

 Score =  362 bits (928), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 201/516 (38%), Positives = 305/516 (59%), Gaps = 2/516 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL  G+Y  ++ + + K ++LSS GTQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALIYLTYGAFLVAGLYIAWRLRNQTKGEFLSSNGTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ G+++Y   S +PL  FA++GP+IRKK PE F LT++  +R+G    IY+S
Sbjct: 69  PEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRKKFPEVFVLTEWTRQRYGVVAGIYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           ++++  +F +M++ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDNIQ
Sbjct: 129 ILTLITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFKVSFLTDNIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W
Sbjct: 189 GAMVVGLIIIAVITVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG+      +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLE 308

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP WV GI +V+ V++S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V 
Sbjct: 309 KLPSWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIIPVVV 368

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             L+   VLR+FLI+DL++AS +P ++LGL D  Y+    +                +I+
Sbjct: 369 VALRSPSVLRIFLISDLVSASAIPVLVLGLSDKFYWWTAFEVIVGGLGGILSVFIFGTIY 428

Query: 427 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 486
           Y NA DG  LI L  GLY  D+S  GAF+ AP+  + F  L+ G+R+   ++ +K  G  
Sbjct: 429 YGNATDGGNLILLQNGLYANDWSAFGAFVAAPVGGLIFACLALGLRVGYKFILSKTTGRH 488

Query: 487 FVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 522
           F     P +  +   AG    D+ E I +     I 
Sbjct: 489 FDVFDLP-LPRSHMAAGPMHLDEPEFIATGTDATIR 523



>gi|358393547|gb|EHK42948.1| hypothetical protein TRIATDRAFT_247013 [Trichoderma atroviride IMI
           206040]
          Length = 521

 Score =  360 bits (925), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 200/488 (40%), Positives = 300/488 (61%), Gaps = 3/488 (0%)

Query: 8   SNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           SN +IYV    FL  G GI    +K  N +D+L+   TQ A  L  N+ AS++GS IL+S
Sbjct: 9   SNAIIYVTYGFFLVMGTGIAWRMRKQPN-TDFLAGNRTQTAWPLAFNFIASALGSGILFS 67

Query: 66  FPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYV 125
           +P++ TIAG+ GV++YA  S +PL +FA LGP++R+KCP+GF LT++  ER+G    +Y+
Sbjct: 68  YPQLATIAGVQGVVVYALASALPLLIFAALGPILRRKCPDGFVLTEWTRERYGTVAMLYL 127

Query: 126 SLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 185
           S M++  +F +M++ELSAVG ++  LTG+D L  +I   +VTT+YT  GG R S +TD +
Sbjct: 128 SFMTLVTLFLYMVAELSAVGQVVNALTGLDGLPVIIVECVVTTIYTSLGGFRISFLTDVV 187

Query: 186 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 245
           QG                   I++ +ID+S L K++ +GWQL+YI+PVAV     F   F
Sbjct: 188 QGAMVVGLIIIATITIGVKAEIDRDLIDSSGLTKASLVGWQLVYILPVAVLTNDFFLSNF 247

Query: 246 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 305
           W R FSSK D++L +     ++ +  +L  +G TG+IA W G WPGE +++  LAFF L 
Sbjct: 248 WLRTFSSKTDKDLWIGVSVATVAVLCILTLVGATGLIAAWTGAWPGESDIDGSLAFFALL 307

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP+WV GI +V+ VS+S +A+D+L SA  ++ SND+F NRL + + R L ++  +P V
Sbjct: 308 EQLPNWVVGIVLVMVVSLSVSAFDSLQSAMISSASNDLFRNRLNIWIIRVLVVLVIIPTV 367

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 425
              LK   +L++FLI+DL +A+T+PP+ LGLID  Y+    +                +I
Sbjct: 368 VIALKAPSILQIFLISDLASAATIPPLCLGLIDGFYWWRGFEVVVGGLGGILSVFIYGAI 427

Query: 426 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           +Y +AK G ELI L  GLY  D+   GAF++AP+  I + F++  +RL   +V  K RGE
Sbjct: 428 YYGDAKSGGELILLEQGLYEGDWGAFGAFVMAPVGGIIWGFIALVLRLSVQFVQAKSRGE 487

Query: 486 EFVFPKKP 493
            F    +P
Sbjct: 488 RFDALDRP 495



>gi|406868486|gb|EKD21523.1| urea transporter [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 552

 Score =  357 bits (916), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 191/491 (38%), Positives = 293/491 (59%), Gaps = 1/491 (0%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
           K T N+ ++LSS  TQ A+ L  N+ A+S+GSSIL+S+P++ TI G+ GVI+YA  S  P
Sbjct: 49  KLTMNQGEFLSSNRTQTALPLALNFIAASLGSSILFSYPQLATIVGVQGVIIYAISSAAP 108

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
           L VFA+L P+IRKKCPEGF LT++  +R+G    IY+S M++A MF +M++ELSA+  I+
Sbjct: 109 LLVFAFLTPIIRKKCPEGFVLTEWTRQRYGVVTAIYLSFMTMATMFLYMVAELSALQQIM 168

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIE 208
             LTG+D L  VI    VTT+YT  GG + S ITDNIQ                   +I+
Sbjct: 169 TALTGMDGLPMVIVQCAVTTIYTSVGGFKISFITDNIQATMVISLIIIATITIGVQTKID 228

Query: 209 KSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIM 268
           KS+ DNS LL+ + LGWQLLYI+PV++     F   FW RAF++K DR+L       +++
Sbjct: 229 KSLRDNSVLLEPSKLGWQLLYILPVSIITNVFFLSSFWIRAFAAKTDRDLWTGVTIATLV 288

Query: 269 LFPVLVFLGLTGMIAVWAGLW-PGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAA 327
           +  +L  +G+TG+IA W+G + P   + +  +AFF L + LP W  G+ +V+ +SMS AA
Sbjct: 289 VLIILTLVGVTGLIATWSGAYDPTNPDQDGSIAFFLLLESLPTWTIGLILVIVISMSTAA 348

Query: 328 YDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAAS 387
           +D++ SA  +  SND+F N+L +   R   ++   P V   LK   VLR++LI++L++ S
Sbjct: 349 FDSIQSAMVSTASNDLFRNKLNIWFIRASVVLLIFPVVVIALKSPSVLRIYLISNLVSTS 408

Query: 388 TMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITD 447
           T+P ++LGL+D  Y+    +                +I++ +A+ G  L+ +  GL+  D
Sbjct: 409 TIPVLVLGLMDRFYWWRGFEVVVGGLGGLLSVFVFGTIYFGDAEQGANLLIIDSGLFAND 468

Query: 448 YSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFK 507
           +SV GAF+ AP+ SI + F +  VRL   +V  K++G  F    +P  +  +      + 
Sbjct: 469 WSVFGAFVAAPVGSILWGFGALAVRLGYRFVEAKVKGHRFDALDRPAYMQERAEGVTDYV 528

Query: 508 DDTEIIQSSDP 518
           DD + + S  P
Sbjct: 529 DDHDEVHSDAP 539



>gi|501308643|dbj|GAC97537.1| predicted urea transporter [Pseudozyma hubeiensis SY62]
          Length = 523

 Score =  356 bits (913), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 182/437 (41%), Positives = 280/437 (64%), Gaps = 5/437 (1%)

Query: 55  ASSIGSSILYSFPEVGTI--AGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQF 112
           ++ + SS+L+ +P++  I  AG+LG++ Y F +++PL+ FAWLGPLIR+ CP+GFTL ++
Sbjct: 27  STDMSSSLLFGYPQLAVIPNAGVLGLVAYCFATVVPLWFFAWLGPLIRRICPDGFTLAEY 86

Query: 113 VLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTG 172
           +  RFG    +   L+ + +MFCFM+ EL+  G+ + TL GV+     + +A+ TT+YT 
Sbjct: 87  IRRRFGWPVGVLSGLIFVGFMFCFMLVELNTYGSAVNTLGGVNPTIAALIVALSTTIYTA 146

Query: 173 YGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMP 232
           YGG +ASL TDN+                  ++ I+ + +++S LL+   LG +L YI+P
Sbjct: 147 YGGFKASLYTDNVNAVIILIFIVIASVAVGVNLDIDHARVESSGLLRPQRLGGELWYILP 206

Query: 233 VAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--P 290
            A+ F+ +F++GFWQRAF+SKN++ L LS ++ +I LF V + +G+ G +A W+GL+  P
Sbjct: 207 AAIIFSQMFNQGFWQRAFASKNNKTLYLSVIFATIPLFAVCMLVGMAGPLAWWSGLFNGP 266

Query: 291 GEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPL 350
             E+ +  L FF +   LP+W++GI +VL   +S +AYDT  SA  +   ND+F  RL +
Sbjct: 267 TAED-DGSLTFFYILNTLPNWLTGIVIVLCGCLSSSAYDTFQSAQISTIQNDVFLGRLNI 325

Query: 351 NVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXX 410
              R + ++ NVP+V   +K++D+L VFLIADL A + +P  LLGL+  LYFLN +D   
Sbjct: 326 WWCRAILVLINVPSVVLAVKNIDILEVFLIADLAAIACIPAFLLGLVPQLYFLNGLDAVG 385

Query: 411 XXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFG 470
                        ++F+ +A  GI LIGLP GLYI DYSVLGAFI APL S+ +TF++FG
Sbjct: 386 GAVGGFLTVFLFGTVFFRSAAQGIALIGLPNGLYIDDYSVLGAFIAAPLGSLGWTFVTFG 445

Query: 471 VRLISMWVFTKIRGEEF 487
           +R   MWV+ +  GE+F
Sbjct: 446 IRATVMWVWCRRTGEKF 462



>gi|440469250|gb|ELQ38367.1| urea transport protein [Magnaporthe oryzae Y34]
 gi|440486720|gb|ELQ66559.1| urea transport protein [Magnaporthe oryzae P131]
          Length = 537

 Score =  354 bits (909), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 198/519 (38%), Positives = 303/519 (58%), Gaps = 6/519 (1%)

Query: 8   SNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           SN ++Y+    FL  G GI A   + + K+D+L+   TQ A  L  N+ AS+IGS IL+S
Sbjct: 9   SNAIVYLTYGAFLLLGSGI-AWTMRNQPKADFLAGNRTQTAFPLALNFIASAIGSGILFS 67

Query: 66  FPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYV 125
           +P++ TI G+ GV++YA  S +PL +FA LGP IR KCPEGF LT++  ER+G+   +Y+
Sbjct: 68  YPQLATITGVQGVVVYALSSALPLLIFAALGPKIRNKCPEGFVLTEWTRERYGKVTALYL 127

Query: 126 SLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 185
           S MS+  +F +M++ELSA+G ++ TLT ++ L  +I   IVTT YT  GG + S +TDN+
Sbjct: 128 SFMSLVTLFLYMVAELSAIGQVISTLTTMNPLPVMIVQCIVTTAYTSMGGFKISFLTDNV 187

Query: 186 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 245
           QG                  RI+ ++ID+S L K   LGWQLLYI+PVA+     F   F
Sbjct: 188 QGAMVLGLILIATIAIGVETRIDLALIDSSGLTKPTLLGWQLLYILPVAILTNDFFLSSF 247

Query: 246 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 305
           W R F+SK D++L +     +  +  +L  +G+TG++AVW+G WPG +N +  +AFF L 
Sbjct: 248 WLRTFASKTDKDLWIGISLATGAILCILTLVGVTGLVAVWSGAWPGPDNADGSVAFFMLL 307

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP+WV G+ +++AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +
Sbjct: 308 QQLPNWVVGMVLLMAVTLSTAAFDSLQSAMVSSASNDLFRNRLGVWPIRAAVVLVMIPVI 367

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXXXXX 423
              L+   +L+++LI+DL++AST+P ++LGL D  YF  W   D                
Sbjct: 368 VIALRAPSILQIYLISDLVSASTIPVLVLGLSDH-YFYWWRGFDVVCGGLGGILSVFIFG 426

Query: 424 SIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIR 483
           + +Y +A+ G ELI L  GLY  D+ V GAF+ AP   + F FL+   R+  ++V  K+ 
Sbjct: 427 TAYYGSAQAGGELILLQQGLYTGDWGVFGAFVAAPAGGLIFAFLAMLGRVGFLFVRAKMI 486

Query: 484 GEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 522
           G  F    +P              +D E+ +     E E
Sbjct: 487 GAPFTAFDRPMAEVALPARAEPEYEDGELREEDSITEQE 525



>gi|327306029|ref|XP_003237706.1| hypothetical protein TERG_02421 [Trichophyton rubrum CBS 118892]
 gi|326460704|gb|EGD86157.1| hypothetical protein TERG_02421 [Trichophyton rubrum CBS 118892]
          Length = 536

 Score =  353 bits (907), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 201/525 (38%), Positives = 312/525 (59%), Gaps = 8/525 (1%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL +G+Y  ++ + + K ++LSS GTQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALIYLTYGSFLVVGLYIAWRLRNQTKGEFLSSNGTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ G+++Y   S +PL  FA++GP+IRKK PE F LT++  +R+G    IY+S
Sbjct: 69  PEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRKKFPEVFVLTEWTRQRYGVVAGIYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           ++++  +F +M++ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+Q
Sbjct: 129 ILTMITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W
Sbjct: 189 GAMVVGLIIIAVITVGARTNIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG       +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGNPPQAGSIAFFLLLE 308

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP+WV GI +V+ V++S AA+D+L SA  +  SND+F N+LPL   R   ++  VP V 
Sbjct: 309 KLPNWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIVPVVV 368

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             L+   VLR+FLI+DL++AS +P ++LGL + +Y+    +                +I+
Sbjct: 369 VALRSPSVLRIFLISDLVSASAIPVLVLGLSNRMYWWTAFEVIVGGLGGILSVFIFGTIY 428

Query: 427 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 486
           Y NA +G +LI L  GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  
Sbjct: 429 YGNATEGGKLILLQNGLYANDWSAFGAFVAAPVGGLIFACIALGLRVGYKYVLSKTTGRH 488

Query: 487 F-VF----PKKPEVVDTKKYAGNKF--KDDTEIIQSSDPDEIEIR 524
           F VF    P+ P            F       II+++D +  + R
Sbjct: 489 FDVFDRPLPRSPMAAGPMHLDQPDFIATGTDAIIRNNDEEGAKFR 533



>gi|302664422|ref|XP_003023841.1| hypothetical protein TRV_02038 [Trichophyton verrucosum HKI 0517]
 gi|291187859|gb|EFE43223.1| hypothetical protein TRV_02038 [Trichophyton verrucosum HKI 0517]
          Length = 536

 Score =  352 bits (903), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 197/516 (38%), Positives = 308/516 (59%), Gaps = 2/516 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL +G+Y  ++ + + K ++LSS GTQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALIYLTYGAFLVVGLYIAWRLRNQTKGEFLSSNGTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ G+++Y   S +PL  FA++GP+IR+K PE F LT++  +R+G    IY+S
Sbjct: 69  PEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           ++++  +F +M++ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+Q
Sbjct: 129 ILTLITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W
Sbjct: 189 GAMVVGLIIIAVITVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG+      +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLE 308

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP+WV GI +V+ V++S AA+D+L SA  +  SND+F N+LPL   R   ++  VP V 
Sbjct: 309 KLPNWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIVPVVV 368

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             L+   VLR+FLI+DL++AS +P ++LGL + +Y+    +                +I+
Sbjct: 369 VALRSPSVLRIFLISDLVSASAIPVLVLGLSERMYWWTAFEVIVGGLGGILSVFIFGTIY 428

Query: 427 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 486
           Y NA +G +LI L  GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  
Sbjct: 429 YGNATEGGKLILLQNGLYANDWSAFGAFVAAPIGGLIFACIALGLRVGYAFVLSKTTGRH 488

Query: 487 FVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 522
           F     P +  +   AG    D  + I +     I 
Sbjct: 489 FDVFDHP-LPRSHMAAGPMHLDQPDFIATGTDATIR 523



>gi|440633300|gb|ELR03219.1| hypothetical protein GMDG_01202 [Geomyces destructans 20631-21]
          Length = 530

 Score =  352 bits (902), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 199/518 (38%), Positives = 304/518 (58%), Gaps = 13/518 (2%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL  G    ++ + + K ++LSS  TQ+A  L  N+ AS++GS IL+S+
Sbjct: 9   SNALIYITYGSFLIFGCAIAWRLRHQTKDEFLSSNRTQSAGPLALNFVASALGSGILFSY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           P++  + G+ GV++YA  S  PL VFA LGP+IR KCPEGF LT++  +R+G    +++S
Sbjct: 69  PQLAALTGVQGVVVYAVSSAAPLMVFAILGPIIRNKCPEGFILTEWTRQRYGVVTAMFLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
            +++  MF +M++ELSA+  I+  LTG+D L  +I  A+VTT+YT  GG + S ITDNIQ
Sbjct: 129 FLTLVTMFLYMVAELSAMQQIVGALTGMDGLPAIIVQAVVTTIYTSLGGFKISFITDNIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
                               +++S++D+S LL +  LGWQLLYI+PVAV     F   FW
Sbjct: 189 AVMVFFLVTVATITIGVKTNVDRSLVDSSGLLNATLLGWQLLYILPVAVLTNDFFLSNFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLF 305
            R F+S+ D++L +     S ++  +L  +G+TG++AVW G L PGE+     +AFF L 
Sbjct: 249 IRTFASRTDKDLFIGVSSASAIVLVILTLVGVTGLLAVWTGALAPGEDG---SIAFFLLL 305

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP WV GI +V+ V++S AA+D+  SA  ++ SND+F N+L + V R   +    P V
Sbjct: 306 ETLPSWVVGIVLVMTVTLSTAAFDSFQSAMVSSASNDLFGNKLNIWVIRAGIVALIFPVV 365

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 425
              LK   +L+++LI+DL++AST+P +++GL D  Y+    +                +I
Sbjct: 366 VIALKAPSILQIYLISDLVSASTIPVLVIGLSDRFYWWRGFEVVIGGLGGILTVFIFGTI 425

Query: 426 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           ++ NA DG +LI L  GLY  D+SV GAF+ AP   + + F +  VRL   W+  KI+G+
Sbjct: 426 YFGNALDGAKLILLEGGLYANDWSVFGAFVAAPFGGLLWGFGALVVRLGFQWLIAKIKGQ 485

Query: 486 EF------VFPKKPEVVDTKKY--AGNKFKDDTEIIQS 515
            F       +  +P +VD  +Y   G+    D E I S
Sbjct: 486 RFDSLDKPDYLTRPRIVDANEYTDGGDITAADEEFITS 523



>gi|340519811|gb|EGR50049.1| hypothetical protein TRIREDRAFT_3412 [Trichoderma reesei QM6a]
          Length = 520

 Score =  350 bits (897), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 198/487 (40%), Positives = 295/487 (60%), Gaps = 1/487 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYKKTKN-KSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV    FL +G    +K  K   +D+LS   TQ A+ L  N+ AS++GS IL+S+
Sbjct: 9   SNAIIYVTYGFFLILGTSIAWKMRKQPNTDFLSGNRTQTALPLAFNFIASALGSGILFSY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ GV++YA  S +PL VFA LGP+IR+KCP+GF LT++   R+G    +Y+S
Sbjct: 69  PELATIAGVQGVVVYALASALPLLVFAALGPMIRRKCPDGFVLTEWTRNRYGTVAMLYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
            M++  +F +M++ELSAVG ++  LTG+D L  +I    VTT+YT  GG R S +TD IQ
Sbjct: 129 FMTLVTLFLYMVAELSAVGQVVNALTGLDGLPVIIVECAVTTIYTSLGGFRISFLTDVIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I++ +ID+S L K++ +GWQL+YI+PVAV     F   FW
Sbjct: 189 GAMVVGLIIIATITIGVKAEIDRDLIDSSGLTKASLVGWQLVYILPVAVLTNDFFLSNFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R FSSK D++L +     ++ +  +L  +G TG+IA W G WPGE +++  LAFF L +
Sbjct: 249 LRTFSSKTDKDLWVGVSIATVAVLCILTLVGATGLIAAWTGAWPGESDIDGSLAFFALLE 308

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP WV GI +V+ VS+S +A+D+L SA  ++ SND+F NRL + + R + ++  +P V 
Sbjct: 309 QLPSWVVGIVLVMVVSLSVSAFDSLQSAMISSASNDLFRNRLNIWIIRVIVVLVIIPTVV 368

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             LK   +L++FLI+DL +A+T+P + LGL D+ Y+    +                +I+
Sbjct: 369 IALKAPSILQIFLISDLASAATIPALCLGLFDTFYWWRGFEVVVGGLGGILTVFIYGAIY 428

Query: 427 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 486
           Y +AK G ELI L  GLY  D+   GAF+ AP+  I + F++  +RL   +   K+RGE 
Sbjct: 429 YGDAKSGGELILLEQGLYAGDWGAFGAFVAAPVGGIIWGFIALALRLSVQFTLAKMRGER 488

Query: 487 FVFPKKP 493
           F    +P
Sbjct: 489 FDALDRP 495



>gi|407918302|gb|EKG11573.1| Sodium/solute symporter [Macrophomina phaseolina MS6]
          Length = 468

 Score =  347 bits (891), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 191/458 (41%), Positives = 289/458 (63%), Gaps = 1/458 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IY+    FL  G++  +K + ++K+DYLSS  TQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNAIIYLTYGAFLICGVFVAWKLRHQSKTDYLSSNRTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ G+++YA  S +PL +F +LGPLIRKKCPEGF LT++  +R+G    +++S
Sbjct: 69  PEIATIAGVQGLVVYALSSGLPLLIFGYLGPLIRKKCPEGFVLTEWTRQRYGTVAALFLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           LM++  +F +M+SELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDNIQ
Sbjct: 129 LMTLITLFLYMVSELSALQQIITALTGLDGLPAVIVQCAVTTIYTSVGGFKVSFVTDNIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I++S+ID+S  L S+ LGWQL+YI+PVA+     F  GFW
Sbjct: 189 GVMVLGLIIIACITVGVETEIDRSLIDSSGYLNSSLLGWQLIYILPVAILTNDFFLSGFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R F+S+ DR+LR++    ++ +  +L  +G TG++A W+G+WPG       +AFFTL  
Sbjct: 249 LRTFASRTDRDLRIAVSIAAVTVTIILTLVGCTGLLATWSGVWPGNPPQVGSIAFFTLLG 308

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP WV GI +V+ V++S AA+D+  SA  +  SND+F NRLPL   R L ++A VP V 
Sbjct: 309 TLPAWVVGIVLVMVVALSTAAFDSFQSAMVSTGSNDLFRNRLPLWWIRALVVVAIVPVVV 368

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             L+   VL+V+LI+DL++AS +P +++GL D  ++ +  +                +++
Sbjct: 369 VALRSPSVLQVYLISDLVSASLVPVLVIGLSDRCWWWSGTEVVVGGLGGIFSVFLFGTVY 428

Query: 427 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFF 464
           Y NA+DG  LI L  GLY  D+S  GAF+ AP+  + +
Sbjct: 429 YGNARDGANLILLENGLYGDDWSAFGAFVAAPVGGLLW 466



>gi|402086111|gb|EJT81009.1| urea transporter [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 533

 Score =  343 bits (879), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 185/519 (35%), Positives = 304/519 (58%), Gaps = 4/519 (0%)

Query: 4   SGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           S   S+ ++Y     FL +G    ++ + ++KSD+L+   TQ A+ L  N+ AS++GS I
Sbjct: 5   SSEASHAIVYATYGAFLVLGTGIAWRMRNQSKSDFLNGNRTQTALPLALNFIASAMGSGI 64

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L+++P++ TIAG+ GV++YA  S +PL +FA LGP IR++CPEGF LT++  +R+G    
Sbjct: 65  LFAYPQLATIAGIQGVVVYALSSALPLLIFAALGPAIRRRCPEGFVLTEWTRQRYGAVAA 124

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+  M++  +F +M++ELSA+  ++ TL+ +D L  VI    +TT+YT  GG + S +T
Sbjct: 125 LYLGFMTLLTLFLYMVAELSAISQVVTTLSNLDGLPVVIVQCAITTIYTSMGGFKISFLT 184

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN+QG                  RI+ ++I++S LL+   LGWQL+YI+PVA+     F 
Sbjct: 185 DNVQGAMVLGLIIIATITIGVETRIDPALIESSGLLQPTLLGWQLVYILPVAILTNDFFL 244

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 302
             FW R F+SK DR+L +     S     +L  +G TG++AVW+G WPG +N +  +AFF
Sbjct: 245 SSFWLRTFASKTDRDLWIGVGMASAATLCILTLVGTTGLVAVWSGAWPGPDNADGSVAFF 304

Query: 303 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 362
           TL ++LP+WV GI +V+AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +
Sbjct: 305 TLLQLLPNWVVGIVLVMAVTLSTAAFDSLQSAMVSSASNDLFRNRLGIWYIRAAVVLVII 364

Query: 363 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXX 420
           P +   L+   +L+++LI+D+++A+T+P ++LGL D  YF  W   D             
Sbjct: 365 PVIVIALRAPSILQIYLISDMVSAATIPVLVLGLSDR-YFYWWRGFDVVCGGLGGILSVF 423

Query: 421 XXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFT 480
              + +Y + + G  LI L  GLY  D+ V GAF+ AP+  + F F++  +R+  ++   
Sbjct: 424 IFGTAYYGDVEAGGRLILLEQGLYTGDWGVFGAFVAAPVGGMVFGFIAMLLRVGFLFAQA 483

Query: 481 KIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPD 519
           K  G +F   ++P    T          +     S+D +
Sbjct: 484 KATGGQFTAFERPLPESTAISENGPADGEVRFDDSADRE 522



>gi|345566015|gb|EGX48962.1| hypothetical protein AOL_s00079g183 [Arthrobotrys oligospora ATCC
           24927]
          Length = 532

 Score =  342 bits (877), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 193/495 (38%), Positives = 302/495 (61%), Gaps = 7/495 (1%)

Query: 4   SGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           S   SN +IY+   +FL +G+   +K + ++K  +LSS  TQ A+ L  N+ AS +GS I
Sbjct: 5   SAPASNAIIYLTYGLFLVMGLAFAWKFRNQSKEQFLSSNRTQRAIPLALNFIASGLGSGI 64

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L+++P++G  AG+ G+++YA  S  P+ +FA L P+IR++ P GF LT++  +RFG    
Sbjct: 65  LFTYPDIGAFAGIQGLLVYALASATPIILFALLTPIIRRRTPNGFLLTEWTRDRFGAPAA 124

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+SL+++  MF +M++ELSAV +++  LTG++ L  +I   +VTT+YT  GG R S +T
Sbjct: 125 LYLSLLTMITMFLYMVAELSAVNSVINLLTGLNGLPALIVEVVVTTIYTSLGGFRVSFVT 184

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DNIQG               T   I+ S+I+ S L ++  LGW+LLYI+PVA+S   +F 
Sbjct: 185 DNIQGALVLCLIIICTISIGTKSHIDTSLIEPSGLTRATLLGWKLLYILPVAISTNFMFL 244

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWA---GLWPGEENLESYL 299
             FW R+F+S+ D++L + +    + +F +L   G TG+IAVWA     W G  +  S +
Sbjct: 245 SPFWMRSFASRTDKDLYIGSAIAGVWIFVILTVTGFTGIIAVWAHGVDKW-GPVSEWSSV 303

Query: 300 AFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLI 359
           AFF L   LP WV G+ +++ V++S A +D+L SA  +  SND+F N+LPL   R    I
Sbjct: 304 AFFYLIAELPAWVVGLVLLMVVALSTAIFDSLQSALISTASNDLFRNKLPLTYIRVGVAI 363

Query: 360 ANVPAVYWGLK-DLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXX 418
             +P +   +K D  VL++FLI+D+++A+ +P +LLGL+DSLYFL+ +D           
Sbjct: 364 LTIPVIVVAIKADASVLQIFLISDIVSAAAIPALLLGLVDSLYFLSGLDVIIAGCGGILS 423

Query: 419 XXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
                +I+Y +AK G ELI +   LY+ D+ V GA++ AP+  + F F S  +RL  +WV
Sbjct: 424 VFIFGTIYYGSAKAGGELIAMKT-LYVDDWGVFGAYVAAPVGGLLFLFGSCAIRLAGLWV 482

Query: 479 FTKIRGEEFVFPKKP 493
           F K++G  F    KP
Sbjct: 483 FAKVKGRRFDGLDKP 497



>gi|408392233|gb|EKJ71591.1| hypothetical protein FPSE_08230 [Fusarium pseudograminearum CS3096]
          Length = 522

 Score =  341 bits (875), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 189/488 (38%), Positives = 296/488 (60%), Gaps = 2/488 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV    FL +G    +K + ++K+D+LS  GTQ A  L  N+ AS++GS IL+S+
Sbjct: 9   SNAVIYVTYGAFLIMGTGIAWKMRNQSKADFLSGNGTQTAFPLALNFIASALGSGILFSY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TI+G+ G+++YA  S +P+ +F +LGP+IR++CPEGF LT++  +R+G    +Y+S
Sbjct: 69  PELATISGVQGMMVYALASALPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGIITMLYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
            MS+  +F +M+SELSA+G ++  LTG+D L  +I    +TT+YT  GG R S +TD +Q
Sbjct: 129 FMSMVTLFLYMVSELSAIGQVVQALTGLDPLPVMIVQCAITTIYTSLGGFRISFMTDVVQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I++ +ID S L K N LGWQLLYI+PVAV     F   FW
Sbjct: 189 GTMVIGLVIIAAITIGAKTEIQRPLIDESGLTKPNLLGWQLLYILPVAVLTNDFFLSSFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLF 305
            R F+SK D++LR+     +I++  VL  +G TG+IAVW+G  P  ++     +AFF L 
Sbjct: 249 LRTFASKTDKDLRIGTTIATIVILCVLTLVGSTGLIAVWSGALPLADKAGSGSVAFFVLL 308

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP WV GI +V+ V+MS AA+D+L SA  ++ SND+F N+L +   R + ++  +P +
Sbjct: 309 ETLPSWVVGIVLVMVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAIVVLIIIPVI 368

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 425
              LK   VL+++LI DL++A+T+P +++GL++  Y+    +                 +
Sbjct: 369 AIALKAPSVLQIWLITDLISAATIPVLVIGLVEKFYWWRGFEVVVGGLGGILTVFIFGCV 428

Query: 426 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           +Y NAK+  EL+ +  GLY  D+S  GAF+ AP+ S+ +   +  VR+   +V  K+RG 
Sbjct: 429 YYGNAKEAGELLLVQKGLYGNDWSAFGAFVAAPVGSLLWGCGAMIVRITFQYVHAKVRGH 488

Query: 486 EFVFPKKP 493
            F    +P
Sbjct: 489 HFDALDRP 496



>gi|322709553|gb|EFZ01129.1| urea transporter [Metarhizium anisopliae ARSEF 23]
          Length = 510

 Score =  340 bits (873), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 193/510 (37%), Positives = 304/510 (59%), Gaps = 16/510 (3%)

Query: 8   SNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           SN +IY+    FL  G GI A   + ++K D+LSS GTQ+A           +G+ IL+S
Sbjct: 9   SNAIIYLTYGAFLVLGTGI-AWTMRNQSKQDFLSSNGTQSA-----------LGAGILFS 56

Query: 66  FPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYV 125
           +PE+ TI G+ GVI+YA  S +P+ +F  LGP+IR+KCPEGF LT++  +R+G    +Y+
Sbjct: 57  YPELATITGVQGVIIYALASALPMLIFGALGPIIRRKCPEGFVLTEWTRQRYGTVAMLYL 116

Query: 126 SLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 185
           S M++  +F +M++ELSA+G ++ TLTG+D L  +I   ++TT+YT  GG + S +TD +
Sbjct: 117 SFMTLVTLFLYMVAELSALGQVVSTLTGIDSLPVIIVECVITTIYTSLGGFKISFLTDVV 176

Query: 186 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 245
           QG                   I++ +ID+S LL+ + LGWQLLYI+PVAV     F   F
Sbjct: 177 QGGMVVGLIIIATITVGAKTEIKRELIDSSHLLEPSLLGWQLLYILPVAVLTNDFFLSNF 236

Query: 246 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 305
           W R FSSK+D++L +      +++  +L  +G +G+IA W+G WPGE   E  LAFF L 
Sbjct: 237 WLRTFSSKSDKDLWVGVSVAMVVILCILTLVGCSGLIAAWSGAWPGEPEQEGSLAFFLLL 296

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP WV GI +V+ VS+S AA+D+L SA  ++ SND+F NRL +   R + ++  +P V
Sbjct: 297 QQLPSWVVGIILVMVVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWYIRGMVVLIIIPVV 356

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 425
              L+   +L+++LI+DLL+A+T+P + LGL D LY+    +                +I
Sbjct: 357 VVALRASSILQIYLISDLLSAATIPVLCLGLSDRLYWWRGFEVVVGGLGGILTVFIFGAI 416

Query: 426 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           +Y +A+ G +L+ +  GLY  D+S  GAF+ AP+  I + F +  +RL   ++  ++R E
Sbjct: 417 YYKDAEQGAQLLLIQNGLYANDWSAFGAFVAAPVGGIVWGFGALALRLSFQYIKARLRRE 476

Query: 486 EFVFPKKPEVVDTKKYAGNKFKDDTEIIQS 515
            F    +P  + T+  + ++  D+  I  S
Sbjct: 477 RFDALDRP--LMTRTVSDSEMPDEVVIASS 504



>gi|400595550|gb|EJP63345.1| urea transporter [Beauveria bassiana ARSEF 2860]
          Length = 521

 Score =  340 bits (872), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 192/487 (39%), Positives = 288/487 (59%), Gaps = 1/487 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IY+   +FL +G    +K + + K+D+LSS GTQ A  L  N+ AS++GS IL+S+
Sbjct: 9   SNAIIYLTYGLFLVMGTGIAWKLRNQAKTDFLSSNGTQTAFPLALNFIASALGSGILFSY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ GV++YA  S +P+ VF +LGP+IR++CPEGF LT++  +R+G    +++S
Sbjct: 69  PELATIAGVQGVVVYALASSLPMLVFGYLGPVIRRRCPEGFVLTEWTRQRYGIPGMLFLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           ++++  +F +M++ELSA+G ++ TLTG+D L  VI   IVTT+YT  GG + S +TD IQ
Sbjct: 129 VLTLITLFLYMVAELSAIGQVVSTLTGLDGLPVVIVQCIVTTIYTSLGGFKISFLTDVIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I+  +ID S L K   LGWQLLYI+PVAV     F   FW
Sbjct: 189 GGMVVGLIIIATITIGVKTEIQTELIDASGLTKPTLLGWQLLYILPVAVLTNDFFLSNFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R FSSK D++LR+      +++  VL  +G TG+IA W+G WPG+      LAFF L +
Sbjct: 249 LRTFSSKTDKDLRVGVTMAMVVILCVLTLVGCTGLIAAWSGAWPGDPAQAGSLAFFVLLE 308

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP WV GI +V+ VS+S AA+D+L SA  ++ SND+F NRL +   R   ++  +P V 
Sbjct: 309 RLPGWVVGIVLVMVVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWFIRGFVVLVIIPVVV 368

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             LK   +L++FLI+DL++++ +P + +GL+   +     +                + +
Sbjct: 369 LALKAPSILQIFLISDLVSSAAIPVLCIGLLPQAWVWRGFEFVVGTLGGILTVFIFGACY 428

Query: 427 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 486
           Y +A  G  LI L  GLY  D+SV GAF+ AP   + +  ++   RL   +   KI G  
Sbjct: 429 YKDAYRGARLILLEEGLYAQDWSVFGAFVAAPFGGLVWGCIALACRLTFQYAKAKITGGV 488

Query: 487 FVFPKKP 493
           F    KP
Sbjct: 489 FDALDKP 495



>gi|302919081|ref|XP_003052786.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256733726|gb|EEU47073.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 521

 Score =  340 bits (871), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 191/503 (37%), Positives = 305/503 (60%), Gaps = 6/503 (1%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN ++Y+    FL +G    ++ + ++K D+LS  GTQ A  L  N+ AS++GS+IL+S+
Sbjct: 9   SNAVMYLTYGAFLIVGTGIAWRMRNQSKKDFLSGNGTQTAFPLALNFIASALGSAILFSY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ G+I+Y+F S IP+ +F ++GP+IR++CPEGF LT++  +R+G    +Y+S
Sbjct: 69  PELATIAGVQGMIVYSFSSAIPILMFGYIGPVIRRRCPEGFVLTEWTRQRYGTLTMLYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
            M++  +F +M+SELSA+G ++  LTG+D L  +I   ++TT+YT  GG R S +TD IQ
Sbjct: 129 FMTLVTLFLYMVSELSAIGQVVTALTGLDGLPVMIVQCVITTIYTSLGGFRISFLTDVIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I++S+ID+S LL +N LGWQLLYI PVAV   + F   FW
Sbjct: 189 GAMVIGLVIIATITIGAKTSIDRSLIDSSGLLDANLLGWQLLYIFPVAVVTNSFFLSSFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLF 305
            R F+SK D++L L  +  +I++  VL  +G TG+IA+W+G    +E   S  +AFF L 
Sbjct: 249 LRTFASKTDKDLHLGTIIATIVVLCVLTLVGSTGLIAIWSGALQEDETASSGAIAFFALL 308

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP WV G+ +V+ V++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +
Sbjct: 309 EQLPSWVVGVVLVMVVTLSTAAFDSLQSAMVSSASNDLFRNRLNVWFIRGGVVLIIIPVI 368

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 425
              LK   +L+++LI DL++A+T+P + +GLI S Y+    +                 +
Sbjct: 369 VLALKAPSILQIYLITDLISAATIPVLCIGLIKSCYWWRGFEVVVGGLGGIFTVFLFGLV 428

Query: 426 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           +Y NA++  EL+ +  GLY  D+S  GAF+ AP+    +   +  +RL   +V  K++G 
Sbjct: 429 YYGNAQEAGELLLVQKGLYGNDWSAFGAFVAAPVGGFLWGVGALILRLSVQFVMAKVQGR 488

Query: 486 EFVF---P-KKPEVVDTKKYAGN 504
            F     P ++PE  +T + A N
Sbjct: 489 RFDALDRPLERPESRETDEPAEN 511



>gi|399166435|emb|CCE32710.1| uncharacterized protein CPUR_06574 [Claviceps purpurea 20.1]
          Length = 515

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 178/475 (37%), Positives = 284/475 (59%), Gaps = 6/475 (1%)

Query: 42  GTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRK 101
           G+ +A  + +     S+G+ IL+S+PE+ TIAG+ G+I+YAF S +P+ VF  +GP+IR+
Sbjct: 36  GSTDAANMHTAHARPSLGAGILFSYPELATIAGVQGIIIYAFASALPMLVFGAIGPIIRR 95

Query: 102 KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVI 161
           KCPEGF LT++  +R+G    +Y+S +++  +F +M++ELSA+G ++ TLTG+D L  +I
Sbjct: 96  KCPEGFVLTEWTRQRYGTVTMLYLSFLTLVTLFLYMVAELSALGQVVSTLTGLDSLPAII 155

Query: 162 CIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSN 221
              ++TTLYT  GG + S +TD IQG                   +++ ++D S LL+ +
Sbjct: 156 VECVITTLYTSLGGFKISFLTDTIQGVMVVGLIIVATITVGVKADVKRELVDASHLLEPS 215

Query: 222 SLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGM 281
            LGWQLLYI+PVAV     F   FW R FSS++D++L L     ++++  +L  +G TG+
Sbjct: 216 LLGWQLLYILPVAVLTNDFFLSNFWLRTFSSRSDKDLMLGVSMATVVVLCILTLIGCTGL 275

Query: 282 IAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSN 341
           I+VW+G WP + +    LAFF L + LP WV GI +V+ V++SCAA+D+L SA  ++ SN
Sbjct: 276 ISVWSGAWPLDGSQPGSLAFFLLLEQLPTWVIGIILVMVVALSCAAFDSLQSAMVSSASN 335

Query: 342 DIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 401
           D+F NRL +   R + ++  +P V   L+   +L++FLI+DLL+A+T+P + LGLID LY
Sbjct: 336 DLFRNRLNIWWIRAMVVVIIIPVVIVALRASSILQIFLISDLLSAATIPVLCLGLIDRLY 395

Query: 402 FLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSS 461
           +    +                 I+Y N+ D  +L+ +  GLY  D+S  GAF+  PL  
Sbjct: 396 WWRGFEVVVGGLGGILTIFIFGVIYYGNSYDAGQLLLVKNGLYAKDWSTFGAFVAGPLGG 455

Query: 462 IFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSS 516
           I + F + G+RL   ++  K R E F    +P +  T          D ++++ S
Sbjct: 456 IVWGFGALGLRLSFQYLKAKYRHERFDALDRPAIALTSG------DSDVDVLRQS 504



>gi|350297242|gb|EGZ78219.1| hypothetical protein NEUTE2DRAFT_154667 [Neurospora tetrasperma
           FGSC 2509]
          Length = 564

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 190/531 (35%), Positives = 302/531 (56%), Gaps = 32/531 (6%)

Query: 4   SGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASS----- 57
           S   SN +IY  L IFL +G    +  + ++K D+L+   TQ A+ L  N+ AS      
Sbjct: 5   SSEASNAIIYTTLGIFLIMGTGVAWTMRNQSKGDFLAGNRTQTAIPLALNFIASGDNGIS 64

Query: 58  -----------------------IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAW 94
                                  +GS IL+++PE+ T+AGL GV++YA  S +PLFVFA 
Sbjct: 65  EDREDEPGGDLATCWTTKLRLYPLGSGILFTYPEIATLAGLQGVLVYALASALPLFVFAL 124

Query: 95  LGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGV 154
           LGP+IR+KCPEGF LT++  +R+G    +Y+S +++  +F +M++ELS +G ++  LTG+
Sbjct: 125 LGPIIRRKCPEGFVLTEWTRQRYGTIAALYLSFVTLVTLFLYMVAELSGIGQVVEVLTGL 184

Query: 155 DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN 214
           + L  +I   ++TT+YT  GG R S ITDNIQG                  +I+ S+I+ 
Sbjct: 185 NGLPVLIVECVITTIYTSLGGFRISFITDNIQGAMVIGLLVVASIAIGVETKIDTSLIEP 244

Query: 215 SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLV 274
           S LLK + LGWQLLYI+PVA+     F   FW R F+SK DR+L +     ++ +  ++ 
Sbjct: 245 SGLLKDSLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDRDLWIGITLAALFILIIIT 304

Query: 275 FLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL 331
            +G TG+IA W+G+WPG   E  L   +AFF L + LP WV G  +V++V++S AA+D+L
Sbjct: 305 MIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGLLENLPAWVVGFVLVMSVTLSTAAFDSL 364

Query: 332 ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPP 391
            SA  ++ SND+F N+L +   R   ++  +P V   +K   +L+++LI+DL++A+T+P 
Sbjct: 365 QSAMVSSASNDLFRNKLSVWWIRVAVVLVIIPIVVLAIKAPSILQIYLISDLVSAATIPV 424

Query: 392 ILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVL 451
           +++GL D  Y+    +                +I+Y++A  G +LI L  G+Y   ++  
Sbjct: 425 LIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYNDAYKGAQLILLEDGIYQEGWAAF 484

Query: 452 GAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYA 502
           GAF+ AP+  + + F +  +RL   WV  K +G  F    +P VV++   A
Sbjct: 485 GAFVAAPVGGLLWGFGALALRLAVQWVQAKRKGVRFDALDRPVVVESDSEA 535



>gi|336463537|gb|EGO51777.1| hypothetical protein NEUTE1DRAFT_125428 [Neurospora tetrasperma
           FGSC 2508]
          Length = 564

 Score =  338 bits (866), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 193/551 (35%), Positives = 309/551 (56%), Gaps = 42/551 (7%)

Query: 4   SGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASS----- 57
           S   SN +IY  L +FL +G    +  + ++K D+L+   TQ A+ L  N+ AS      
Sbjct: 5   SSEASNAIIYTTLGVFLIMGTGVAWTMRNQSKGDFLAGNRTQTAIPLALNFIASGDNGIS 64

Query: 58  -----------------------IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAW 94
                                  +GS IL+++PE+ T+AGL GV++YA  S +PLFVFA 
Sbjct: 65  EDREDEQGGDLATCWTTKLRLYPLGSGILFTYPEIATLAGLQGVLVYALASALPLFVFAL 124

Query: 95  LGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGV 154
           LGP+IR+KCPEGF LT++  +R+G    +Y+S +++  +F +M++ELS +G ++  LTG+
Sbjct: 125 LGPIIRRKCPEGFVLTEWTRQRYGTIAALYLSFVTLVTLFLYMVAELSGIGQVVEVLTGL 184

Query: 155 DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN 214
           + L  +I   ++TT+YT  GG R S ITDNIQG                  +I+ S+I+ 
Sbjct: 185 NGLPVLIVECVITTIYTSLGGFRISFITDNIQGAMVIGLLVVASIAIGVETKIDTSLIEP 244

Query: 215 SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLV 274
           S LLK + LGWQLLYI+PVA+     F   FW R F+SK DR+L +     ++ +  ++ 
Sbjct: 245 SGLLKDSLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDRDLWIGITLAALFILIIIT 304

Query: 275 FLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL 331
            +G TG+IA W+G+WPG   E  L   +AFF L + LP WV G  +V++V++S AA+D+L
Sbjct: 305 MIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGLLENLPAWVVGFVLVMSVTLSTAAFDSL 364

Query: 332 ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPP 391
            SA  ++ SND+F N+L +   R   ++  +P V   +K   +L+++LI+DL++A+T+P 
Sbjct: 365 QSAMVSSASNDLFRNKLSVWWIRVAVVLIIIPIVVLAIKAPSILQIYLISDLVSAATIPV 424

Query: 392 ILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVL 451
           +++GL D  Y+    +                +I+Y++A  G +LI L  G+Y   ++  
Sbjct: 425 LIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYNDAYKGAQLILLEDGIYQEGWAAF 484

Query: 452 GAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTE 511
           GAF+ AP+  + + F +  +RL   WV  K +G  F    +P VV++          D+E
Sbjct: 485 GAFVAAPVGGLLWGFGALALRLTVQWVQAKRKGVRFDALDRPVVVES----------DSE 534

Query: 512 IIQSSDPDEIE 522
            IQ     ++E
Sbjct: 535 AIQYVAGGDLE 545



>gi|50423383|ref|XP_460274.1| DEHA2E22396p [Debaryomyces hansenii CBS767]
 gi|49655942|emb|CAG88555.1| DEHA2E22396p [Debaryomyces hansenii CBS767]
          Length = 527

 Score =  338 bits (866), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 195/527 (37%), Positives = 303/527 (57%), Gaps = 12/527 (2%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N +IY+  A  L  GI+  +K TK  S +LSS GTQ  + L  N+ AS++G  I
Sbjct: 4   LSSEGNNAIIYLTYAFLLATGIFIAWKYTKADS-FLSSNGTQRGLPLALNFIASAMGCGI 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++ E+G I+GL G+++Y     IP+  FA+ GP+IRKKCPEGF LT++V  RFG    
Sbjct: 63  LTTYAEIGNISGLHGLLVYTLCGAIPILGFAYFGPIIRKKCPEGFVLTEWVRHRFGVITA 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +   MF FM+ ELSA+   + TLTG+D LA VI   +VT++YT  GG + S +T
Sbjct: 123 LYLSFFTCLTMFLFMVGELSAIRTAIETLTGLDALAAVIVQCVVTSIYTSIGGFKVSFVT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN QG               + I I+KS +  S LLK+N LGWQLLYI+ VA+     F 
Sbjct: 183 DNFQGVFVLLLVIICAAGMGSYIDIDKSKVGESGLLKANKLGWQLLYILFVAILTNDCFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAF 301
            GFW R F+S+ +++L +     S + F +   +G TG +AVWAG L  G+  ++ Y AF
Sbjct: 243 AGFWLRTFASRTNKDLWIGCSIASFVTFVICTLVGTTGFLAVWAGDLVVGD--VDGYNAF 300

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   +P W+    ++  +S+S   +D+L SA  +  SND+F N+L +N TR L ++  
Sbjct: 301 FILLSKMPGWLVAFILIFVISLSTCTFDSLQSAMVSTISNDVFRNKLHINYTRVLVVLIM 360

Query: 362 VPAVYWGLKDL-DVLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXX 419
           +P +   +K   D+L+++LIADL++A+ +P + LGL D+  +FL  +D            
Sbjct: 361 IPIIVLAVKVADDILQIYLIADLVSAAIIPVVFLGLSDTYFWFLRGLDVMCGGLGGLLGV 420

Query: 420 XXXXSIFYHNAKDGIELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
               +++Y +AK+G +L+ +  G+Y   D+   GAF++AP   I   F    +R+   ++
Sbjct: 421 FIFGTVYYGSAKEGGKLLLVWNGIYDDADWGPFGAFVIAPFGGIVICFCVAALRIGVTYI 480

Query: 479 FTKIRGEEFVFPKKP---EVVDTKKYAGNKFKDDTE--IIQSSDPDE 520
           +++I G  FV   KP   E++D+ ++      D TE  I +S D  +
Sbjct: 481 YSRISGSPFVALDKPEPKEIIDSTEFHNGSQYDSTEDNIKKSIDESQ 527



>gi|500255736|gb|EON99074.1| putative urea transporter protein [Togninia minima UCRPA7]
          Length = 515

 Score =  338 bits (866), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 187/488 (38%), Positives = 290/488 (59%), Gaps = 1/488 (0%)

Query: 30  KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPL 89
           + + K ++LS   T+ A  L  N+ A+ +GS IL+S+PE+ TIAG+ GV++YA  S +PL
Sbjct: 17  RGETKEEFLSGNRTRTAFPLALNFIAAGLGSGILFSYPELATIAGVQGVLVYALSSALPL 76

Query: 90  FVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILV 149
            VFA+LGP+IR+KCPEGF LT++  +R+G    +++S +++  +F +M++ELSAVG ++ 
Sbjct: 77  LVFAFLGPIIRRKCPEGFVLTEWTRQRYGIVTALFLSFLTLVTLFLYMVAELSAVGQVVT 136

Query: 150 TLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEK 209
           TLTG+D L  VI   +VTT+YT  GG + S ITDNIQG                   I++
Sbjct: 137 TLTGLDGLPVVIVECVVTTIYTSLGGFQISFITDNIQGALVVGLVIIATITIGVKTDIDQ 196

Query: 210 SVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIML 269
            +ID+S LLK N LGWQLLYI+P+A+     F   FW R F+SK D++LR+     + ++
Sbjct: 197 DLIDSSGLLKGNLLGWQLLYILPIAILTNDFFLSNFWLRTFASKTDKDLRIGVSIATCVI 256

Query: 270 FPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYD 329
             +L  +G+TG++A W+G WPG+   E  +AFF L + LP WV GI +V+ V +S A++D
Sbjct: 257 LVILTLVGMTGVLAAWSGAWPGDPPQEGSIAFFLLLEQLPSWVVGIVLVMVVCLSTASFD 316

Query: 330 TLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTM 389
           +L SA  ++ SND+F NRL +   R   ++  +P V   LK   +L+++LI+DL++A+T+
Sbjct: 317 SLQSAMVSSASNDLFRNRLNIWFIRGAVVLIIIPVVVLALKAPSILQIYLISDLVSAATI 376

Query: 390 PPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYS 449
           P + LGL D LY+    +                +I+Y +A  G +L+ L  GLY  D+ 
Sbjct: 377 PVLCLGLSDRLYWWRGFEIVVGGLGGILTVFIFGTIYYGDALTGAQLMLLEQGLYEGDWG 436

Query: 450 VLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGN-KFKD 508
             GAF+ AP+  + + F    +RL    V  K+ G  F    +P  +   + AG     D
Sbjct: 437 AFGAFVAAPVGGLLWGFGGCALRLAFQLVKAKVTGRRFDALDRPAFLSADEGAGAYGSAD 496

Query: 509 DTEIIQSS 516
           D + +  S
Sbjct: 497 DADALYQS 504



>gi|443898725|dbj|GAC76059.1| hypothetical protein PANT_19d00093 [Pseudozyma antarctica T-34]
          Length = 493

 Score =  337 bits (864), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 177/465 (38%), Positives = 278/465 (59%), Gaps = 4/465 (0%)

Query: 60  SSILYSFPEVGTI--AGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           SS+ + +P++  I  AG+LG+  Y F ++ PL+ F WLGP IR+ CP+GFTL +++  R+
Sbjct: 3   SSLFFGYPQLAVIPNAGILGLTAYCFSTVAPLWAFGWLGPQIRRICPDGFTLAEYIRRRY 62

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +   L+ + +MFCFM+ EL+  G+ +  L GV+     + +A+ TT+YT YGG +
Sbjct: 63  GWPVGVLSGLIFVGFMFCFMLVELNTYGSTVNVLGGVNPTIAALIVALSTTIYTAYGGFK 122

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
           ASL TDN+                  ++ I+ + +++S LLK   LG +L YI+  A+ F
Sbjct: 123 ASLYTDNVNAVIIMIFVVIATIAVGVNLDIDHARVESSGLLKPQRLGGELWYILTAALVF 182

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGE-ENLE 296
           + +F++GFWQRAF+SKN++ L LS ++ ++ LF +   +G+ G +A WAGL+ G     +
Sbjct: 183 SQMFNQGFWQRAFASKNNKTLYLSVIFATVPLFAICFIVGMAGPLAWWAGLFDGPTAEDD 242

Query: 297 SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFL 356
             L FF +   LP+WV+GI +VLA  +S +AYDT  SA  +   ND+F  R+ +   R +
Sbjct: 243 GSLTFFYIINTLPNWVTGIVIVLAGCLSSSAYDTFQSAQISTIQNDVFLGRVNIWWCRAI 302

Query: 357 SLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXX 416
            ++ NVP+V   +K++D+L VFL+ADL A + +P  LLGL+  LYFLN +D         
Sbjct: 303 LVLINVPSVVLAVKNIDILEVFLVADLAAIACIPAFLLGLVPQLYFLNGVDAVGGAVGGF 362

Query: 417 XXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISM 476
                  + FY +A+ GI+L+GLP GLYI D+SVLGAF  APL S+ +TF +FG+R  + 
Sbjct: 363 LTVFLFGTAFYGSAEQGIKLLGLPNGLYIDDFSVLGAFFAAPLGSLGWTFATFGMRAAAT 422

Query: 477 WVFTKIRGEEF-VFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDE 520
           WV+ +  G  F VF  +   V       ++  D   +  S +P++
Sbjct: 423 WVYCRYTGRAFNVFEYREFDVTKWALPEDRPADFHGVHGSGNPND 467



>gi|296414011|ref|XP_002836698.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630533|emb|CAZ80889.1| unnamed protein product [Tuber melanosporum]
          Length = 541

 Score =  337 bits (863), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 198/528 (37%), Positives = 303/528 (57%), Gaps = 28/528 (5%)

Query: 7   VSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFAS--------- 56
           VSN L+Y   AIFL IG+   ++ + ++K +++ S  TQ A+ +  N+ AS         
Sbjct: 8   VSNGLMYTTYAIFLIIGLALAWRYRGQSKLEFIHSNRTQTAIPVALNFIASGECCYRRNG 67

Query: 57  -----------SIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPE 105
                      ++GS+IL+S+PE+GTIAG+ G I YA  S +PL  FA L P +R+K P 
Sbjct: 68  LRHVIGQLGSSAMGSAILFSYPEIGTIAGVQGAITYAACSALPLMSFAILAPKVRRKLPG 127

Query: 106 GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAI 165
           GF LT +V ER+G +  +Y++ +S+A MF +M++ELS++  ++ TLTG++ L  VI   +
Sbjct: 128 GFILTMWVRERYGPYAALYLTFLSLATMFLYMVAELSSLQQVISTLTGLNGLPVVIVEVV 187

Query: 166 VTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGW 225
           VT++YT  GG R S +TDNIQG               TS+ I++S I  S L     LG+
Sbjct: 188 VTSIYTSLGGFRISFLTDNIQGVLIAVLIAICTIAIGTSVEIDRSRIGPSGLTHDTLLGY 247

Query: 226 QLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVW 285
           QL+YI+   + F+ +F   FW RAF+SK D++L +     ++++F +L+ +  TG IA W
Sbjct: 248 QLIYILFTGILFSFMFLSSFWMRAFASKTDKDLWIGVSIAAVVIFVILLLVSSTGFIAAW 307

Query: 286 AGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFN 345
           AG+W  E  +   +AFF L   LP WV G TVV+ V++SCA +D+  SA  +  SND+F 
Sbjct: 308 AGVW--EPGMYGGMAFFLLLAELPSWVVGFTVVMVVALSCAIFDSQQSAMVSTISNDLFK 365

Query: 346 NRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNW 405
           N+L L   RF  L+ ++PA+   LK   +LR+FLI+++ + + MP ILLGL+D++YFL  
Sbjct: 366 NKLSLIWVRFFVLLVSIPAIVVALKSPSILRIFLISNIFSCAAMPSILLGLLDTMYFLRG 425

Query: 406 IDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFT 465
           +D                  +Y +AK   ELI L  GLY  D+SV G F+ AP+ S+ F 
Sbjct: 426 VDIIIAGVGGMLSVFLFGCAYYGDAKKAAELIILTTGLYANDWSVFGVFVAAPVGSLIFL 485

Query: 466 FLSFGVRLISMWVFTKIRGEEF-----VFPKKPEVVDTKKYAGNKFKD 508
            L+   R+  +WV  K++G  F       P++  V +     G   +D
Sbjct: 486 ALAVACRMGGVWVRCKVQGGRFDCLDKPLPREGGVCEGDGTPGGSLED 533



>gi|358384934|gb|EHK22531.1| hypothetical protein TRIVIDRAFT_179853 [Trichoderma virens Gv29-8]
          Length = 510

 Score =  334 bits (857), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 194/508 (38%), Positives = 296/508 (58%), Gaps = 20/508 (3%)

Query: 8   SNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           SN +IYV    FL  G GI    +K  N +D+LS   TQ A  L  N+ AS++GS IL+S
Sbjct: 9   SNAIIYVTYGFFLILGTGIAWRMRKQPN-TDFLSGNRTQTAWPLAFNFIASALGSGILFS 67

Query: 66  FPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYV 125
           +PE+ TIAG+ GV++YA  S +PL +FA+LGP+IR+KCP+GF LT++   R+G    +Y+
Sbjct: 68  YPELATIAGVQGVVVYALASALPLLIFAYLGPMIRRKCPDGFVLTEWTRNRYGTVAMLYL 127

Query: 126 SLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 185
           S M++  +F +M++ELSAVG ++  LTG+D L  +I   +VTT+YT             I
Sbjct: 128 SFMTLVTLFLYMVAELSAVGQVVNALTGLDGLPVIIVECVVTTIYTYV-----------I 176

Query: 186 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 245
           QG                   I + +ID+S L K++ +GWQL+YI+PVAV     F   F
Sbjct: 177 QGAMVVGLIIIATITIGVKAEINRDLIDSSGLTKASLVGWQLVYILPVAVLTNDFFLSNF 236

Query: 246 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 305
           W R FSSK D++L +     ++ +  +L  +G TG+IA W G WPG+ +++  LAFF L 
Sbjct: 237 WLRTFSSKTDKDLWVGISVATVAVLCILTLVGATGLIAAWTGAWPGDSDIDGSLAFFALL 296

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP WV GI +V+ VS+S +A+D+L SA  ++ SND+F N+L + + R L ++  +P V
Sbjct: 297 EQLPSWVVGIVLVMVVSLSVSAFDSLQSAMISSASNDLFRNKLNIWIIRVLVVLVIIPTV 356

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 425
              LK   +L++FLI+DL +A+T+P + LGL D+ Y+    +                +I
Sbjct: 357 VIALKAPSILQIFLISDLASAATIPVLCLGLFDTFYWWRGFEVVVGGLGGILTVFIYGAI 416

Query: 426 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           +Y +AK G ELI L  GLY  D+   GAF+ AP+  I + F++  +RL   +   K+RGE
Sbjct: 417 YYGDAKSGGELILLEQGLYAGDWGAFGAFVAAPVGGIIWGFIALALRLSVQFTQAKMRGE 476

Query: 486 EFVFPKKPEVVDTKKYAGNKFKDDTEII 513
            F    +P      +      +DD +++
Sbjct: 477 RFDGLDRPLATSEVE------EDDAQLV 498



>gi|238882735|gb|EEQ46373.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 521

 Score =  334 bits (856), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 190/526 (36%), Positives = 302/526 (57%), Gaps = 15/526 (2%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N +IY+  A  L  G++  +K + NK D+LSS GTQ  + L  N+ AS++G  I
Sbjct: 4   LSSQGNNAIIYLSYAFMLATGLFLAWKFSSNK-DFLSSNGTQRGIPLALNFVASAMGVGI 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           + ++ ++  IAGL G+++Y     IP+  FA +GP+IR+KCP+GF LT++V  RFG    
Sbjct: 63  ITTYAQIANIAGLHGLLVYTICGAIPIVGFAVVGPVIRRKCPDGFILTEWVRHRFGMVTA 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +   MF FM+ ELSA+ + + TLTG++ L  VI   +VTT+YT +GG R S IT
Sbjct: 123 LYLSAFTCLTMFLFMVGELSAIRSAIETLTGLNALGAVIVECVVTTIYTFFGGFRVSFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN QG               + I I+ S I  S LLK+N LGWQL+YI+ VA+     F 
Sbjct: 183 DNFQGVCVLLLLIICAAGMGSYIEIDTSKIGPSGLLKANKLGWQLVYILFVAIVTNDCFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAF 301
            GFW R F+SK D++L +     + + F +   +G TG +AVW+G L  G+EN   Y AF
Sbjct: 243 SGFWLRTFASKTDKDLWIGTSIAAFVTFAICTLIGTTGFLAVWSGDLTVGDEN--GYDAF 300

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   +P W+    ++  + +S   +D+L SA  +  SND+F N+L +N  R + ++  
Sbjct: 301 FILLSKMPRWLVAFVLIFCIVLSTCTFDSLQSAMVSTISNDVFRNKLHINYVRIMLILIM 360

Query: 362 VPAVYWGLKDLD-VLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXX 419
           VP V   +K  D +L+++LIADL++A+ +P + LGL D+  ++L   D            
Sbjct: 361 VPIVVLAVKVADNILQIYLIADLVSAAIIPSVFLGLADTWFWYLRGFDVMAGGLGALLGV 420

Query: 420 XXXXSIFYHNAKDGIELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
               +++YH+A++G +L+ +  GLY  +D+   GAF++AP+  +  T  S  +R+  ++ 
Sbjct: 421 FIFGTVYYHSAREGGKLLLIWNGLYDSSDWGPFGAFVIAPVGGVIITLASAALRIAVLYA 480

Query: 479 FTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIEIR 524
           ++K+ G+EF    KP  V+ +       +D T    S D DE + +
Sbjct: 481 YSKVTGKEFTALDKPVTVEVEN------QDHTY--GSIDDDESDTK 518



>gi|68489472|ref|XP_711409.1| hypothetical protein CaO19.6656 [Candida albicans SC5314]
 gi|46432709|gb|EAK92179.1| hypothetical protein CaO19.6656 [Candida albicans SC5314]
          Length = 521

 Score =  334 bits (856), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 190/526 (36%), Positives = 302/526 (57%), Gaps = 15/526 (2%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N +IY+  A  L  G++  +K + NK D+LSS GTQ  + L  N+ AS++G  I
Sbjct: 4   LSSQGNNAIIYLSYAFMLATGLFLAWKFSSNK-DFLSSNGTQRGIPLALNFVASAMGVGI 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           + ++ ++  IAGL G+++Y     IP+  FA +GP+IR+KCP+GF LT++V  RFG    
Sbjct: 63  ITTYAQIANIAGLHGLLVYTICGAIPIVGFAVVGPVIRRKCPDGFILTEWVRHRFGMVTA 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +   MF FM+ ELSA+ + + TLTG++ L  VI   +VTT+YT +GG R S IT
Sbjct: 123 LYLSAFTCLTMFLFMVGELSAIRSAIETLTGLNALGAVIVECVVTTIYTFFGGFRVSFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN QG               + I I+ S I  S LLK+N LGWQL+YI+ VA+     F 
Sbjct: 183 DNFQGVCVLLLLIICAAGMGSYIEIDTSKIGPSGLLKANKLGWQLVYILFVAIVTNDCFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAF 301
            GFW R F+SK D++L +     + + F +   +G TG +AVW+G L  G+EN   Y AF
Sbjct: 243 SGFWLRTFASKTDKDLWIGTSIAAFVTFAICTLIGTTGFLAVWSGDLIVGDEN--GYDAF 300

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   +P W+    ++  + +S   +D+L SA  +  SND+F N+L +N  R + ++  
Sbjct: 301 FILLSKMPRWLVAFVLIFCIVLSTCTFDSLQSAMVSTISNDVFRNKLHINYVRIMLILIM 360

Query: 362 VPAVYWGLKDLD-VLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXX 419
           VP V   +K  D +L+++LIADL++A+ +P + LGL D+  ++L   D            
Sbjct: 361 VPIVVLAVKVADNILQIYLIADLVSAAIIPSVFLGLADTWFWYLRGFDVMAGGLGALLGV 420

Query: 420 XXXXSIFYHNAKDGIELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
               +++YH+A++G +L+ +  GLY  +D+   GAF++AP+  +  T  S  +R+  ++ 
Sbjct: 421 FIFGTVYYHSAREGGKLLLIWNGLYDSSDWGPFGAFVIAPVGGVIITLASAALRIAVLYA 480

Query: 479 FTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIEIR 524
           ++K+ G+EF    KP  V+ +       +D T    S D DE + +
Sbjct: 481 YSKVTGKEFTALDKPVTVEVEN------QDHTY--GSIDDDESDTK 518



>gi|326471561|gb|EGD95570.1| hypothetical protein TESG_03046 [Trichophyton tonsurans CBS 112818]
          Length = 509

 Score =  333 bits (853), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 192/516 (37%), Positives = 298/516 (57%), Gaps = 29/516 (5%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL +G+Y  ++ + + K ++LSS GTQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALIYLTYGAFLVVGLYIAWRLRNQTKGEFLSSNGTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ G+++Y   S +PL  FA++GP+IR+K PE F LT++  +R+G    IY+S
Sbjct: 69  PEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           ++++  +F +M++ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+Q
Sbjct: 129 ILTMITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W
Sbjct: 189 GAMVVGLIIIAVITVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG+      +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLE 308

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP+WV GI +V+ V++S AA+D+L SA  +  SND F N+LPL   R   ++  VP V 
Sbjct: 309 KLPNWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDAFRNKLPLIYVRIGVVLCIVPVVV 368

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             L+   VLR+FLI+DL++AS +P ++LGL D +Y+    +                 I 
Sbjct: 369 VALRSPSVLRIFLISDLVSASAIPVLVLGLSDRMYWWTAFEVI---------------IL 413

Query: 427 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 486
             N            GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  
Sbjct: 414 LQN------------GLYANDWSAFGAFVAAPIGGLIFACIALGLRVGYKFVLSKTTGRH 461

Query: 487 FVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 522
           F    +P +  +   AG    D  + I +     I 
Sbjct: 462 FDVFDRP-LPHSHVPAGPMHLDQPDFIATGTDATIR 496



>gi|378730007|gb|EHY56466.1| hypothetical protein HMPREF1120_04548 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 541

 Score =  333 bits (853), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 188/502 (37%), Positives = 287/502 (57%), Gaps = 3/502 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IY   A FL  G+   +  + + K +YL+SL TQ  + L  N+ AS++GS IL+++
Sbjct: 9   SNAIIYTTYAGFLIFGLAVAWTLRHQTKGEYLASLRTQKGIPLALNFIASALGSGILFTY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TIAG+ G+++Y+  S +PL VFA+LGP+IRKKCPEGF LT++  +R+G    +Y+S
Sbjct: 69  PEIATIAGVQGLVVYSLASALPLLVFAYLGPIIRKKCPEGFVLTEWTRQRYGTITGLYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
            +++  +F +M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG R S ITDNIQ
Sbjct: 129 ALTLITIFLYMVAELSALQQIVNALTGLNGLPAVIVECAVTTIYTSLGGFRVSFITDNIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I + +ID S  L ++ LGWQL+YI+ VA+     F  GFW
Sbjct: 189 GGMVVALIIIACITVGVKTDINRDLIDRSGYLDASLLGWQLIYILSVAIITNDFFISGFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R F++K D++L + A   +  +  +L  +G+TG++A WAG+  G+   ES +AFF L  
Sbjct: 249 MRTFAAKTDKDLWIGAGVATGAVAVILTLVGVTGLLAGWAGIL-GDPPEESSIAFFLLLG 307

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP WV GI +V+ + +S AA+D+L SA  +  SND+F N+L     R   +I   P V 
Sbjct: 308 QLPAWVVGIVLVMTICLSTAAFDSLQSAMVSTGSNDLFRNKLNFWFIRAAVVIIIFPVVV 367

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             LK   VL+++LI+DL++AS++P +L+GL D  Y     +                 ++
Sbjct: 368 VALKSPSVLQIYLISDLISASSIPCLLIGLSDRFYVWRGFEVVVGGLGGIVTVFLFGLVY 427

Query: 427 YHNAKDGI-ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           YH  +     LI L  GLY  D+S  GAF+ AP+    ++  +F +R+   W   K +G 
Sbjct: 428 YHGDRQAAGNLILLEQGLYGNDWSAFGAFVAAPVGGFLWSLGAFALRIAIQWSMAKYKGT 487

Query: 486 EFVFPKKPEVVDTKKYAGNKFK 507
            F    KP       Y G++ +
Sbjct: 488 RFDAFDKPAAPSAAFYTGDQIR 509



>gi|239613852|gb|EEQ90839.1| urea transporter [Ajellomyces dermatitidis ER-3]
 gi|327349966|gb|EGE78823.1| urea transporter [Ajellomyces dermatitidis ATCC 18188]
          Length = 520

 Score =  332 bits (852), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 170/432 (39%), Positives = 263/432 (60%)

Query: 56  SSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLE 115
             +GS IL+++PE+ TIAG+ G+I+Y   S +PL VF +LGP+IR+KCPEGF LT++  +
Sbjct: 23  QGLGSGILFTYPEIATIAGVQGLIVYGLASSLPLLVFGYLGPIIRRKCPEGFVLTEWARQ 82

Query: 116 RFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGG 175
           R+G     Y+SL+++  +F +M++ELSA+  I+  LTG+D L  VI    VTT+YT  GG
Sbjct: 83  RYGIVAATYLSLLTLITLFLYMVAELSALQQIITALTGLDGLPVVIVEVAVTTIYTSLGG 142

Query: 176 LRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAV 235
            + S +TDN+QG               T + I+++++++S  L+ + LGWQL+YI+P+A+
Sbjct: 143 FKVSFVTDNLQGAMVVGLIIIAVITVGTEVNIDRALVESSGFLEPSLLGWQLIYILPIAI 202

Query: 236 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENL 295
                F   FW R F+SK DR+LR+     S  +F +L  +G++G++A W+G WPG+   
Sbjct: 203 LTNDFFLSNFWLRTFASKTDRDLRIGVSIASGAIFCILTLVGVSGLLAAWSGAWPGDPPQ 262

Query: 296 ESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRF 355
              +AFF L + LP WV GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R 
Sbjct: 263 LGSIAFFLLLEKLPAWVVGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRI 322

Query: 356 LSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXX 415
           L ++  +P +   L    VL++FLI+DL++AS++P ++ GL D +Y+    +        
Sbjct: 323 LVVLCIIPVIVVALMSPSVLQIFLISDLVSASSIPVLVFGLWDKVYWWTGFEVVVGGLGG 382

Query: 416 XXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLIS 475
                   +I+Y +A  G +LI L  GLY  D+SV GAF+ APL  I F   +  +RL  
Sbjct: 383 IFSVFIFGTIYYGDAHAGAKLILLENGLYAKDWSVFGAFLAAPLGGILFAIAALILRLGY 442

Query: 476 MWVFTKIRGEEF 487
            ++  K +   F
Sbjct: 443 HYLLAKSQHRRF 454



>gi|451852092|gb|EMD65387.1| hypothetical protein COCSADRAFT_35445 [Bipolaris sorokiniana
           ND90Pr]
          Length = 530

 Score =  332 bits (852), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 181/517 (35%), Positives = 296/517 (57%), Gaps = 2/517 (0%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           M S   SN +IY+ L  FL +G +  ++ + ++K+++LSS  TQ  + L  N+ AS++GS
Sbjct: 3   MPSQPASNAIIYLTLGAFLVLGCFIAWRLRHQSKTEWLSSNRTQKGIPLAFNFIASALGS 62

Query: 61  SILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRF 120
            IL+++P++ TIAG+ G+++YA  S +PL VF  LGP+IR+KCPEGF LT++  +R+G  
Sbjct: 63  GILFTYPQIATIAGIQGLLIYALSSSLPLLVFGALGPIIRRKCPEGFVLTEWTRQRYGAV 122

Query: 121 NQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 180
             I++SL ++  MF +M++ELSA+  I+  LTG++ L  VI    +TT+YT  GG + S 
Sbjct: 123 AGIFLSLCTLITMFLYMVAELSALQQIVTLLTGLNGLPVVIVECAITTIYTSLGGFKVSF 182

Query: 181 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATL 240
           +TDNIQG                   I++S+ID S  LK + LGWQL+YI+PVA+     
Sbjct: 183 VTDNIQGAMVIGLIILGVIAVGVETDIDRSLIDQSGYLKPSLLGWQLIYILPVAILTNDF 242

Query: 241 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLA 300
           F  GFW R F+S+ D++L +     S+ +  +L  LG+ GM+A W+G +   +     LA
Sbjct: 243 FLSGFWMRTFASRTDKDLWIGVSLASMGILIILTLLGVGGMLAAWSGAYTIGDEANGSLA 302

Query: 301 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIA 360
           FF L + LP WV G+ +V+ +S+S AA+D+  SA  +  SND F N+L + V R   +  
Sbjct: 303 FFLLLEKLPAWVVGVVLVMTISLSTAAFDSFQSAMISTGSNDFFRNKLNIWVIRAFVVAL 362

Query: 361 NVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXX 420
             P V   L+  D+L++FLI+DL++A+ +P +++GL +  Y+    D             
Sbjct: 363 IFPVVVVALRSPDILQIFLISDLVSAAVVPCLVIGLSERFYWYRGFDFVVGGLGGIFTIF 422

Query: 421 XXXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 479
               ++Y  +A    +L+ L  GLY  D+S  GAF+ AP+  + + F +  +R+  +W  
Sbjct: 423 LFGLVYYDGDATLASKLLLLEGGLYANDWSAFGAFVAAPVGGLLWAFGACALRISFLWAK 482

Query: 480 TKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSS 516
            +++G  F    +P      +       D   +++ S
Sbjct: 483 ARVQGRRFDAFDRPIPRSFDRPGAFDNHDSDAVLEDS 519



>gi|451997584|gb|EMD90049.1| hypothetical protein COCHEDRAFT_1022148 [Bipolaris maydis C5]
 gi|477592667|gb|ENI09737.1| hypothetical protein COCC4DRAFT_29696 [Bipolaris maydis ATCC 48331]
          Length = 530

 Score =  332 bits (851), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 183/517 (35%), Positives = 298/517 (57%), Gaps = 2/517 (0%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           M S   SN +IY+ L  FL +G +  ++ + ++K+++LSS  TQ  + L  N+ AS++GS
Sbjct: 3   MPSQPASNAIIYLTLGSFLVLGCFIAWRLRHQSKTEWLSSNRTQKGIPLAFNFIASALGS 62

Query: 61  SILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRF 120
            IL+++P++ TIAG+ G+++YA  S +PL +F  LGP+IR+KCPEGF LT++  +R+G  
Sbjct: 63  GILFTYPQIATIAGVQGLLVYALSSSLPLLIFGALGPIIRRKCPEGFVLTEWTRQRYGAV 122

Query: 121 NQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 180
             I++SL ++  MF +M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S 
Sbjct: 123 AGIFLSLCTLITMFLYMVAELSALQQIVNLLTGLNGLPVVIVECAVTTIYTSLGGFKVSF 182

Query: 181 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATL 240
           +TDNIQG                   I++S+ID S  LK + LGWQL+YI+PVA+     
Sbjct: 183 VTDNIQGAMVSGLIILGVIAVGVETDIDRSLIDQSGYLKPSLLGWQLIYILPVAILTNDF 242

Query: 241 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLA 300
           F  GFW R F+S+ D++L +     ++ +  +L  LG+ GM+A W+G +   +   S LA
Sbjct: 243 FLSGFWMRTFASRTDKDLWIGVSLATMGILIILTLLGVGGMLAAWSGAYTIGDEANSSLA 302

Query: 301 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIA 360
           FF L + LP WV G+ +V+ VS+S AA+D+  SA  +  SND F N+L + V R   +  
Sbjct: 303 FFLLLEKLPAWVVGVILVMTVSLSTAAFDSFQSAMISTASNDFFRNKLNIWVIRAFVVAI 362

Query: 361 NVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXX 420
             P V   L+  D+L++FLI+DL++A+ +P +++GL +  Y+    D             
Sbjct: 363 IFPVVVVALRSPDILQIFLISDLVSAAVVPCLVIGLSERFYWYRGFDFVVGGLGGIFTIF 422

Query: 421 XXXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 479
               ++Y  +A    +L+ L  GLY  D+S  GAF+ AP+  + + F +  +R+  +W  
Sbjct: 423 LFGLVYYDGDATLASKLLLLEGGLYANDWSAFGAFVAAPVGGLLWAFGACALRISFLWAK 482

Query: 480 TKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSS 516
            +I+G  F    +P      +       D   ++++S
Sbjct: 483 ARIQGRRFDAFDRPIPQSFDRPGAFDNHDSDAVLENS 519



>gi|241955795|ref|XP_002420618.1| urea transporter, putative; urea/polyamine transporter, putative
           [Candida dubliniensis CD36]
 gi|223643960|emb|CAX41700.1| urea transporter, putative [Candida dubliniensis CD36]
          Length = 523

 Score =  330 bits (847), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 187/523 (35%), Positives = 298/523 (56%), Gaps = 8/523 (1%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N +IY+  A  L  G++  +K + NK D+LSS GTQ  + L  N+ AS++G  I
Sbjct: 4   LSSQGNNAIIYLSYAFMLATGLFLAWKFSSNK-DFLSSNGTQRGIPLALNFIASAMGVGI 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           + ++ ++  IAGL G+++Y     IP+  FA +GP+IR+KCP+GF LT++V  RFG    
Sbjct: 63  ITTYAQIANIAGLHGLLVYTICGAIPIVGFALVGPIIRRKCPDGFILTEWVRHRFGMVTA 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +   MF FM+ ELSA+ + + TLTG++ L  VI   +VTT+YT +GG R S IT
Sbjct: 123 LYLSAFTCLTMFLFMVGELSALRSAVETLTGLNALGAVIVECVVTTIYTFFGGFRVSFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN QG               + I I+ S I  S LLK+N LGWQL+YI+ VA+     F 
Sbjct: 183 DNFQGVCVLLLLIICAAGMGSYIEIDTSKIGPSGLLKANKLGWQLIYILFVAIVTNDCFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAF 301
            GFW R F+SK D++L +     + + F +   +G TG +AVW+G L  G+EN   Y AF
Sbjct: 243 SGFWLRTFASKTDKDLWIGTSIAAFVTFAICTLIGTTGFLAVWSGDLTVGDEN--GYDAF 300

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   +P W+    ++  + +S   +D+L SA  +  SND+F N+L +N  R + ++  
Sbjct: 301 FILLSKMPRWLVAFVLIFCIVLSTCTFDSLQSAMVSTISNDVFRNKLHINYVRIMLVLIM 360

Query: 362 VPAVYWGLKDL-DVLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXX 419
           VP V   +K   ++L+++LIADL++A+ +P + LGL DS  ++L   D            
Sbjct: 361 VPIVVLAVKVANNILQIYLIADLVSAAIIPSVFLGLADSWFWYLRGFDVMAGGLGALVGV 420

Query: 420 XXXXSIFYHNAKDGIELIGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
               +++YH+A++G +L+ +  GLY  +D+   GAF++AP+  +  T  S  +R+  ++ 
Sbjct: 421 FIFGTVYYHSAREGGKLLLIWNGLYDPSDWGAFGAFVIAPVGGVVITLASAALRIAVLYA 480

Query: 479 FTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEI 521
           ++K+ G EF    KP  V+       K+    +    SD  ++
Sbjct: 481 YSKVTGGEFTALDKPIAVEVDN-EDQKYGSIDDDDDESDTKKV 522



>gi|389637038|ref|XP_003716160.1| urea transporter [Magnaporthe oryzae 70-15]
 gi|351641979|gb|EHA49841.1| urea transporter [Magnaporthe oryzae 70-15]
          Length = 511

 Score =  330 bits (847), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 179/467 (38%), Positives = 274/467 (58%), Gaps = 3/467 (0%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           IGS IL+S+P++ TI G+ GV++YA  S +PL +FA LGP IR KCPEGF LT++  ER+
Sbjct: 34  IGSGILFSYPQLATITGVQGVVVYALSSALPLLIFAALGPKIRNKCPEGFVLTEWTRERY 93

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G+   +Y+S MS+  +F +M++ELSA+G ++ TLT ++ L  +I   IVTT YT  GG +
Sbjct: 94  GKVTALYLSFMSLVTLFLYMVAELSAIGQVISTLTTMNPLPVMIVQCIVTTAYTSMGGFK 153

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S +TDN+QG                  RI+ ++ID+S L K   LGWQLLYI+PVA+  
Sbjct: 154 ISFLTDNVQGAMVLGLILIATIAIGVETRIDLALIDSSGLTKPTLLGWQLLYILPVAILT 213

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES 297
              F   FW R F+SK D++L +     +  +  +L  +G+TG++AVW+G WPG +N + 
Sbjct: 214 NDFFLSSFWLRTFASKTDKDLWIGISLATGAILCILTLVGVTGLVAVWSGAWPGPDNADG 273

Query: 298 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 357
            +AFF L + LP+WV G+ +++AV++S AA+D+L SA  ++ SND+F NRL +   R   
Sbjct: 274 SVAFFMLLQQLPNWVVGMVLLMAVTLSTAAFDSLQSAMVSSASNDLFRNRLGVWPIRAAV 333

Query: 358 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXX 415
           ++  +P +   L+   +L+++LI+DL++AST+P ++LGL D  YF  W   D        
Sbjct: 334 VLVMIPVIVIALRAPSILQIYLISDLVSASTIPVLVLGLSDH-YFYWWRGFDVVCGGLGG 392

Query: 416 XXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLIS 475
                   + +Y +A+ G ELI L  GLY  D+ V GAF+ AP   + F FL+   R+  
Sbjct: 393 ILSVFIFGTAYYGSAQAGGELILLQQGLYTGDWGVFGAFVAAPAGGLIFAFLAMLGRVGF 452

Query: 476 MWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 522
           ++V  K+ G  F    +P              +D E+ +     E E
Sbjct: 453 LFVRAKMIGAPFTAFDRPMAEVALPARAEPEYEDGELREEDSITEQE 499



>gi|164429597|ref|XP_964341.2| hypothetical protein NCU11204 [Neurospora crassa OR74A]
 gi|157073543|gb|EAA35105.2| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 542

 Score =  328 bits (842), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 187/534 (35%), Positives = 301/534 (56%), Gaps = 42/534 (7%)

Query: 20  LGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASS---------------------- 57
           +G G+ A   + ++K D+L+   TQ A+ L  N+ AS                       
Sbjct: 1   MGTGV-AWTMRNQSKGDFLAGNRTQTAIPLALNFIASGEYGISEDREDEHRGDLATCWTT 59

Query: 58  ------IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQ 111
                 +GS IL+++PE+ T+AGL GV++YA  S +PLFVFA LGP+IR+KCPEGF LT+
Sbjct: 60  KLRLYPLGSGILFTYPEIATLAGLQGVLVYALASALPLFVFALLGPIIRRKCPEGFVLTE 119

Query: 112 FVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYT 171
           +  +R+G    +Y+S +++  +F +M++ELS +G ++  LTG++ L  +I   ++TT+YT
Sbjct: 120 WTRQRYGTIAALYLSFVTLVTLFLYMVAELSGIGQVVEVLTGLNGLPVLIVECVITTIYT 179

Query: 172 GYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIM 231
             GG R S ITDNIQG                  +I+ S+I+ S LLK + LGWQLLYI+
Sbjct: 180 SLGGFRISFITDNIQGAMVIGLLVVASIAIGVETKIDTSLIEPSGLLKDSLLGWQLLYIL 239

Query: 232 PVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
           PVA+     F   FW R F+SK DR+L +     ++ +  ++  +G TG+IA W+G+WPG
Sbjct: 240 PVAILTNDFFLSSFWLRTFASKTDRDLWIGITLAALFILIIITMIGCTGLIAAWSGVWPG 299

Query: 292 ---EENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL 348
              E  L   +AFF L + LP WV G  +V++V++S AA+D+L SA  ++ SND+F N+L
Sbjct: 300 SDPENPLPGSVAFFGLLENLPAWVVGFVLVMSVTLSTAAFDSLQSAMVSSASNDLFRNKL 359

Query: 349 PLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDX 408
            +   R   ++  +P V   +K   +L+++LI+DL++A+T+P +++GL D  Y+    + 
Sbjct: 360 SVWWIRVAVVLIIIPIVVLAIKAPSILQIYLISDLVSAATIPVLIVGLSDRCYWWRGFEV 419

Query: 409 XXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLS 468
                          +I+Y++A  G +LI L  G+Y   ++  GAF+ AP+  + + F +
Sbjct: 420 VVGGLGGIFTVFIFGAIYYNDAYKGAQLILLEDGIYQEGWAAFGAFVAAPVGGLLWGFGA 479

Query: 469 FGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 522
             +RL   WV  K +G  F    +P VV++          D+E IQ     ++E
Sbjct: 480 LALRLAVQWVQAKRKGVRFDALDRPVVVES----------DSEAIQYVAGGDLE 523



>gi|171676089|ref|XP_001902998.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936110|emb|CAP60770.1| unnamed protein product [Podospora anserina S mat+]
          Length = 504

 Score =  327 bits (838), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 177/462 (38%), Positives = 275/462 (59%), Gaps = 6/462 (1%)

Query: 57  SIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLER 116
           ++GS+IL+++P++ TI+G+ GVI+YA  S +PLF FAWLGP+IRKKCP+GF LT++  +R
Sbjct: 20  ALGSAILFAYPQLATISGVQGVIVYALSSALPLFAFAWLGPIIRKKCPQGFVLTEWTRQR 79

Query: 117 FGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGL 176
           +G    +++S M++  +F +M+SELSAVG ++  L G+D L  +I   I+TT+YT  GG 
Sbjct: 80  YGDAAALFLSFMTLVTLFLYMVSELSAVGQVVNMLAGIDGLPVLIVECIITTIYTSLGGF 139

Query: 177 RASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVS 236
           + S  TDNIQG                  +I+ S+I+ S LLK N LGWQL+YI+PVA+ 
Sbjct: 140 KISFFTDNIQGTMVMALVVIATISIGVETKIDTSLIEESGLLKGNLLGWQLVYILPVALL 199

Query: 237 FATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EE 293
             + F   FW R F+SK DR+L        + +  + V +G TG++AVWAGL PG   E 
Sbjct: 200 TNSFFLSHFWLRTFASKTDRDLWTGISLAVVAILVIFVLVGCTGLVAVWAGLVPGDDLEN 259

Query: 294 NLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVT 353
            ++  +AFF L + LP+WV GI +V++V++S AA+D+  +A   + SND+F NRL +   
Sbjct: 260 PVDGGIAFFALLQQLPNWVVGIVIVMSVTLSTAAFDSFQTAMVTSASNDLFRNRLNIWWI 319

Query: 354 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXX 413
           R   ++  VP V   ++   +L+++LI DL++A+T+P + LGL +  YF    +      
Sbjct: 320 RAGVVVIMVPVVVIAIRAPSILQIYLITDLVSAATIPVLCLGLSEKFYFWRGFEVVVGGL 379

Query: 414 XXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRL 473
                      ++Y +A+ G EL+ L  GL+  D+   GAF+ AP+  I + F + G+RL
Sbjct: 380 GGLFTVFLFGLVYYQDAQKGAELLLLQQGLFTGDWGCFGAFVAAPVGGILWGFGALGLRL 439

Query: 474 ISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQS 515
              +   K +G  F    KP VVD  +    +   DT+ + S
Sbjct: 440 SIQYFSAKRKGVRFDALDKPFVVDGGQ---QQLVGDTQHVDS 478



>gi|512203105|gb|EPE31930.1| hypothetical protein GLAREA_12012 [Glarea lozoyensis ATCC 20868]
          Length = 488

 Score =  325 bits (834), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 179/461 (38%), Positives = 276/461 (59%), Gaps = 1/461 (0%)

Query: 53  WFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQF 112
           + ++++GS IL+++P++ TI G+ GV++YA  S  PL +FAWLGP+IR KCP GF LT++
Sbjct: 10  YHSTALGSGILFAYPQLATITGVQGVVVYAVSSAAPLLIFAWLGPIIRSKCPGGFVLTEW 69

Query: 113 VLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTG 172
             +R+G    +Y+S +S+A MF +M++ELSA+  I+  LTG+D L  VI   +V T+YT 
Sbjct: 70  TRQRYGVVAALYISFLSMATMFLYMVAELSALQQIMTALTGMDGLPMVIVQCVVATIYTS 129

Query: 173 YGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMP 232
            GG + S ITDNIQG                   I+ S+ID+S L +++ LGWQLLYI+P
Sbjct: 130 LGGFKISFITDNIQGAMVVCLIIIATITIGVKTDIDTSLIDSSGLTQASLLGWQLLYILP 189

Query: 233 VAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPG 291
           VAV     F   FW RAF+SK D++L +     ++++  +L  +G TG+IAVW+G L P 
Sbjct: 190 VAVLTNDFFLSNFWIRAFASKTDKDLWIGISIAAVVVLIILTLIGCTGLIAVWSGALGPD 249

Query: 292 EENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLN 351
           +      +AFF L + LP WV GI +V+ VS+S AA+D+  SA  +  SND+F N+L + 
Sbjct: 250 DIESSGSIAFFLLLERLPAWVVGIVLVMVVSLSTAAFDSFQSAMVSMGSNDLFRNKLNIW 309

Query: 352 VTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXX 411
             R   ++  VP +   LK   +L+++LI+DL +AS++P ++LGL D  Y+    +    
Sbjct: 310 FIRAAVVLLIVPVIILALKAPSILQIYLISDLFSASSIPVLILGLSDRFYWWRGFEVVVG 369

Query: 412 XXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGV 471
                       +I+Y NA+ G +LI L  GLY  D+SV GAF+ AP+  + + F +F V
Sbjct: 370 GLGGIITVFIFGTIYYGNAQAGADLILLEGGLYANDWSVFGAFVAAPVGGLLWGFGAFVV 429

Query: 472 RLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEI 512
           R+   ++F KI G  F    +P  ++ +     ++ D  EI
Sbjct: 430 RIAFQFIFAKITGRHFGALDRPAYLNRRVMGAPEYADSDEI 470



>gi|340975607|gb|EGS22722.1| hypothetical protein CTHT_0011960 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 557

 Score =  325 bits (833), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 184/552 (33%), Positives = 307/552 (55%), Gaps = 40/552 (7%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFAS---------- 56
           SN LIY     FL +G    ++ + ++K ++L+   TQ A+ L  N+ AS          
Sbjct: 9   SNALIYSTYGAFLIVGTGVAWRFRNQSKGEFLAGNRTQTALPLALNFIASGSYPDLIDTP 68

Query: 57  ---------------------SIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
                                ++GS IL+++P++GT+AG+ GV++YA  S +PL  FA L
Sbjct: 69  PLRFPCLLRDLAFCFLQWQRQTLGSGILFAYPQLGTLAGVQGVVVYALASGLPLLAFATL 128

Query: 96  GPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVD 155
           GP+IR+KCP+GF LT++  +R+G    +Y+S M++  +F +M+SELSA+G ++  LTG+D
Sbjct: 129 GPIIRRKCPQGFVLTEWTRQRYGTITALYLSFMTLVTLFLYMVSELSAIGQVVNLLTGLD 188

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 215
            L  +I   +VTT+YT  GG + S  TDNIQG                  +I+  +I++S
Sbjct: 189 GLPVLIVECLVTTIYTSLGGFKISFFTDNIQGAMVLGLIIIATITIGVETKIDTGLIESS 248

Query: 216 DLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVF 275
            L K N LGWQLLYI+PVA+     F   FW R F+SK DR+L L      + +  ++  
Sbjct: 249 GLTKGNLLGWQLLYILPVAILTNDFFLSQFWLRTFASKTDRDLWLGISAAVVAIIIIVTL 308

Query: 276 LGLTGMIAVWAGLWPGEEN--LESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLIS 333
           +G TG+IA W+G+WPG  +  ++  +AFF L + LP WV GI +V++V++S AA+D+  S
Sbjct: 309 VGSTGLIAAWSGVWPGPPDNPVDGSVAFFALLQQLPSWVVGIVLVMSVTLSTAAFDSFQS 368

Query: 334 ATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPIL 393
           A   + S D+F N+L +   R   ++  +P V   ++   +L+++LI+DL++A+T+P ++
Sbjct: 369 AMVTSASTDLFRNKLSIWWIRAGVVLTMIPVVVIAIRAPSILQIYLISDLVSAATIPVLI 428

Query: 394 LGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGA 453
           LGL D+ Y+    +                +++Y + K G EL+ L  GL+  D+   GA
Sbjct: 429 LGLSDACYWWRGFEVVVGGLGGLFTVFLFGTVYYGDVKSGAELMLLQQGLFTGDWGCFGA 488

Query: 454 FIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEII 513
           F+ AP+  + + F +  +RL   +   K++G+ F    +P  +D +   G+ ++ ++   
Sbjct: 489 FVAAPIGGLLWGFGALALRLGIQYTRAKLQGKRFDSLDRPVSLDEE---GHGWETESS-- 543

Query: 514 QSSDPDEIEIRG 525
            S +P   E  G
Sbjct: 544 -SDNPGIAETTG 554



>gi|367021828|ref|XP_003660199.1| hypothetical protein MYCTH_2298205 [Myceliophthora thermophila ATCC
           42464]
 gi|347007466|gb|AEO54954.1| hypothetical protein MYCTH_2298205 [Myceliophthora thermophila ATCC
           42464]
          Length = 542

 Score =  325 bits (832), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 177/470 (37%), Positives = 284/470 (60%), Gaps = 10/470 (2%)

Query: 56  SSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLE 115
            ++GS IL+++P++ T+AG+ GV++YA  S +PL  FA LGP+IR+KCP+GF LT++  +
Sbjct: 63  QALGSGILFTYPQLATLAGVQGVVVYALASALPLLSFAALGPIIRRKCPQGFVLTEWTRQ 122

Query: 116 RFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGG 175
           R+G    +Y+S M++  +F +MISELSA+G ++  LTG+D L  +I   ++TT+YT  GG
Sbjct: 123 RYGTLAALYLSFMTLVTLFLYMISELSAIGQVVNLLTGIDGLPVLIVECVITTIYTSVGG 182

Query: 176 LRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAV 235
            + S  TDNIQG                  +I+ S+I++S L K++ LGWQLLYI+PVA+
Sbjct: 183 FKVSFFTDNIQGAMVLGLILIATITIGVETKIDTSLIESSGLTKASLLGWQLLYILPVAI 242

Query: 236 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN- 294
                F   FW R FS+K DR+L L      +    ++  +G TG+IA WAG+WPG E+ 
Sbjct: 243 LTNDFFLSNFWLRTFSAKTDRDLWLGITGAVVATLVIITLVGSTGLIAAWAGVWPGPEDA 302

Query: 295 -LESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVT 353
            ++  +AFF L   LP+WV G+ VV++V++S AA+D+L SA   + SND+F NRL +   
Sbjct: 303 PVDGSVAFFALLTQLPNWVVGVVVVMSVTLSTAAFDSLQSAMVTSASNDLFRNRLNIWWI 362

Query: 354 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXX 413
           R   ++  +P V   ++   +L+++LI+DL++A+T+P +++GL D+ Y+    +      
Sbjct: 363 RAGVVLIMIPVVVIAIRAPSILQIYLISDLVSAATIPVLVIGLSDACYWWRGFEVVVGGL 422

Query: 414 XXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRL 473
                     +++Y +A+ G EL+ L  GLY  D+   GAF+ AP+  + + F + G+RL
Sbjct: 423 GGLFTVFLFGTVYYGDAQLGAELMLLEQGLYTADWGAFGAFVAAPVGGLLWGFGALGLRL 482

Query: 474 ISMWVFTKIRGEEF------VFPKKPEVVDTKKYAGNKFKDDTEIIQSSD 517
              +V  ++RG+ F      V    P++VD +        D+TEI  SSD
Sbjct: 483 GIQYVSARLRGQRFDALDRPVAVSGPQLVDPEAGRDGGTWDNTEI--SSD 530



>gi|477525718|gb|ENH77590.1| urea transporter [Colletotrichum orbiculare MAFF 240422]
          Length = 527

 Score =  323 bits (829), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 193/524 (36%), Positives = 295/524 (56%), Gaps = 13/524 (2%)

Query: 4   SGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           S   SN +IYV   +FL  G    +K + ++K ++LS+L       L  N+ AS++GS I
Sbjct: 5   SAAASNAIIYVTYGLFLISGTAIAWKFRNQSKGEFLSAL------PLALNFIASALGSGI 58

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L+S+PE+ TI G+ GV++YA  S +PL +FA LGP+IR+K PEGF LT +  +R+G    
Sbjct: 59  LFSYPELATITGIQGVLVYALSSSLPLLIFAVLGPIIRRKTPEGFVLTAWTRQRYGTVAM 118

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
            Y+S M++  +F +M++ELSA+G ++ TLT +D L  +I   I+TT+YT  GG R S IT
Sbjct: 119 FYLSFMTLVTLFLYMVAELSAIGQVVNTLTSLDGLPVMIVQCIITTIYTSLGGFRISFIT 178

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN+QG                   I+ S+I+ S  LK   LGWQLLYI+P+ +     F 
Sbjct: 179 DNLQGAMVVCLIVIVAVTMGVKAEIDTSLIETSGYLKPTLLGWQLLYILPICILTNDFFL 238

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAF 301
            GFW R F+SK D++LR+      +++  +L  +G+TG +AVW+G  P +   ES  +AF
Sbjct: 239 SGFWLRTFASKTDKDLRIGVSVAVVIILCILTMVGVTGCVAVWSGALPLDGVAESGSVAF 298

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   LP WV GI +V+  ++S AA+DTL SA  ++ SND+F NRL +   R   ++  
Sbjct: 299 FLLLNQLPAWVVGIVLVMVCTLSTAAFDTLQSAMVSSASNDLFRNRLNIWWIRAGVVVII 358

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXX 421
           +P V   LK   +L+++LI+DL++AS +P ++ GL D  Y+    +              
Sbjct: 359 IPTVIIALKAPSILQIYLISDLVSASVIPVLVFGLTDRFYWWRGFEVVVGGLGGLLTVFI 418

Query: 422 XXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFT 480
              I+Y  + +    L+ +  GLY  D+SV GAF+ AP+ S  + F   G RL   +   
Sbjct: 419 FGIIYYDGDTQKAGNLLIISEGLYANDWSVFGAFVAAPVGSFLWGFAGLGCRLAFQYAMA 478

Query: 481 KIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSD-PDEIEI 523
           K  G  F    +P  VDT  YA +      ++ + +D   ++EI
Sbjct: 479 KKNGRRFDALDRP--VDT-PYAPDGVPRQVDVDEYADVTSDVEI 519



>gi|330917930|ref|XP_003298017.1| hypothetical protein PTT_08598 [Pyrenophora teres f. teres 0-1]
 gi|311328989|gb|EFQ93864.1| hypothetical protein PTT_08598 [Pyrenophora teres f. teres 0-1]
          Length = 524

 Score =  322 bits (826), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 177/507 (34%), Positives = 294/507 (57%), Gaps = 2/507 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IY+ L  FL +G +  +K + ++KS++LSS  TQ  V L  N+ AS++GS IL+++
Sbjct: 9   SNAIIYLTLGAFLVLGCFVAWKLRHQSKSEWLSSNRTQKGVPLAFNFIASALGSGILFTY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           P++  IAG+ G+++YA  S +PL VF  LGP+IR+KCPEGF LT++  +R+G    +++S
Sbjct: 69  PQIAIIAGVQGLLVYALSSALPLLVFGALGPIIRRKCPEGFVLTEWTRQRYGAVAGLFLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           + ++  MF +M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQ
Sbjct: 129 VCTLITMFLYMVAELSALQQIISLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFVTDNIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                  +I++S+ID S  L+ + LGWQL+YI+PVA+     F  GFW
Sbjct: 189 GIMVIGLIIMGVIAVGVETKIDRSLIDKSGYLEPSLLGWQLIYILPVAIMTNDFFLSGFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            R F+++ D++L +     S  +  +L  LG+ GM+A W+G +   +     LAFF L +
Sbjct: 249 MRTFAARTDKDLWIGVSLASGGVLIILTLLGVGGMLAAWSGAYTIGDEANRSLAFFLLLE 308

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP WV G+ +V+ +S+S AA+D+  SA  +  SND F N+L + + R   +    P V 
Sbjct: 309 TLPAWVIGVVLVMTISLSAAAFDSFQSAMISTGSNDFFRNKLNIWIIRACVVALIFPVVV 368

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             L+  D+L++FLI+DL++A+ +P +++GL D  Y+    D                 ++
Sbjct: 369 VALRSPDILQIFLISDLVSAAVVPCLVIGLSDKFYWYRGFDFVVGGLGGVFTIFLFGLVY 428

Query: 427 YH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           Y  +     +L+ L  GLY  D+S  GAF+ AP   + + F +  +R+  +WV  +++G 
Sbjct: 429 YDGDVTKAGKLLLLEGGLYGNDWSAFGAFVAAPFGGLLWAFGACALRISFLWVRARVQGT 488

Query: 486 EFVFPKKPEVVDTKKYAGNKFKDDTEI 512
            F    +P  ++   + G+   + + +
Sbjct: 489 RFDAFDRPISLNNDDHDGDAVLEHSSL 515



>gi|320590557|gb|EFX03000.1| urea transport protein [Grosmannia clavigera kw1407]
          Length = 493

 Score =  321 bits (823), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 175/468 (37%), Positives = 267/468 (57%), Gaps = 14/468 (2%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +GS IL+S+P++  I+G+ GV++YA  S +P+F+FA LGP+IR+KCPEGF LT++  +R+
Sbjct: 14  LGSGILFSYPQLAVISGVQGVLVYALASALPMFIFAALGPIIRRKCPEGFVLTEWTRQRY 73

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    I++  +++A +F +M++ELSA+G ++  LTG+D L  VI   IVTT+YT  GG  
Sbjct: 74  GIPATIFLGFVTLATLFLYMMAELSAIGQVVTALTGLDGLPAVIVECIVTTIYTAIGGFH 133

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S +TDNIQG                   I++S I  S LLK N LGWQLLYI+PVA+  
Sbjct: 134 ISFVTDNIQGAMVLGLIVIATIAIGAETHIDRSTIAESGLLKGNLLGWQLLYILPVAILT 193

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG----EE 293
              F   FW R F+S+ DR+L +     +  +  +   +G TG++AVW+G WPG      
Sbjct: 194 NDFFLSNFWLRTFASRTDRDLWIGISIAAAAILVIATLVGCTGLVAVWSGAWPGAGQDAS 253

Query: 294 NLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVT 353
           + +S  AFF L ++LP+WV G  +V+++S+S A++D+L SA  ++ SNDIF NRL     
Sbjct: 254 DADSSTAFFNLLQLLPNWVVGFVLVMSISLSTASFDSLQSAMVSSASNDIFRNRLSSIYI 313

Query: 354 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXX 413
           R    I  VP V   L+   VL+++LI+DL++A+ +P +++GL D     N  D      
Sbjct: 314 RIAVAIVIVPTVVLALRTPSVLQIYLISDLVSAAIIPVLVVGLSDRCSAWNGTDVVVGGL 373

Query: 414 XXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRL 473
                     +I+Y +A  G +L+ L  GLY  D+   GAF+ AP+  + F   SF +R+
Sbjct: 374 GGLLAVFAFGAIYYQDAYSGAKLLLLEQGLYEGDWGAFGAFVAAPIGGVLFGLASFLLRM 433

Query: 474 ISMWVFTKIRGEEF-VFPKKPEVVDTK--------KYAGN-KFKDDTE 511
             +++  +  G  F    K  + V T          Y G  +  DD E
Sbjct: 434 AYLYIRARATGRPFDPVSKGKQAVGTSVVEEPVLDPYVGQPELHDDEE 481



>gi|477518870|gb|ENH71070.1| hypothetical protein FOC1_g10008443 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 569

 Score =  321 bits (822), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 200/564 (35%), Positives = 309/564 (54%), Gaps = 56/564 (9%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFAS---------- 56
           SN +IYV  A+FL +G    +K + ++K+D+LS  GTQ A  L  N+ AS          
Sbjct: 9   SNAVIYVTYALFLLMGTGIAWKMRNQSKADFLSGNGTQTAFPLALNFIASAQLRSLSAEL 68

Query: 57  -------------------------------------SIGSSILYSFPEVGTIAGLLGVI 79
                                                S+GS IL+S+PE+ TI+G+ G+I
Sbjct: 69  GYSNYLLQRGNLGRLGGEDAAHYGRRVDVSSGSNLGASLGSGILFSYPELATISGVQGMI 128

Query: 80  MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 139
           +YA  S +P+ +F +LGP+IR++CPEGF LT++  +R+G    +Y+S MS+  +F +M+ 
Sbjct: 129 VYALASSLPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGVITMLYLSFMSLVTLFLYMVG 188

Query: 140 ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 199
           ELSA+G ++  +TG+  L  +I    VTT+YT  GG R S ITD  QG            
Sbjct: 189 ELSAIGQVVNAMTGLKPLPVMIVQCAVTTIYTSLGGFRISFITDVAQGTMVIGLVIIAAI 248

Query: 200 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 259
                  I++ +I+ S L KSN LGWQLLYI+PVAV     F   FW R F+SK D++LR
Sbjct: 249 TIGAKTEIQRPLIEESGLTKSNLLGWQLLYILPVAVLTNDFFLSSFWLRTFASKTDKDLR 308

Query: 260 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVV 318
           +     +I++  +L  +G TG+IAVW+G    E+   S  +AFF L + LP WV GI +V
Sbjct: 309 IGTTIATIVILCILTLVGSTGLIAVWSGALSLEDAAGSGSVAFFVLLETLPSWVVGIVLV 368

Query: 319 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 378
           + V+MS AA+D+L SA  ++ SND+F N+L +   R   ++  +P +   LK   VL+++
Sbjct: 369 MVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAFVVLIIIPVIVIALKAPSVLQIW 428

Query: 379 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 438
           LI DL++A+T+P +++GL+D  Y+    +                 I+Y NA++  EL+ 
Sbjct: 429 LITDLISAATIPVLVIGLVDKFYWWRGFEVVVGGLGGILTVFIFGCIYYGNAQEAGELLL 488

Query: 439 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 498
           +  GLY  D+S  GAF+ AP+ S+ +   +  +RL   ++  KIRG  F    +P  VD 
Sbjct: 489 VQKGLYGNDWSAFGAFVAAPVGSLLWGCGALALRLSYQYMSAKIRGHRFDALDRP--VDL 546

Query: 499 KKYAGNKFKDD--TEIIQSSDPDE 520
           +    +  ++D  TE + SS P +
Sbjct: 547 RP---SSTEEDVPTENLVSSTPGK 567



>gi|46129398|ref|XP_389060.1| hypothetical protein FG08884.1 [Fusarium graminearum PH-1]
          Length = 511

 Score =  320 bits (821), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 183/488 (37%), Positives = 289/488 (59%), Gaps = 13/488 (2%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV    FL +G    +K + ++K+D+LS  GTQ A  L  N+ AS++GS IL+S+
Sbjct: 9   SNAVIYVTYGAFLIMGTGIAWKMRNQSKADFLSGNGTQTAFPLALNFIASALGSGILFSY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TI+G+ G+++YA  S +P+ +F +LGP+IR++CPEGF LT++  +R+G    +Y+S
Sbjct: 69  PELATISGVQGMMVYALASALPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGIITMLYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
            MS+  +F +M+SELSA+G ++  LTG+D L  +I    +TT+YT             +Q
Sbjct: 129 FMSMVTLFLYMVSELSAIGQVVQALTGLDPLPVMIVQCAITTIYTYV-----------VQ 177

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I++ +ID S L K N LGWQLLYI+PVAV     F   FW
Sbjct: 178 GTMVVGLVIIAAITIGAKTEIQRPLIDESGLTKPNLLGWQLLYILPVAVLTNDFFLSSFW 237

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLF 305
            R F+SK D++LR+     +I++  VL  +G TG+IAVW+G  P  ++     +AFF L 
Sbjct: 238 LRTFASKTDKDLRIGTTIATIVILCVLTLVGSTGLIAVWSGALPLADKAGSGSVAFFVLL 297

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP WV GI +V+ V+MS AA+D+L SA  ++ SND+F N+L +   R + ++  +P +
Sbjct: 298 ETLPSWVVGIVLVMVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAIVVLIIIPVI 357

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 425
              LK   VL+++LI DL++A+T+P +++GL++  Y+    +                 +
Sbjct: 358 AIALKAPSVLQIWLITDLISAATIPVLVIGLVEKFYWWRGFEVVVGGLGGILTVFIFGCV 417

Query: 426 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           +Y NAK+  EL+ +  GLY  D+S  GAF+ AP+ S+ +   +  VR+   +V  K+RG 
Sbjct: 418 YYGNAKEAGELLLVQKGLYGNDWSAFGAFVAAPVGSLLWGCGAMVVRITFQYVHAKVRGH 477

Query: 486 EFVFPKKP 493
            F    +P
Sbjct: 478 RFDALDRP 485



>gi|448515648|ref|XP_003867382.1| Dur3 urea transporter [Candida orthopsilosis Co 90-125]
 gi|380351721|emb|CCG21944.1| Dur3 urea transporter [Candida orthopsilosis]
          Length = 524

 Score =  320 bits (820), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 186/520 (35%), Positives = 300/520 (57%), Gaps = 11/520 (2%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N +IY+     L  G++  +K   +K+D+LSS GTQ  + L  N+ AS++G  I
Sbjct: 4   LSSQGNNAIIYLTYIFMLATGLFLAWK-FASKTDFLSSNGTQRGIPLALNFIASAMGVGI 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           + ++ E+  IAGL G+++Y     IP+  FA  GP+IRKKCP+GF LT++V  RFG    
Sbjct: 63  ISTYAEIANIAGLHGLLVYTLCGAIPILGFAIFGPIIRKKCPDGFILTEWVRHRFGMITA 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +   MF FMI ELSA+ + +  LTG++ L  VI    VTT+YT +GG R S IT
Sbjct: 123 LYISFFTCLTMFLFMIGELSAIRSAIEALTGLNALGAVIVECAVTTIYTFFGGFRVSFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN QG               + I I+ S +  S LLK+N LGWQL+YI+ VA+     F 
Sbjct: 183 DNFQGACVLILVIICACGMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAF 301
            GFW R F+SK D++L +     +++ F +   +G TG +AVW+G L  G++  E Y AF
Sbjct: 243 SGFWLRTFASKTDKDLWIGCSIAAVVTFVITSLVGTTGFLAVWSGDLQVGDD--EGYNAF 300

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   +P W+    ++  + +S   +D+L SA  +  SND+F N+L  N +R L +I  
Sbjct: 301 FILLSHMPRWLVAFVLIFCIILSTCTFDSLQSAFVSTISNDVFRNKLHTNWSRLLVVIMI 360

Query: 362 VPAVYWGLKDLD-VLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXX 419
            P V   +K  D +L+++LIADL++A+ +P   LGL ++  +++   D            
Sbjct: 361 FPIVVLAVKVADNILQIYLIADLVSAAVIPAAFLGLSNTYFWWMRGFDVMCGGLGALLGV 420

Query: 420 XXXXSIFYHNAKDGIELIGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
               +++Y++AK+G +L+ +  GLY + D+   GAF++AP+  + F++++  VR+ +++V
Sbjct: 421 FVFGTVYYNSAKEGGKLLLIWNGLYDSEDWGPFGAFVIAPVGGVVFSWVAAAVRISAVYV 480

Query: 479 FTKIRGEEFVFPKKPEVVDTKKYAGNK--FKDDTEIIQSS 516
           ++KIRG  F    +P+  +   Y  N+  +  D  + Q+S
Sbjct: 481 YSKIRGTPFTELDRPD--EEPIYVDNQATYGADENVEQTS 518



>gi|302505048|ref|XP_003014745.1| hypothetical protein ARB_07307 [Arthroderma benhamiae CBS 112371]
 gi|291178051|gb|EFE33842.1| hypothetical protein ARB_07307 [Arthroderma benhamiae CBS 112371]
          Length = 497

 Score =  319 bits (818), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 178/467 (38%), Positives = 278/467 (59%), Gaps = 1/467 (0%)

Query: 56  SSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLE 115
           S++GS IL+++PE+ TIAG+ G+++Y   S +PL  FA++GP+IR+K PE F LT++  +
Sbjct: 19  STLGSGILFTYPEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQ 78

Query: 116 RFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGG 175
           R+G    IY+S++++  +F +M++ELSA+  I+  L+G++ L  VI   +VTT+YT  GG
Sbjct: 79  RYGVVAGIYLSILTLITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGG 138

Query: 176 LRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAV 235
            + S +TDN+QG                   I+KS+ID+S LLK   LGWQL+YI+PVA+
Sbjct: 139 FQVSFLTDNVQGAMVVGLIIIAVITVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAI 198

Query: 236 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENL 295
                F    W R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG+   
Sbjct: 199 LTNDFFLSNLWLRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQ 258

Query: 296 ESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRF 355
              +AFF L + LP+WV GI +V+ V++S AA+D+L SA  +  SND+F N+LPL   R 
Sbjct: 259 AGSIAFFLLLEKLPNWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRI 318

Query: 356 LSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXX 415
             ++  VP V   L+   VLR+FLI+DL++AS +P ++LGL D +Y+    +        
Sbjct: 319 GVVLCIVPVVVVALRSPSVLRIFLISDLVSASAIPVLVLGLSDRMYWWTAFEVIVGGLGG 378

Query: 416 XXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLIS 475
                   +I+Y NA +G +LI L  GLY  D+S  GAF+ AP+  + F  ++ G+R+  
Sbjct: 379 ILSVFIFGTIYYGNATEGGKLILLQNGLYANDWSAFGAFVAAPIGGLIFACIALGLRVGY 438

Query: 476 MWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 522
            +V +K  G  F    +P +  +   AG    D  + I +     I 
Sbjct: 439 AFVLSKTTGRHFDVFDRP-LPRSHMAAGPMHLDQPDFIATGTDATIR 484



>gi|482808759|gb|EOA85644.1| hypothetical protein SETTUDRAFT_169663 [Setosphaeria turcica Et28A]
          Length = 528

 Score =  318 bits (815), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 188/520 (36%), Positives = 299/520 (57%), Gaps = 8/520 (1%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           M S   SN +IY+ L  FL +G +  ++ + ++K+++LSS  TQ  V L  N+ AS++GS
Sbjct: 3   MPSQPASNAIIYLTLGAFLVLGCFIAWRLRHQSKTEWLSSNRTQKGVPLAFNFIASALGS 62

Query: 61  SILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRF 120
            IL+++P++ TIAG+ G+++YA  S +PL VF  LGP+IR+KCPEGF LT++  +R+G  
Sbjct: 63  GILFTYPQIATIAGVQGLLVYALASALPLLVFGALGPIIRRKCPEGFVLTEWTRQRYGVV 122

Query: 121 NQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 180
             I++S  ++  MF +M++ELSA+  I+  LTG+  L  VI    VTT+YT  GG + S 
Sbjct: 123 AGIFLSACTLITMFLYMVAELSALQQIVTLLTGLKGLPVVIVECAVTTIYTSLGGFKVSF 182

Query: 181 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATL 240
           +TDNIQG                   I++S+ID S  L+ + LGWQL+YI+PVAV     
Sbjct: 183 VTDNIQGVMVIGLIIMGVIAVGVETHIDRSLIDKSGYLEPSLLGWQLIYILPVAVLTNDF 242

Query: 241 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLA 300
           F  GFW R F+S+ D++L +     S+ +  +L  LG+ GM+A W+G +   +     LA
Sbjct: 243 FLSGFWMRTFASRTDKDLWIGVSLASMGILIILTLLGVAGMLAAWSGAYKIGDAATGSLA 302

Query: 301 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIA 360
            F L   LP WV G+ +V+ +S+SCAA+D+  SA  +  SND F N+L + V R   +  
Sbjct: 303 LFLLLNQLPSWVVGVVLVMTISLSCAAFDSFQSAMISTGSNDFFRNKLNIWVIRACVVAL 362

Query: 361 NVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXX 420
             P V   L+  D+L++FLI+DL++A+ +P +++GL D  Y+    D             
Sbjct: 363 IFPVVVVALRSPDILQIFLISDLVSAAVVPCLVIGLSDRFYWYRGFDFVVGGLGGIFTIF 422

Query: 421 XXXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 479
               ++Y  +     +L+ L  GLY  D+S  GAF+ AP+  + + F + G+R+  +WV 
Sbjct: 423 LFGLVYYDGDVTLAGKLLLLEGGLYGNDWSAFGAFVAAPVGGLLWAFGACGLRIGFLWVR 482

Query: 480 TKIRGEEF-VFPKK-PEVVDTKKYAGNKFKDDTEIIQSSD 517
            +++G  F  F +  P+ +D        F D   +I++S 
Sbjct: 483 ARVQGRRFDAFDRPIPQPIDRP----GAFDDHDAVIENSS 518



>gi|71017739|ref|XP_759100.1| hypothetical protein UM02953.1 [Ustilago maydis 521]
 gi|46098892|gb|EAK84125.1| hypothetical protein UM02953.1 [Ustilago maydis 521]
          Length = 503

 Score =  318 bits (815), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 177/432 (40%), Positives = 269/432 (62%), Gaps = 5/432 (1%)

Query: 60  SSILYSFPEVGTI--AGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           SS+L+ +P++  I  AG+LG++ Y F ++ PL+ FAWLGP IR+ CP+GFTL +++  RF
Sbjct: 3   SSLLFGYPQLAVIPEAGILGLVAYCFATVAPLWFFAWLGPQIRRICPDGFTLAEYIRRRF 62

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +   L+ + +MFCFM+ EL+  G+ +  L GV+     + IAI+TT+YT YGG +
Sbjct: 63  GWPVGVLSGLIFVGFMFCFMLVELNTYGSAVNLLGGVNPTIAALVIAIITTIYTTYGGFK 122

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
           ASL TDN+                   + I+ + +++S LLK   LG +L YI+P A+ F
Sbjct: 123 ASLYTDNVNAIIILIFIVIASIAVGVKLDIDHARVESSGLLKPQRLGGELWYILPAALIF 182

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENL 295
           + +F++GFWQRAF+SK+++ L +S +  +I LF V + +G+ G +A W+GL+  P  E+ 
Sbjct: 183 SQMFNQGFWQRAFASKDNKTLYISVICATIPLFAVCMLVGMAGPLAWWSGLFNGPTAED- 241

Query: 296 ESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRF 355
           +  L FF +   LP+W++GI +VL   +S +AYDT  SA  +   ND+F  R+ +   R 
Sbjct: 242 DGSLNFFYILGTLPNWLTGIVIVLCGCLSSSAYDTFQSAQISTIQNDVFLGRVNIWWCRA 301

Query: 356 LSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXX 415
           + ++ N+P+V   +K++D+L VFLIADL A + +P  LLGL+  LYFLN +D        
Sbjct: 302 ILILINIPSVVLAVKNIDILEVFLIADLAAIACIPAFLLGLVPRLYFLNGVDAVGGAVGG 361

Query: 416 XXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLIS 475
                   +IF+ +A  GI LIGLP GLYI DYSVLGAFI APL S+ +TF++  +R   
Sbjct: 362 FLTVFLFGTIFFGSASQGIALIGLPNGLYIDDYSVLGAFIAAPLGSLGWTFVTCAIRAAV 421

Query: 476 MWVFTKIRGEEF 487
            WV+ K  G +F
Sbjct: 422 TWVWCKKTGRKF 433



>gi|505755900|gb|EOR00094.1| putative urea active transporter 1 [Wallemia ichthyophaga EXF-994]
          Length = 560

 Score =  317 bits (813), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 184/514 (35%), Positives = 300/514 (58%), Gaps = 17/514 (3%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFP 67
           S  +IYV L +FL IG+   +  TK K+D+L++  T N+  +  N+ A  +G+ +  ++P
Sbjct: 9   SMAIIYVTLGVFLIIGLVISFFVTKTKTDFLAAAKTANSGVIMCNFAAQGLGAGLQLTYP 68

Query: 68  EVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSL 127
           E+ T  GL  +I Y+  + +PL  F  L   +RKKCPEGF LT+F+  RFG    +++S 
Sbjct: 69  EIATY-GLQPLITYSLAASLPLLTFPPLASQLRKKCPEGFILTEFIRARFGVPAGLFLST 127

Query: 128 MSIAYMFCFMISELSAVGNILVTLTG-------VDKLAPVICIAIVTTLYTGYGGLRASL 180
            +I  ++ FM+SE++++ +++ +LTG       V  + P++   +VT +YT +GG + SL
Sbjct: 128 FTIITLYVFMLSEMTSIHSVIQSLTGWSSETQNVWLIMPIVVEMLVTMMYTAWGGFKVSL 187

Query: 181 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN-SDLLKSNSLGWQLLYIMPVAVSFAT 239
           +TD IQ               A ++ I+  +I   SDLLK + LGWQLLYI+PVAV F  
Sbjct: 188 VTDTIQASFFIILVVVCTIAVAVNVEIDTDLIHQRSDLLKDSQLGWQLLYILPVAVVFNN 247

Query: 240 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE--- 296
            F   +WQR +++K+ ++L +  +  + ++F +   +G +G+IA W+ ++PG  N+    
Sbjct: 248 YFLSSYWQRCYAAKSQKDLTIGCILAACLIFCLTFLVGFSGLIASWSNVYPGPNNVNEDS 307

Query: 297 -SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRF 355
            S + F  + +  P W++G+ +VL+V++SCAAYDTL +A  A  SNDIF N++ +  TR 
Sbjct: 308 SSTVLFLLVNRFCPAWINGLMMVLSVALSCAAYDTLQTALVATVSNDIFRNKINVWWTRL 367

Query: 356 LSLI-ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXX 414
           + ++ A V       K  DVL ++LIADL++A+ MP +LLG  D LYFLN  D       
Sbjct: 368 ILIVNAAVIGPVASNKVNDVLILYLIADLVSAAIMPAMLLGFTDRLYFLNGFDVIIGGLG 427

Query: 415 XXXXXXXXXSIFYH-NAKDGIELIGLPLGLYIT--DYSVLGAFIVAPLSSIFFTFLSFGV 471
                     ++Y+ +A     L+ +  GLY +   +  LG FI AP+ SI +T  +FGV
Sbjct: 428 GILTVFLFGLVYYNGDASSAGALLIINEGLYPSYNSFEALGTFIAAPVGSILWTIAAFGV 487

Query: 472 RLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNK 505
           R++ M++ +KI G EF   +KP+ +D    AGN+
Sbjct: 488 RVLYMYIRSKITGAEFSVFEKPKPLDPAVVAGNE 521



>gi|402086110|gb|EJT81008.1| urea transporter, variant [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 482

 Score =  317 bits (813), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 170/471 (36%), Positives = 276/471 (58%), Gaps = 4/471 (0%)

Query: 52  NWFA-SSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLT 110
           NW    ++GS IL+++P++ TIAG+ GV++YA  S +PL +FA LGP IR++CPEGF LT
Sbjct: 2   NWRPYGAMGSGILFAYPQLATIAGIQGVVVYALSSALPLLIFAALGPAIRRRCPEGFVLT 61

Query: 111 QFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLY 170
           ++  +R+G    +Y+  M++  +F +M++ELSA+  ++ TL+ +D L  VI    +TT+Y
Sbjct: 62  EWTRQRYGAVAALYLGFMTLLTLFLYMVAELSAISQVVTTLSNLDGLPVVIVQCAITTIY 121

Query: 171 TGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYI 230
           T  GG + S +TDN+QG                  RI+ ++I++S LL+   LGWQL+YI
Sbjct: 122 TSMGGFKISFLTDNVQGAMVLGLIIIATITIGVETRIDPALIESSGLLQPTLLGWQLVYI 181

Query: 231 MPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP 290
           +PVA+     F   FW R F+SK DR+L +     S     +L  +G TG++AVW+G WP
Sbjct: 182 LPVAILTNDFFLSSFWLRTFASKTDRDLWIGVGMASAATLCILTLVGTTGLVAVWSGAWP 241

Query: 291 GEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPL 350
           G +N +  +AFFTL ++LP+WV GI +V+AV++S AA+D+L SA  ++ SND+F NRL +
Sbjct: 242 GPDNADGSVAFFTLLQLLPNWVVGIVLVMAVTLSTAAFDSLQSAMVSSASNDLFRNRLGI 301

Query: 351 NVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNW--IDX 408
              R   ++  +P +   L+   +L+++LI+D+++A+T+P ++LGL D  YF  W   D 
Sbjct: 302 WYIRAAVVLVIIPVIVIALRAPSILQIYLISDMVSAATIPVLVLGLSDR-YFYWWRGFDV 360

Query: 409 XXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLS 468
                          + +Y + + G  LI L  GLY  D+ V GAF+ AP+  + F F++
Sbjct: 361 VCGGLGGILSVFIFGTAYYGDVEAGGRLILLEQGLYTGDWGVFGAFVAAPVGGMVFGFIA 420

Query: 469 FGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPD 519
             +R+  ++   K  G +F   ++P    T          +     S+D +
Sbjct: 421 MLLRVGFLFAQAKATGGQFTAFERPLPESTAISENGPADGEVRFDDSADRE 471



>gi|448080486|ref|XP_004194649.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
 gi|359376071|emb|CCE86653.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
          Length = 524

 Score =  317 bits (811), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 191/496 (38%), Positives = 288/496 (58%), Gaps = 7/496 (1%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   SN +IY+  A  L  GI+   K +K  + +LSS GTQ A+ L  N+ AS++G  I
Sbjct: 4   LSSQGSNAIIYLTYAFLLATGIFIAVKFSKPNT-FLSSNGTQRAIPLSLNFIASAMGCGI 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++ ++  I+GL G+++Y     IPL  F +LGPLIRKKCP+GF LT++V  RFG    
Sbjct: 63  LTTYCQIANISGLHGLLVYTLCGAIPLVGFGFLGPLIRKKCPDGFILTEWVRHRFGVVTS 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +   MF FMISEL+A+   + T+TG++ LA +I   +VT++YT  GG   S IT
Sbjct: 123 LYLSFFTCLTMFLFMISELAAIRTAIETMTGLNALAAIIVECVVTSIYTSIGGFHVSFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN QG               + I I+ S +  S LLK+N LGWQL+YI+ VA+     F 
Sbjct: 183 DNFQGALVLLLVVICAAGMGSYIDIDTSKVAPSGLLKANKLGWQLVYILFVAILTNDCFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAF 301
            GFW R F+S++DR+L +     + + F +   +G+TG +AVW+G L  G+ N  S  AF
Sbjct: 243 AGFWLRTFASRSDRDLIIGCSLAAFVTFVICSLVGVTGFLAVWSGDLKVGDSNGSS--AF 300

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   +P W+    ++  VS+S   +D+L SA  +  SND+F N+L +N TR + +I  
Sbjct: 301 FILLSKMPAWLMAFVLIFCVSLSTCTFDSLQSAMVSTISNDLFRNKLHINYTRIIVVIII 360

Query: 362 VPAVYWGLKDL-DVLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXX 419
           VP +   +K   ++L ++LIADL+++S +P ILLGL D   +FL   D            
Sbjct: 361 VPIIVLAIKVANNILTIYLIADLVSSSIIPIILLGLSDRYFWFLRGFDVMFGGLGAILAV 420

Query: 420 XXXXSIFYHNAKDGIELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
                I+Y +AK+G +L+ L  GLY   D+   GAF++AP+ SI    +S  VR+ + ++
Sbjct: 421 FVFGCIYYQSAKEGGKLLLLWNGLYNPEDWGPFGAFVIAPVGSILLALISASVRISASYL 480

Query: 479 FTKIRGEEFVFPKKPE 494
           + K +G+ F    +PE
Sbjct: 481 YCKWKGKSFHALDRPE 496



>gi|346320510|gb|EGX90110.1| urea transporter [Cordyceps militaris CM01]
          Length = 573

 Score =  317 bits (811), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 198/562 (35%), Positives = 304/562 (54%), Gaps = 59/562 (10%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQN-----------------AVAL 49
           SN +IY+   +FL +G    +K + + K+++LSS GTQ                  A  L
Sbjct: 9   SNAIIYLTYGVFLIMGTGIAWKLRNQAKTEFLSSNGTQTGQDSLTLLREYVLIPLAAFPL 68

Query: 50  GSNWFASS-----------------------------------IGSSILYSFPEVGTIAG 74
             N+ AS+                                   +GS IL+S+PE+ TIAG
Sbjct: 69  ALNFIASAKVCPALSPSRLRPLARDTIDCKTLNDWKSKLRDAALGSGILFSYPELATIAG 128

Query: 75  LLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMF 134
           + GV++YA  S +P+ VF +LGP+IR++CPEGF LT++  +R+G    +++S +++  +F
Sbjct: 129 VQGVVVYALASALPMLVFGYLGPVIRRRCPEGFVLTEWTRQRYGTVAMLFLSFLTLVTLF 188

Query: 135 CFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXX 194
            +M++ELSA+G ++ TLTG+D L  VI   +VTT+YT  GG + S +TD IQG       
Sbjct: 189 LYMVAELSAIGQVVSTLTGLDGLPVVIVQCVVTTIYTSLGGFKISFLTDVIQGGMVVGLI 248

Query: 195 XXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 254
                       I+  +ID+S L K+N LGWQLLYI+PVA+     F   FW R FSSK 
Sbjct: 249 IIATITIGVKTEIKTELIDSSGLTKANLLGWQLLYILPVAILTNDFFLSNFWLRTFSSKT 308

Query: 255 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 314
           D++LR+      +++  VL  +G TG+IA W+G WPG+      LAFF L + LP WV G
Sbjct: 309 DKDLRIGVTMAMLVILCVLTLVGSTGLIAAWSGAWPGDPPQGGSLAFFVLLEQLPAWVVG 368

Query: 315 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 374
           I +V+ VS+S AA+D+L SA  ++ SND+F NRL +   R   ++  VP V   LK   +
Sbjct: 369 IVLVMVVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWFIRVGVVVLIVPVVVLALKAPSI 428

Query: 375 LRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGI 434
           L++FLI+DL++++ +P ++LGL+   +F    +                + +Y +A  G 
Sbjct: 429 LQIFLISDLVSSAAIPVLVLGLLPQCWFWRGFEFVVGSLGGIFTVFIFGACYYRDAYRGA 488

Query: 435 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 494
            LI L  GLY  D+SV GAF+ AP   + + F++   RL   +   KI G  F    KP 
Sbjct: 489 RLILLEEGLYAQDWSVFGAFVAAPFGGLVWGFIALVCRLGFQYGKAKITGGVFDALDKP- 547

Query: 495 VVDTKKYAGNKFKDDTEIIQSS 516
            +DT +        D+E+++ +
Sbjct: 548 -LDTVR----PLSSDSEVVEQT 564



>gi|448084999|ref|XP_004195745.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
 gi|359377167|emb|CCE85550.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
          Length = 524

 Score =  317 bits (811), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 189/497 (38%), Positives = 289/497 (58%), Gaps = 7/497 (1%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
            LS   +N +IY+     L  GI+   K +K  + +LSS GTQ A+ L  N+ AS++G  
Sbjct: 3   QLSSQGNNAIIYLTYIFLLATGIFIAIKFSKPNT-FLSSNGTQRAIPLSLNFIASAMGCG 61

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           IL ++ ++  I+GL G+++Y     IP+  F +LGPLIRKKCP+GF LT++V  RFG   
Sbjct: 62  ILTTYCQIANISGLHGLLVYTLCGAIPIVGFGFLGPLIRKKCPDGFILTEWVRHRFGVIT 121

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
            +Y+S  +   MF FMISEL+A+   + T+TG++ LA VI   +VT++YT  GG   S I
Sbjct: 122 ALYLSFFTCLTMFLFMISELAAIRTAIETMTGLNALAAVIVECVVTSIYTSIGGFHVSFI 181

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLF 241
           TDN QG               + I I+ S +  S LLK+N LGWQL+YI+ VA+     F
Sbjct: 182 TDNFQGVLVLLLVVICAAGMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCF 241

Query: 242 HEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLA 300
             GFW R F+S++D++L +       + F +   +G+TG +AVW+G L  G+EN ++  A
Sbjct: 242 MAGFWLRTFASRSDKDLIIGCSIAGFVTFVICSLVGVTGFLAVWSGDLEVGDENGQN--A 299

Query: 301 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIA 360
           FF L   +P WV    ++  V++S   +D+L SA  +  SND+F N+L +N TR + +I 
Sbjct: 300 FFILLSKMPAWVLAFVLIFCVALSTCTFDSLQSAMVSTISNDVFRNKLHINYTRIIVVII 359

Query: 361 NVPAVYWGLKDL-DVLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXX 418
            VP +   +K   D+L ++LIADL+++S +P ILLGL DS  +FL   D           
Sbjct: 360 IVPIIVLAIKVANDILTIYLIADLVSSSIIPIILLGLSDSYFWFLRGFDVMFGGLGAILA 419

Query: 419 XXXXXSIFYHNAKDGIELIGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 477
                 I+Y +A++G +L+ L  GLY   D+   GAF++AP+ SI    +S  VR+ + +
Sbjct: 420 VFVFGCIYYQSAEEGGKLLLLWNGLYDPEDWGPFGAFVIAPVGSILLALISASVRISATY 479

Query: 478 VFTKIRGEEFVFPKKPE 494
           ++ K +G+ F    +PE
Sbjct: 480 LYCKWKGKSFHALDRPE 496



>gi|342878048|gb|EGU79459.1| hypothetical protein FOXB_10044 [Fusarium oxysporum Fo5176]
          Length = 581

 Score =  315 bits (806), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 193/530 (36%), Positives = 300/530 (56%), Gaps = 17/530 (3%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNA--------VALGSNW 53
           ML G     L ++  A    +    GY     +   L  LG ++A        V+ GSN 
Sbjct: 56  MLVGAFPLALNFIASAQLRSLSAELGYSNYLLQRGNLGRLGGEDAAHYGRRVDVSSGSN- 114

Query: 54  FASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFV 113
             +S+GS IL+S+PE+ TI+G+ G+I+YA  S +P+ +F +LGP+IR++CPEGF LT++ 
Sbjct: 115 LGASLGSGILFSYPELATISGVQGMIVYALASSLPMLIFGYLGPIIRRRCPEGFVLTEWT 174

Query: 114 LERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGY 173
            +R+G    +Y+S MS+  +F +M+ ELSA+G ++  +TG+  L  +I    VTT+YT  
Sbjct: 175 RQRYGVITMLYLSFMSLVTLFLYMVGELSAIGQVVNAMTGLKPLPVMIVQCAVTTIYTSL 234

Query: 174 GGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPV 233
           GG R S ITD  QG                   I++ +I+ S L KSN LGWQLLYI+PV
Sbjct: 235 GGFRISFITDVAQGTMVIGLVIIAAITIGAKTEIQRPLIEESGLTKSNLLGWQLLYILPV 294

Query: 234 AVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEE 293
           AV     F   FW R F+SK D++LR+     +I++  +L  +G TG+IAVW+G    E+
Sbjct: 295 AVLTNDFFLSSFWLRTFASKTDKDLRIGTTIATIVILCILTLVGSTGLIAVWSGALSLED 354

Query: 294 NLES-YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV 352
              S  +AFF L + LP WV GI +V+ V+MS AA+D+L SA  ++ SND+F N+L +  
Sbjct: 355 AAGSGSVAFFVLLETLPSWVVGIVLVMVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWY 414

Query: 353 TRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXX 412
            R   ++  +P +   LK   VL+++LI DL++A+T+P +++GL+D  Y+    +     
Sbjct: 415 IRAFVVLIIIPVIVIALKAPSVLQIWLITDLISAATIPVLVIGLVDKFYWWRGFEVVVGG 474

Query: 413 XXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 472
                       I+Y NA++  EL+ +  GLY  D+S  GAF+ AP+ S+ +   +  +R
Sbjct: 475 LGGILTVFIFGCIYYGNAQEAGELLLVQKGLYGNDWSAFGAFVAAPVGSLLWGCGALALR 534

Query: 473 LISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDD--TEIIQSSDPDE 520
           L   ++  KIRG  F    +P  VD +    +  ++D  TE + SS P +
Sbjct: 535 LSYQYMSAKIRGHRFDALDRP--VDLRP---SSTEEDVPTENLVSSTPGK 579



>gi|388578764|gb|EIM19102.1| hypothetical protein WALSEDRAFT_61642 [Wallemia sebi CBS 633.66]
          Length = 564

 Score =  314 bits (805), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 186/518 (35%), Positives = 294/518 (56%), Gaps = 17/518 (3%)

Query: 4   SGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSIL 63
           S   S  +IYV L +FL +G+   Y  TK K+D+LS+  T N   +  N+ A  +G+ + 
Sbjct: 7   SDEASMAIIYVTLGVFLILGLVISYFVTKTKADFLSATKTANYAVIMCNFAAQGLGAGLQ 66

Query: 64  YSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQI 123
            ++PEV T  GL  +I Y+  + +PL  F  L   +RKKCPEGF LT+F+  RFG    +
Sbjct: 67  LTYPEVATY-GLQPLITYSLAASLPLLTFPPLAAQLRKKCPEGFVLTEFIRARFGVVASL 125

Query: 124 YVSLMSIAYMFCFMISELSAVGNILVTLTG-------VDKLAPVICIAIVTTLYTGYGGL 176
           ++SL SI  ++ FM+SE++++ +++ +LTG       V  + P+    +VT LYT +GG 
Sbjct: 126 FLSLCSIVTLYVFMLSEMTSIYSVIQSLTGWSSETQNVWLIMPIFTEMMVTMLYTAWGGF 185

Query: 177 RASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN-SDLLKSNSLGWQLLYIMPVAV 235
           + SLITD IQ                 ++ I+ S+I   S+LL+ + LGWQLLYI+PVA+
Sbjct: 186 KTSLITDTIQATLFILLVIICTIAIGVTVEIDTSMIQQRSELLRGSQLGWQLLYILPVAI 245

Query: 236 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---- 291
            F   F   +WQR +++K  ++L +     +I++F +   +G +G+IA WA ++PG    
Sbjct: 246 VFNNYFLSSYWQRCYAAKTQKDLTIGCTLAAILIFCLTFLVGFSGLIAAWADVYPGPDSV 305

Query: 292 EENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLN 351
            E   S + F  + K  P W+S + +VL+V++SCAAYDTL +A  A  SND+F N++ + 
Sbjct: 306 NEESSSTVLFLLINKYCPPWISALMLVLSVALSCAAYDTLQTALVATVSNDVFRNKINIW 365

Query: 352 VTRFLSLI-ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXX 410
             R + ++ A V A     K  DVL ++LIADL++A+ MP +LLG  D LYFLN  D   
Sbjct: 366 WIRLILVVNAAVIAPVATNKVNDVLILYLIADLVSAAVMPAMLLGFTDKLYFLNGWDVTI 425

Query: 411 XXXXXXXXXXXXXSIFYH-NAKDGIELIGLPLGLYITD--YSVLGAFIVAPLSSIFFTFL 467
                         ++Y  +AK    L+ +  GLY ++  +  LG FI AP+ SI +T  
Sbjct: 426 GGLGGIFTVFLFGLVYYDGDAKSAAALLIINEGLYPSENSFECLGTFIAAPVGSILWTIA 485

Query: 468 SFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNK 505
           +FGVR++  ++ ++  G  F   +K + +D    AGN+
Sbjct: 486 AFGVRVLYTYIRSRTTGSPFTVFEKTKPLDPYVVAGNE 523



>gi|255732433|ref|XP_002551140.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240131426|gb|EER30986.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 530

 Score =  314 bits (805), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 182/490 (37%), Positives = 287/490 (58%), Gaps = 7/490 (1%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           MLS   +N +IY+  A  L  G++  +K   NK D+L++ GTQ  + L  N+ AS++G  
Sbjct: 1   MLSSQGNNAIIYLSYAFMLFTGLFLAWKFASNK-DFLAANGTQKGLPLALNFIASAMGVG 59

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           IL ++ ++  I+GL G+++Y     +P+  FA +GPLIRKKCP+GF LT++V  RFG   
Sbjct: 60  ILTTYAQIANISGLHGLLVYTICGAVPILGFAAVGPLIRKKCPDGFILTEWVRHRFGVVT 119

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
            +Y+S  +   MF FMI ELSA+   + TLTG++ L  VI    VTT+YT +GG R S I
Sbjct: 120 ALYLSAFTCLTMFLFMIGELSAIRGAIETLTGLNALGAVIVEVGVTTIYTFFGGFRVSFI 179

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLF 241
           TDN QG               + I I+K +I  S LLK N LGWQL+YI+ VA+     F
Sbjct: 180 TDNFQGVCVLILLIICACGMGSYIHIDKDLIGPSGLLKGNKLGWQLVYILFVAILTNDCF 239

Query: 242 HEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLA 300
             GFW R F+S++D++L +     ++ +F +   +G+ G +AVW+G L  G++N   Y A
Sbjct: 240 MSGFWLRTFASRSDKDLWIGTSIAAVAVFVICTLVGVPGFLAVWSGDLTVGDDN--GYNA 297

Query: 301 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIA 360
           FF L   +P+W+    ++  + +S   +D+L SA  +  SND+F N+L  N  R + ++ 
Sbjct: 298 FFILLAKMPNWLLAFVLIFCIVLSTCTFDSLQSAMVSTISNDVFRNKLNTNWVRGMLVLL 357

Query: 361 NVPAVYWGLKDLD-VLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXX 418
            VP V   +K  D +L+++LIADL++A+ +P I LGL DS  ++L   D           
Sbjct: 358 MVPIVVLAVKVADNILQIYLIADLVSAAIIPSIFLGLADSWFWYLRGFDIMVGGFGALLG 417

Query: 419 XXXXXSIFYHNAKDGIELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 477
                +++Y +AK+G +L+ +  G+Y   D+   GAF++AP+  + F  L+   R+ S++
Sbjct: 418 VFVFGTVYYDSAKEGGKLLLIWNGIYDPEDWGAFGAFVIAPVGGVVFALLAAAARIGSLY 477

Query: 478 VFTKIRGEEF 487
           V++KI G +F
Sbjct: 478 VYSKITGNQF 487



>gi|336264692|ref|XP_003347122.1| hypothetical protein SMAC_05421 [Sordaria macrospora k-hell]
 gi|380093817|emb|CCC08781.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 495

 Score =  313 bits (801), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 173/473 (36%), Positives = 279/473 (58%), Gaps = 8/473 (1%)

Query: 57  SIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLER 116
           ++GS +L+++PE+ T+AGL GV++YA  S +PLF FA LGP+IR+KCPEGF LT++  +R
Sbjct: 18  ALGSGMLFTYPEIATLAGLQGVLVYALASSLPLFAFASLGPIIRRKCPEGFVLTEWTRQR 77

Query: 117 FGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGL 176
           +G    +Y+S +++  +F +M++ELS++G ++  LTG+  L  +I   ++TT+YT  GG 
Sbjct: 78  YGTVTALYLSFVTLVTLFLYMVAELSSIGQVVEVLTGLHGLPVIIVECVITTIYTSLGGF 137

Query: 177 RASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVS 236
           R S ITDNIQG                  +I+ S+I+ S LLK N LGWQLLYI+PVA+ 
Sbjct: 138 RISFITDNIQGAMVVGLIVVAAIAIGVETKIDTSLIEPSGLLKDNLLGWQLLYILPVAIL 197

Query: 237 FATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EE 293
               F   FW R F+SK D++L +     ++++  ++  +G TG+IA W+G+WPG   E 
Sbjct: 198 TNDFFLSSFWLRTFASKTDKDLWIGISLAALIILIIITMVGCTGLIAAWSGIWPGSDPEN 257

Query: 294 NLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVT 353
            L   +AFF L + LP WV G  +V++V++S AA+D+L SA  +  SND+F N+L +   
Sbjct: 258 PLPGSVAFFGLLENLPAWVVGFVLVMSVTLSTAAFDSLQSAMVSTASNDLFRNKLNVWWI 317

Query: 354 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXX 413
           R   ++  +P V   +K   +L+++LI+DL++A+T+P +++GL D  Y+    +      
Sbjct: 318 RGAVVLVIIPIVVIAIKAPSILQIYLISDLVSAATIPVLVIGLSDRCYWWRGFEVVVGGL 377

Query: 414 XXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRL 473
                     +I+Y +A  G +L+ L  GLY   ++  GAF+ AP+  + + F +  +RL
Sbjct: 378 GGIFTVFIFGAIYYKDAHRGAQLMLLEEGLYQEGWAAFGAFVAAPVGGLLWGFGALALRL 437

Query: 474 ISMWVFTKIRGEEFVFPKKPEVV----DTKKY-AGNKFKDDTEIIQSSDPDEI 521
              WV  K +G  F    +P +V    +T +Y AG   +      Q S   +I
Sbjct: 438 SVQWVQAKRKGVRFDALDRPVMVEGDGETVQYIAGGDLETILSTGQESGAGKI 490



>gi|326481865|gb|EGE05875.1| hypothetical protein TEQG_04886 [Trichophyton equinum CBS 127.97]
          Length = 552

 Score =  312 bits (800), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 176/465 (37%), Positives = 274/465 (58%), Gaps = 1/465 (0%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +GS IL+++PE+ TIAG+ G+++Y   S +PL  FA++GP+IR+K PE F LT++  +R+
Sbjct: 76  LGSGILFTYPEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQRY 135

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    IY+S++++  +F +M++ELSA+  I+  L+G++ L  VI   +VTT+YT  GG +
Sbjct: 136 GVVAGIYLSILTMITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQ 195

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S +TDN+QG                   I+KS+ID+S LLK   LGWQL+YI+PVA+  
Sbjct: 196 VSFLTDNVQGAMVVGLIIIAVITVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILT 255

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES 297
              F    W R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG+     
Sbjct: 256 NDFFLSNLWLRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAG 315

Query: 298 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 357
            +AFF L + LP+WV GI +V+ V++S AA+D+L SA  +  SND F N+LPL   R   
Sbjct: 316 SIAFFLLLEKLPNWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDAFRNKLPLIYVRIGV 375

Query: 358 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXX 417
           ++  VP V   L+   VLR+FLI+DL++AS +P ++LGL D +Y+    +          
Sbjct: 376 VLCIVPVVVVALRSPSVLRIFLISDLVSASAIPVLVLGLSDRMYWWTAFEVIVGGLGGIL 435

Query: 418 XXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 477
                 +I+Y NA +G +LI L  GLY  D+S  GAF+ AP+  + F  ++  +R+   +
Sbjct: 436 SVFIFGTIYYGNATEGGKLILLQNGLYANDWSAFGAFVAAPIGGLIFACIALCLRVGYKF 495

Query: 478 VFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 522
           V +K  G  F    +P +  +   AG    D  + I +     I 
Sbjct: 496 VLSKTTGRHFDVFDRP-LTHSHVPAGPMHLDQPDFIATGTDATIR 539



>gi|459369699|gb|EMG48026.1| Urea transporter, putative (Urea/polyamine transporter, putative)
           [Candida maltosa Xu316]
          Length = 522

 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 183/519 (35%), Positives = 299/519 (57%), Gaps = 9/519 (1%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N +IY+  A  L  G++  +K    K ++LS+ GTQ  + L  N+ AS++G  I
Sbjct: 4   LSSQGNNAIIYLSYAFMLFTGLFLAWKFASTK-EFLSANGTQRGIPLALNFIASAMGVGI 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++ ++  I+GL G+++Y     IP+  FA +GPLIR++CP+GF LT++V  RFG    
Sbjct: 63  LTTYAQIANISGLHGLLVYTICGAIPIVGFALVGPLIRRRCPDGFILTEWVRHRFGPITA 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +   MF FMI ELSA+   + TLTG++ L  VI    VTT+YT +GG R S IT
Sbjct: 123 LYLSGFTCLTMFLFMIGELSAIRGAIETLTGLNALGAVIVEVGVTTIYTFFGGFRVSFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN QG               + I I+ S +  S LLK+N LGWQL+YI+ VA+     F 
Sbjct: 183 DNFQGACVLILIIICAAGMGSYIEIDTSKVGPSGLLKANKLGWQLVYILFVAILTNDCFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAF 301
            GFW R F+S++D++L +     ++++F V   +G  G +AVW+G L  G+EN   Y AF
Sbjct: 243 SGFWLRTFASRSDKDLWIGTSIAAVVVFVVCTLVGTPGFLAVWSGDLTVGDEN--GYNAF 300

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L + +P W+    ++  + +S   +D+L SA  +  SNDIF N+L  N  R + ++  
Sbjct: 301 FILLEKMPRWLVAFVIIFCIVLSTCTFDSLQSAMVSTISNDIFRNKLHTNYVRGMLVLLM 360

Query: 362 VPAVYWGLKDL-DVLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXX 419
           VP V   +K   ++L+++LIADL++A+ +P + LGL D+  +FL   D            
Sbjct: 361 VPIVVLAVKVANNILQIYLIADLVSAAVIPSVFLGLADAWFWFLTGFDVMVGGFGALLGV 420

Query: 420 XXXXSIFYHNAKDGIELIGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
               +++Y +A++G +L+ +  G+Y + D+   GAF++AP+    FT +   +RL ++++
Sbjct: 421 FVFGTVYYGSAREGGKLLLIWNGIYDSEDWGAFGAFVIAPVGGTIFTLICAALRLGALYL 480

Query: 479 FTKIRGEEFVFPKKPE--VVDTKKYAGNKFKDDTEIIQS 515
           ++K+ G EF    +PE  +V+ +   G    DD + ++ 
Sbjct: 481 YSKVSGSEFTALDRPETVIVEHEPSKGLSQTDDDDSLKK 519



>gi|471566473|gb|EMR66770.1| putative urea transporter protein [Eutypa lata UCREL1]
          Length = 522

 Score =  309 bits (791), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 183/525 (34%), Positives = 311/525 (59%), Gaps = 14/525 (2%)

Query: 1   IMLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           ++  G+  +++ + VL   LG G+ A   + ++K+++LS   TQ+A+ +  N+ A+++GS
Sbjct: 2   VLFCGMGKSIITHEVL---LGTGL-AWKMRNQSKANFLSGNRTQSAIPIALNFIAAAMGS 57

Query: 61  SILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRF 120
            IL+S+P++ T+AGL GVI+YA  S  PL +FA L P+IR+KCPEGF LT++  +RFG  
Sbjct: 58  GILFSYPQLATLAGLQGVIVYAISSSFPLLIFAALVPIIRRKCPEGFVLTEWARQRFGIV 117

Query: 121 NQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 180
             +Y+  +++  +F +M++ELSA+G ++  LTG+  L  +I   ++TT+YT  GG   S 
Sbjct: 118 TALYLGALTLLTLFLYMVAELSAIGQVINALTGLYGLPVIIVECVITTIYTSLGGFTISF 177

Query: 181 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATL 240
           +TDN+QG                 + I+  ++  S LL ++ +GWQ++YI+P+A+     
Sbjct: 178 LTDNVQGAMVCCLIIIAAVTVGVKVDIQPDLVKGSPLLDASLIGWQIIYILPIAILTNQF 237

Query: 241 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE-SYL 299
           F   FW RAF+S+ D++L +     S ++F VL+ +G TG+IAVW+G +PG+   E   +
Sbjct: 238 FLANFWLRAFASRTDKDLWVGLGIASFVIFCVLLLVGFTGLIAVWSGAFPGDPPAEDGSI 297

Query: 300 AFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLI 359
           AFF L + LP+WV GI +V+ V++S AA+D+L SA  ++ SND+F NRL +   R   ++
Sbjct: 298 AFFLLLEQLPNWVVGIVIVMVVTLSTAAFDSLQSAMVSSASNDVFRNRLNIWWIRAGVVL 357

Query: 360 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXX 419
             +P V   ++   +L+++LI+DLL+A+ +P +++GL +  YF    +            
Sbjct: 358 IIIPVVVIAIQAPGILQIYLISDLLSAAVIPVLVIGLSERFYFWRGFEVVVGGLGGILTV 417

Query: 420 XXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 479
               +I+Y +AK G ELI L  GLY  D+   GAF+ AP+  + +  ++   RL    + 
Sbjct: 418 FIFGTIYYDSAKQGGELILLQQGLYTGDWGAFGAFVAAPVGGVVWGCIALAFRLTIQLLQ 477

Query: 480 TKIRGEEF-VFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIEI 523
           +KI G  F  F +  EV   ++Y  +   +D  I    + DE+ +
Sbjct: 478 SKIAGRRFDAFDRPIEV--QRQY--DSLPEDAAI----NGDEVPM 514



>gi|512188743|gb|EPE04513.1| urea transporter [Ophiostoma piceae UAMH 11346]
          Length = 511

 Score =  305 bits (782), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 173/452 (38%), Positives = 264/452 (58%), Gaps = 7/452 (1%)

Query: 68  EVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSL 127
           ++  I+GL GV++YA  S +PLFVF+ LGP+IR+KCPEGF LT++  +R+G    I++  
Sbjct: 38  QLAVISGLQGVLVYALSSALPLFVFSALGPIIRRKCPEGFVLTEWTRQRYGVPAAIFLGF 97

Query: 128 MSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG 187
           +++A +F +M++ELSA+G ++ TLTG+D L  VI   +VTT+YT  GG R S ITDNIQG
Sbjct: 98  LTLATLFLYMVAELSAIGQVVSTLTGLDGLPVVIVECVVTTIYTAVGGFRISFITDNIQG 157

Query: 188 WAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQ 247
                          T   I++  + +S LLKSN LGWQLLYI+PVA+     F   FW 
Sbjct: 158 AIVLCMIIIATITVGTKTHIDRQDVIDSGLLKSNLLGWQLLYILPVAILTNDFFLSNFWL 217

Query: 248 RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLFK 306
           R F+S+ D++L L     ++ +  +L  +G  G++AVW+G +   + + +S +AFF L +
Sbjct: 218 RTFASRTDKDLWLGVSMAALAILIILTLVGCGGLVAVWSGAYDMSDPDADSSVAFFLLLE 277

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 366
            LP WV GI +V++VS+S AA+D+L SA  ++ SNDIF NRL     R   ++  +P V 
Sbjct: 278 QLPSWVVGIVLVMSVSLSTAAFDSLQSAMISSASNDIFRNRLSTKWIRGGVVLVIIPIVV 337

Query: 367 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 426
             LK   +L+++LI+DL++AST+P +++GL +     N  D                +I+
Sbjct: 338 LALKAPSILQIYLISDLVSASTIPVLIIGLSNRFPLWNGTDVIIGGLGGLMTVFIFGTIY 397

Query: 427 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 486
           Y +A+ G EL+ L  GLY  D+   GAF+ AP+  + F   SF  R+     +T IR   
Sbjct: 398 YGSAQSGAELLLLEQGLYEGDWGAFGAFVAAPIGGLLFGLASFLARM----AYTYIRARA 453

Query: 487 FVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDP 518
              P +P  ++ + Y       D   I + DP
Sbjct: 454 SGRPFQP--LNPRAYIIGPDNSDDASIGAFDP 483



>gi|322696792|gb|EFY88579.1| urea transporter [Metarhizium acridum CQMa 102]
          Length = 463

 Score =  304 bits (778), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 182/488 (37%), Positives = 279/488 (57%), Gaps = 37/488 (7%)

Query: 8   SNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           SN +IY+    FL  G GI A   + ++K D+LSS GTQ+A           +G+ IL+S
Sbjct: 9   SNAIIYLTYGAFLVLGTGI-AWTMRNQSKQDFLSSNGTQSA-----------LGAGILFS 56

Query: 66  FPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYV 125
           +PE+ TI G+ GVI+YA  S +P+ +F  LGP+IR+KCPEGF LT++  +R+G     Y+
Sbjct: 57  YPELATITGVQGVIIYALASALPMLIFGALGPIIRRKCPEGFVLTEWTRQRYGTVAMFYL 116

Query: 126 SLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 185
           S M++  +F +M++ELSA+G + VTL                      GG + S +TD I
Sbjct: 117 SFMTLVTLFLYMVAELSALGQV-VTL----------------------GGFKISFLTDVI 153

Query: 186 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 245
           QG                   I++ +ID+S LL+ + LGWQLLYI+PVAV     F   F
Sbjct: 154 QGGMVVGLIIIATITVGAKTEIKRELIDSSHLLEPSLLGWQLLYILPVAVLTNDFFLSNF 213

Query: 246 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 305
           W R FSSK+D++L +      +++  +L  +G TG+IA W+G WPGE   E  LAFF L 
Sbjct: 214 WLRTFSSKSDKDLWVGVSVAMVVILCILTLVGCTGLIAAWSGAWPGEPEQEGSLAFFLLL 273

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP WV GI +V+ VS+S AA+D+L SA  ++ SND+F NRL +   R + ++  +P V
Sbjct: 274 QQLPSWVVGIILVMVVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWYIRGMVVLIIIPVV 333

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 425
              L+   +L+++LI+DLL+A+T+P + LGL D LY+    +                ++
Sbjct: 334 VVALRASSILQIYLISDLLSAATIPVLCLGLSDRLYWWRGFEVVVGGLGGILTVFIFGAV 393

Query: 426 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 485
           +Y +A+ G +L+ +  GLY  D+S  GAF+ AP+  I + F +  +RL   ++  ++R E
Sbjct: 394 YYKDAEQGAQLLLIQNGLYANDWSTFGAFVAAPVGGIVWGFGALALRLSFQYIKARLRRE 453

Query: 486 EFVFPKKP 493
            F    +P
Sbjct: 454 RFDALDRP 461



>gi|406605512|emb|CCH43156.1| Sodium/glucose cotransporter 1 [Wickerhamomyces ciferrii]
          Length = 530

 Score =  303 bits (777), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 187/498 (37%), Positives = 287/498 (57%), Gaps = 2/498 (0%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N ++YV   + L  G+  G+    +K  +L+  GTQ  + L  N+ AS +G  I
Sbjct: 4   LSHPAANAILYVTYGLLLISGVSIGWI-FHDKKTFLNVNGTQKGIPLAFNFVASGLGVGI 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++P+V   AGL G+++YA    +P+ +F++LGP IRK+CP+GF LT++V  RFG    
Sbjct: 63  LSTYPQVANTAGLQGLLVYALCGGLPMLLFSFLGPKIRKQCPDGFVLTEWVFHRFGPVAG 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +I  +F FM+S+++++   + TLTG++ L  VI   +VT++YT  GG + S IT
Sbjct: 123 LYLSACTILTLFLFMVSDVASLQYAINTLTGLNALPVVIVECVVTSIYTAIGGFKVSFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DNIQ                T I I+ S I  S LLK N LGWQL+YI+ +A+    LF 
Sbjct: 183 DNIQIATVFILIIIISCAMGTYIDIDTSKIPESGLLKGNKLGWQLIYILVIAIFTNDLFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 302
            GFW R F+SK D++L +     + ++  + V +G+ G+IAVWAGL    ++  S  +FF
Sbjct: 243 SGFWLRTFASKTDKDLWIGCSIAAFLMTCIAVIVGIPGIIAVWAGLVDVGDDGASGASFF 302

Query: 303 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 362
            +   LP WV G T+V   ++S     +L SA T+  SNDIF N++P+   R + ++  V
Sbjct: 303 IILTQLPSWVMGFTLVFIAALSTCTIGSLQSALTSTISNDIFRNKIPIMYIRVIVVLIIV 362

Query: 363 PAVYWGLKDL-DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXX 421
           P +  GLK   DVL+++ IADLL+A+ +P ILLGL    YFL   +              
Sbjct: 363 PVIVVGLKVADDVLQIYFIADLLSAAVIPVILLGLSSYFYFLTVFEVIAGGLGGLLTVFI 422

Query: 422 XXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 481
             +I+Y NAKDG  L+ +  G+Y  D+S  GAF+ AP+ S+    +  G+RL+ + + +K
Sbjct: 423 FGTIYYGNAKDGGLLLIVNNGIYGNDWSAFGAFVAAPVGSLLAASIMLGLRLLVLKLISK 482

Query: 482 IRGEEFVFPKKPEVVDTK 499
             G+ F    KP+  DTK
Sbjct: 483 SSGKPFTALDKPKPKDTK 500



>gi|396469553|ref|XP_003838434.1| hypothetical protein LEMA_P113700.1 [Leptosphaeria maculans JN3]
 gi|312215002|emb|CBX94955.1| hypothetical protein LEMA_P113700.1 [Leptosphaeria maculans JN3]
          Length = 871

 Score =  302 bits (774), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 172/493 (34%), Positives = 273/493 (55%), Gaps = 6/493 (1%)

Query: 4   SGVVSNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           S   SN +IY+   +FL      +    +     +YL S   Q++      +    +GS 
Sbjct: 5   SQPASNAIIYLTYGVFLRSARSEFHCIGERMLSVEYLKSSSFQSSQGEAEKY---PLGSG 61

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           IL+++P++ TIAG+ G+++YA  S +PL +F  LGP+IR+KCPEGF LT++  +R+G   
Sbjct: 62  ILFTYPQIATIAGVQGLLVYALSSALPLLIFGALGPIIRRKCPEGFVLTEWTRQRYGAVA 121

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
            +++S+ ++  MF +M++ELSA+  I+  LTG++ L  VI    +TT+YT +GG + S +
Sbjct: 122 GLFLSVCTLITMFLYMVAELSALQQIVTLLTGLNGLPVVIVECTITTIYTSFGGFKVSFL 181

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLF 241
           TDNIQG                   I++S+ID S  L  + LGWQL+YI+PVA+     F
Sbjct: 182 TDNIQGVMVLGLIIMGVIAVGVETNIDRSLIDQSGYLNPSLLGWQLIYILPVAILTNDFF 241

Query: 242 HEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAF 301
             GFW R F++K D++L +     S  +  +L  LG+ G+++ W+G +   +     LAF
Sbjct: 242 LSGFWMRTFAAKTDKDLWIGVSLASGGVLIILTLLGVAGLLSAWSGAYTIGDQENGSLAF 301

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L + LP WV GIT+V+ VS+S AA+D+  SA  +  SND F N+L + V R   +   
Sbjct: 302 FLLLEKLPAWVIGITLVMTVSLSTAAFDSFQSAMISTGSNDFFRNKLNIWVIRACVVALI 361

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXX 421
            P V   L+  D+LR+FLI+DL++A+ +P ++LGL +  Y+    D              
Sbjct: 362 FPVVVVALRSPDILRIFLISDLVSAAVVPCLVLGLSERFYWYRGFDFVIGGLGGIFTIFL 421

Query: 422 XXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFT 480
              +FY  +      L+ L  GLY  D+SV GAF+ AP   + +   + G+R+  +W+  
Sbjct: 422 FGLVFYDGDVTMAGNLLLLESGLYADDWSVFGAFVAAPFGGLLWAMGACGLRISFLWIMA 481

Query: 481 KIRGEEFVFPKKP 493
           K RG  F    +P
Sbjct: 482 KARGRRFDALDRP 494



>gi|258573539|ref|XP_002540951.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237901217|gb|EEP75618.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 463

 Score =  302 bits (774), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 176/454 (38%), Positives = 263/454 (57%), Gaps = 9/454 (1%)

Query: 80  MYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMIS 139
           +Y   S +PL  F +LGP+IRKKCPEGF LT++  +R+G    +Y+SL+++  +F +M++
Sbjct: 3   VYGLSSSLPLLAFGYLGPIIRKKCPEGFVLTEWTRQRYGVAAAMYLSLLTLITLFLYMVA 62

Query: 140 ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 199
           ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDNIQG            
Sbjct: 63  ELSALQQIVNALTGLNGLPAVIVQVVVTTIYTSLGGFKVSFMTDNIQGAMVVGLIIIGVI 122

Query: 200 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 259
              T  +I +S+ID+S LL+ + LGWQL+YI+PVA+     F   FW R F+SK DR+LR
Sbjct: 123 TVGTKTQINRSLIDSSGLLEPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDRDLR 182

Query: 260 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 319
           +     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV GI +V+
Sbjct: 183 IGVSIASFTVLCILVLVGSTGLLAAWSGAWPGDPPQSGSIAFFLLLEKLPGWVVGIVLVM 242

Query: 320 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 379
            V++S AA+D+L SA  +  SND+F N+L L   R   ++  VP V   LK   VL++FL
Sbjct: 243 TVALSTAAFDSLQSAMVSTASNDLFRNKLSLIYIRIGVVLCIVPVVVVALKSPSVLQIFL 302

Query: 380 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 439
           I+DL++AS +P +++ L D  YF    +                +I+Y +A +G  LI L
Sbjct: 303 ISDLVSASAIPVLVISLWDKCYFWKGSEVIAGGLGGILSIFIFGTIYYGSAYEGGRLILL 362

Query: 440 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP------ 493
             GLY  D+SV GAF+ AP+    F  ++F +R+   +V +K+RGE F    KP      
Sbjct: 363 ENGLYADDWSVFGAFVAAPVGGFIFALIAFALRIAYQFVVSKVRGEHFDAFDKPIKPVRT 422

Query: 494 --EVVDTKKYAGNKFKDDTEIIQSSDPDEIEIRG 525
             +V D  +  GN  +D+ +  Q+  P     RG
Sbjct: 423 TSQVDDPIRPVGNA-RDEEDGKQNDSPAVEADRG 455



>gi|154286680|ref|XP_001544135.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150407776|gb|EDN03317.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 485

 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/413 (40%), Positives = 251/413 (60%)

Query: 75  LLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMF 134
           LLG+++Y   S +PL VF +LGP+IR+KCPEGF LT++  +R+G    IY+S++++  +F
Sbjct: 7   LLGLVVYGLASALPLLVFGYLGPIIRRKCPEGFVLTEWARQRYGIVAGIYLSILTLITLF 66

Query: 135 CFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXX 194
            +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG       
Sbjct: 67  LYMVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVGLI 126

Query: 195 XXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 254
                   T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+SK 
Sbjct: 127 VIAVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKT 186

Query: 255 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 314
           DR+LR+     S  +F +L  +G+TG++A W+G WPG+      +AFF L + LP WV G
Sbjct: 187 DRDLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGDPPQLGSIAFFLLLEQLPGWVVG 246

Query: 315 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 374
           I +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L +++ +P V   LK   V
Sbjct: 247 IVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLSIIPVVVVALKSPSV 306

Query: 375 LRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGI 434
           L++FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  G 
Sbjct: 307 LQIFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHAGA 366

Query: 435 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 487
           +LI L  GLY  D+S  GAF+ APL    F   +  +RL   ++  K +   F
Sbjct: 367 KLILLGNGLYAEDWSAFGAFVAAPLGGTLFGMGALLLRLSYHYLLAKRQHRRF 419



>gi|295663094|ref|XP_002792100.1| urea transport protein [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226279275|gb|EEH34841.1| urea transport protein [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 503

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/441 (37%), Positives = 253/441 (57%), Gaps = 25/441 (5%)

Query: 54  FASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFV 113
           F +++GS IL+++PE+ TIAG+ G+++Y   S +PL                        
Sbjct: 38  FLAALGSGILFTYPEIATIAGVQGLVIYGLASALPLL----------------------- 74

Query: 114 LERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGY 173
             R+G    IY+S++++  +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  
Sbjct: 75  --RYGLVTAIYLSILTLITLFLYMVAELSALQQIVSALTGLNGLPTVIVQVMVTTIYTSL 132

Query: 174 GGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPV 233
           GG + S ITDNIQG               T   I++S+ID+S LL ++ LGWQL+YI+P+
Sbjct: 133 GGFKVSFITDNIQGAMVVGLVIIAVITVGTKTNIDRSLIDSSGLLDASLLGWQLIYILPI 192

Query: 234 AVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEE 293
           A+     F   FW R F+SK+DR+LR+     S  +F +L  +G+TG++A W+G WPG  
Sbjct: 193 AIFTNDFFLSNFWLRTFASKSDRDLRIGVSIASGTVFCILTLVGVTGLLAAWSGAWPGNP 252

Query: 294 NLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVT 353
              + +AFF L + LP WV GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   
Sbjct: 253 PQRASIAFFLLLEKLPGWVVGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLKYV 312

Query: 354 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXX 413
           R L ++  +P V   L+   VL++FLI+DL++AS++P +  GL +  Y+    +      
Sbjct: 313 RILVVLCIIPVVVVALRSPSVLQIFLISDLVSASSIPVLTFGLWEKAYWWKGFEVVVGGL 372

Query: 414 XXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRL 473
                     +I++ +A++G +LI L  GLY  D+SV GAF+ APL  I F   + G+RL
Sbjct: 373 GGIFSVFVFGAIYFKDAQEGAKLILLGNGLYAQDWSVFGAFLAAPLGGILFGIAALGLRL 432

Query: 474 ISMWVFTKIRGEEFVFPKKPE 494
              ++  K +   F    KPE
Sbjct: 433 GYQFLLCKHQHRRFDALDKPE 453



>gi|126137249|ref|XP_001385148.1| urea transport protein [Scheffersomyces stipitis CBS 6054]
 gi|126092370|gb|ABN67119.1| urea transport protein [Scheffersomyces stipitis CBS 6054]
          Length = 520

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 181/500 (36%), Positives = 283/500 (56%), Gaps = 7/500 (1%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
            LS   +N +IY+  A  L  G+   +K +  KS +LSS GTQ  + L  N+ AS++G  
Sbjct: 3   QLSSQGNNAIIYLTYAFLLFTGLALAWKFSSAKS-FLSSNGTQRGLPLALNFIASAMGVG 61

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           IL ++ ++  I+GL G+++Y     IP+  FA +GPLIRKKCP+GF LT++V  RFG   
Sbjct: 62  ILTTYSQIANISGLHGLLVYTLCGAIPIVGFALVGPLIRKKCPDGFILTEWVRARFGIVT 121

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
            +Y+S  +   MF FM+ ELSA+   + TLTG+D L  VI   IVTT+YT  GG + S I
Sbjct: 122 ALYLSFFTCLTMFLFMVGELSAIRGAIETLTGLDALGAVIVECIVTTIYTSIGGFKISFI 181

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLF 241
           TDN QG               + I I+ S +  S LLK+N LGWQL+YI+ VA+     F
Sbjct: 182 TDNFQGALVIILIIICGAGMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCF 241

Query: 242 HEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLA 300
             GFW R F+S+ D++L +     +   F +   +G TG +AVW+G L   ++N   Y A
Sbjct: 242 LSGFWLRTFASRTDKDLWIGTSIAAFATFAICTLVGTTGFLAVWSGDLEVSDDN--GYNA 299

Query: 301 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIA 360
           FF L   +P W+    ++  + +S   +D+L S   +  SND+F N+L +N TR L ++ 
Sbjct: 300 FFILLAKMPRWIVAFVLIFCICLSTCTFDSLQSGMVSTISNDVFRNKLHINYTRGLVVLV 359

Query: 361 NVPAVYWGLKDLD-VLRVFLIADLLAASTMPPILLGLIDSLY-FLNWIDXXXXXXXXXXX 418
            VP V   +K  D +L+++LIADL++A+ +P + LGL D+ + ++   D           
Sbjct: 360 MVPIVVLAVKVADNILQIYLIADLVSAAIIPAVFLGLSDTCFWYIRGFDVMCGGLGALIG 419

Query: 419 XXXXXSIFYHNAKDGIELIGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 477
                +++Y  A++G +L+ +  G+Y   D+   GAF++AP   +  TF +  +R+ + +
Sbjct: 420 VFIFGTVYYGTAREGAKLLLIWNGIYDPEDWGAFGAFVIAPFGGLVITFAAAALRIGAAY 479

Query: 478 VFTKIRGEEFVFPKKPEVVD 497
           V+ K+ G  F    KPE+V+
Sbjct: 480 VYAKVSGNTFSALDKPEIVE 499



>gi|366999438|ref|XP_003684455.1| hypothetical protein TPHA_0B03510 [Tetrapisispora phaffii CBS 4417]
 gi|357522751|emb|CCE62021.1| hypothetical protein TPHA_0B03510 [Tetrapisispora phaffii CBS 4417]
          Length = 565

 Score =  301 bits (772), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 186/512 (36%), Positives = 292/512 (57%), Gaps = 24/512 (4%)

Query: 32  KNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFV 91
           +N   +L++ GTQ+A+ L  N+ AS +G  IL ++P++  I GL G+++YA    +P+FV
Sbjct: 32  RNSKTFLNANGTQSAIPLAFNFVASGLGCGILSTYPQIANIDGLHGLLVYALAGGLPMFV 91

Query: 92  FAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTL 151
           F++LGPLIRKK P GF L+++V  RFG     Y+S  +I  M+ FM+SEL+++   + TL
Sbjct: 92  FSFLGPLIRKKTPHGFILSEWVFHRFGIAAGWYLSACTILTMYLFMVSELASLKYAVETL 151

Query: 152 TGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSV 211
           TG+  L  VI   +VT++YT  GG + S +TD +Q                + I I+KS 
Sbjct: 152 TGIKALPVVIIECVVTSIYTTVGGFKISFLTDTLQVSIVFILLIIVSCAMGSYISIDKSK 211

Query: 212 IDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFP 271
           I+ S LLK+N LGWQL+YI+ +A+    LF  GFW R F+S++D++L +     + +L  
Sbjct: 212 IEPSGLLKANRLGWQLIYILTIAIFTNDLFLNGFWLRTFASRSDKDLLIGCSIAAFLLTA 271

Query: 272 VLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL 331
           ++  +G+TG IAVWAG     +   S  AFF L   LP WV G T+V  + +S    D+L
Sbjct: 272 IVTVVGVTGFIAVWAGFVEVADEENSGAAFFILLAQLPSWVMGFTLVFVLILSTCTLDSL 331

Query: 332 ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPP 391
            SA  +  SND+F N++P+  TR + ++  VP V  GL   DVL ++LI DLL++S +P 
Sbjct: 332 QSALVSTISNDVFRNKIPILYTRIIVVVIMVPVVVVGLIAEDVLSIYLIVDLLSSSVVPV 391

Query: 392 ILLGL---IDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDY 448
           ++LGL    DS ++  W +                +I+YH+A++G +L+ +  GLYI D+
Sbjct: 392 LVLGLWSKFDS-FWTAW-EVIGGGLAGIFGVWVYGTIYYHSAREGGKLLLIWNGLYIQDW 449

Query: 449 SVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVD----------- 497
              GAF+VAP++S+  +F+   +RL S+ ++   + +  V  +  +V D           
Sbjct: 450 GAFGAFVVAPVASMVISFIILAIRLYSIKLY---QADTTVGHRFRDVCDSLGKITGITWL 506

Query: 498 --TKKYAGNKF---KDDTEIIQSSDPDEIEIR 524
             T KY  NK     D +E I  S    +EI+
Sbjct: 507 YRTTKYWDNKLIKELDYSEAISDSSEGIVEIQ 538



>gi|156847319|ref|XP_001646544.1| hypothetical protein Kpol_1055p41 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117222|gb|EDO18686.1| hypothetical protein Kpol_1055p41 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 573

 Score =  298 bits (762), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 170/454 (37%), Positives = 266/454 (58%), Gaps = 5/454 (1%)

Query: 31  TKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLF 90
           T++  ++LS+ GTQ  + L  N+ AS +G  +L S+P++  I GL G+++YA    +P+F
Sbjct: 31  TRSSKNFLSANGTQKGLPLAFNFVASGLGCGVLSSYPQIANIDGLHGLLVYALSGGLPMF 90

Query: 91  VFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVT 150
           +FA+LGPLIRKK P GF LT++V  RFG     Y+S  +I  ++ F++SE++++   + T
Sbjct: 91  LFAFLGPLIRKKTPNGFVLTEWVFHRFGLLAGWYLSACTILTVYLFLVSEVASLKYAIET 150

Query: 151 LTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKS 210
           LTG++ L  +I   +VT++YT  GG   S +TD IQ                + + I+KS
Sbjct: 151 LTGINALPVIIIECVVTSIYTSIGGFNISFLTDTIQVSIVFILLIIVACAMGSYVDIDKS 210

Query: 211 VIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLF 270
           +I  S LLK+N LGWQL+YI+PVAV    LF  GFW R F+++++++L +       +L 
Sbjct: 211 LIGPSGLLKANKLGWQLVYILPVAVFTNDLFMSGFWLRTFAARSNKDLLIGCSIACFILV 270

Query: 271 PVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDT 330
             +  +G+TG IAVWAG     +   S  AFF L   LP WV G T+V  + +S    D+
Sbjct: 271 AFVTVVGVTGFIAVWAGFVSVADQENSGAAFFILLAQLPSWVMGFTLVFILVLSTCTLDS 330

Query: 331 LISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMP 390
           L SA  +  SNDIF N+LP+ + R + +   VP V  GL   DVL ++LI DLL++S +P
Sbjct: 331 LQSALVSTVSNDIFRNKLPILIVRGIVIAIMVPVVVVGLIAQDVLTIYLIVDLLSSSVVP 390

Query: 391 PILLGL---IDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITD 447
            +++GL   +D+++   W +                SI+YH+AK+G +L+ +  GLY+ D
Sbjct: 391 VLVIGLWSKMDNIW-TAW-EVISGGVGGILGVFIFGSIYYHSAKEGGKLLIISNGLYVDD 448

Query: 448 YSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 481
           +S  GAF+VAP + I  +      RL S+ ++  
Sbjct: 449 WSTFGAFVVAPGAGIVTSLGVLAFRLSSIRLYNS 482



>gi|363755328|ref|XP_003647879.1| hypothetical protein Ecym_7216 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356891915|gb|AET41062.1| hypothetical protein Ecym_7216 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 517

 Score =  297 bits (761), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 187/520 (35%), Positives = 283/520 (54%), Gaps = 14/520 (2%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS V SN +I+    + L       Y K  +K+ +LS+ G+Q AV L  N+ AS +G S+
Sbjct: 4   LSSVASNAIIWPTYIVMLVSASAIAYWKHDSKT-FLSANGSQRAVPLALNFIASGVGCSV 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++PE+  +AGL G+++YA  S +P++VFA  GP I+KKCP GF LT++V +R+G    
Sbjct: 63  LVAYPEMANVAGLQGLLVYALTSALPMYVFAVFGPQIKKKCPNGFMLTEWVFQRYGTVAG 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +I  +F FM+SE++++   + TLT    LA VI   +VTT+YT  GG   S IT
Sbjct: 123 LYLSACTILTLFLFMVSEIASLKQAVETLTKGGGLAVVIVECVVTTIYTTIGGFNISFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           D++Q                  +++++S+I+ S LLK   LGWQL+YI+ VA+     F 
Sbjct: 183 DSLQTLVFLFIWIISAIAFGCYVKVDRSLIEPSGLLKPTRLGWQLIYILTVAIFTNDFFL 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAF 301
            GFW R F++K+D++L +     + +L    V +G TG++AVW G  P G E+  S  AF
Sbjct: 243 SGFWLRTFAAKSDKDLLIGCSLAAGILVFFFVVVGFTGILAVWGGYVPIGSEDPGS--AF 300

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   LP W+ G+ +   + +S    D+L SA  +  SND+F N+LPL  TR +  I  
Sbjct: 301 FVLLSELPSWIMGLVLTFVLVLSTCTLDSLQSALVSTISNDLFKNKLPLMYTRAIVGIVM 360

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXX 421
           +P V  GL   DVL +FLI DLL+++ +P ++LGL   + FL   +              
Sbjct: 361 IPVVIVGLIATDVLTIFLIVDLLSSAVVPVLMLGLWSKMDFLTAWEIIGGGLGGLFCVFL 420

Query: 422 XXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 481
             + +Y N +DG  L+ +  GLY  D+   GA + AP  S+   F    +R  S  ++ +
Sbjct: 421 FGTAYYGNTRDGGRLLLISDGLYKNDWGAFGAMVAAPFGSLLVGFSILAIR--SAVIYLR 478

Query: 482 IRGEEFVFPKKPEVVDTKK--YAGNKF-KDDTEIIQSSDP 518
            R       KKP  V T+K  Y    + K D   I S  P
Sbjct: 479 CRTT-----KKPFTVFTRKIVYHDQIYSKQDDVSITSKSP 513



>gi|50305545|ref|XP_452732.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641865|emb|CAH01583.1| KLLA0C11913p [Kluyveromyces lactis]
          Length = 529

 Score =  297 bits (760), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 174/504 (34%), Positives = 282/504 (55%), Gaps = 9/504 (1%)

Query: 26  AGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGS 85
           A +K +     +LS+ GTQ  V L  N+ AS++G  +L ++P++  I GL G+++Y+   
Sbjct: 28  AFWKFSDKPKTFLSANGTQRGVPLAFNFVASALGCGVLSAYPQIANIDGLQGLLVYSLAG 87

Query: 86  IIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVG 145
            +P+F+FA+ GP+IRKKCP+GF LT++V+ RFG     Y+S  +I  +F FM+SEL+++ 
Sbjct: 88  SLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFGIICGWYLSACTIITIFLFMVSELASLK 147

Query: 146 NILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI 205
             + +LT +  L  +I   +VTT+YT  GG   S ITD IQ                + +
Sbjct: 148 YAIESLTKIKALPVIIVECVVTTIYTSIGGFHISFITDTIQVSIVFILLIIVSCAMGSYV 207

Query: 206 RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYG 265
            I+KS+I  S LLK+++LGWQL+YI+ VA+     F  GFW R F+++ D++L +     
Sbjct: 208 HIDKSLIAESGLLKASTLGWQLVYILTVAIFTNDFFMSGFWLRTFAARTDKDLMIGCSIA 267

Query: 266 SIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSC 325
           +++L   +  +G+TGMIAVWAG  P  +   S  AFF +   +P WV G  +   V +S 
Sbjct: 268 AVILAVFVTVIGVTGMIAVWAGYMPVADQENSGAAFFIVLTQMPGWVIGFVLAFVVMLST 327

Query: 326 AAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLA 385
              D+L SA  +  SNDIF N+LP+   R + ++  VP V  GL   DVL ++LI DLL+
Sbjct: 328 CTLDSLQSALVSTISNDIFRNKLPIIWIRGIVVLIMVPVVVVGLIADDVLTIYLIVDLLS 387

Query: 386 ASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYI 445
           +S +P ++LGL     FL   +                +++Y + ++G +L+ +  GLY 
Sbjct: 388 SSVVPILMLGLSSKFDFLTAWEIIGGGFGGLLSVWIFGTVYYDSPREGGKLLLIWNGLYA 447

Query: 446 TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK-------IRGEEFVFPKKPEVVDT 498
            D++  GAF+VAP   + F F    VR I +++  K       +  ++F++  + EV  T
Sbjct: 448 DDWAAFGAFVVAPFGGLIFGFFVLFVRTIIVYIDCKKNNKPFDLYSKKFIYRHEGEVQST 507

Query: 499 KKYAGNKFKDDTEIIQSSDPDEIE 522
               G+K K  T + +  + + +E
Sbjct: 508 TT-DGDK-KSFTSVERELETESVE 529



>gi|255718783|ref|XP_002555672.1| KLTH0G14718p [Lachancea thermotolerans]
 gi|238937056|emb|CAR25235.1| KLTH0G14718p [Lachancea thermotolerans CBS 6340]
          Length = 535

 Score =  295 bits (756), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 171/500 (34%), Positives = 273/500 (54%), Gaps = 8/500 (1%)

Query: 32  KNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFV 91
           K+   +LS+ GTQ  V L  N+ AS++G  +  ++P++  I+GL G+++YA    +P+F+
Sbjct: 32  KDAKTFLSANGTQKGVPLAFNFVASALGVGVFTTYPQIANISGLHGLLVYALAGGLPMFL 91

Query: 92  FAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTL 151
           FA+ GP+IR+K P GF LT++V +R+G+   +Y+S  +I  ++ FM+SEL+++   + +L
Sbjct: 92  FAFFGPVIRRKVPNGFVLTEWVFQRYGKVCGLYLSACTILTLYLFMVSELASLKFCIQSL 151

Query: 152 TGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSV 211
           T V  L  VI   +VTT+YT  GG   S ITD++Q                + I I+ S 
Sbjct: 152 TTVRALPVVIVECVVTTIYTTVGGFHISFITDSMQVSVVFALLVVVACAMGSYIHIDTSK 211

Query: 212 IDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFP 271
           I  S LLK N LGWQL+YI+ VA+     F  GFW R F++++DR+L +      ++L  
Sbjct: 212 IGPSGLLKQNKLGWQLVYILVVAIFTNDFFMSGFWLRTFAARSDRDLLIGCSLAFVVLVI 271

Query: 272 VLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL 331
           ++  +G+TG IAVWAGL    +      +FF L   +PDWV G  +  AV +S    D+L
Sbjct: 272 MVSLIGVTGFIAVWAGLVDVADQDLGGSSFFVLLTAMPDWVMGFVLAFAVVLSTCTLDSL 331

Query: 332 ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPP 391
            SA  +  SND+F N+LPL   R L  +  VP V  GL   DVL +FLI DLL+++ +P 
Sbjct: 332 QSALVSTISNDVFRNKLPLVYARGLVALIMVPVVVVGLIAEDVLSIFLIVDLLSSAVVPV 391

Query: 392 ILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI----GL----PLGL 443
           ++LGL    +FL+  +                +++Y + ++G  L+    GL      G+
Sbjct: 392 LMLGLSSRFFFLSAWEVVGGGLGGIFAVWIFGTVYYDSPREGGRLLLVSNGLYGQDSKGV 451

Query: 444 YITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAG 503
           Y  D+S  GAF+VAP   I   FL   +R    +   ++   +F   KK  +V+  ++  
Sbjct: 452 YGNDWSAFGAFVVAPFGGILVGFLILAIRTAVNYTRCRMHNLKFNMYKKTALVEEPEHNE 511

Query: 504 NKFKDDTEIIQSSDPDEIEI 523
              ++D  I ++      E+
Sbjct: 512 PVLEEDATIKKTFTSRTSEV 531



>gi|429848401|gb|ELA23890.1| urea transporter [Colletotrichum gloeosporioides Nara gc5]
          Length = 458

 Score =  295 bits (756), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 168/466 (36%), Positives = 259/466 (55%), Gaps = 38/466 (8%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV   +FL  G    +K + ++K ++LS   TQ A  L  N+ AS++GS IL+S+
Sbjct: 9   SNAIIYVTYGLFLITGTAIAWKFRNQSKGEFLSGNRTQTAFPLALNFIASALGSGILFSY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           PE+ TI G+ GV++YA  S +PL +FA LGP+IR+K PEGF LT +  +R+G    +Y+S
Sbjct: 69  PELATITGVQGVVVYALSSSLPLLIFAVLGPIIRRKTPEGFVLTAWTRQRYGTIAMLYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
            M++  +F +M++ELSA+G ++  LT +D L  +I   ++TT+YT  GG + S ITDN+Q
Sbjct: 129 FMTLVTLFLYMVAELSAIGQVVNALTSLDGLPVMIVQCVITTIYTSLGGFKISFITDNLQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                   I+ S+ID S LLK   LGWQLLYI+P+ +     F  GFW
Sbjct: 189 GAMVVCLIIIVAITMGVKTEIDTSLIDTSGLLKPTLLGWQLLYILPICILTNDFFLSGFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLF 305
            R F+SK DR+LR+       ++  VL  +G+TG++A W+G  P ++  +S  +AFF L 
Sbjct: 249 LRTFASKTDRDLRIGVSIAVAVILCVLTMVGVTGLVAAWSGALPLDQIADSGSVAFFLLL 308

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
           + LP WV GI +V+  ++S AA+D+L SA   +                           
Sbjct: 309 QQLPAWVVGIVLVMVCTLSTAAFDSLQSAMAPS--------------------------- 341

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 425
                   VL+++LI+DL++AS +P ++ GL+D  Y+    +                 +
Sbjct: 342 --------VLQIYLISDLVSASVIPVLVFGLVDRFYWWRGFEVVVGGLGGILTVFLFGLV 393

Query: 426 FYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFG 470
           FY  +A+    L+ +  GLY  D+SV GAF+ AP+ S  + F + G
Sbjct: 394 FYEGDAQKAANLLIISEGLYADDWSVFGAFVAAPVGSFLWGFGALG 439



>gi|149237959|ref|XP_001524856.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451453|gb|EDK45709.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 479

 Score =  294 bits (752), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 167/470 (35%), Positives = 268/470 (57%), Gaps = 10/470 (2%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +G  IL ++ ++  I+GL G+++Y     IP+  FA  GP+IRK+CP+GF LT++V  RF
Sbjct: 1   MGVGILTTYTQIANISGLHGLLVYTLCGSIPILGFAVFGPIIRKRCPDGFILTEWVRHRF 60

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +Y+S  +   MF FM+ ELSA+   + TLTG++ L  VI   +VTT+YT +GG R
Sbjct: 61  GVVTALYLSFFTCLTMFLFMVGELSAIRGAIETLTGLNALGAVIVECVVTTIYTFFGGFR 120

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S ITDN QG               T I I+ S +  S LLK+N LGWQL+YI+ VA+  
Sbjct: 121 VSFITDNFQGACVLILIIICACGMGTYIEIDPSKVGPSGLLKANKLGWQLVYILFVAIVT 180

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLE 296
              F  GFW R F+SK D++L +     + + F +   +G  G +AVW+G +  G+EN  
Sbjct: 181 NDCFMSGFWLRTFASKTDKDLWIGCSIAAFVTFVICTLVGTPGFLAVWSGDITVGDEN-- 238

Query: 297 SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFL 356
            Y AFF L   +P W+    ++  + +S   +D+L SA  +  SND+F N+L  N TR L
Sbjct: 239 GYNAFFILLAKMPRWLVAFVLIFCIMLSTCTFDSLQSAMVSTISNDVFRNKLHTNWTRGL 298

Query: 357 SLIANVPAVYWGLKDL-DVLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXX 414
            ++  VP V   +K   D+L+++LIADL++A+ +P + LGL ++  ++L  ID       
Sbjct: 299 VVLICVPIVVLAVKVADDILQIYLIADLVSAAIIPAVFLGLSNTYFWYLRGIDVMCGGLG 358

Query: 415 XXXXXXXXXSIFYHNAKDGIELIGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRL 473
                    +++YH+A++G +L+ +  G+Y   D+   GAF++AP   +  T    GVR+
Sbjct: 359 ALLGVFIFGTVYYHSAREGGKLLLIWNGIYSPEDWGAFGAFVIAPFGGLVITMAVAGVRI 418

Query: 474 ISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIEI 523
           + +++++KI G+ F   +KP    T+    ++ + +TE + SS    I +
Sbjct: 419 LGLYLYSKITGKPFTALEKP----TQVIYVDEQERETESLTSSSNINITV 464



>gi|344233479|gb|EGV65351.1| hypothetical protein CANTEDRAFT_119625 [Candida tenuis ATCC 10573]
          Length = 518

 Score =  291 bits (745), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 183/517 (35%), Positives = 289/517 (55%), Gaps = 13/517 (2%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N +IY+  A  L  G++  +K +K+ + +LSS GTQ A  L  N+ AS++G  +
Sbjct: 4   LSSQGNNAIIYLTYAFLLATGLFLAFKYSKSAT-FLSSNGTQRAAPLVLNFVASAMGCGV 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++ ++  I+GL G+++Y     IP+  F + GP+IRKKCP+GF L+++V  RFG    
Sbjct: 63  LTTYAQIANISGLHGLLVYTICGAIPIASFGFFGPIIRKKCPDGFILSEWVRHRFGIVTA 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+SL +   MF +M++ELS+V   + TLTG+D L  VI   +VTT+YT  GG + S IT
Sbjct: 123 LYLSLFTCLTMFLYMVAELSSVSLAIETLTGLDALGAVIVECVVTTIYTSVGGFKVSFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           DN QG               + I I+ S I  S LL++N LGW+L+Y+  VAV     F 
Sbjct: 183 DNFQGALVLLLIIICAAGMGSYIDIDTSKIGPSHLLQANKLGWELIYVFFVAVGTNAFFL 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAF 301
             FW R F+SK+DR L +     ++++  +   +G+ G +AVW+G L  G+EN    +AF
Sbjct: 243 NSFWLRTFASKSDRGLAIGTSVSAVIVMVICTLVGVPGFLAVWSGDLTVGDEN--GSMAF 300

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   +P W+    ++  +++S   +D+L SA  +  SNDIF NRL     R + +I  
Sbjct: 301 FILLAKMPGWIIAFVLIFTITISTCTFDSLQSAFVSTISNDIFRNRLKTIWVRAMVVIMI 360

Query: 362 VPAVYWGLKDLD-VLRVFLIADLLAASTMPPILLGLIDSLY-FLNWIDXXXXXXXXXXXX 419
           VP V   +K  D +L+++LIADL+++S +P I LGL D  + FL  +D            
Sbjct: 361 VPIVVLAVKVADNILQIYLIADLISSSIIPIIFLGLSDRFFWFLTGVDVMVGGLGALVAI 420

Query: 420 XXXXSIFYHNAKDGIELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
               +++Y  AK+G +L+ +  GLY   D+   GAF++AP   I    +    R+ ++WV
Sbjct: 421 FIFGTVYYGTAKEGGKLLLIWNGLYDAEDWGAFGAFVIAPFGGILIALVCVVARVGAIWV 480

Query: 479 FTKIRGEEFVFPKKP---EVVDTK---KYAGNKFKDD 509
           + KI  + F   ++P   E+V+ +    Y     K D
Sbjct: 481 YCKITKKPFTALQRPVPVEIVEEEFDSAYGSTNAKSD 517



>gi|366987111|ref|XP_003673322.1| hypothetical protein NCAS_0A03750 [Naumovozyma castellii CBS 4309]
 gi|342299185|emb|CCC66933.1| hypothetical protein NCAS_0A03750 [Naumovozyma castellii CBS 4309]
          Length = 579

 Score =  291 bits (744), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 179/493 (36%), Positives = 276/493 (55%), Gaps = 9/493 (1%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           +LS V +N +I+    + L       Y K  +KS +LSS GTQ A+ L  N+ AS +G  
Sbjct: 3   ILSAVTANAIIWPTYMVLLISASAIAYWKRDSKS-FLSSNGTQKALPLAFNFVASGLGCG 61

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L ++P++  I GL G+++YA    +P+FVFAWLGPLIRKK P+GF LT++V  RFG   
Sbjct: 62  VLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLIC 121

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             Y+S  +I  ++ F++SE++++   + T+T +  L  +I   +VTT+YT  GG   S I
Sbjct: 122 GWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISFI 181

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLF 241
           TD +Q                + I I++S+I  S LLK N LGWQL+YI+  A+     F
Sbjct: 182 TDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTNDFF 241

Query: 242 HEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAF 301
             GFW R F+S++D++L +      ++L      +G+TG IAVWAGL    +   S  AF
Sbjct: 242 MSGFWLRTFASRSDKDLMIGCSVACVILVVFCTVVGVTGFIAVWAGLVQVADEENSGAAF 301

Query: 302 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 361
           F L   LP WV G T+V    +S    D+L SA  +  SND+F NRL +   R + ++  
Sbjct: 302 FILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWVRGIVVLIM 361

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL---IDSLYFLNWIDXXXXXXXXXXX 418
           VP V  GL   +VL ++LI DLL++S +P ++LG     D L+   W +           
Sbjct: 362 VPVVVVGLIAENVLNIYLIVDLLSSSVVPVLVLGFWSKFDDLW-TAW-EVIGGGLGGILS 419

Query: 419 XXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
                +++YH+A++G  L+ +  GLY+ D+S  GAF+VAP   + F+     +RLI + +
Sbjct: 420 VWIFGTVYYHSAREGGRLLLISNGLYVDDWSTFGAFVVAPGGGLVFSGFILVIRLICVRL 479

Query: 479 FTKIRGEEFVFPK 491
           +   + EE +F +
Sbjct: 480 Y---KDEEGLFHR 489



>gi|354547251|emb|CCE43985.1| hypothetical protein CPAR2_502100 [Candida parapsilosis]
          Length = 467

 Score =  290 bits (743), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 168/465 (36%), Positives = 264/465 (56%), Gaps = 10/465 (2%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +G  I+ ++ ++  IAGL G+++Y     IP+  FA  GP+IRKKCP+GF LT++V  RF
Sbjct: 1   MGVGIISTYAQIANIAGLHGLLVYTLCGAIPILGFAIFGPIIRKKCPDGFILTEWVRHRF 60

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +Y+S  +   MF FMI ELSA+ + +  LTG++ L  VI    VTT+YT +GG R
Sbjct: 61  GMITALYLSFFTCLTMFLFMIGELSAIRSAIEALTGLNALGAVIVECAVTTIYTFFGGFR 120

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S ITDN QG               + I I+ S +  S LLK+N LGWQL+YI+ VA+  
Sbjct: 121 VSFITDNFQGACVLILIIICACGMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVT 180

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWA-GLWPGEENLE 296
              F  GFW R F+SK D++L +     + + F +   +G TG +AVW+  L  G++  E
Sbjct: 181 NDCFMSGFWLRTFASKTDKDLWIGCSIAAFVAFVITSLVGTTGFLAVWSEDLQVGDD--E 238

Query: 297 SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFL 356
            Y AFF L   +P W+    ++  + +S   +D+L SA  +  SND+F N+L  N  R L
Sbjct: 239 GYNAFFVLLSHMPRWLVAFVLIFCIVLSTCTFDSLQSAFVSTISNDVFRNKLHTNWARLL 298

Query: 357 SLIANVPAVYWGLKDLD-VLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXX 414
            +I   P V   +K  D +L+++LIADL +A+ +P + LGL +   +++   D       
Sbjct: 299 VVIMIFPIVVLAVKVADNILQIYLIADLASAAVIPAVFLGLSNRYFWWMRGFDVMCGGLG 358

Query: 415 XXXXXXXXXSIFYHNAKDGIELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRL 473
                    +++YH+AK+G +L+ +  GLY   D+   GAF++AP+  I F++++  VR+
Sbjct: 359 ALLGVFVFGTVYYHSAKEGGKLLLIWNGLYNPEDWGPFGAFVIAPVGGIVFSWIAAAVRI 418

Query: 474 ISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNK--FKDDTEIIQSS 516
            +++V++KI G  F   ++PE  +   Y  N+  +  DT I Q+S
Sbjct: 419 GAVYVYSKISGTPFTVLERPE--EEPIYVDNQTTYGSDTNIEQTS 461



>gi|38567077|emb|CAE76374.1| hypothetical protein [Neurospora crassa]
          Length = 461

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 162/458 (35%), Positives = 263/458 (57%), Gaps = 24/458 (5%)

Query: 68  EVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSL 127
           E+ T+AGL GV++YA  S +PLFVFA LGP+IR+KCPEGF LT++  +R+G    +Y+S 
Sbjct: 6   EIATLAGLQGVLVYALASALPLFVFALLGPIIRRKCPEGFVLTEWTRQRYGTIAALYLSF 65

Query: 128 MSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG 187
           +++  +F +M++ELS +G ++  LTG++ L  +I   ++TT+Y           T NIQG
Sbjct: 66  VTLVTLFLYMVAELSGIGQVVEVLTGLNGLPVLIVECVITTIY-----------TYNIQG 114

Query: 188 WAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQ 247
                             +I+ S+I+ S LLK + LGWQLLYI+PVA+     F   FW 
Sbjct: 115 AMVIGLLVVASIAIGVETKIDTSLIEPSGLLKDSLLGWQLLYILPVAILTNDFFLSSFWL 174

Query: 248 RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTL 304
           R F+SK DR+L +     ++ +  ++  +G TG+IA W+G+WPG   E  L   +AFF L
Sbjct: 175 RTFASKTDRDLWIGITLAALFILIIITMIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGL 234

Query: 305 FKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPA 364
            + LP WV G  +V++V++S AA+D+L SA  ++ SND+F N+L +   R   ++  +P 
Sbjct: 235 LENLPAWVVGFVLVMSVTLSTAAFDSLQSAMVSSASNDLFRNKLSVWWIRVAVVLIIIPI 294

Query: 365 VYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXS 424
           V   +K   +L+++LI+DL++A+T+P +++GL D  Y+    +                +
Sbjct: 295 VVLAIKAPSILQIYLISDLVSAATIPVLIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGA 354

Query: 425 IFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRG 484
           I+Y++A  G +LI L  G+Y   ++  GAF+ AP+  + + F +  +RL   WV  K +G
Sbjct: 355 IYYNDAYKGAQLILLEDGIYQEGWAAFGAFVAAPVGGLLWGFGALALRLAVQWVQAKRKG 414

Query: 485 EEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 522
             F    +P VV++          D+E IQ     ++E
Sbjct: 415 VRFDALDRPVVVES----------DSEAIQYVAGGDLE 442



>gi|50554165|ref|XP_504491.1| YALI0E27984p [Yarrowia lipolytica]
 gi|49650360|emb|CAG80094.1| YALI0E27984p [Yarrowia lipolytica CLIB122]
          Length = 495

 Score =  284 bits (727), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 164/474 (34%), Positives = 260/474 (54%), Gaps = 12/474 (2%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +G+  L ++P++   AG+ G+++Y   S +P+ +FA +GP++RK CP+GF LT++   R+
Sbjct: 1   MGAGTLNAYPDIAVRAGVEGLVVYGLSSALPMMLFAGVGPIVRKACPDGFVLTEWTRLRY 60

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G     Y++ ++I  M+ +M++EL+AV   + TLTG+D L  +I  A+ T++YT  GG  
Sbjct: 61  GWLTSFYLTCLTIGTMYLYMVAELAAVQAAIETLTGIDALPVLIVEAVFTSIYTAVGGFH 120

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S  TDN QG                   ++ S    S +L  N L  +L+YI+PVA++ 
Sbjct: 121 TSFFTDNFQGGMMLVLMVIVCVGLGVYFHVDPSEPAKSGMLGPNLLANKLIYILPVAIAT 180

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEE---- 293
              F  GFW R F+SKN+ EL  +    S ++  VL  +GLTG++AVWA L    +    
Sbjct: 181 NDCFLSGFWMRTFASKNNVELFWACAIASSIVLIVLTVVGLTGLLAVWAKLEIDGQVFVY 240

Query: 294 -NLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV 352
            +  S LAFF + K +P WV G TV   +S+S A+YD+  SA  +  SND F N++P+  
Sbjct: 241 GDERSALAFFYVLKEMPGWVIGFTVAFVLSLSVASYDSSQSAMASTISNDFFRNKIPMVW 300

Query: 353 TRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXX 412
            R + L  N P +   LK  +VL +FLIADL +A+ +P +  GL   +YF++  +     
Sbjct: 301 VRLIVLCINAPVIVVALKAPNVLNIFLIADLFSAAVIPIMFCGLSKRMYFISGWEVIGGG 360

Query: 413 XXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 472
                      SI++ +A++GI+LI L  GLY  D+S  GAF+ AP+ S+ + F    VR
Sbjct: 361 FGGMLTVFIFGSIYFKSAREGIKLIILLEGLYGDDWSAFGAFVAAPVGSLLWGFGILTVR 420

Query: 473 LISMWVFTKIRGEEFVFPKKPEVVDTK----KYAGNKFKDDTE---IIQSSDPD 519
           L  + +++ I G+ F    KP    T     +  G+   D+T    I+   DP+
Sbjct: 421 LTVLKIYSLITGKPFTALDKPSDDKTGIAVIREIGHVEDDNTSESIILDRKDPN 474



>gi|116193701|ref|XP_001222663.1| hypothetical protein CHGG_06568 [Chaetomium globosum CBS 148.51]
 gi|88182481|gb|EAQ89949.1| hypothetical protein CHGG_06568 [Chaetomium globosum CBS 148.51]
          Length = 372

 Score =  281 bits (718), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 149/344 (43%), Positives = 223/344 (64%), Gaps = 3/344 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN L+YV   +FL +G    +K + ++K ++L+   TQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALVYVTYGVFLIMGTGVAWKFRNQSKGEFLAGNRTQTALPLALNFIASALGSGILFAY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           P++ T+AG+ GV++YA  S +PL +FA LGP+IR+KCP+GF LT++  +R+G    +Y+S
Sbjct: 69  PQLATLAGVQGVVVYALSSALPLLIFAALGPIIRRKCPQGFVLTEWTRQRYGTVAALYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
            MS+  +F +MISELSA+G ++  LTG+D L  +I   IVTT+YT  GG + S  TDNIQ
Sbjct: 129 FMSLVTLFLYMISELSAIGQVVNLLTGIDGLPVLIVECIVTTIYTSVGGFKVSFFTDNIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G                  +I+ S+I++S L K + LGWQLLYI+PVA+     F   FW
Sbjct: 189 GAMVMGLILIATITIGVETKIDTSLIESSGLTKPSLLGWQLLYILPVAILTNDFFLSHFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN--LESYLAFFTL 304
            R F+SK DR+L L      + +  ++  +G TG+IA WAGLWPG E+  ++  +AFF L
Sbjct: 249 LRTFASKTDRDLWLGISGAVVGVLVIVTLVGSTGLIAAWAGLWPGPEDAPVDGSVAFFAL 308

Query: 305 FKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL 348
              LP+WV G+ VV+AV++S AA+D+  SA   + SND+F N+L
Sbjct: 309 LMQLPNWVVGVVVVMAVTLSTAAFDSFQSAMVTSASNDLFRNKL 352



>gi|296804300|ref|XP_002843002.1| urea transport protein [Arthroderma otae CBS 113480]
 gi|238845604|gb|EEQ35266.1| urea transport protein [Arthroderma otae CBS 113480]
          Length = 513

 Score =  278 bits (711), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 159/403 (39%), Positives = 231/403 (57%), Gaps = 23/403 (5%)

Query: 56  SSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLE 115
           S++GS IL+++PE+ TIAG+ G+++Y   S +PL  FA++GP+IR+K PE          
Sbjct: 134 STLGSGILFTYPEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRRKFPE---------- 183

Query: 116 RFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGG 175
                         +  +F +M++ELSA+  I+  LTG+D L  VI   +VTT+YT  GG
Sbjct: 184 -------------VLITLFLYMVAELSALQQIVTALTGLDGLPAVIVQVVVTTIYTSLGG 230

Query: 176 LRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAV 235
            + S +TDNIQG                   I+KS+ID+S LLK   LGWQL+YI+PVA+
Sbjct: 231 FQVSFLTDNIQGGMVVGLIIIAVITVGARTNIDKSLIDSSGLLKPTLLGWQLIYILPVAI 290

Query: 236 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENL 295
                F   FW R F+SK DR+LR+     S  +  +LV +G TG++A W+G+WPG+   
Sbjct: 291 LTNDFFLSNFWLRTFASKTDRDLRIGISIASFAVLCILVLVGSTGLLAAWSGVWPGDPPQ 350

Query: 296 ESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRF 355
              +AFF L + LP WV GI +V+ VS+S AA+D+L SA  +  SNDIF N+LPL   R 
Sbjct: 351 AGSIAFFLLLEKLPSWVVGIVLVMTVSLSTAAFDSLQSAMVSTASNDIFQNKLPLIYVRI 410

Query: 356 LSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXX 415
             ++  +P V   L+   VL++FLI+DL++AS +P ++LGL D LY+    +        
Sbjct: 411 GVVLCIIPVVVVALRSPSVLQIFLISDLVSASAIPVLVLGLSDKLYWWTAFEVIIGGLGG 470

Query: 416 XXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAP 458
                   +I+Y NA +G +LI L  GLY  D+S  G     P
Sbjct: 471 ILSVFIFGTIYYGNATEGGKLILLQNGLYANDWSAFGIITPTP 513



>gi|453084248|gb|EMF12293.1| hypothetical protein SEPMUDRAFT_46200, partial [Mycosphaerella
           populorum SO2202]
          Length = 475

 Score =  278 bits (710), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 155/432 (35%), Positives = 256/432 (59%), Gaps = 4/432 (0%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +GS++L+++P +  IAG+ G+++YA  S +PL +FA LGP+IR+KCP+GF LTQ+ LER+
Sbjct: 1   LGSAVLFTYPNIAAIAGVQGLLVYALSSGLPLLIFAALGPIIRRKCPDGFVLTQWTLERY 60

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +Y+S  S A ++ +M++ELSA+  ++  LTG++ L  +I  A +TT YT  GG R
Sbjct: 61  GLITSLYLSFFSCATIWLYMVAELSALQQVVNLLTGLNGLPALIVQAAITTTYTALGGFR 120

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S +TDNIQG                ++ I++S+I  S+ L+ + LGWQLLYI+PVA+  
Sbjct: 121 VSFVTDNIQGAMVLLFLIVGTIAIGVTVDIDRSLIPVSNYLEPSLLGWQLLYILPVAILT 180

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES 297
              F   FW RAF++K D++L +     ++ +  +   +G++G+IA W+G+  G     S
Sbjct: 181 NDFFLSNFWLRAFAAKTDKDLYIGVSIAAVAVTIITTLVGVSGLIAGWSGVL-GNPPEAS 239

Query: 298 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 357
            +  FTL + LP WV GI +V+ V++S +A+D+L SA  +  SND F N+L +   RF  
Sbjct: 240 GIELFTLLETLPTWVVGIVLVMVVTLSISAFDSLQSALISTGSNDFFRNKLNIWWVRFFV 299

Query: 358 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXX 417
           ++  +P V   LK   VL+++LI+D+++A+ +P +++GL    YF    +          
Sbjct: 300 VLLIIPTVVVALKSPSVLQIYLISDIISAAMIPCLVIGLSSKFYFWRGFEVVVGGLGGIL 359

Query: 418 XXXXXXSIFYHN--AKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLIS 475
                  ++Y    ++ G  LI L  GLY +D+SV G F+ AP+  + +   +F  R+  
Sbjct: 360 SVFLFGLVYYDGDVSRAGSLLI-LSDGLYASDWSVFGVFVAAPVGGLLWALAAFVARISV 418

Query: 476 MWVFTKIRGEEF 487
           +W   K++G  F
Sbjct: 419 LWTVAKVKGHRF 430



>gi|494831159|gb|EON67651.1| hypothetical protein W97_06794 [Coniosporium apollinis CBS 100218]
          Length = 479

 Score =  275 bits (703), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 173/466 (37%), Positives = 279/466 (59%), Gaps = 6/466 (1%)

Query: 55  ASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVL 114
           A ++GS IL+++P++ T+ G+ G+++Y   S +PL +F  LGP+IR+KCPEGF LT++  
Sbjct: 2   ALALGSGILFTYPQIATLCGVQGLVIYTLSSSLPLLLFGLLGPIIRRKCPEGFVLTEWTR 61

Query: 115 ERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYG 174
           +R+G    + +SL ++  +F +M++ELSA+  I+  LTG+D L  VI   +VTT+YT  G
Sbjct: 62  QRYGAVTALLLSLATLVTLFLYMVAELSALQQIVSALTGLDGLPAVIVQCVVTTIYTSLG 121

Query: 175 GLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVA 234
           G + S ITDNIQG                +  I+KS++D+S LL+S+ LGWQLLYI+PVA
Sbjct: 122 GFKVSFITDNIQGAMVVGLIIIGVITVGVNTEIDKSLVDSSGLLESSLLGWQLLYILPVA 181

Query: 235 VSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN 294
           +     F  GFW R F+S+ D++LR+     ++ +  +L F+G TG++A W+G WPG+  
Sbjct: 182 IFTNVFFISGFWLRTFASRTDKDLRIGTGIATVAVAIILAFVGSTGLLAAWSGAWPGDPP 241

Query: 295 LESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTR 354
            +  ++FF L   LP WV GI +V+ VS+S AA+D+  SA  +N SNDIF NRL +   R
Sbjct: 242 QDGAISFFLLLGQLPAWVVGIVLVMVVSLSTAAFDSFQSAMVSNGSNDIFRNRLNIWFIR 301

Query: 355 FLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXX 414
              ++  VP V   LK  D+L ++LI+DL++AS +P +++GL D  Y+    +       
Sbjct: 302 LSVVLIIVPVVVVALKSPDILTIYLISDLVSASLVPVLVIGLSDRCYWWRGFEVVVGALG 361

Query: 415 XXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLI 474
                    +++Y +A  G +LI L  GLY  D+   GAF+ AP+ ++ +   +F +R+ 
Sbjct: 362 GIFTVFLFGTVYYGDAGRGAKLILLEGGLYAEDWGAFGAFVAAPVGALLWALAAFILRIA 421

Query: 475 SMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDE 520
            +++  K++G  F    +P   D  ++AG      T+ + +   DE
Sbjct: 422 FLFIKAKVQGRRFDAFDRPIPADPGRFAG------TDALSTGTGDE 461



>gi|365985345|ref|XP_003669505.1| hypothetical protein NDAI_0C06030 [Naumovozyma dairenensis CBS 421]
 gi|343768273|emb|CCD24262.1| hypothetical protein NDAI_0C06030 [Naumovozyma dairenensis CBS 421]
          Length = 573

 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 174/458 (37%), Positives = 259/458 (56%), Gaps = 4/458 (0%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS + SN +I+    I L       Y K  +K+ +LS+ GTQ A+ L  N+ AS +G  +
Sbjct: 4   LSQLTSNAIIWPTYMILLITASIVAYWKRDSKA-FLSANGTQKALPLAFNFVASGLGVGV 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++P++  I+GL G+++Y     +P+FVFA+LGPLIRKK P GF LT++V  RFG    
Sbjct: 63  LSAYPQIANISGLHGLLVYTIAGGLPMFVFAFLGPLIRKKTPNGFVLTEWVFHRFGLICG 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
            Y+S  +I  ++ F++SE++++   + T+T +  L  +I   IVTT+YT  GG   S IT
Sbjct: 123 WYLSACTILTVYLFLVSEVASLKYAIETMTQIKALPVIIIECIVTTIYTTIGGFNISFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           D++Q  A             + I I++S I  S LLKSN LGWQL+YI+  A+     F 
Sbjct: 183 DSLQVSAVFVLLIIVACAMGSYIDIDRSKIGPSGLLKSNKLGWQLIYILVFAIFTNDFFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 302
            GFW R F+S++D++L +       +L      +G+TG IAVWAGL    +   S  AFF
Sbjct: 243 SGFWLRTFASRSDKDLIIGCSIACFILVIFCTVIGVTGFIAVWAGLISVNDEENSGAAFF 302

Query: 303 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 362
            L   LP WV G T+V +V +S    D+L SA  +  SNDIF N+LP+   R + ++   
Sbjct: 303 ILLSELPSWVMGFTIVFSVILSTCTLDSLQSALVSTISNDIFRNKLPIMYVRGIVVLIMF 362

Query: 363 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXX 420
           P V  GL   DVL ++LI DLL++S +P +++GL   L   +  W +             
Sbjct: 363 PVVVVGLIAEDVLNIYLIVDLLSSSVVPVLVVGLWSKLDNIWSAW-EVVGGGLSGIFSVW 421

Query: 421 XXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAP 458
              +I+Y +A++G  L+ +  GLYI D+S  GAF VAP
Sbjct: 422 VFGTIYYGSAREGGRLLLISNGLYINDWSTFGAFCVAP 459



>gi|367008374|ref|XP_003678687.1| hypothetical protein TDEL_0A01440 [Torulaspora delbrueckii]
 gi|359746344|emb|CCE89476.1| hypothetical protein TDEL_0A01440 [Torulaspora delbrueckii]
          Length = 554

 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 171/484 (35%), Positives = 267/484 (55%), Gaps = 4/484 (0%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   SN +I+    + L       Y K  +K+ +LS+ GTQ A+ L  N+ AS +G  +
Sbjct: 4   LSFQASNGIIWPTYVVLLLSASAVAYWKRDSKT-FLSANGTQKALPLAFNFVASGLGCGV 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++P++  I GL G+++YA    +P+F+FA+LGP+IRKK P GF LT++V  RFG    
Sbjct: 63  LSAYPQIANIDGLHGLLVYALAGGLPMFLFAFLGPIIRKKTPNGFVLTEWVFHRFGLLTG 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
            Y+   +I  +F FM+SE++++   + T+ G+  L  +I   +VTT+YT  GG   S IT
Sbjct: 123 WYLGACTILTVFLFMVSEVASLKYAIETIAGIKALPVIIIECVVTTIYTTIGGFHISFIT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           D +Q                  + I+ S+I+ S LLK+N LGWQL+YI+  A+     F 
Sbjct: 183 DTLQVSVVFVLLIIVACAMGKYVHIDSSMIEPSGLLKANKLGWQLVYILTFAIFTNDFFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 302
            GFW R F+S+++++L +      ++L   +  +G+TG IAVWAGL    +   S  AFF
Sbjct: 243 SGFWLRTFASRSNKDLMIGCSIACVILVVFVTVIGVTGFIAVWAGLISVADEENSGAAFF 302

Query: 303 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 362
            L   LP WV G T+V  V +S    D+L SA  ++ SND+F N++P+   R L L+  V
Sbjct: 303 ILLAQLPSWVMGFTLVFVVVLSTCTLDSLQSALVSSVSNDVFRNKIPIMYVRGLVLLVMV 362

Query: 363 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXX 420
           P V  GL   DVL ++LI DLL++S +P ++ GL      Y+  W +             
Sbjct: 363 PVVVVGLIAEDVLSIYLIVDLLSSSVVPVLVFGLSKRFEKYWTGW-EVVGGGLGGILATW 421

Query: 421 XXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFT 480
              +++Y + ++G +L+ +  GLY  D+   GAF+VAP   I F F    +RL  + +++
Sbjct: 422 IFGTVYYDSPEEGGKLLLITNGLYADDWGTFGAFVVAPFGGIAFGFFIMLIRLDCVKLYS 481

Query: 481 KIRG 484
              G
Sbjct: 482 NKDG 485



>gi|380471757|emb|CCF47122.1| hypothetical protein CH063_15636 [Colletotrichum higginsianum]
          Length = 454

 Score =  274 bits (700), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 158/453 (34%), Positives = 251/453 (55%), Gaps = 18/453 (3%)

Query: 79  IMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMI 138
           ++YA  S +PL +FA LGP+IR+K PEGF LT +  +R+G    +Y+S M++  +F +M+
Sbjct: 1   MVYALSSSLPLLIFAVLGPIIRRKTPEGFVLTAWTRQRYGTVAMLYLSFMTLVTLFLYMV 60

Query: 139 SELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX 198
           +ELSA+G ++  LT +D L  +I   ++TT+YT  GG R S +TDN+QG           
Sbjct: 61  AELSAIGQVVNALTSLDGLPVMIVQCVITTIYTSLGGFRISFLTDNLQGAMVVCLIIIVA 120

Query: 199 XXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 258
                   I+ S+I+ S LLK   LGWQLLYI+P+ +     F  GFW R F+SK D++L
Sbjct: 121 ITMGVKTDIDTSLIETSGLLKPTLLGWQLLYILPICILTNDFFLSGFWLRTFASKTDKDL 180

Query: 259 RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITV 317
           R+      +++  +L  +G+TG++A W+G  P ++  ES  +AFF L + +P WV GI +
Sbjct: 181 RVGVSIAVVVILCILTMVGVTGLVAAWSGALPLDQISESGSVAFFLLLQRMPAWVVGIVL 240

Query: 318 VLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRV 377
           V+  ++S AA+DTL SA  ++ SND+F NRL +   R   ++  +P V   LK   VL++
Sbjct: 241 VMVCTLSTAAFDTLQSAMVSSASNDLFRNRLNIWWIRAGVVVIIIPTVVIALKAPSVLQI 300

Query: 378 FLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIEL 436
           +LI+DL++AS +P ++ GL D  Y+    +                 ++Y  +A+    L
Sbjct: 301 YLISDLVSASVIPVLVFGLTDRFYWWRGFEVVAGGLGGILTVFLFGLVYYDGDAQKAGNL 360

Query: 437 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF------VFP 490
           + +  GLY  D+SV GAF+ AP+ S  + F + G RL   +   K  G  F      + P
Sbjct: 361 LIISEGLYANDWSVFGAFVAAPVGSFLWGFAALGCRLGFQYAMAKKSGRRFDALDRPIGP 420

Query: 491 -------KKPEVVDTKKYAGNKFKDDTEIIQSS 516
                    P  V+  +YA      D E+++ +
Sbjct: 421 GFTPEADGAPRYVERDEYAATS---DVEVVKPA 450



>gi|513034046|gb|AGO14012.1| AaceriAGR155Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 502

 Score =  273 bits (698), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 159/470 (33%), Positives = 266/470 (56%), Gaps = 3/470 (0%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS V +N +++   A+ L +     Y+  +N   +LS+ GTQ AV L  N+ AS +G  +
Sbjct: 4   LSYVAANAIVWPTYAVMLMVASVLAYR-LRNVRTFLSANGTQKAVPLALNFIASGLGCGV 62

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++P++  +AGL G+++Y   S +P++VFA+ GPLI++ CP+GF LT++VL RFGR   
Sbjct: 63  LLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAA 122

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  ++  ++ FM+SE+ ++   +  L+ +  +  VI   +VTT+YT  GG   S +T
Sbjct: 123 LYLSACTMLTLYLFMVSEIVSLRLAVEALSNIKPIPVVIVQCVVTTIYTAIGGFHISFVT 182

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           D++Q                TS++++ + I  S LL+ + LGWQL+YI+ +A+     F 
Sbjct: 183 DSLQATVVLLLLIVCAAAVGTSVKVDPARIGPSGLLRPSRLGWQLVYILTIAIFTNDFFM 242

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 302
            GFW R F+++++R+L +     + +L  VL+ +G+TG++AVWAG  P  +   +  +FF
Sbjct: 243 SGFWLRTFAARSNRDLLIGCSLAAALLAIVLLLIGVTGLLAVWAGYAPVADAESA--SFF 300

Query: 303 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 362
            L   LP WV+G+ +   V +S    D+  SA  +  SND+F NRL     R    +  V
Sbjct: 301 LLIAELPAWVNGVVLAFVVVLSTCTLDSFQSALVSTVSNDLFRNRLRPIYARAAVAVVMV 360

Query: 363 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXX 422
           P V  GL   D+L ++LI DLL+A+ +P +LLG       ++  +               
Sbjct: 361 PVVVVGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRFARMSAYEVIGGGLGGLLCVFIF 420

Query: 423 XSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 472
            +I+YH+A++G  L+ +  GLY  D+   GA + AP+ S+ F  + F VR
Sbjct: 421 GAIYYHSAREGGRLLIIANGLYADDWGTFGAMVAAPVGSLLFAGIIFLVR 470



>gi|310794094|gb|EFQ29555.1| hypothetical protein GLRG_04699 [Glomerella graminicola M1.001]
          Length = 454

 Score =  273 bits (698), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 155/439 (35%), Positives = 243/439 (55%), Gaps = 4/439 (0%)

Query: 91  VFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVT 150
           VFA+LGP+IR+K PEGF LT +  +R+G    +Y+S M++  +F +M++ELSA+G ++  
Sbjct: 13  VFAFLGPIIRRKTPEGFVLTAWTRQRYGTVAMLYLSFMTLVTLFLYMVAELSAIGQVVNA 72

Query: 151 LTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKS 210
           LT +D L  +I   +VTT+YT  GG R S +TDN+QG                   I+ S
Sbjct: 73  LTSLDGLPVMIVQCVVTTIYTSLGGFRISFVTDNLQGAMVVCLIVIVGIAMGVKTDIDTS 132

Query: 211 VIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLF 270
           +I++S LLK   LGWQLLYI+PV +     F  GFW R F+SK DR+LR+       ++ 
Sbjct: 133 LIESSGLLKPTLLGWQLLYILPVCILTNDFFLSGFWLRTFASKTDRDLRVGVSIAVAVIL 192

Query: 271 PVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYD 329
            +L  +G+TG++A W+G  P ++  E+  +AFF L + +P WV G+ +V+  ++S AA+D
Sbjct: 193 CILTLVGVTGLVAAWSGALPLDQVAENGSVAFFLLLERMPAWVVGLVLVMVCTLSTAAFD 252

Query: 330 TLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTM 389
           +L SA  ++ SND+F NRL +   R   ++   P +   LK   VL+++LI+DL++AS +
Sbjct: 253 SLQSAMVSSASNDLFRNRLNIWWIRAAVVLVIAPTIVIALKAPSVLQIYLISDLVSASVI 312

Query: 390 PPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIGLPLGLYITDY 448
           P ++LGL D  Y+    +                 ++Y  +A     L+ L  GLY  D+
Sbjct: 313 PVLVLGLSDRFYWWRGFEVVAGGLGGILTVFLFGLVYYDGDASRAGNLLILSEGLYADDW 372

Query: 449 SVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGN--KF 506
           S  GAF+ AP+ S  + F + G RL   +V  +  G  F     P V      A    +F
Sbjct: 373 SAFGAFVAAPVGSFLWGFAALGCRLAFQYVAARRSGRRFDALDDPAVAPDAASADGAPRF 432

Query: 507 KDDTEIIQSSDPDEIEIRG 525
            +  E   +SD + ++  G
Sbjct: 433 VERDEYEATSDVEVVKPAG 451



>gi|254567718|ref|XP_002490969.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238030766|emb|CAY68689.1| Hypothetical protein PAS_chr2-1_0088 [Komagataella pastoris GS115]
 gi|328352498|emb|CCA38897.1| Sodium-coupled monocarboxylate transporter 2 [Komagataella pastoris
           CBS 7435]
          Length = 539

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 171/523 (32%), Positives = 284/523 (54%), Gaps = 12/523 (2%)

Query: 1   IMLSGVVSNVLIYVV--LAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSI 58
           + LS   SN +IYV   L +   +G+ A Y    +KS +LSS  T+  + L  N+ AS++
Sbjct: 1   MTLSSQASNAIIYVTYGLTLIFCVGL-AWYHN--DKSKFLSSNQTKTGIPLALNFIASAM 57

Query: 59  GSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFG 118
           G  IL ++ +V  +AG+ G++ Y     +P+F F++ GPLIR+KCPEGF LT++  +RFG
Sbjct: 58  GCGILTTYTQVANLAGIHGLMTYTIVGALPIFFFSFWGPLIRRKCPEGFVLTEWTFQRFG 117

Query: 119 RFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRA 178
                Y+SL +I  MF FM++ELSA+   +  LTG+D L  VI   IVTT+YT  GG + 
Sbjct: 118 SVTGYYLSLATILTMFLFMVAELSAIKFAVEALTGLDGLPVVIVECIVTTIYTSIGGFQV 177

Query: 179 SLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSD--LLKSNSLGWQLLYIMPVAVS 236
           S  TDN Q               A ++ I+  +   ++  LL +N LGWQLLYI+ +A++
Sbjct: 178 SFSTDNYQACVVLVLAVIGVIGFALNVNIDPELKRETESYLLGANKLGWQLLYILFIAIA 237

Query: 237 FATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENL 295
               F  GFW R F++K +++L +     SI+   +   +GL G+  VW G +  G    
Sbjct: 238 TCDCFISGFWLRTFAAKTNKDLMIGTGIASIVAMTICTLVGLPGIFGVWTGDVVIGSP-- 295

Query: 296 ESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRF 355
           E YL+FF +   + +W+ G+ ++ ++ +S   +D+L S  T+   ND    R+PL   R 
Sbjct: 296 EGYLSFFIMVSTMGNWMIGLILIFSIVLSTCTFDSLQSGLTSTIVNDFGRGRMPLWAARV 355

Query: 356 LSLIANVPAV-YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXX 414
           ++++  VP++        DVL+++ IADL+++S +P + +GL    YF +  +       
Sbjct: 356 ITILVMVPSIVVAVKVADDVLKIYFIADLISSSVIPSLFIGLSTRFYFWSGWEVVGGGFA 415

Query: 415 XXXXXXXXXSIFYHNAKDGIELIGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRL 473
                    +++Y +A +G +L+ +  G+Y + D+   GAF+VAP  S+    +  GVRL
Sbjct: 416 GLFFVWVFGTVYYGDAAEGGKLLLIWNGIYDSEDWGPFGAFVVAPGVSLVGGLIICGVRL 475

Query: 474 ISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSS 516
             + V++ I+G  F    +PE +     A     D  E+ + +
Sbjct: 476 AVLKVYSNIKGTPFTALDRPEKLGFGGVAIGDSSDIEEVYEET 518



>gi|225685269|gb|EEH23553.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 456

 Score =  271 bits (693), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 156/436 (35%), Positives = 234/436 (53%), Gaps = 47/436 (10%)

Query: 59  GSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFG 118
           GS IL+++PE+ TIAG+ G+++Y                                     
Sbjct: 18  GSGILFTYPEIATIAGVQGLVIYG------------------------------------ 41

Query: 119 RFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRA 178
                      +  +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + 
Sbjct: 42  -----------LITLFLYMVAELSALQQIVNALTGLNGLPTVIVQVMVTTIYTSLGGFKV 90

Query: 179 SLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFA 238
           S ITDNIQG               T   I++S+ID+S LL  + LGWQL+YI+P+A+   
Sbjct: 91  SFITDNIQGAMVVGLVIIAVITVGTKTTIDRSLIDSSGLLDPSLLGWQLIYILPIAIFTN 150

Query: 239 TLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY 298
             F   FW R F+SK+DR+LR+     S  +F +L  +G+TG++A W+G WPG     + 
Sbjct: 151 DFFLSNFWLRTFASKSDRDLRIGVSIASATVFCILTLVGVTGLLAAWSGAWPGNPPQRAS 210

Query: 299 LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 358
           +AFF L + LP WV GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L +
Sbjct: 211 IAFFLLLEKLPGWVVGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVV 270

Query: 359 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXX 418
           +  +P V   LK   VL++FLI+DL++AS++P +  GL +  Y+    +           
Sbjct: 271 LCIIPVVVVALKSPSVLQIFLISDLVSASSIPVLTFGLWEKAYWWKGFEVVVGGLGGIFS 330

Query: 419 XXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
                +I++ +AK+G +LI L  GLY  D+SV GAF+ APL  I F   + G+RL   ++
Sbjct: 331 VFIFGAIYFKDAKEGAKLILLGNGLYAQDWSVFGAFLAAPLGGILFGIAALGLRLGYQFL 390

Query: 479 FTKIRGEEFVFPKKPE 494
            +K +   F    KP 
Sbjct: 391 LSKYQHHRFDALDKPS 406



>gi|398408051|ref|XP_003855491.1| hypothetical protein MYCGRDRAFT_36927, partial [Zymoseptoria
           tritici IPO323]
 gi|339475375|gb|EGP90467.1| hypothetical protein MYCGRDRAFT_36927 [Zymoseptoria tritici IPO323]
          Length = 474

 Score =  271 bits (692), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 159/441 (36%), Positives = 255/441 (57%), Gaps = 2/441 (0%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +GS IL+++P +  +AG+ G+++YA  S +PLF+FA L P+IR+KCPEGF LT++  +R+
Sbjct: 1   LGSGILFTYPNIAALAGVHGLLVYALSSGLPLFIFAVLAPIIRRKCPEGFVLTEWTRQRY 60

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +Y+S  ++A M+ +M++ELSA+  ++  LTG++ L  VI    VTT+YT  GG R
Sbjct: 61  GSVTSLYLSFFTLATMWLYMVAELSALQQVVNLLTGLNGLPAVIVQCAVTTIYTAAGGFR 120

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S +TDNIQG              AT++ I++S I  S  L +N LGWQLLYI+PVA+  
Sbjct: 121 VSFVTDNIQGAMVLLFIIIGTISIATTVDIDRSSIPASGYLNANLLGWQLLYILPVAILT 180

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES 297
              F   FW RAF++K D++L +     ++ +  +   +G++G++A W+G+  G   + S
Sbjct: 181 NDFFLSQFWMRAFAAKTDKDLWIGVSIAAVAVTCITTLIGVSGLVAGWSGVL-GTPPVPS 239

Query: 298 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 357
            +  FTL   LP WV G+ +V+ V++S +A+D+  SA  +  SND+F N+L   + R + 
Sbjct: 240 GIELFTLLNTLPAWVVGVILVMVVTLSTSAFDSFQSAIISTGSNDLFRNKLNTWIVRAIV 299

Query: 358 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXX 417
           +I  VP +   LK   VL+++LI+DLL+AS  P +++GL    Y     +          
Sbjct: 300 VIIIVPTMIVALKSPSVLQIYLISDLLSASITPCLVIGLSSKAYCWRGFEVVIGGLGGIL 359

Query: 418 XXXXXXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISM 476
                  ++Y  +A    EL+ L  GLY  D+S  GAF+ AP+  + F   +F +R+  +
Sbjct: 360 SVFFFGLVYYDGDAHKAGELLILSGGLYGDDWSAFGAFVAAPVGGLLFAISAFLLRIGVL 419

Query: 477 WVFTKIRGEEFVFPKKPEVVD 497
           W+  K  G  F    +P   D
Sbjct: 420 WLKAKASGTRFTALDRPTAPD 440



>gi|226294605|gb|EEH50025.1| urea transport protein [Paracoccidioides brasiliensis Pb18]
          Length = 558

 Score =  270 bits (690), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 156/436 (35%), Positives = 234/436 (53%), Gaps = 47/436 (10%)

Query: 59  GSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFG 118
           GS IL+++PE+ TIAG+ G+++Y                                     
Sbjct: 120 GSGILFTYPEIATIAGVQGLVIYG------------------------------------ 143

Query: 119 RFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRA 178
                      +  +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + 
Sbjct: 144 -----------LITLFLYMVAELSALQQIVNALTGLNGLPTVIVQVMVTTIYTSLGGFKV 192

Query: 179 SLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFA 238
           S ITDNIQG               T   I++S+ID+S LL  + LGWQL+YI+P+A+   
Sbjct: 193 SFITDNIQGAMVVGLVIIAVITVGTKTTIDRSLIDSSGLLDPSLLGWQLIYILPIAIFTN 252

Query: 239 TLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY 298
             F   FW R F+SK+DR+LR+     S  +F +L  +G+TG++A W+G WPG     + 
Sbjct: 253 DFFLSNFWLRTFASKSDRDLRIGVSIASGTVFCILTLVGVTGLLAAWSGAWPGNPPQRAS 312

Query: 299 LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 358
           +AFF L + LP WV GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L +
Sbjct: 313 IAFFLLLEKLPGWVVGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVV 372

Query: 359 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXX 418
           +  +P V   LK   VL++FLI+DL++AS++P +  GL +  Y+    +           
Sbjct: 373 LCIIPVVVVALKSPSVLQIFLISDLVSASSIPVLTFGLWEKAYWWKGFEVVVGGLGGIFS 432

Query: 419 XXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 478
                +I++ +AK+G +LI L  GLY  D+SV GAF+ APL  I F   + G+RL   ++
Sbjct: 433 VFIFGAIYFKDAKEGAKLILLGNGLYAQDWSVFGAFLAAPLGGILFGIAALGLRLGYQFL 492

Query: 479 FTKIRGEEFVFPKKPE 494
            +K +   F    KP 
Sbjct: 493 LSKYQHHRFDALDKPS 508



>gi|465795812|emb|CCV00245.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 545

 Score =  266 bits (680), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 168/455 (36%), Positives = 256/455 (56%), Gaps = 12/455 (2%)

Query: 58  IGSSILYSFPEVGTI--AGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLE 115
           + SS+L S+P++  I  AGL G+  YAF +I P++ F  LGPLIR+ CP+GFTL++++  
Sbjct: 1   MSSSLLESYPQMALIPGAGLFGLAAYAFATIAPVWAFGLLGPLIRRVCPDGFTLSEYIRR 60

Query: 116 RFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYG 174
           RFG    ++ +L+ I +MFCFMI EL+  G I+ T+   + K+ P + IAI TT+YT YG
Sbjct: 61  RFGWPVGVFSALVFIGFMFCFMIVELNTYGLIVQTIVPSMSKIIPPLIIAITTTIYTMYG 120

Query: 175 GLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVA 234
           G +ASL TDN                 +  + ++   + +  LL +++ G +L YI+ V+
Sbjct: 121 GFKASLWTDNFNAVVVVVFIIIGAVMFSVKLDLDSERVHDPRLLGAHAFGGELWYILTVS 180

Query: 235 VSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGE 292
           + FA +F++GFWQRAF+SK +  L +S    SI LF +   +G+ G +A WA +   P +
Sbjct: 181 IVFAQMFNQGFWQRAFASKTNMGLYVSVALASIPLFAICFLVGMAGPLAYWAHVQELPND 240

Query: 293 ENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV 352
           E+ +   A F     +P WV G+ +VL   +S +AYDT  SA  +   +D+F  RL +  
Sbjct: 241 ED-DGSNALFNALLYMPKWVHGLVLVLTGVLSSSAYDTFQSAQISVIQSDLFLGRLNIWW 299

Query: 353 TRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXX 412
            R L L+ NVP V   L  +D+L+VFLIADL   + +P + +GLI      N  D     
Sbjct: 300 CRVLLLLLNVPCVVLALIQIDILQVFLIADLAGLAVIPAVFMGLIPGFDVFNGFDVVVGG 359

Query: 413 XXXXXXXXXXXSIFYH-NAKDGIELIGLPLGLY-----ITDYSVLGAFIVAPLSSIFFTF 466
                      +I+YH +A  G +LIGLP GLY      +DYSV+GAF+ AP+  + F  
Sbjct: 360 CGGFLTVFVFGTIYYHGDAIRGGQLIGLPDGLYGVDADASDYSVIGAFLAAPVGDLCFAL 419

Query: 467 LSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKY 501
            S G+R++  W + +   + F   +K E     KY
Sbjct: 420 ASCGLRILVGWAYARYTNQPFTMLQKREEYRMDKY 454



>gi|189202288|ref|XP_001937480.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187984579|gb|EDU50067.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 440

 Score =  266 bits (679), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 145/429 (33%), Positives = 243/429 (56%), Gaps = 1/429 (0%)

Query: 85  SIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAV 144
           S +PL +F  LGP+IR+KCPEGF LT++  +R+G    +++S+ ++  MF +M++ELSA+
Sbjct: 3   SALPLLIFGALGPIIRRKCPEGFVLTEWTRQRYGAAAGLFLSVCTLITMFLYMVAELSAL 62

Query: 145 GNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATS 204
             I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQG                 
Sbjct: 63  QQIVNLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFVTDNIQGVMVIGLIIMGIIAVGVE 122

Query: 205 IRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVY 264
            +I++S+ID S  L+S+ LGWQL+YI+PVA+     F  GFW R F+++ D++L +    
Sbjct: 123 TKIDRSLIDKSGYLESSLLGWQLIYILPVAILTNDFFLSGFWMRTFAARTDKDLWIGVSL 182

Query: 265 GSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMS 324
            S+ +  +L  LG+ GM+A W+G +   +     LAFF L + LP WV G+ +V+ +S+S
Sbjct: 183 ASVGVLIILTLLGVGGMLAAWSGAYTIGDEANGSLAFFLLLETLPAWVVGVILVMTISLS 242

Query: 325 CAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLL 384
            AA+D+  SA  +  SND F N+L + + R   +    P V   L+  D+L++FLI+DL+
Sbjct: 243 TAAFDSFQSAMISTGSNDFFRNKLNIWIIRACVVALIFPVVVVALRSPDILQIFLISDLV 302

Query: 385 AASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIELIGLPLGL 443
           +A+ +P +++GL D  Y+    D                 ++Y  +A    +L+ L  GL
Sbjct: 303 SAAVVPCLVIGLSDRFYWYRGFDFVVGGLGGVFTIFLFGLVYYDGDATKAGKLLLLEGGL 362

Query: 444 YITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAG 503
           Y  D+S  GAF+ AP   + + F +  +R+  +W+  +++G  F    +P  ++   + G
Sbjct: 363 YGNDWSAFGAFVAAPFGGLLWAFGACALRISFLWIRARVQGTRFDAFDRPIPLNNDDHDG 422

Query: 504 NKFKDDTEI 512
           +   + + +
Sbjct: 423 DAVLEHSSV 431



>gi|320581949|gb|EFW96168.1| urea transporter, putative urea/polyamine transporter, putative
           [Ogataea parapolymorpha DL-1]
          Length = 463

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/464 (34%), Positives = 258/464 (55%), Gaps = 15/464 (3%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +G  IL ++ ++  IAG+ G+++Y     IP+F+F+  GP+IR++CPEGF LT++V +RF
Sbjct: 1   MGCGILTTYTQIANIAGIHGLLVYTISGAIPIFLFSLFGPMIRRRCPEGFVLTEWVFQRF 60

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +Y+S  +I  MF FM+SEL+A+   +  LTG+D    ++   +VTT+YT  GG  
Sbjct: 61  GPVTALYLSAFTIFTMFLFMLSELTAIEYAIEALTGLDATPAMVVECVVTTIYTFLGGFH 120

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSD--LLKSNSLGWQLLYIMPVAV 235
            S ITD  Q               ATSI I+  +   ++  LL +N LGW LLYI+PVA+
Sbjct: 121 VSFITDAFQAAFVLVLLVIGVVGYATSIHIDMDLKHATEDQLLHANKLGWMLLYILPVAI 180

Query: 236 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEEN 294
                F  GFW R F++K D++L + A   +++   V   +GL G++AVW G +   +EN
Sbjct: 181 ITNDCFLSGFWLRTFAAKTDKDLYIGASIAAVVAGIVCTLVGLPGILAVWTGDMKVYDEN 240

Query: 295 LESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTR 354
             +  AFF L   + +WV G+ ++ ++ +S A +D+L SATT++ SND F N++ +   R
Sbjct: 241 GSN--AFFILVSKMDNWVIGVILIFSIGISTATFDSLQSATTSSISNDFFRNKVNIMWVR 298

Query: 355 FLSLIANVPAV-YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXX 413
           F+ ++  VP++        +VL+++LIADL++AS +P I LGL     FL  +D      
Sbjct: 299 FIVILVMVPSIVVAVKAAANVLQIYLIADLVSASVIPIIFLGLSKRFDFLRGLDVMVGGL 358

Query: 414 XXXXXXXXXXSIFYHNAKDGIELIGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVR 472
                     +I+Y NAK+G  L+ +  G+Y   D+   GAF++AP+      F    +R
Sbjct: 359 GALVAVFIYGTIYYGNAKEGARLLLIWNGIYSDKDWGAFGAFVIAPIGGCLIGFACAAIR 418

Query: 473 LISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSS 516
           +  + +  KI G +    + PEV    +      +DD  + +S 
Sbjct: 419 ISVLKIKDKITGID----RLPEV----EVQQELLEDDESLKKSK 454



>gi|452984112|gb|EME83869.1| hypothetical protein MYCFIDRAFT_162760, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 364

 Score =  263 bits (672), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 139/357 (38%), Positives = 222/357 (62%), Gaps = 2/357 (0%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY     FL  G++  ++ + ++  ++LS+  TQ A  L  N+ AS++GS IL+++
Sbjct: 9   SNALIYCSYVAFLVFGLFIAWRLRGQSAGEWLSANRTQKAFPLALNFIASALGSGILFTY 68

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           P +  +AGL G+++YA  S +PL +FA LGP+IR+KCP+GF LTQ+  +R+G    +Y+S
Sbjct: 69  PNIAALAGLHGLLVYALSSGLPLLIFAALGPIIRRKCPDGFVLTQWTRQRYGTITSLYLS 128

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
             S A ++ +M++ELSA+  ++  LTG++ L  VI    VTT+YT  GG R S +TDNIQ
Sbjct: 129 FFSCATIWLYMVAELSALQQVIKLLTGMNGLPAVIVQCAVTTIYTAAGGFRVSFVTDNIQ 188

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 246
           G              A ++ I+ S+I  S  L++N LGWQLLYI+PVA+     F  GFW
Sbjct: 189 GAMVLLFLIVGVITIAVTVDIDTSLIPVSGYLEANLLGWQLLYILPVAILTNDFFLSGFW 248

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
            RAF++K D++L +     ++ +  +   +G++G+IA W+G+  G   + + +  FTL K
Sbjct: 249 LRAFAAKTDKDLYIGVSIAAVAVALITTLVGVSGLIAGWSGVL-GVPPVATGIELFTLLK 307

Query: 307 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVP 363
            LP WV GI +V+ V++S +A+D+L SA  +  SND F N+L +   R + ++  +P
Sbjct: 308 TLPAWVVGIILVMVVTLSISAFDSLQSALISTGSNDFFRNKLNIWWIRLIVVVLIIP 364



>gi|50551147|ref|XP_503047.1| YALI0D19866p [Yarrowia lipolytica]
 gi|49648915|emb|CAG81239.1| YALI0D19866p [Yarrowia lipolytica CLIB122]
          Length = 504

 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 153/425 (36%), Positives = 238/425 (56%), Gaps = 5/425 (1%)

Query: 79  IMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMI 138
           ++Y   S +P+ +FAW+GP++R++CP+GF LT++   R+G     Y+S ++I  M+ +M+
Sbjct: 1   MVYTISSALPMMLFAWVGPIVRRECPDGFVLTEWTRYRYGWLTSFYLSCLTIGTMYLYMV 60

Query: 139 SELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX 198
           +ELSAV   + TL GVD L  +I  AI T++YT  GG   S  TDNIQG           
Sbjct: 61  AELSAVQAAIETLAGVDALPVLIVEAIFTSIYTAVGGFHTSFFTDNIQGGMVLILLIIVC 120

Query: 199 XXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 258
                   ++ S    S +L+ N L  +L+YI+PVA++    F  GFW R F+SKN+REL
Sbjct: 121 VGLGVYFHVDPSEPKKSGMLEPNLLANKLIYILPVAIATNDCFLSGFWMRTFASKNNREL 180

Query: 259 RLSAVYGSIMLFPVLVFLGLTGMIAVWAGL-WPGEE----NLESYLAFFTLFKVLPDWVS 313
             +    +++   +L  LGLTG++AVWA +   GE+    +  S  AFF +   +P WV 
Sbjct: 181 FWACAIATVLTLVILTVLGLTGLLAVWAKMVVDGEQFVYGDERSANAFFYVLLEMPGWVI 240

Query: 314 GITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD 373
           G T+   +S+S AAYD+ +SA  +  SND F N++P+   R + L  N P +   +K  +
Sbjct: 241 GFTIAFTLSLSVAAYDSNVSAMASTISNDFFRNKVPMVWVRLIVLCINAPVIVVAIKAPN 300

Query: 374 VLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDG 433
           VL +FLIADL +A+ +P +  GL   +YF+   +                SI++ NA +G
Sbjct: 301 VLNIFLIADLFSAAVIPIMFCGLSRKMYFITGWEVIGGGFGGMITVFIFGSIYFKNAHEG 360

Query: 434 IELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 493
           I+L+ L  GLY  D+S  GAF+ AP+ SI + F    +RL  + +++ I  + F    KP
Sbjct: 361 IKLLILLQGLYGDDWSAFGAFVAAPVGSILWGFGILIIRLTVLKIYSMISKKPFTALDKP 420

Query: 494 EVVDT 498
           +   T
Sbjct: 421 DPTQT 425



>gi|119192082|ref|XP_001246647.1| hypothetical protein CIMG_00418 [Coccidioides immitis RS]
          Length = 490

 Score =  260 bits (664), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 207/361 (57%)

Query: 133 MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 192
           +F +M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDN+QG     
Sbjct: 84  LFLYMVAELSALQQIVNALTGLNGLPAVIVQVAVTTIYTSLGGFKVSFMTDNLQGAMVVG 143

Query: 193 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 252
                     T   I++S+ID+S  L ++ LGWQL+YI+PVA+     F   FW R F+S
Sbjct: 144 LIIIGVITVGTKTTIDRSLIDSSGYLNASLLGWQLIYILPVAILTNDFFLSNFWLRTFAS 203

Query: 253 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 312
           K DR+LR+     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV
Sbjct: 204 KTDRDLRIGVSIASFTVLCILVLVGCTGLLAAWSGAWPGDPPQSGSIAFFLLLERLPSWV 263

Query: 313 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 372
            GI +V+ V +S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V   LK  
Sbjct: 264 VGIVLVMTVVLSTAAFDSLQSAMVSTASNDLFRNKLPLIYIRVGVVLCIIPVVVVALKSP 323

Query: 373 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 432
            VL++FLI+DL++AS +P ++LGL D  YF    +                +I+Y +A +
Sbjct: 324 SVLQIFLISDLVSASAIPVLILGLWDKCYFWKGFEVIAGGLGGILSVFIFGTIYYGSAYE 383

Query: 433 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 492
           G  LI L  GLY  D+S  GAF+ AP+    F  ++FG R+   +V  KI+G  F    K
Sbjct: 384 GGRLILLENGLYAEDWSAFGAFVAAPVGGFIFALIAFGSRIAYQFVIAKIQGRRFDAFDK 443

Query: 493 P 493
           P
Sbjct: 444 P 444



>gi|50290383|ref|XP_447623.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526933|emb|CAG60560.1| unnamed protein product [Candida glabrata]
          Length = 559

 Score =  258 bits (660), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 165/477 (34%), Positives = 269/477 (56%), Gaps = 6/477 (1%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFP 67
           ++ +I+    + L       Y K  +K+ +LS+ GTQ A+ L  N+ AS +G  +L ++P
Sbjct: 9   AHAIIWPTYGVLLITASMVAYWKRDSKT-FLSANGTQKAIPLAFNFVASGLGCGVLSTYP 67

Query: 68  EVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSL 127
           ++  + GL G+++YA    +P+FVFA+LGPLIRKK P GF LT++V  RFG     Y+S 
Sbjct: 68  QIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLLCGWYLSA 127

Query: 128 MSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG 187
            +I  ++ F++SE++++   + TLT ++ L  +I   +VTT+YT  GG   S +TD++Q 
Sbjct: 128 CTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMTDSLQV 187

Query: 188 WAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQ 247
                          + I I++ +I  S LLK N LGWQL+YI+ VA+     F  GFW 
Sbjct: 188 SIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDFFMSGFWL 247

Query: 248 RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKV 307
           R F+S+++++L +       +L   +  +G+TG IAVWAGL P  +   S  AF+ L   
Sbjct: 248 RTFASRSNKDLLIGCSLACFILVTFVTVVGVTGFIAVWAGLLPARDQENSGAAFYLLLAQ 307

Query: 308 LPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYW 367
           LP W+ G T+V    +S    D+L SA  +  SND+F N+L + + R + +   VP V  
Sbjct: 308 LPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLVRGIVVAIMVPVVVV 367

Query: 368 GLKDLDVLRVFLIADLLAASTMPPILLGL---IDSLYFLNWIDXXXXXXXXXXXXXXXXS 424
           GL   DVL ++LI DLL++S +P +++GL   +D ++   W +                +
Sbjct: 368 GLIAQDVLSIYLIVDLLSSSVVPVLVVGLWGKLDEIWS-AW-EVIGGGCAGILGVWIFGT 425

Query: 425 IFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 481
           ++YH+AK+G  L+ +  GLY  D+   GAF+VAP + +  + +   +RL  M ++ K
Sbjct: 426 VYYHSAKEGGRLLLISNGLYADDWGAFGAFVVAPGAGLVCSVIILAIRLSLMKLYKK 482



>gi|303313113|ref|XP_003066568.1| hypothetical protein CPC735_057930 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240106230|gb|EER24423.1| hypothetical protein CPC735_057930 [Coccidioides posadasii C735
           delta SOWgp]
 gi|320036548|gb|EFW18487.1| urea transporter [Coccidioides posadasii str. Silveira]
          Length = 403

 Score =  257 bits (656), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 141/357 (39%), Positives = 204/357 (57%)

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 196
           M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDN+QG         
Sbjct: 1   MVAELSALQQIVNALTGLNGLPAVIVQVAVTTIYTSLGGFKVSFMTDNLQGAMVVGLIII 60

Query: 197 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 256
                 T   I++S+ID+S  L ++ LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 61  GVITVGTKTTIDRSLIDSSGYLNASLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 120

Query: 257 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 316
           +LR+     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 121 DLRIGVSIASFTVLCILVLVGCTGLLAAWSGAWPGDPPQSGSIAFFLLLERLPSWVVGIV 180

Query: 317 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 376
           +V+ V +S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V   LK   VL+
Sbjct: 181 LVMTVVLSTAAFDSLQSAMVSTASNDLFRNKLPLIYIRVGVVLCIIPVVVVALKSPSVLQ 240

Query: 377 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 436
           +FLI+DL++AS +P ++LGL D  YF    +                +I+Y +A +G  L
Sbjct: 241 IFLISDLVSASAIPVLILGLWDKCYFWKGFEVIAGGLGGILSVFIFGTIYYGSAYEGGRL 300

Query: 437 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 493
           I L  GLY  D+S  GAF+ AP+    F  ++FG R+   +V  KI+G  F    KP
Sbjct: 301 ILLENGLYAEDWSAFGAFVAAPVGGFIFALIAFGSRIAYQFVIAKIQGRRFDAFDKP 357



>gi|164656775|ref|XP_001729515.1| hypothetical protein MGL_3550 [Malassezia globosa CBS 7966]
 gi|159103406|gb|EDP42301.1| hypothetical protein MGL_3550 [Malassezia globosa CBS 7966]
          Length = 589

 Score =  249 bits (637), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 159/432 (36%), Positives = 244/432 (56%), Gaps = 12/432 (2%)

Query: 73  AGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAY 132
           AGL G+  YAF +I PL+ FA+ GPLIR  CP+GFTL +FV  RFG    I+ +++ I +
Sbjct: 7   AGLFGLGAYAFSTIAPLWAFAFFGPLIRHYCPDGFTLAEFVRRRFGWVIGIFSAMVFIGF 66

Query: 133 MFCFMISELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXX 191
           MFCFMI EL+    I+ ++   + K+ P + IA+ TT+YT YGG +ASL TDN       
Sbjct: 67  MFCFMIVELNTYSVIVRSIQPDISKVIPPLIIALTTTIYTTYGGFKASLWTDNFNAIVVI 126

Query: 192 XXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFS 251
                        + I+K ++ +S +L ++ LG +L YI+ +++ F+ +F++GFWQRAF+
Sbjct: 127 VFIIIGAVMFGKRLDIDKDLMHDSGMLGAHRLGGELWYILTISIIFSQMFNQGFWQRAFA 186

Query: 252 SKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP----GEENLESY----LAFFT 303
           SK +  L LS    +I LF +   +G+ G +A W+ + P      E+   Y     A F 
Sbjct: 187 SKTNTGLYLSVAMATIPLFAICFLVGMAGPLAYWSHVQPPLNTSTEDTSLYDDGSNALFR 246

Query: 304 LFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVP 363
               +P WV G+ +VL   +S +AYDT  SA  +   +D+  +R+ +   R + ++ NVP
Sbjct: 247 ALLYMPKWVHGLVLVLTGVLSSSAYDTFQSAMISVIESDLLLSRVNIWWCRLILIMFNVP 306

Query: 364 AVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXX 423
            V   + D+D+L+VFL+ADL   + +P + LGL   L  LN  D                
Sbjct: 307 CVALAVIDIDILQVFLVADLAGLAVIPSVFLGLAPRLDVLNGFDLVVGGCGGFLTVFVFG 366

Query: 424 SIFYH-NAKDGIELIGLPLGLY--ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFT 480
           +I+Y+ +A +G +LIGLP GLY    DYSV+GAF+ APL  + FT  S G R++  W++ 
Sbjct: 367 TIYYNGDAIEGGQLIGLPNGLYGDPDDYSVIGAFLAAPLGGMGFTLASCGTRILLGWLYA 426

Query: 481 KIRGEEFVFPKK 492
           +I    F   +K
Sbjct: 427 RITNTPFTMLRK 438



>gi|261193629|ref|XP_002623220.1| urea transporter [Ajellomyces dermatitidis SLH14081]
 gi|239588825|gb|EEQ71468.1| urea transporter [Ajellomyces dermatitidis SLH14081]
          Length = 417

 Score =  247 bits (631), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 204/351 (58%)

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 196
           M++ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDN+QG         
Sbjct: 1   MVAELSALQQIITALTGLDGLPVVIVEVAVTTIYTSLGGFKVSFVTDNLQGAMVVGLIII 60

Query: 197 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 256
                 T + I+++++++S  L+ + LGWQL+YI+P+A+     F   FW R F+SK DR
Sbjct: 61  AVITVGTEVNIDRALVESSGFLEPSLLGWQLIYILPIAILTNDFFLSNFWLRTFASKTDR 120

Query: 257 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 316
           +LR+     S  +F +L  +G++G++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 121 DLRIGVSIASGAIFCILTLVGVSGLLAAWSGAWPGDPPQLGSIAFFLLLEKLPAWVVGIV 180

Query: 317 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 376
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P +   L    VL+
Sbjct: 181 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVIVVALMSPSVLQ 240

Query: 377 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 436
           +FLI+DL++AS++P ++ GL D +Y+    +                +I+Y +A  G +L
Sbjct: 241 IFLISDLVSASSIPVLVFGLWDKVYWWTGFEVVVGGLGGIFSVFIFGTIYYGDAHAGAKL 300

Query: 437 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 487
           I L  GLY  D+SV GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 301 ILLENGLYAKDWSVFGAFLAAPLGGILFAIAALILRLGYHYLLAKSQHRRF 351



>gi|302309420|ref|NP_986821.2| AGR155Cp [Ashbya gossypii ATCC 10895]
 gi|299788351|gb|AAS54645.2| AGR155Cp [Ashbya gossypii ATCC 10895]
 gi|374110070|gb|AEY98975.1| FAGR155Cp [Ashbya gossypii FDAG1]
          Length = 563

 Score =  244 bits (622), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 166/470 (35%), Positives = 271/470 (57%), Gaps = 3/470 (0%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS V +N +++   A+ L +     Y+  +N   +LS+ GTQ AV L  N+ AS +G  +
Sbjct: 65  LSYVAANAIVWPTYAVMLAVASVLAYR-LRNVRTFLSANGTQKAVPLALNFIASGLGCGV 123

Query: 63  LYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
           L ++P++  +AGL G+++Y   S +P++VFA+ GPLI++ CP+GF LT++VL RFGR   
Sbjct: 124 LLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAA 183

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           +Y+S  +I  ++ FM+SE+ ++   +  L+ +  +  V+   +VTT+YT  GG   S +T
Sbjct: 184 LYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPVVVVQCVVTTIYTAIGGFHISFVT 243

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           D++Q                TS++I+ + I  S LL+ + LGWQL+YI+ VA+     F 
Sbjct: 244 DSLQATVVLLLVVVGAVAVGTSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTNDFFM 303

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 302
            GFW R F+++++R+L L     +++L  VL+ +G+TG++AVWAG  P   +L+S  +FF
Sbjct: 304 SGFWLRTFAARSNRDLLLGCSLAAVLLAVVLLLVGVTGLLAVWAGYAP-VADLDS-ASFF 361

Query: 303 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 362
            L   LP W +G+ + L V +S    D+  SA  +  SND+F NRLP    R    +  V
Sbjct: 362 LLLAALPAWANGVVLALVVVLSTCTLDSFQSALVSTISNDLFRNRLPPLYARAAVAVVMV 421

Query: 363 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXX 422
           P V  GL   D+L ++LI DLL+A+ +P +LLG       L+  +               
Sbjct: 422 PVVVVGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARLSAWELIGGGLGGLLCVFVF 481

Query: 423 XSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 472
            +I+Y +A++G  L+ +  GLY+ D+   GA +VAPL S+ F  + F +R
Sbjct: 482 GAIYYRSAREGGRLLIIANGLYVDDWGTFGAMVVAPLGSLLFAAIIFALR 531



>gi|325094525|gb|EGC47835.1| urea transporter [Ajellomyces capsulatus H88]
          Length = 428

 Score =  240 bits (612), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 207/355 (58%)

Query: 133 MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 192
           +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG     
Sbjct: 7   LFLYMVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVG 66

Query: 193 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 252
                     T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+S
Sbjct: 67  LIVIAVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFAS 126

Query: 253 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 312
           K DR+LR+     S  +F +L  +G+TG++A W+G WPG       +AFF L + LP WV
Sbjct: 127 KTDRDLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGNPPQLGSIAFFLLLEQLPGWV 186

Query: 313 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 372
            GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK  
Sbjct: 187 VGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSP 246

Query: 373 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 432
            VL++FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  
Sbjct: 247 SVLQIFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHA 306

Query: 433 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 487
           G +LI L  GLY  D+S  GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 307 GAKLILLGNGLYAEDWSAFGAFVAAPLGGILFGIGALLLRLSYHYLLAKWQHRRF 361



>gi|302419953|ref|XP_003007807.1| urea transport protein [Verticillium albo-atrum VaMs.102]
 gi|261353458|gb|EEY15886.1| urea transport protein [Verticillium albo-atrum VaMs.102]
          Length = 512

 Score =  240 bits (612), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 152/442 (34%), Positives = 240/442 (54%), Gaps = 30/442 (6%)

Query: 56  SSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLE 115
           + +GSS+L+++PE+ TI G+ GVI+YA  S +PL +FA LG +IR+K PEGF LT++  +
Sbjct: 54  AGLGSSVLFAYPELATITGVQGVIVYALSSSLPLLIFAALGSIIRRKTPEGFVLTEWTRQ 113

Query: 116 RFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGG 175
           R+G    +Y+S  ++  +F ++ +ELSA+G ++ TLTGV++L  ++    VTT+YT  GG
Sbjct: 114 RYGTAAMLYLSAATLFTLFLYLTAELSAIGQVVTTLTGVNQLPVMLVQVAVTTIYTSLGG 173

Query: 176 LRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAV 235
            + S +TDNIQG                   I+ S+I  S+ LK   LGWQLLYI+PV +
Sbjct: 174 FKISFVTDNIQGGMVICLIVIAAATIGALTDIDTSLIRESEFLKPTLLGWQLLYILPVCI 233

Query: 236 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENL 295
                F   +W RAF+SK D++L +     S+    +L +  L  ++       PG    
Sbjct: 234 LTNNFFLSNYWLRAFASKTDKDLWIGV---SLATTVILGYFRLGCLLHS-----PGSS-- 283

Query: 296 ESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRF 355
                        P WV G+ +V+ V+MSC+A+DTL SA  ++ SND+F NRL +   R 
Sbjct: 284 -------------PSWVIGVVLVMVVTMSCSAFDTLQSAMVSSASNDLFRNRLNIWWIRA 330

Query: 356 LSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXX 415
             L+  +PA+   L+   VL+++LI+DL++A  +P + +GL +  Y+    +        
Sbjct: 331 GILLIIIPAIVIALEAPSVLQIYLISDLVSACIVPVLCIGLSNKCYWWRGFEVIVGGLGG 390

Query: 416 XXXXXXXXSIFY----HNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGV 471
                    I+Y    H A +   L+ +  GLY  D+SV G F+ AP+ SI + F +   
Sbjct: 391 ILTSFLFGVIYYDGDVHRAGN---LLLISEGLYADDWSVFGVFVAAPVGSIVWGFAALAC 447

Query: 472 RLISMWVFTKIRGEEFVFPKKP 493
           RL   ++  K  G  F    +P
Sbjct: 448 RLSFQYIQAKRSGCRFDALDRP 469



>gi|240275165|gb|EER38680.1| urea transporter [Ajellomyces capsulatus H143]
          Length = 428

 Score =  239 bits (609), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 206/355 (58%)

Query: 133 MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 192
           +F +M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG     
Sbjct: 7   LFLYMVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVG 66

Query: 193 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 252
                     T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+S
Sbjct: 67  LIVIAVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFAS 126

Query: 253 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 312
           K DR+LR+     S  +F +L  +G+TG++A W+G WPG       +AFF L + LP WV
Sbjct: 127 KTDRDLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGNPPQLGSIAFFLLLEQLPGWV 186

Query: 313 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 372
            GI +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK  
Sbjct: 187 VGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSP 246

Query: 373 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 432
            VL++FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  
Sbjct: 247 SVLQIFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHA 306

Query: 433 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 487
           G +LI L  GLY  D+S  GAF+ APL  I F   +  +RL    +  K +   F
Sbjct: 307 GAKLILLGNGLYAEDWSAFGAFVAAPLGGILFGIGALLLRLSYHHLLAKWQHRRF 361



>gi|403216744|emb|CCK71240.1| hypothetical protein KNAG_0G01820 [Kazachstania naganishii CBS
           8797]
          Length = 565

 Score =  238 bits (606), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 155/476 (32%), Positives = 263/476 (55%), Gaps = 6/476 (1%)

Query: 6   VVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           +   V+  V+L +   I + A +++   K  ++S+  TQ+A+ L  N+  S IG  +  +
Sbjct: 11  ITGGVIWPVLLVLGASISLLAYWRRDPKK--FISANKTQSALPLSLNFIGSGIGCGLFAA 68

Query: 66  FPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYV 125
           FP++  IAGL G+ +YA    +P+++FA+LGPLIRKK P GF LT++V  R+G     Y+
Sbjct: 69  FPQIANIAGLHGLFVYAIIGSLPMYLFAFLGPLIRKKTPNGFLLTEWVFHRYGLICSWYL 128

Query: 126 SLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 185
           SL ++  +F F + + S++   +V LTG+D L  +I  A++TT YT  GG   S +TD+ 
Sbjct: 129 SLCTLLTLFLFAVGDFSSLKICVVALTGMDPLPVIIAEAVITTCYTTIGGFGISFLTDSF 188

Query: 186 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 245
           Q +                  I+   + +  LL +N LGWQL+YI+ +A+    LF  GF
Sbjct: 189 QVYIGISLMLILGYGIRGYTTIDMEKVASVGLLSTNKLGWQLVYILTIAIFTNDLFLNGF 248

Query: 246 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 305
           W R F+S++DR+L+++     I+L    +F+G  G +AV AGL    +   S  AFF L 
Sbjct: 249 WLRTFASRSDRDLKIACTVSCIVLTIFCIFVGSAGFLAVGAGLLDSNDP-NSGSAFFLLL 307

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
             LP++   + ++  V++S  + D+  S   +  SND+F N+L +   R + +I  +P V
Sbjct: 308 NALPEFFLQVALISFVTLSVCSLDSQQSCLVSTISNDLFRNKLKIKWARLMVIIIIIPIV 367

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXXXXX 423
              L   ++L +++  DLL++S +P +++G I  L  Y+ +W +                
Sbjct: 368 LLSLFAENILSIYMFVDLLSSSVIPTLVVGFIPDLEAYWTSW-EVIGGGFGGLFCTFLFG 426

Query: 424 SIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 479
           + +Y + K+G++L+ +  GLY  D+S  GAF+ APL  I  + L  GVRL ++ +F
Sbjct: 427 TFYYSDFKEGVKLLLIWNGLYAEDWSTFGAFVTAPLGGIIVSLLIMGVRLYAIELF 482



>gi|225558773|gb|EEH07057.1| urea transporter [Ajellomyces capsulatus G186AR]
          Length = 418

 Score =  237 bits (604), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 205/351 (58%)

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 196
           M++ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG         
Sbjct: 1   MVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVGLIVI 60

Query: 197 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 256
                 T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 61  AVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 120

Query: 257 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 316
           +LR+     S  +F +L  +G+TG++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 121 DLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGDPPQLGSIAFFLLLEQLPGWVVGIV 180

Query: 317 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 376
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK   VL+
Sbjct: 181 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSPSVLQ 240

Query: 377 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 436
           +FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  G +L
Sbjct: 241 IFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHAGAKL 300

Query: 437 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 487
           I L  GLY  D+S  GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 301 ILLGNGLYGEDWSAFGAFVAAPLGGILFGIGALLLRLSYHYLLAKRQHRRF 351



>gi|260943103|ref|XP_002615850.1| hypothetical protein CLUG_04732 [Clavispora lusitaniae ATCC 42720]
 gi|238851140|gb|EEQ40604.1| hypothetical protein CLUG_04732 [Clavispora lusitaniae ATCC 42720]
          Length = 311

 Score =  231 bits (589), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 174/297 (58%), Gaps = 1/297 (0%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +G  IL ++ ++G I+GL G+++Y     IP+  FA +GP+IRKKCP+GF +T++V  RF
Sbjct: 1   MGCGILATYAQIGNISGLHGLMVYTLSGAIPIVGFAIMGPMIRKKCPDGFIMTEWVRRRF 60

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +YVS  +   MF FMI E+SAV + + TLTG++ L  VI   +VTT+YT +GG R
Sbjct: 61  GIVTALYVSFFTCLTMFLFMIGEVSAVKSAIETLTGLNGLGAVIVECVVTTIYTAFGGFR 120

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S ITDN QG               + I I+ S I  S LL +N LGWQLLYI+PVA+  
Sbjct: 121 VSFITDNFQGVLVVLLVVICAAGMGSYIDIDTSKIGPSHLLDANKLGWQLLYILPVAIIT 180

Query: 238 ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES 297
              F  GFW R F+SK DR+L + A   S + F +   +G TG +AVWAG +    + + 
Sbjct: 181 NDCFMAGFWLRTFASKTDRDLWIGAGIASFVTFAICTLVGTTGFLAVWAG-YIDVNDEDG 239

Query: 298 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTR 354
             AFF +   +P W+    ++  + +S   +D+L SA  +  SND+F N+L +   R
Sbjct: 240 GNAFFIMLSHMPRWLIAFVLIFVICLSTCTFDSLQSAMVSTISNDVFRNKLDMIYVR 296



>gi|485923385|gb|EOD48562.1| putative urea transporter protein [Neofusicoccum parvum UCRNP2]
          Length = 349

 Score =  231 bits (589), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 203/345 (58%)

Query: 128 MSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG 187
           M++  +F +M++ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDNIQG
Sbjct: 1   MTLITLFLYMVAELSALQQIVTALTGLDGLPAVIVECAVTTIYTSLGGFKVSFVTDNIQG 60

Query: 188 WAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQ 247
                              I++S+ID+S  L+S+ LGWQL+YI+PVA+     F  GFW 
Sbjct: 61  VMVLGLIIIGVITVGVETHIDRSLIDSSGYLESSLLGWQLIYILPVAILTNDFFISGFWL 120

Query: 248 RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKV 307
           R F+S+ DR+LR+     ++++  +L  +G TG++A W+G+WPG+   E  +AFFTL   
Sbjct: 121 RTFASRTDRDLRIGTTIATVVVTIILTLVGCTGLLAAWSGVWPGDPPQEGSIAFFTLLAT 180

Query: 308 LPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYW 367
           LP WV GI +V+ V++S AA+D+  SA  +  SND+F N LPL   R   + A VP V  
Sbjct: 181 LPAWVVGIVLVMVVALSTAAFDSFQSAMVSTGSNDLFRNALPLWCIRAAVVAAIVPVVVV 240

Query: 368 GLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFY 427
            L+   VL+V+LI+DL++AS +P +++GL D+ ++ +  +                +++Y
Sbjct: 241 ALRSPSVLQVYLISDLVSASLVPVLVVGLCDACWWWSGAEVVVGGLGGIFTVFLFGTVYY 300

Query: 428 HNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 472
            NA+DG  LI L  GLY  D+S  GAF+ AP+        S GV 
Sbjct: 301 CNARDGGRLILLENGLYGDDWSAFGAFVAAPVGDAVCGAGSAGVE 345



>gi|344301867|gb|EGW32172.1| hypothetical protein SPAPADRAFT_61262 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 392

 Score =  229 bits (584), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 134/359 (37%), Positives = 205/359 (57%), Gaps = 6/359 (1%)

Query: 133 MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 192
           MF FM+ ELSA+   L TLTGV+ LA VI   +VTT+YT +GG R S ITDN QG     
Sbjct: 1   MFLFMVGELSAISGALETLTGVNALAAVIVECVVTTIYTFFGGFRISFITDNFQGACVLI 60

Query: 193 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 252
                     + I I+ S +  S LLKSN LGWQL+YI+ VA+     F  GFW R F+S
Sbjct: 61  LLIICAAGMGSYIEIDPSKVGPSGLLKSNKLGWQLVYILFVAIVTNDCFLSGFWLRTFAS 120

Query: 253 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDW 311
           K D++L +     + + F +   +G+ G +AVW+G L  G++  E Y AFF L   +P W
Sbjct: 121 KTDKDLWIGTSLAAFVTFVITTLVGVPGFLAVWSGDLTVGDD--EGYNAFFILLAKMPRW 178

Query: 312 VSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKD 371
           +    ++  V +S   +D+L SA  +  SND+F N+L L+ TR + ++  VP V   +K 
Sbjct: 179 LVAFVIIFCVVLSTCTFDSLQSAMVSTISNDVFRNKLQLHWTRCIVILVMVPIVVLAVKV 238

Query: 372 LD-VLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHN 429
            D +L+++LIADL++A+ +P + LGL DS  +FL   D                +++Y +
Sbjct: 239 ADNILQIYLIADLVSAAIIPALFLGLSDSWFWFLRGFDIMCGGLGALLGVFIFGTVYYGS 298

Query: 430 AKDGIELIGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 487
           A++G +L+ +  G+Y + D+   GAF++AP   I  T ++ GVR+   + ++K  G+ F
Sbjct: 299 AREGGKLLLIWNGIYSSEDWGAFGAFVIAPFGGILITLVAAGVRIAGAYCYSKATGKPF 357



>gi|361125484|gb|EHK97525.1| putative Eukaryotic translation initiation factor eIF-1 [Glarea
           lozoyensis 74030]
          Length = 517

 Score =  226 bits (575), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 140/368 (38%), Positives = 207/368 (56%), Gaps = 4/368 (1%)

Query: 130 IAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWA 189
           +A MF +M++ELSA+  I+  LTG+D L  VI   +V T+YT  GG + S ITDNIQG  
Sbjct: 1   MATMFLYMVAELSALQQIMTALTGMDGLPMVIVQCVVATIYTSLGGFKISFITDNIQGAM 60

Query: 190 XXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRA 249
                            I+ S+ID+S L +++ LGWQLLYI+PVAV     F   FW RA
Sbjct: 61  VVCLIIIATITIGVKTDIDTSLIDSSGLTQASLLGWQLLYILPVAVLTNDFFLSNFWIRA 120

Query: 250 FSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVL 308
           F+SK D++L +     ++++  +L  +G TG+IAVW+G L P +      +AFF L + L
Sbjct: 121 FASKTDKDLWIGISIAAVVVLIILTLIGCTGLIAVWSGALGPDDIESSGSIAFFLLLERL 180

Query: 309 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWG 368
           P WV GI +V+ VS+S AA+D+  SA  +  SND+F N+L +   R   ++  VP +   
Sbjct: 181 PAWVVGIVLVMVVSLSTAAFDSFQSAMVSMGSNDLFRNKLNIWFIRAAVVLLIVPVIILA 240

Query: 369 LKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH 428
           LK   +L+++LI+DL +AS++P ++LGL D  Y+    +                +I+Y 
Sbjct: 241 LKAPSILQIYLISDLFSASSIPVLILGLSDRFYWWRGFEVVVGGLGGIITVFIFGTIYYG 300

Query: 429 NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFV 488
           NA+ G +LI L  GLY  D+SV GAF+ AP+  + +    FG  + S   F+        
Sbjct: 301 NAQAGADLILLEGGLYANDWSVFGAFVAAPVGGLLW---GFGAFVPSTHTFSYFSPSTIS 357

Query: 489 FPKKPEVV 496
            P KPE V
Sbjct: 358 TPSKPETV 365



>gi|507524472|ref|YP_008046085.1| solute symporter-like protein [Spiribacter salinus M19-40]
 gi|511292660|ref|WP_016352927.1| solute symporter-like protein [Spiribacter salinus]
 gi|507224482|gb|AGM40620.1| solute symporter-like protein [Spiribacter salinus M19-40]
          Length = 461

 Score =  217 bits (552), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 138/393 (35%), Positives = 219/393 (55%), Gaps = 18/393 (4%)

Query: 12  IYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT 71
           I V+L IF+ IG  A  +      DYL++  +Q+ + LG ++ AS +G+ IL++ PEVG 
Sbjct: 9   IAVILLIFVAIGSQA--RSIGGLDDYLTARQSQSGLTLGLSFLASGMGAWILFAPPEVGA 66

Query: 72  IAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIA 131
             G + V  YA GS +P  V   +GP IR++ P G +LT+F   RFG   + +VS++S+ 
Sbjct: 67  FVGPVAVAGYALGSALPFVVLGVIGPTIRRQLPAGRSLTEFAASRFGGAMRRWVSILSVL 126

Query: 132 YMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXX 191
           YM CF+ +EL+A+G I   L+G+D    ++ +A+ T +YT  GGLRASL+TD  Q W   
Sbjct: 127 YMLCFLAAELTAIGAITTLLSGLDGRYVIVGVALATLIYTAIGGLRASLLTDRWQAWLLV 186

Query: 192 XXXXXXXXXXATSIRIEK------SVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 245
                                   S + N+ L  + SLG  L  I  +AV+ A LFH+G+
Sbjct: 187 GLVGLVAFAALALAPARPGEAAPTSTLPNTGL--AASLGVALTLI--IAVTAANLFHQGY 242

Query: 246 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 305
           WQR +++++DR L+ +A+ G      V+  LG  G++A   GL  G   +     FF L 
Sbjct: 243 WQRVWAARDDRALKTAALVGGASTVGVVAVLGGAGILAGLRGLPLGSPPIP----FFALL 298

Query: 306 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 365
              P W++   +VLA+++  ++ DTL +A  +    +  +  + L   R+LS +  +P V
Sbjct: 299 SEAPQWLALPALVLAITLVASSVDTLQNALVSLGVTE--SQAMGLTGARWLSALLMLPVV 356

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGLID 398
              L+++ VLR+FLIADLL A+ + P+L GL +
Sbjct: 357 GLALQEISVLRLFLIADLLCATAVVPLLSGLSE 389



>gi|169594868|ref|XP_001790858.1| hypothetical protein SNOG_00164 [Phaeosphaeria nodorum SN15]
 gi|160700958|gb|EAT91659.2| hypothetical protein SNOG_00164 [Phaeosphaeria nodorum SN15]
          Length = 395

 Score =  206 bits (525), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 207/385 (53%), Gaps = 1/385 (0%)

Query: 133 MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 192
           MF +M++ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQG     
Sbjct: 1   MFLYMVAELSALQQIVTLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFLTDNIQGVMVLG 60

Query: 193 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 252
                         I++S+ID S  LK + LGWQL+YI+PVA+     F  GFW R F++
Sbjct: 61  LIIMGVIAVGVETNIDRSLIDQSGYLKPSLLGWQLIYILPVAILTNDFFLSGFWLRTFAA 120

Query: 253 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 312
           + D++L +     S  +  +L  +G+ G++A W+G     +    Y++ F L + LP WV
Sbjct: 121 RTDKDLWIGVSLASFGVLVILTLVGVAGLLAAWSGALQLGDAEGGYISLFLLLQQLPSWV 180

Query: 313 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 372
            G+ +V+ +S+S AA+D+  SA  +  SND+F N+L + V R   ++  +P V   L+  
Sbjct: 181 VGVVLVMVMSLSTAAFDSFQSAMVSTGSNDLFRNKLNIWVIRGCVVLIIIPVVVVALRSP 240

Query: 373 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAK 431
           D+L++FLI+DL++A+ +P +++GL +  Y+    D                 ++Y  +  
Sbjct: 241 DILQIFLISDLVSAAVVPCLVIGLSEKFYWYRGFDFVIGGLGGIFTIFLFGLVYYDGDVT 300

Query: 432 DGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPK 491
              +L+ L  GLY  D+S  GAF+ AP   + + F +  +R+  +W+  +++G  F    
Sbjct: 301 QAGKLLLLENGLYANDWSAFGAFVAAPFGGLLWAFGACALRIGFLWIMARVKGHRFDAFD 360

Query: 492 KPEVVDTKKYAGNKFKDDTEIIQSS 516
           KP    T +      +++  +++  
Sbjct: 361 KPVPRHTARLGAFDEQENDAVLEHG 385



>gi|496243989|ref|WP_008957374.1| sodium:solute symporter [Halomonas sp. HAL1]
 gi|350600213|gb|EHA16283.1| hypothetical protein HAL1_07285 [Halomonas sp. HAL1]
          Length = 459

 Score =  193 bits (491), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 197/361 (54%), Gaps = 6/361 (1%)

Query: 36  DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
           DY+++  +Q A  LG ++ AS +G+ IL++ PE+G   G L +  YA GS +P  V    
Sbjct: 32  DYVTARNSQTASTLGLSFLASGMGAWILFAPPEIGAFVGPLALAGYALGSALPFIVLGLY 91

Query: 96  GPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVD 155
           GP IR+  PEG ++ +F    +G   + +V+L+S+ YM CF+ +EL+A+G I   L+ V 
Sbjct: 92  GPKIRRALPEGRSIAEFAEACYGPGVRRWVTLVSVGYMACFLAAELTAIGAITALLSDVP 151

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 215
               +I +A+ T +YT  GGLRASL TD  Q W                +    S     
Sbjct: 152 PALVIIGVALTTLVYTAVGGLRASLATDRWQAWLLLALLLAVGSVTLWRLPTMPSEATLP 211

Query: 216 DLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVF 275
            +  +++L   L  +  +AV+ A LFH+G+WQR +++++D+ L   A  G  M   V++ 
Sbjct: 212 SIPVTSALSVALTLV--IAVTAANLFHQGYWQRVWAARDDQSLGRGAWLGGGMTVVVVML 269

Query: 276 LGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISAT 335
           +G  GM+A  +G+  GE  +     FF L    P W++   +VLAV++  ++ DTL +  
Sbjct: 270 IGGLGMLATMSGVPLGEPPMP----FFALLTEAPAWLTLPALVLAVTLVASSVDTLQNGI 325

Query: 336 TANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLG 395
            +   +      + +   R++++   +P V   L+ L VLR+FLIADLL A+ + P+LLG
Sbjct: 326 ASLVVSRSEQRGVSIAAARWVTIALMMPVVVIALQGLSVLRLFLIADLLCAAIVVPVLLG 385

Query: 396 L 396
           L
Sbjct: 386 L 386



>gi|501087544|ref|WP_012137811.1| solute symporter-like protein [Marinobacter lipolyticus]
 gi|499161817|gb|EON92887.1| solute symporter-like protein [Marinobacter lipolyticus SM19]
          Length = 454

 Score =  187 bits (474), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 127/386 (32%), Positives = 214/386 (55%), Gaps = 12/386 (3%)

Query: 12  IYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT 71
           + V L +F  +G+ A         D++++  TQ A ALG ++ AS +G  IL++ PEVG 
Sbjct: 9   LAVALILFTWLGVRARLAD-GGLDDFVTARNTQGARALGLSFLASGMGGWILFAPPEVGA 67

Query: 72  IAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIA 131
           + G L +  YA G+ +P  VFA+ GP IR+  P+G ++ +F    +G   + YVSL+S+ 
Sbjct: 68  LVGPLALAGYALGAALPFIVFAFCGPAIRRLLPQGRSIGEFAQACYGNGVRRYVSLISVL 127

Query: 132 YMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXX 191
           YM CF+ +EL+A+G I   L+ V+    V+ +A  T +YT +GGLRASL+TD    W   
Sbjct: 128 YMLCFVTAELTAIGAITSLLSNVNGNLAVVAVASATLIYTAWGGLRASLVTDQ---WQAF 184

Query: 192 XXXXXXXXXXATSI-RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAF 250
                       +I R+ +  +D+S  +   S    +   + +AV+ A LFH+G+WQR +
Sbjct: 185 LLIALLIIVGVVAINRLPEISLDHSPSVPVGS-ALSVALTLVIAVTAANLFHQGYWQRLW 243

Query: 251 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPD 310
           S+++   L+  A +G I+   V+  +G  G+ A  +G   G   +     FF +    P 
Sbjct: 244 SARDTSSLQRGAFFGGIITIAVVALVGSMGIAAAMSGTDLGNPPIP----FFAMLSGAPA 299

Query: 311 WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLK 370
           W++   +VLA+++  ++ DTL +A  +    +     L L   R+++++  +P V   L+
Sbjct: 300 WLTIPALVLALTLVASSVDTLQNALASLAVTE--KKGLSLTAARWITVLLMIPVVLVALQ 357

Query: 371 DLDVLRVFLIADLLAASTMPPILLGL 396
            + VLR+FLIADLL A+ + P+L+GL
Sbjct: 358 GISVLRLFLIADLLCATAVIPVLMGL 383



>gi|490716886|ref|WP_004579451.1| solute symporter-like protein [Marinobacter nanhaiticus]
 gi|478770607|gb|ENO15155.1| solute symporter-like protein [Marinobacter nanhaiticus D15-8W]
          Length = 455

 Score =  186 bits (472), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 207/364 (56%), Gaps = 14/364 (3%)

Query: 36  DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
           DY+++  +Q A ALG ++ AS +G  IL++ PEVG + G +G+  YA G+ +P  VFA+ 
Sbjct: 31  DYVTARNSQGARALGLSFLASGMGGWILFAPPEVGALVGPIGLAGYALGAALPFIVFAFC 90

Query: 96  GPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVD 155
           GP IR+  P G ++ +F    +G   + +V+L+S+ YM CF+ +EL+AVG I   LT ++
Sbjct: 91  GPAIRRHLPHGRSIGEFAQTCYGTGMRRWVALISVLYMLCFLTAELTAVGAITGLLTDLN 150

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 215
               ++ +A  T +YT +GGLRASL+TD    W               ++    S +D +
Sbjct: 151 GNVAILGVAGATLIYTAWGGLRASLVTDR---WQALLLVGLILVVGFVALPGLPSPVDRT 207

Query: 216 DLLKS---NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPV 272
            +  +   ++LG  L  ++  AV+ A LFH+G+WQR +++++   L   A+ G ++   V
Sbjct: 208 PMPSAPIGSALGVALTLVL--AVTAANLFHQGYWQRVWAARDGAALGQGAILGGVITIAV 265

Query: 273 LVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLI 332
           +  +G  G+ A  +G+  G   +     FF L    PDW++ + ++LA+++  ++ DTL 
Sbjct: 266 VALVGGLGVTAAMSGVDLGSPPIP----FFALLSQAPDWLALVALILALTLVASSVDTLQ 321

Query: 333 SATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPI 392
           +   +    +   + L L+  R++++   VP V   L+   VLR+FLIADLL A+ + P+
Sbjct: 322 NGLASLAVTE--KSGLSLSAARWITVGLMVPVVLIALQGYSVLRLFLIADLLCATAVIPV 379

Query: 393 LLGL 396
           L+GL
Sbjct: 380 LMGL 383



>gi|219129440|ref|XP_002184897.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403682|gb|EEC43633.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 578

 Score =  184 bits (467), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 133/416 (31%), Positives = 223/416 (53%), Gaps = 34/416 (8%)

Query: 11  LIYVVLAIF--LGIGIYAGY----------------KKTKNKSDY-LSSLGTQNAVALGS 51
           ++Y VL  F  LG+G  AGY                 ++  ++DY LS+  +    A+  
Sbjct: 13  VLYCVLCFFTLLGLGA-AGYLNKLPSVLTSCCMLNQNESVGETDYFLSARNSAGTSAIAL 71

Query: 52  NWFASSIGSSILYSFPEVGTIAGL--LGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTL 109
           ++FAS +G+ ILY   E+G    L  LGV+ Y+  S  P  V  WLGP++R +  E F+ 
Sbjct: 72  SFFASGMGAWILYGTTEMGATPQLSWLGVMGYSTASSFPAVVICWLGPMVRARSTEAFST 131

Query: 110 TQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDK----LAPVICIAI 165
           T F L+R+GR  QI ++ +S+ YMF F+++EL+A+ NI   LTG +     +   I I +
Sbjct: 132 TDFGLQRYGRVMQISIAAISVFYMFIFIVAELTAISNIFALLTGNNSKIYGIGITIAIGV 191

Query: 166 VTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSL-- 223
            T +YT   GL AS++TD  QG              A +I  E  +  +   L SN    
Sbjct: 192 FTIIYTTLAGLPASIVTDRFQG--GIVALLIIMLTLAVTISDENRITRDEFALASNFTIQ 249

Query: 224 GWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIA 283
           G +    + +A+  A LF++G WQR +++++   +R     GS M+F +++F G+ GMIA
Sbjct: 250 GLKAAVTLVIAILCAELFNQGTWQRVWAAESIPVMRRGFAIGSAMVFLIMMFFGVMGMIA 309

Query: 284 VWAGLWPGEENLE--SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSN 341
            +A      +N E  ++LAFF L   L +    + ++L  +++ ++ D+L +  T+ F++
Sbjct: 310 -YAKDPESYDNFEKFAFLAFFDLLLPLGNGWHVLVLILVTALAASSIDSLQNGLTSVFAH 368

Query: 342 DIFN-NRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           D+      P+   R L +  NVPA++   +  DV+ +FL+ADL+ A+++ P+ LGL
Sbjct: 369 DLLKVGWNPIWAARALMVAVNVPAIWLASRKWDVIALFLVADLVCATSVFPVFLGL 424



>gi|494264168|ref|WP_007153677.1| sodium:solute symporter [Marinobacter algicola]
 gi|149359352|gb|EDM47813.1| Na+/solute symporter [Marinobacter algicola DG893]
          Length = 456

 Score =  183 bits (465), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 122/361 (33%), Positives = 205/361 (56%), Gaps = 9/361 (2%)

Query: 36  DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
           D++++  +Q A ALG ++ AS +G  IL++ PEVG + G + +  YA G+ +P  VFA+ 
Sbjct: 32  DFVTARNSQGARALGLSFLASGMGGWILFAPPEVGALMGPVALAGYALGAALPFIVFAFC 91

Query: 96  GPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVD 155
           GP IR+  PEG ++ +F    +G   + YVSL+S+ YM CF+ +EL+A+G I   L+GV+
Sbjct: 92  GPAIRRYLPEGRSIGEFAQACYGTSVRRYVSLISVLYMLCFLTAELTAIGAITSLLSGVN 151

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 215
               V+ +A+ T +YT +GGLRAS++TD  Q +             A     E  + D  
Sbjct: 152 GNLAVLGVAVATLIYTTWGGLRASIVTDQWQAF-LLIGLLAIVGFVAMDRLPELQMADAP 210

Query: 216 DLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVF 275
                ++LG  L  +  +AV+ A LFH+G+WQR +S+++   LR  A+ G ++   V+  
Sbjct: 211 SAPVGSALGVALTLV--IAVTAANLFHQGYWQRLWSARDISALRSGALLGGLVTIIVVAV 268

Query: 276 LGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISAT 335
           +G  G+ A  +G   G   +     FF L    P W++   +VLA+++  ++ DTL +A 
Sbjct: 269 VGGLGIAAAMSGADLGSPPIP----FFALLSGAPAWLTIPALVLALTLVASSVDTLQNAL 324

Query: 336 TANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLG 395
            +    +     L +   R+++++  +P V   L+ + VLR+FLIADLL A+ + P+L+G
Sbjct: 325 ASLAVTE--KQGLSITSARWVTVLLMIPVVIVALQGVSVLRLFLIADLLCATAVIPVLMG 382

Query: 396 L 396
           L
Sbjct: 383 L 383



>gi|512441197|ref|WP_016416980.1| sodium:solute symporter [Halomonas anticariensis]
 gi|511273970|gb|EPC02107.1| sodium:solute symporter [Halomonas anticariensis FP35 = DSM 16096]
          Length = 459

 Score =  182 bits (463), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 125/363 (34%), Positives = 201/363 (55%), Gaps = 8/363 (2%)

Query: 36  DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
           DY+++  +Q A  LG ++ AS +G+ IL++ PEVG   G + +  YA G+ +P  VFA  
Sbjct: 32  DYITARNSQTASTLGLSFLASGMGAWILFAPPEVGAFVGPIALAGYAIGAALPFIVFAAC 91

Query: 96  GPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVD 155
           GP IR+  PEG ++ +F   R+G   + YVSL+S+ YM  F+ +EL+A+  I   L+ + 
Sbjct: 92  GPSIRRYLPEGRSIGEFAQHRYGMGVRRYVSLLSVLYMAVFLAAELTAINGITTLLSDMS 151

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 215
               VI +A+ T +YT  GGLRASL TD  Q W                +    S  +  
Sbjct: 152 GSVVVIGVALSTLVYTALGGLRASLATDRWQAWLLIALLGVVGWVGWQRLPALPSDANLP 211

Query: 216 DLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVF 275
            +   ++L   L  +  +AV+ A LFH+G+WQR ++++N   L   A+ G ++   V+  
Sbjct: 212 SVPAGSALSVALTLV--IAVTAANLFHQGYWQRVWAARNGHALGRGAILGGLITVAVVAV 269

Query: 276 LGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLIS-- 333
           +G  G++A  +G   GE  +     FF L    P W+  + +VLAV++  ++ DTL +  
Sbjct: 270 VGGLGILAAMSGTPLGEPPMP----FFALLTEAPQWLMLLALVLAVTLVASSVDTLQNGI 325

Query: 334 ATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPIL 393
           A+ A    +  + R+ L   R++++   VP V   L++L VLR+FLIADLL A+ + P+L
Sbjct: 326 ASLAVSEGEGGSRRVSLATARWITVALMVPVVIVALQNLSVLRLFLIADLLCATAVVPVL 385

Query: 394 LGL 396
           LGL
Sbjct: 386 LGL 388



>gi|496591109|ref|WP_009288217.1| Sodium/solute symporter [Halomonas titanicae]
 gi|445564478|gb|ELY20598.1| Sodium/solute symporter [Halomonas titanicae BH1]
          Length = 470

 Score =  182 bits (462), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 122/361 (33%), Positives = 198/361 (54%), Gaps = 6/361 (1%)

Query: 36  DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
           DY+++  +Q A  LG ++ AS +G+ IL++ PE+G   G L +  YA GS +P  V    
Sbjct: 32  DYVTARNSQTASTLGLSFLASGMGAWILFAPPEIGAFVGPLALAGYALGSALPFIVLGLY 91

Query: 96  GPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVD 155
           GP IR+  PEG ++ +F    +G   + +V+L+SIAYM CF+ +EL+A+G I   L+ V 
Sbjct: 92  GPKIRRALPEGRSIAEFAEACYGPGVRRWVTLVSIAYMACFLAAELTAIGAITALLSDVP 151

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 215
               +I +A+ T +YT  GGLRASL TD  Q W                +    +     
Sbjct: 152 PALVIIGVALTTLIYTAAGGLRASLATDRWQAWLLLVLLCVVGGMALWRLPTIPNEAALP 211

Query: 216 DLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVF 275
            +  +++L   L  +  +AV+ A LFH+G+WQR +++++D+ L   A  G  M   V++ 
Sbjct: 212 AIPITSALSVALTLV--IAVTAANLFHQGYWQRVWAAQDDQSLGRGAWLGGAMTVVVVMV 269

Query: 276 LGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISAT 335
           +G  G++A  +G+  GE  +     FF L    P W++   +VLAV++  ++ DTL +  
Sbjct: 270 IGGLGVLAAMSGVPLGEPPMP----FFALLSDAPVWLTLPALVLAVTLVASSVDTLQNGI 325

Query: 336 TANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLG 395
            +          + L   R+++++  VP V   L+ L VLR+FLIADLL A+ + P+LLG
Sbjct: 326 ASLVVARSEQQGVSLVAARWVTVVVMVPVVLIALQGLSVLRLFLIADLLCAAIVVPVLLG 385

Query: 396 L 396
           L
Sbjct: 386 L 386



>gi|494173757|ref|WP_007113484.1| sodium:solute symporter [Halomonas boliviensis]
 gi|357970128|gb|EHJ92575.1| hypothetical protein KUC_2532 [Halomonas boliviensis LC1]
          Length = 463

 Score =  181 bits (460), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 125/365 (34%), Positives = 199/365 (54%), Gaps = 14/365 (3%)

Query: 36  DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
           DY+++  +Q A  LG ++ AS +G+ IL++ PE+G  AG L +  YA GS +P  V    
Sbjct: 32  DYVTARNSQTASTLGLSFLASGMGAWILFAPPEIGAFAGPLALAGYALGSALPFIVLGLY 91

Query: 96  GPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVD 155
           GP IR+  PEG ++ +F    +G   + +V+L+SIAYM CF+ +EL+A+G I   L+ V 
Sbjct: 92  GPKIRRALPEGRSIAEFAEACYGPGVRRWVTLVSIAYMACFLAAELTAIGAITALLSDVP 151

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 215
               +I +A+ T +YT  GGLRASL TD  Q W                +      I N 
Sbjct: 152 PALVIIGVALTTLIYTAAGGLRASLATDRWQAWLLLILLCVVGGMALWRL----PTIPNE 207

Query: 216 DLLKS----NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFP 271
             L S    ++L   L  +  +AV+ A LFH+G+WQR +++++D+ L   A  G  M   
Sbjct: 208 TALPSIPVTSALSVALTLV--IAVTAANLFHQGYWQRVWAAQDDQSLGRGAWLGGAMTVV 265

Query: 272 VLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL 331
           V++ +G  G++A  + +  GE  +     FF L    P W++   +VLAV++  ++ DTL
Sbjct: 266 VVMVIGGLGVLAAMSDVSLGEPPMP----FFALLSDAPIWLTLPALVLAVTLVASSVDTL 321

Query: 332 ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPP 391
            +   +          + L   R+++++  +P V   L+ L VLR+FLIADLL A+ + P
Sbjct: 322 QNGIASLVVARSEQRGVSLVAARWVTVVVMIPVVLIALQGLSVLRLFLIADLLCAAIVVP 381

Query: 392 ILLGL 396
           +LLGL
Sbjct: 382 VLLGL 386



>gi|307544110|ref|YP_003896589.1| hypothetical protein HELO_1521 [Halomonas elongata DSM 2581]
 gi|503096465|ref|WP_013331276.1| sodium:solute symporter [Halomonas elongata]
 gi|307216134|emb|CBV41404.1| hypothetical protein HELO_1521 [Halomonas elongata DSM 2581]
          Length = 468

 Score =  180 bits (456), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 212/378 (56%), Gaps = 15/378 (3%)

Query: 25  YAGYKKTKNKS---DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMY 81
           Y G +  +      DY+++  +Q+A +LG ++ AS +G+ IL++ PE+G + G L ++ Y
Sbjct: 18  YLGLRARRADGPLDDYVTARNSQSARSLGVSFLASGMGAWILFAPPEIGAMVGPLALVGY 77

Query: 82  AFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISEL 141
           A GS +P  V +  GP+IR+  PEG ++ +F    +G+  + +V+L+SI YM CF+ +EL
Sbjct: 78  ALGSALPFIVLSLYGPVIRRYLPEGRSIGEFAEACYGQGVRRWVTLVSILYMACFLAAEL 137

Query: 142 SAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXX 201
           +A+G I   L+ V     V+ +A+VT +YT  GGLRASL TD    W             
Sbjct: 138 TAIGAIASLLSEVPAGLVVMGVAVVTLVYTAVGGLRASLATDR---WQGWLLLALLVLVA 194

Query: 202 ATSIRIEKSVIDNSDLLKS---NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 258
              + +   + +N+ +  +   N+L   L  I  +AV+ A LFH+G+WQR ++++ +  L
Sbjct: 195 GVVVWVLPPLPENASMPTTPSVNALSVALTLI--IAVTAAELFHQGYWQRVWAAETNGAL 252

Query: 259 RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVV 318
              A+ G + +  V++ +G  G++A   GL  GE  +     FF L    P W++   +V
Sbjct: 253 GRGALLGGVGVLLVVMVIGGLGILAAMHGLPLGEPPIP----FFALLAEAPGWLAVPALV 308

Query: 319 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 378
           LAV++  ++ DTL +A  +          L +   R  +++  VP V   L++L VLR+F
Sbjct: 309 LAVTLVASSVDTLQNAIASLVVAGSGRRGLSIGSARLATVVLMVPVVVVALQELSVLRLF 368

Query: 379 LIADLLAASTMPPILLGL 396
           LIADLL A+T+ P+LLG+
Sbjct: 369 LIADLLCAATVVPVLLGV 386



>gi|497407386|ref|WP_009721584.1| sodium:solute symporter [Halomonas sp. TD01]
 gi|338766491|gb|EGP21410.1| hypothetical protein GME_01569 [Halomonas sp. TD01]
          Length = 462

 Score =  176 bits (447), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 201/367 (54%), Gaps = 17/367 (4%)

Query: 36  DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
           DY+++  +Q A  LG ++ AS +G+ IL++ PE+G   G + +  YA GS +P  V    
Sbjct: 32  DYVTARNSQTASTLGFSFLASGMGAWILFAPPEIGAFVGPVALSGYALGSALPFIVLGLY 91

Query: 96  GPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVD 155
           GP IR+  PEG ++ +F    +G+  + +V L+S+AYM CF+ +EL+A+G I   L+ V 
Sbjct: 92  GPKIRRALPEGRSIAEFAHACYGKGVRHWVLLVSVAYMGCFLAAELTAIGAITALLSDVP 151

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEK-SVIDN 214
               +I +A+ T +YT  GGLRASL TD  Q W               S+ I +   + N
Sbjct: 152 PALVIIGVALTTLVYTVIGGLRASLATDRWQAWLLLALLLAVG-----SVAIWRLPTMPN 206

Query: 215 SDLLKSNSLGWQL--LYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPV 272
             ++ S  +   L     + +AV+ A LFH+G+WQR +++++D+ L   A  G  M   V
Sbjct: 207 DAVMPSIPIASALSVALTLVIAVTAANLFHQGYWQRVWAAQDDQSLGRGAWLGGGMTVMV 266

Query: 273 LVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL- 331
           ++ +G  GM+A  +G   G+  +     FF L    P WV+   +VLAV++  ++ DTL 
Sbjct: 267 VMVIGGVGMMAAMSGASLGDPPIP----FFALLTDAPAWVALPALVLAVTLVTSSVDTLQ 322

Query: 332 --ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTM 389
             I++       +   +   L   R++++   VP V   L+ L VLR+FLIADLL A+ +
Sbjct: 323 NGIASLIVGRGGE--RHTASLTTARWITVAMMVPVVLIALQGLSVLRLFLIADLLCAAIV 380

Query: 390 PPILLGL 396
            P+LLGL
Sbjct: 381 VPVLLGL 387



>gi|384254250|gb|EIE27724.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
          Length = 878

 Score =  175 bits (443), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 116/379 (30%), Positives = 209/379 (55%), Gaps = 13/379 (3%)

Query: 29  KKTKNKSD----YLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFG 84
           +  K+  D    +L++  +     +  +++A+++GS  L+S      IAG  G++ YA  
Sbjct: 31  RHRKHGPDTPEFFLTARNSVGTFRIAWSFYAAAMGSWTLFSPASYANIAGWFGLMFYALA 90

Query: 85  SIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAV 144
           S +P+ +  +LGP+++++ P+  + T F+  R+GR  QI+V+L+ +  M   M +E +AV
Sbjct: 91  SGLPILIQGFLGPIVQRRKPDLLSFTDFINHRYGRVVQIWVALLMLLNMGIAMTAEYTAV 150

Query: 145 GNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATS 204
           G++   + G +++  V+ I +V+ +YT YGGL  S+ITD  Q               A +
Sbjct: 151 GDLFELVIGTERVPIVVIIGVVSMIYTAYGGLYISIITDQWQAALGLTLAAILVIWTAVT 210

Query: 205 IR--IEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSA 262
            R  + + + DN   L  N+ G   + +MP+++  A++F E  WQR ++S +D +LR+ A
Sbjct: 211 FRGPLPRPLPDN---LAINNEGLSSIAVMPISLFSASVFSEAIWQRCWASASDAKLRVGA 267

Query: 263 VYGSIMLFPVLVFLGLTGMIAVWAGLW-PGEENLESYLAFFTLF--KVLPDWVSGITVVL 319
           ++G++ +  V+   G  G +AVW+GLW P   +       F L   K    W++ I  VL
Sbjct: 268 IWGALQVTVVVFIFGFGGFLAVWSGLWQPSGPDDPGNTILFALLNAKGQQVWITVIVAVL 327

Query: 320 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 379
           A +MS +A D+L +A   N S   F   LPL   R L +I +VP +   L+   ++ +FL
Sbjct: 328 AATMSESAIDSLQNAIVDNISGS-FLKGLPLIWIRVLVIILSVPVIIVSLQGYGIINLFL 386

Query: 380 IADLLAASTMPPILLGLID 398
           +A+L+  ++  P+LLGL++
Sbjct: 387 LANLITTTSTLPVLLGLLE 405



>gi|385331874|ref|YP_005885825.1| solute symporter-like protein [Marinobacter adhaerens HP15]
 gi|495449986|ref|WP_008174680.1| sodium:solute symporter [Marinobacter manganoxydans]
 gi|311695024|gb|ADP97897.1| solute symporter-like protein [Marinobacter adhaerens HP15]
 gi|357225226|gb|EHJ03733.1| hypothetical protein KYE_14777 [Marinobacter manganoxydans MnI7-9]
          Length = 454

 Score =  174 bits (442), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 122/361 (33%), Positives = 201/361 (55%), Gaps = 9/361 (2%)

Query: 36  DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
           DY+++  +Q A ALG ++ AS +G  IL++ PEVG + G L +  YA G+ +P  VFA+ 
Sbjct: 32  DYVTARNSQGARALGLSFLASGMGGWILFAPPEVGALVGPLALAGYALGAALPFIVFAFC 91

Query: 96  GPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVD 155
           GP IR+  PEG ++ +F    +G   + YVS +S+ YM CF+ +EL+A+G I   L+G+D
Sbjct: 92  GPAIRRFLPEGRSIGEFANACYGNGVRRYVSTISVLYMLCFLTAELTAIGAITSLLSGID 151

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 215
               VI +AI T +YT  GGLRAS++TD  Q               A     + +     
Sbjct: 152 GGIVVIGVAITTLVYTAVGGLRASIVTDQWQA-LLLIGLLAIVSFVAVGKLPDAAPAALP 210

Query: 216 DLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVF 275
           D+  S +L   L  +  +AV+ A LFH+G+WQR +S+++   L   A+ G ++   V+  
Sbjct: 211 DIPASAALSVALTLV--IAVTAANLFHQGYWQRLWSARDTDALSRGALLGGVVTIAVVAV 268

Query: 276 LGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISAT 335
           +G  G++A  +G   G   +     FF L    P W++   ++LA+++  ++ DTL +A 
Sbjct: 269 VGGLGILAAMSGADLGSPPIP----FFALLADAPAWLALPALILAITLVASSVDTLQNAL 324

Query: 336 TANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLG 395
            +    +     L +   R+ +++  +P V   L+ + VLR+FLIADLL A+ + P+L+G
Sbjct: 325 ASLAVTE--KQGLSIVSARWFTVLLMIPVVLVALQGISVLRLFLIADLLCATAVLPVLMG 382

Query: 396 L 396
           L
Sbjct: 383 L 383



>gi|346977478|gb|EGY20930.1| urea transport protein [Verticillium dahliae VdLs.17]
          Length = 345

 Score =  174 bits (440), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 128/201 (63%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +GSS+L+++PE+ TI G+ GVI+YA  S +PL +FA LG +IR+K PEGF LT++  +R+
Sbjct: 46  LGSSVLFAYPELATITGVQGVIVYALSSSLPLLIFAALGSIIRRKTPEGFVLTEWTRQRY 105

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +Y+S  ++  +F ++ +ELSA+G ++ TLTGV++L  ++    VTT+YT  GG +
Sbjct: 106 GTAAMLYLSAATLFTLFLYLTAELSAIGQVVTTLTGVNQLPVMLVQVAVTTIYTSLGGFK 165

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF 237
            S +TDNIQG                   I+ S+I  S+ LK   LGWQLLYI+PV +  
Sbjct: 166 ISFVTDNIQGGMVICLIVIAAATIGALTDIDTSLIRESEFLKPTLLGWQLLYILPVCILT 225

Query: 238 ATLFHEGFWQRAFSSKNDREL 258
              F   +W RAF+SK D++L
Sbjct: 226 NNFFLSNYWLRAFASKTDKDL 246



>gi|223993879|ref|XP_002286623.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220977938|gb|EED96264.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 614

 Score =  165 bits (418), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 117/397 (29%), Positives = 210/397 (52%), Gaps = 30/397 (7%)

Query: 29  KKTKNKSDY-LSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGL--LGVIMYAFGS 85
           KK    +D+ L++  +  A A+  ++FAS +G+ ++Y   E+G    L  LGV+ Y+  S
Sbjct: 56  KKEAGSADFFLAARNSAGARAIALSFFASGMGAWVVYGSTEMGANPNLSWLGVLGYSGAS 115

Query: 86  IIPLFVFAWLGPLIRK-KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAV 144
             P  +   +GP IR     E F  T F L R+GR  Q+ ++ +S+ YMF +++SE++++
Sbjct: 116 AFPAIIICMIGPRIRAITGEEAFCTTDFGLVRYGRLMQLSIAAISVFYMFIYLVSEMTSI 175

Query: 145 GNILVTLTGVDKLAP---------VICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXX 195
            N+   + G+D  +           I +A+ T  YT   GL AS++TD  Q +       
Sbjct: 176 SNVYGLIVGLDTFSDDTVKYTTSIAISLAVFTWFYTSVAGLPASIVTDKFQAYLMFGLVF 235

Query: 196 XXXXXXATSIRIEKSVIDNSDLLKSNSLGWQL-----LYIMPVAVSFATLFHEGFWQRAF 250
                  ++   E  V      + SN   W L        + +A++ A +F++G WQR +
Sbjct: 236 ILLIVACSN--SENQVSKEEFAVASN---WTLDGLAAAVTLFIAIACAEMFNQGNWQRVW 290

Query: 251 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE--SYLAFFTLFKVL 308
           ++K+  ++R    +GS+++F +++F G+ GM+A +A      +N E  +YLAFF L   L
Sbjct: 291 AAKSVPDMRKGFAWGSLLVFLLMMFFGIMGMLA-YANDPDAYDNWEKFAYLAFFDLLAPL 349

Query: 309 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLN----VTRFLSLIANVPA 364
             +   + +++  +++ ++ DTL +A  + FS+D+    L  N    VTRF+ ++ N+PA
Sbjct: 350 NTFFHVLVLIIVTALAASSVDTLQTAIASMFSSDLIRFGLSDNASRFVTRFILVLINIPA 409

Query: 365 VYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 401
           V    K  DV+ +FL+ADL+  + + P+ LGL+   Y
Sbjct: 410 VILSSKRFDVIGLFLVADLVCGTAVLPVFLGLMTEDY 446



>gi|158321712|ref|YP_001514219.1| Na+/solute symporter [Alkaliphilus oremlandii OhILAs]
 gi|501110941|ref|WP_012160530.1| Na+/solute symporter [Alkaliphilus oremlandii]
 gi|158141911|gb|ABW20223.1| Na+/solute symporter [Alkaliphilus oremlandii OhILAs]
          Length = 466

 Score =  163 bits (413), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/404 (29%), Positives = 200/404 (49%), Gaps = 22/404 (5%)

Query: 11  LIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVG 70
           L+ V +  F  +G+     K +   D+ ++ G+  +  L +   AS +G  IL++ PE G
Sbjct: 10  LLTVTVISFTVLGVLYSRGKIETMDDFFTARGSTGSKILSATLLASFLGVFILFTPPEAG 69

Query: 71  TIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSI 130
            I G+  +I Y  G     F F  + P +R   PEG TL  +VL+R+G    +   L+S+
Sbjct: 70  AIGGITTIIGYGIGVASLYFAFLVISPKVRTYLPEGSTLNDYVLKRYGFKMYLLTVLLSL 129

Query: 131 AYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAX 190
            YMF  +I+EL+A+G +   L GV  L   + + I T +YT YGGLRA++ TD IQ    
Sbjct: 130 FYMFVHLIAELTAIGLVAYELAGVPLLYTALFVGIGTLIYTAYGGLRAAMFTDMIQMILI 189

Query: 191 XXXXXXXXXXX-----ATSIRIEKSVIDNSDLLK-SNSLGWQLLYIMPVAVSFATLFHEG 244
                                I  +  +  DL    N  G +    + +AV  A LF++G
Sbjct: 190 VFLLIMVTVGIVHYGGGVGTIISSAKTNAPDLFSFRNWGGIEYGLTLCIAVFAANLFNQG 249

Query: 245 FWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTL 304
           +WQR ++SK+++ LR S +   I+  PV++  G  G++++  G+          +A F+L
Sbjct: 250 YWQRVYASKDNKTLRKSLIVCIIIALPVMLITGFLGIVSMGLGIGSSPS-----VALFSL 304

Query: 305 -FKVLPDWVSGITVVLAVSMSCAAYDTLISATTANF---SNDIFN-----NRLPLNVTRF 355
            +K LP  +     +LA+ +  +  DTL++A  A F   S  IF      + LP    R 
Sbjct: 305 IYKFLPSQLIVAVFILALVLVMSTVDTLLNAIVATFALDSQQIFKKVKSESLLPF--ARM 362

Query: 356 LSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDS 399
           + ++  +PA++   +   VL +F +ADL+ A  + PI  GL ++
Sbjct: 363 MMVVLMIPAIFIAARGYSVLYLFFVADLVCAGVVFPIFFGLFNT 406



>gi|325185496|emb|CCA19979.1| Solute:Sodium Symporter (SSS) Family putative [Albugo laibachii
           Nc14]
          Length = 462

 Score =  163 bits (413), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/401 (29%), Positives = 208/401 (51%), Gaps = 19/401 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDY--LSSLGTQNAVALGSNWFASSIG 59
           ML+  V+ ++ +  L +     +YA  +++ N+S +  LS+  TQ  V+L    FA+ +G
Sbjct: 3   MLAATVTYIIAFATLLVVASYALYAS-RRSSNQSAHAFLSAKDTQGPVSLAWCLFAAGMG 61

Query: 60  SSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGR 119
           S  L+SFPE+G +AG  G+I Y   S + + + A +GP  R+   +G TL++ +L R+G 
Sbjct: 62  SWTLFSFPEIGVLAGAWGIIGYTLSSCLAMLILACVGPRTRRLLCDGVTLSECILHRYGH 121

Query: 120 FNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDK-LAPVICIAIVTTLYTGYGGLRA 178
             Q Y++++S  Y F  + SE + VG +   L+   K +  ++ +A++T LYT  GG+ A
Sbjct: 122 IMQTYIAIISFLYQFLSLASEFTCVGQLTAILSPDAKPIVVILTVAVITNLYTLVGGMLA 181

Query: 179 SLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFA 238
           SL TD  QG               +S     +V+  +     ++ G++ L  + +AV+ +
Sbjct: 182 SLATDVWQGVGVLSLVLLVCIVMISSTTTPANVLSVAVF---DTSGFETLVTLCIAVTSS 238

Query: 239 TLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY 298
            LF  GFWQR +++ +D  LR + +Y      P  V L + GM++     +PGE      
Sbjct: 239 NLFFSGFWQRVYAAADDATLRKACLYACGFCIPFTVALAVAGMVSSLK--YPGE------ 290

Query: 299 LAFFTLFKVLPD-WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 357
           + FF+L   +   W   + +V+    S A+    +  T    SN      L L   R + 
Sbjct: 291 IYFFSLLLNMGTVWQVFVMMVIVSLASSASDSLQMGITAELVSN---FPSLSLFHARVIC 347

Query: 358 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLID 398
           ++ NV A++  L++  VL +FLI+DLL  +++ P+LL L D
Sbjct: 348 VMLNVSAIFVALQNYSVLTLFLISDLLCTASVGPMLLALWD 388



>gi|348678595|gb|EGZ18412.1| hypothetical protein PHYSODRAFT_332209 [Phytophthora sojae]
          Length = 481

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 195/402 (48%), Gaps = 21/402 (5%)

Query: 1   IMLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           ++ SGV   V+I  ++A+     I +   +  +  +++S+  +  ++ L   +F++ +GS
Sbjct: 1   MLASGVTYGVMIATLVAVAAYAIIVSRRMEVNSVKNFISAKNSTTSLRLAWCFFSAGMGS 60

Query: 61  SILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRF 120
             L+SFP++G  AG  GVI Y    +  + V A +GP  R    E  T+T  V +RFG  
Sbjct: 61  WTLFSFPQIGVDAGSWGVIGYTLSGVCGMLVLAVVGPYTRSALGENVTMTDVVAQRFGYV 120

Query: 121 NQIYVSLMSIAYMFCFMISELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRAS 179
            Q+Y+ L+S+ Y F  + SEL+ V  +    +     L P++ +  +T LY   GGLRAS
Sbjct: 121 MQVYIGLISVFYQFISLASELTCVAQLTTMFSPNAHSLIPILVVVFLTNLYLIIGGLRAS 180

Query: 180 LITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFAT 239
           L TD  QG                 + I +     +++      G++ L  + +AV+ + 
Sbjct: 181 LATDVWQGIGVIALLAVVCIAMCFHVAIPEGAWSRTNVAAFTVEGFETLVTLVIAVTASN 240

Query: 240 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYL 299
           LF  GFWQR +++ +D  LR +A     ++ P  V L L GM+              SYL
Sbjct: 241 LFFTGFWQRVYAAYDDHTLRKAAFMACGIIIPFTVALALAGMV--------------SYL 286

Query: 300 AF---FTLFKVLPDWVSG--ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTR 354
           A+      F +L D   G  + +V+ ++M  +     I    A      F  +L L   R
Sbjct: 287 AYPDGVLFFAILMDMGRGWEVLIVIVIAMLASGVSDSIQIGIAAELTTCF-PKLSLLHAR 345

Query: 355 FLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            +  + NVPA+  G +  D+L +FLIADLL  + + P+LLG+
Sbjct: 346 IIVALLNVPAIVIGYQQYDILNLFLIADLLCTAAVGPMLLGV 387



>gi|428175810|gb|EKX44698.1| hypothetical protein GUITHDRAFT_87377 [Guillardia theta CCMP2712]
          Length = 646

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 106/376 (28%), Positives = 192/376 (51%), Gaps = 12/376 (3%)

Query: 32  KNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFV 91
           +    ++++  TQ    +  +++A S+GS ++ S     + AG LGVI YA  + IP+ +
Sbjct: 42  ETSEGFITARKTQGMWRIAWSFYAGSVGSWVITSTASYASYAGYLGVIFYAVATGIPIIM 101

Query: 92  FAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTL 151
            A+ G +++ K P   +L  F+L RFG   ++   ++++  M  FM++E + VG +    
Sbjct: 102 QAYFGDIVQTKFPNANSLGDFILLRFGPTAKLATIIVTLINMSIFMLAEFTTVGGLFSDF 161

Query: 152 TGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIR--IEK 209
            G      +I +A++TT+YT YGGL  S++TD +QG              A + R  +  
Sbjct: 162 VGSVSYPIIIIVAVLTTIYTVYGGLLVSIVTDQVQGIISVLLTIILTIYVAATFRRDLPA 221

Query: 210 SVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIML 269
           +      +L  N  G+  ++ MP++++ AT+F+EG WQR +++++   L+   +     +
Sbjct: 222 NFGPYEPMLGPNLSGYSSIFTMPISLAAATVFNEGMWQRVWAAEDHTALKRGGIIACFAI 281

Query: 270 FPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLP--------DWVSGITVVLAV 321
             V+   G  G++AVW GL    EN    L  F LFK  P        +++  + +VLA 
Sbjct: 282 VFVVFIFGFGGLLAVWGGL-VDYENTNPNLYIFQLFKSDPSAPNAHVENFIEVLVLVLAA 340

Query: 322 SMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIA 381
            M+ +A D+L +   A  S+     + PL   R   L+ N+  V + L +  VL +FL+ 
Sbjct: 341 VMNESAIDSLQNGLAATISSHFLRGK-PLLWARICVLLINIIIVPFALANYSVLSIFLLG 399

Query: 382 DLLAASTMPPILLGLI 397
           ++L     PP+++G I
Sbjct: 400 NMLGVCWFPPVIMGGI 415



>gi|323455936|gb|EGB11803.1| hypothetical protein AURANDRAFT_61010 [Aureococcus anophagefferens]
          Length = 1097

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 122/419 (29%), Positives = 212/419 (50%), Gaps = 37/419 (8%)

Query: 5   GVVSNVLIYVVLAIFLGIGIYAG--YKKTKNKSD-YLSSLGTQNAVALGSNWFASSIGSS 61
           G++  VL    L    GI +  G  +K      D +LS+ G     ++  ++FAS +G+ 
Sbjct: 534 GILFGVLCLTGLLCVAGIVLDKGSTFKDVLRPGDGFLSARGQSAWYSIALSFFASGMGAW 593

Query: 62  ILYSFPEVGTIAGL--LGVIMYAFGSIIPLFVFAWLGPLIRK--KCPEGFTLTQFVLERF 117
           I+Y   E+G    +   GVI Y+  S  P  +  WLGP I+       GF+ T F L R+
Sbjct: 594 IVYGTTEMGATRPISWWGVIGYSTASAFPAVLLCWLGPRIKTVVGAASGFSATDFALSRY 653

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTG-----------VDKLAPVICIAIV 166
           GR   ++V  +S  YM+ +M++EL+++GN+  TL G             K+A  IC+A+ 
Sbjct: 654 GRLMHLHVCCISCFYMYIYMVAELTSIGNVYATLVGKSVAGDDSEHFTTKIA--ICVALF 711

Query: 167 TTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQ 226
           T  YT   GL AS++TD  QG               T    E S  +  D     S G++
Sbjct: 712 TWAYTALAGLPASILTDKFQGVVITCVVIMLLVATTTLKSNEVSKQEYDDATGWFSKGFE 771

Query: 227 LLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIA--- 283
            L  + +A+  A LF++G WQR +++++D+++++  + G++++  V++F G+ G IA   
Sbjct: 772 ALVTLWIAICSAELFNQGNWQRVWAARSDKDMKIGFLAGAVLVTLVMLFFGVMGTIAYAR 831

Query: 284 ------VWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTA 337
                  W  L        +YL+FF L + LP +   +T+ L  +++ ++ DTL +   +
Sbjct: 832 DRESYDTWQKL--------AYLSFFDLLRNLPRFWHYVTLALLTTLAASSLDTLQNGIAS 883

Query: 338 NFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
             S D+   +L  N +R + +  N+ A+       +V+ +FL+ADL+ A+ + P+ LGL
Sbjct: 884 VLSRDLLKQKLNTNWSRLVVVGFNIAAIIQASDRFEVVPLFLVADLVCATAVFPLFLGL 942



>gi|294900101|ref|XP_002776900.1| Osmoregulated proline transporter, putative [Perkinsus marinus ATCC
           50983]
 gi|239884101|gb|EER08716.1| Osmoregulated proline transporter, putative [Perkinsus marinus ATCC
           50983]
          Length = 515

 Score =  162 bits (409), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 128/426 (30%), Positives = 212/426 (49%), Gaps = 39/426 (9%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGY------------KKTKNKSDYLSSLGTQNAVAL 49
           MLS  +S +  Y++L I LG+     Y              T  + D+  +    +   +
Sbjct: 1   MLSYRLSKLSGYLILYITLGVFAAVAYVLLLFRYRVMVQANTDAQEDFYVARKRFSWAWI 60

Query: 50  GSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKC------ 103
           G+++FAS +G+ ++Y+ PEVGT  G  GVI YA   ++P+ +   LG  IR K       
Sbjct: 61  GASYFASGMGTWVIYAAPEVGTFLGWWGVIGYALACVVPMAIIWILGVRIRAKLNSYMSA 120

Query: 104 --PEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVI 161
              EG+  T ++L RFGR  Q+Y  L+SI  M+  M +E +AVG ++   +G+      +
Sbjct: 121 GGSEGYAATDWILARFGRLVQVYAVLVSIFIMWISMTAEYTAVGQVIEIFSGIPVWLSTL 180

Query: 162 CIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSN 221
            +A++T  YT   GL  S++TD  QG A            ATS  +  +  + + +    
Sbjct: 181 SVAVITLSYTLVAGLPVSILTDMAQGLAAVGLIVFAVV--ATSTNVTVTTANWNAVANFT 238

Query: 222 SLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGM 281
           +LG + L  + +A+    L     WQR +++KND  LR+  + G  ++F  ++  G+ GM
Sbjct: 239 TLGLESLITLVLAILGFQLLDMVVWQRVWAAKNDFNLRMGLLLGGSLVFLTMLAFGILGM 298

Query: 282 IAVWAGLWPGEEN--------LESY---LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDT 330
           +A        ++         L  Y   LAFF L  VLP+   G  VVLA+ +S ++ D+
Sbjct: 299 LA------EAQDRARPVPHLTLHPYTKALAFFDLLGVLPNAAVGAVVVLAICLSTSSVDS 352

Query: 331 LISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMP 390
           L SA  + F+ +       LN  R L ++ N+PA+   ++ + V+ +FL+ADL+AA+   
Sbjct: 353 LQSALLSVFAAEFVKRGWSLNWGRLLLVLMNIPAIALAMRGISVINLFLVADLVAATICM 412

Query: 391 PILLGL 396
           P   GL
Sbjct: 413 PAYCGL 418



>gi|323456367|gb|EGB12234.1| hypothetical protein AURANDRAFT_61365 [Aureococcus anophagefferens]
          Length = 1212

 Score =  162 bits (409), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 122/419 (29%), Positives = 212/419 (50%), Gaps = 37/419 (8%)

Query: 5    GVVSNVLIYVVLAIFLGIGIYAG--YKKTKNKSD-YLSSLGTQNAVALGSNWFASSIGSS 61
            G++  VL    L    GI +  G  +K      D +LS+ G     ++  ++FAS +G+ 
Sbjct: 649  GILFGVLCLTGLLCVAGIVLDKGSTFKDVLRPGDGFLSARGQSAWYSIALSFFASGMGAW 708

Query: 62   ILYSFPEVGTIAGLL--GVIMYAFGSIIPLFVFAWLGPLIRK--KCPEGFTLTQFVLERF 117
            I+Y   E+G    +   GVI Y+  S  P  +  WLGP I+       GF+ T F L R+
Sbjct: 709  IVYGTTEMGATRPISWWGVIGYSTASAFPAVLLCWLGPRIKTVVGAASGFSATDFALSRY 768

Query: 118  GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTG-----------VDKLAPVICIAIV 166
            GR   ++V  +S  YM+ +M++EL+++GN+  TL G             K+A  IC+A+ 
Sbjct: 769  GRLMHLHVCCISCFYMYIYMVAELTSIGNVYATLVGKSVAGDDSENFTTKIA--ICVALF 826

Query: 167  TTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQ 226
            T  YT   GL AS++TD  QG               T    E S  +  D     S G++
Sbjct: 827  TWAYTALAGLPASILTDKFQGVVITCVVIMLLVATTTLKSNEVSKQEYDDATGWFSKGFE 886

Query: 227  LLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIA--- 283
             L  + +A+  A LF++G WQR +++++D+++++  + G++++  V++F G+ G IA   
Sbjct: 887  ALVTLWIAICSAELFNQGNWQRVWAARSDKDMKIGFLAGAVLVTLVMLFFGVMGTIAYAR 946

Query: 284  ------VWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTA 337
                   W  L        +YL+FF L + LP +   +T+ L  +++ ++ DTL +   +
Sbjct: 947  DRESYDTWQKL--------AYLSFFDLLRNLPRFWHYVTLALLTTLAASSLDTLQNGIAS 998

Query: 338  NFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
              S D+   +L  N +R + +  N+ A+       +V+ +FL+ADL+ A+ + P+ LGL
Sbjct: 999  VLSRDLLKQKLNTNWSRLVVVGFNIAAIIQASDRFEVVPLFLVADLVCATAVFPLFLGL 1057



>gi|385305452|gb|EIF49423.1| urea urea polyamine [Dekkera bruxellensis AWRI1499]
          Length = 272

 Score =  162 bits (409), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 146/249 (58%), Gaps = 3/249 (1%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF 117
           +G  +L ++ +V  IAG+ G+++YA    +P+ +F++ GP+IRK+CP+GF LT++  +RF
Sbjct: 1   MGCGVLTTYAQVSNIAGIHGLLVYAITGAVPIVLFSYFGPMIRKRCPDGFVLTEWCRQRF 60

Query: 118 GRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLR 177
           G    +Y+SL ++  MF +M+SEL+A+   +  LTG+D    V+   +VTT+YT  GG +
Sbjct: 61  GVITALYLSLFTLLTMFLYMVSELTAIDEAINALTGLDATPCVVVECVVTTIYTFLGGFK 120

Query: 178 ASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN--SDLLKSNSLGWQLLYIMPVAV 235
            S  TD++Q               AT++ I++ +     S +L +N LGW LLYI+ VA+
Sbjct: 121 VSFATDSLQAGFVMVLLVVGVIGYATNVHIDQKIKQETASQMLDANKLGWMLLYILFVAI 180

Query: 236 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENL 295
                F  GFW R F+++ DR+L ++    + +   V    GL G+ AVW G+    ++ 
Sbjct: 181 LTNDAFLSGFWLRTFAARTDRDLLIACSIAAFVCALVCTLAGLPGIYAVWTGVLKVGDD- 239

Query: 296 ESYLAFFTL 304
           E Y AF+ L
Sbjct: 240 EGYNAFYIL 248



>gi|328771326|gb|EGF81366.1| hypothetical protein BATDEDRAFT_34916 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 523

 Score =  156 bits (394), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 144/525 (27%), Positives = 245/525 (46%), Gaps = 41/525 (7%)

Query: 14  VVLAIFLGIG--IYAGYKKTKNKSD---YLSSLGTQNAVALGSNWFASSIGSSILY---- 64
           +V++I  G    +Y+ +   ++K D   ++++  TQ    +  ++FA S+G+ +LY    
Sbjct: 17  IVISILFGAAAVLYSFFGTDQSKVDTEFFITARNTQPVHRIAWSFFAGSMGAWVLYGPAA 76

Query: 65  --SFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQ 122
             S P  GT  G LG+I YA  + +PL + A++G  +RK  P   ++  +   RFG   +
Sbjct: 77  FVSDPTYGT--GYLGLIAYALFTGLPLVMLAFMGTYLRKNVPHATSIASYGRWRFGTGIE 134

Query: 123 IYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 182
           + + ++ +  +   +++E SA+G I     GV    P++ + IVT  YT  GGL  S++T
Sbjct: 135 LLIMIIVVLNLGIALLAEYSAIGGIFQDFFGVPSWVPILVVGIVTMSYTATGGLYVSIVT 194

Query: 183 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
           D  Q                 S     S+    D L + ++GWQ    + +++  AT F 
Sbjct: 195 DQWQAIMALVLFAITIIYMGVSFH-GTSLPKLPDYLGATTVGWQSFITLGISLISATFFS 253

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 302
           E  WQR ++++++R LR+ A+ GS M   V+   GL  M+A W+G    ++N  S   +F
Sbjct: 254 EAMWQRVWAAESERSLRIGAIIGSSMSTVVVAVFGLGSMLAYWSGRATADDN--SNFGYF 311

Query: 303 TLFKVLPDWVSG----ITVVLAVSMSCAAYDTLISATTANFSN--DIFNNRLPLNVTRFL 356
             F+ L  + S     + +++AV M+ +A D+  +A T    +    F  + P    R L
Sbjct: 312 LAFRDLNGYTSAAILVVVILIAVIMNESAVDSFQNAITDAVVSVFGSFGVKFPTMGARLL 371

Query: 357 SLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXX 416
            ++ NVP +Y G   L VL VFLI +++      P++ GLI +   LN I          
Sbjct: 372 VILFNVPIMYIGTLGLSVLGVFLIGNMITTCMFFPLVAGLIPA---LNRIISSFSVCLAC 428

Query: 417 XXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISM 476
                   + Y     G    GL L  + T Y V  AF+ A +SSI +  +  G+ L   
Sbjct: 429 LFSFFSVMV-YGKIMTGDISTGL-LTYFYTVYDV-NAFLTASVSSIVWLVVFTGIDL--- 482

Query: 477 WVFTKIRGEE---FVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDP 518
             F K+ G E     FP K  +  + +      K   E+ ++  P
Sbjct: 483 -AFRKLTGREMPNLPFPSKAALAFSTR------KSIVEVPEAQGP 520



>gi|495594848|ref|WP_008319427.1| sodium/proline symporter [Haloferax mucosum]
 gi|445744445|gb|ELZ95923.1| sodium/proline symporter [Haloferax mucosum ATCC BAA-1512]
          Length = 509

 Score =  152 bits (383), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 120/412 (29%), Positives = 202/412 (49%), Gaps = 18/412 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L    LA+F GIG++    +  +  D +S+  +       +   AS +G  
Sbjct: 1   MVSTEVALGLTVATLALFTGIGVWVSRGRVDSVEDLVSARDSMGERRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ Y  G  +P+ V++ LGP IR+  P G +LT++   R+G   
Sbjct: 61  VLFSAPEAGAGFGIAAVVGYGIGEAVPMLVYSKLGPRIRRLIPHGHSLTEYAHARYGTAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V ++S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLVVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIT 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD IQ                 S+    + +D     N  LL   SL G Q    +  A+
Sbjct: 181 TDAIQAVVVFPLLLLAVGGALVSLGGPTAALDGITETNPALLDLGSLAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKN----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR ++S +    +R  R +AV   +++F V  F G+  +          
Sbjct: 241 LGAELINQTWWQRIYASDSEQTVERSFRSAAVANGLVVF-VTAFFGIVAVGNADVVTNVT 299

Query: 292 EENLESYLAFFTLFK-VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
             N  + +AFF L +   P+W+    V+LA+ +  ++ DTL +A ++  + DI       
Sbjct: 300 SSNYNADVAFFVLLQDAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADIARVLSSP 359

Query: 345 NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           ++R     +R L+++  + A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRQLAVGSRALTVVVALAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|348678575|gb|EGZ18392.1| hypothetical protein PHYSODRAFT_301074 [Phytophthora sojae]
          Length = 528

 Score =  151 bits (381), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 111/396 (28%), Positives = 198/396 (50%), Gaps = 11/396 (2%)

Query: 1   IMLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           ++ SGV   V+   ++A+     I +   +  +  +++S+  +   + L   +F++ IG+
Sbjct: 45  MLASGVTYGVMAATLIAVAAYAIIVSRRMEVNSVKNFVSAKNSTTTLRLAWCFFSAGIGA 104

Query: 61  SILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRF 120
             L+S+PE+G  AG  GVI YA   ++ + V A +GP  R    E  T+T  V  RFG  
Sbjct: 105 GTLFSYPEIGVSAGSWGVIGYALSGVVGMIVLALVGPYTRSALGENVTMTDVVSHRFGYI 164

Query: 121 NQIYVSLMSIAYMFCFMISELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRAS 179
            Q+YV  +S+ Y F  + SE + +  +   ++     +  ++ +A +T LY   GGLRAS
Sbjct: 165 MQVYVGFISMFYQFICLASEYTCIAQLTTMMSPNAHPIVTILIVAFLTNLYLVIGGLRAS 224

Query: 180 LITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFAT 239
           L TD  QG                 + I +    ++++    + G++ L  + +AV+ + 
Sbjct: 225 LATDVWQGIGVVFLVAVVCVAMFFHVSIPEGAWSSTNVAAFTTAGFETLVTLVIAVTASN 284

Query: 240 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYL 299
           LF  GFWQR +++ +D  LR +A+  S ++    V L + GM++  A  +P     +  L
Sbjct: 285 LFFTGFWQRVYAAYDDNTLRKAALIASAIIALFTVALAMAGMVSYLA--YP-----DGSL 337

Query: 300 AFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLI 359
            F  L  +   W   I VV+A+ +S    D++     A  +      +L L  +R + ++
Sbjct: 338 FFAVLIDMGRGWQVLIVVVIAM-LSSGVSDSIQMGLAAELTTCF--PKLSLMHSRVICVL 394

Query: 360 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLG 395
            N PA+  G +  D+L ++LIADLL  + + P+LLG
Sbjct: 395 LNAPAIAIGYQQYDILTLYLIADLLCTAAVGPMLLG 430



>gi|485631099|gb|EOD26242.1| hypothetical protein EMIHUDRAFT_236819 [Emiliania huxleyi CCMP1516]
 gi|485634815|gb|EOD29566.1| hypothetical protein EMIHUDRAFT_233786 [Emiliania huxleyi CCMP1516]
          Length = 554

 Score =  150 bits (380), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 116/462 (25%), Positives = 214/462 (46%), Gaps = 77/462 (16%)

Query: 12  IYVVLAIFLGIGIYAGYK----KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFP 67
           +Y  LA+FL I +  GY+     T++   YL++  +Q  V+L  ++FAS  G+ +L++ P
Sbjct: 15  VYGTLAVFLCISLAIGYRFLRSATQDADQYLTARNSQGIVSLSLSFFASGAGAWVLFTVP 74

Query: 68  EVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSL 127
           E   I G + +  Y   +++P+ +F W+GP++RK  P G T + +V  R+G    +Y +L
Sbjct: 75  EASIIGGPVALAGYTLSTLVPIAIFGWIGPIMRKHLPFGCTFSDYVQLRYGSLVNVYCTL 134

Query: 128 MSIAYMFCFMISELSAVGNILVTLT------------GVD------KLAPVICIAIVTTL 169
           +S+ Y+  ++ +E SA+G+ ++ L             GV       KL  V+ +++ T L
Sbjct: 135 VSLLYLCLYLTAEFSAIGDAVLALCDPADVYDAAAAGGVTDKGHRLKLGLVLGVSLCTLL 194

Query: 170 YTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLG----- 224
           YT   GL  SL+TD +QG               T+        D  + + +   G     
Sbjct: 195 YTAIAGLPVSLVTDKVQGVGIFLFTFLVCIAAFTADSGADGRSDRWEEVTTTGTGDPAAT 254

Query: 225 ----------WQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLV 274
                     +++ +I+  AV+ A + H GF QR +++++  +LR  A+ G ++  P++V
Sbjct: 255 GAGGSTYGNSFKMAFILISAVTCANMMHSGFQQRVWAAEDQAKLRKGAIGGILLTIPLMV 314

Query: 275 FLGLTGMIAVWAG---LWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL 331
             G+ GM++       L+P      S+  F+ L ++   W     V+L   M  ++ DT+
Sbjct: 315 LYGVVGMVSYREYGPFLFP---QFPSFAGFYALNELNVGW-QVCAVILTTMMVASSADTI 370

Query: 332 ISATTANF-----------------SNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 374
            +   A F                   +     + LN     +++ NVPA+       D 
Sbjct: 371 QTGVAAIFKPFTTYVLVRDWKALPSEAEAPRTIVALNFV-LAAVVVNVPAIVISTHRGDA 429

Query: 375 LR---------------VFLIADLLAASTMPPILLGLIDSLY 401
           LR               +F++ADL+ A+ + P+L+GL D ++
Sbjct: 430 LRTRPRSGCDAHLSVLSLFVLADLVCATCVVPVLMGLNDRIH 471



>gi|344212553|ref|YP_004796873.1| sodium-solute symporter putative [Haloarcula hispanica ATCC 33960]
 gi|503807004|ref|WP_014040998.1| sodium:proline symporter [Haloarcula hispanica]
 gi|343783908|gb|AEM57885.1| sodium-solute symporter putative [Haloarcula hispanica ATCC 33960]
          Length = 502

 Score =  150 bits (380), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 121/394 (30%), Positives = 191/394 (48%), Gaps = 19/394 (4%)

Query: 18  IFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT-IAGLL 76
           +F GIG++A   +  +   Y+S+  +  +  L +   AS +G  IL S  E G    GL 
Sbjct: 17  VFTGIGLFAARGRIDSVETYISARDSAGSGTLAATVIASMMGVWILLSPAEAGAAFGGLP 76

Query: 77  GVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCF 136
            V+ YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F
Sbjct: 77  AVLGYAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIF 136

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 196
           + +E++ +   L  +  V      + I     +YT YGGL AS++TD +Q          
Sbjct: 137 LAAEMTGIAGALALVADVPLWQTSLLIGGFVLVYTAYGGLLASIVTDTVQTLVILPLLAV 196

Query: 197 XXXXXATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAF 250
                  S+        +V+     L     G  L + + VA +   A + ++G WQR +
Sbjct: 197 GFGGALLSLGGTSEFHATVVSADPTLLDPGFGPGLEFGLYVAFALLGANMLNQGVWQRVY 256

Query: 251 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPD 310
           ++  +R LR      ++++ P+L+  GL G+ A  AGL   E    S   F  + +  P 
Sbjct: 257 AADGERALRRGLGIAAVVVVPMLLLAGLFGIAA--AGLGLTESGSASIAFFLVVAEAFPT 314

Query: 311 WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL---PLNVT-----RFLSLIANV 362
           WV+   VVLAV +  ++ DT+ +A  +  + D+   RL   P   T     R L++   +
Sbjct: 315 WVTLAIVVLAVLLVMSSADTMFNAIASVVTADL--ARLLDDPDQRTLWLGGRGLTVAVAL 372

Query: 363 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            A++ G +   VL++FL ADLLAA    P L GL
Sbjct: 373 AAMFIGAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|495587964|ref|WP_008312543.1| sodium-solute symporter putative [Haloarcula amylolytica]
 gi|445765873|gb|EMA17010.1| sodium-solute symporter putative [Haloarcula amylolytica JCM 13557]
          Length = 502

 Score =  150 bits (378), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 121/394 (30%), Positives = 191/394 (48%), Gaps = 19/394 (4%)

Query: 18  IFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT-IAGLL 76
           +F GIG++A   +  +   Y+S+  +  +  L +   AS +G  IL S  E G    GL 
Sbjct: 17  VFTGIGLFAARGRIDSVETYISARDSAGSGTLAATVIASMMGVWILLSPAEAGAAFGGLP 76

Query: 77  GVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCF 136
            V+ YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F
Sbjct: 77  AVLGYAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIF 136

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 196
           + +E++ +   L  +  V      + I     +YT YGGL AS++TD +Q          
Sbjct: 137 LAAEMTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAV 196

Query: 197 XXXXXATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAF 250
                  S+        +V+     L     G  L + + VA +   A + ++G WQR +
Sbjct: 197 GFGGALLSLGGTSEFHATVVSADPTLLDPGFGPGLEFGLYVAFALLGANMLNQGVWQRVY 256

Query: 251 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPD 310
           ++  +R LR      ++++ P+L+  GL G+ A  AGL   E    S   F  + +  P 
Sbjct: 257 AADGERALRRGLGIAAVVVVPMLLLAGLFGIAA--AGLGLTESGSASIAFFLVVAEAFPT 314

Query: 311 WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL---PLNVT-----RFLSLIANV 362
           WV+   VVLAV +  ++ DT+ +A  +  + D+   RL   P   T     R L++   +
Sbjct: 315 WVTLAIVVLAVLLVMSSADTMFNAIASVVTADL--ARLLDDPDQRTLWLGGRGLTVAVAL 372

Query: 363 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            A++ G +   VL++FL ADLLAA    P L GL
Sbjct: 373 AAMFIGAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|348689995|gb|EGZ29809.1| hypothetical protein PHYSODRAFT_309973 [Phytophthora sojae]
          Length = 442

 Score =  149 bits (376), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 112/371 (30%), Positives = 185/371 (49%), Gaps = 15/371 (4%)

Query: 28  YKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSII 87
           + +  +  +++S+  + +A+ L   +FA+ IG+  L++FPE+G  AG  GVI Y    I 
Sbjct: 28  HIEVNSVKNFVSAKNSTSALRLAWCFFAAGIGAGSLFTFPEIGVDAGSWGVIGYTLSCIS 87

Query: 88  PLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNI 147
            + V   +GP IR    +  T+T  V  RFG   +IY+  +S+ Y F  + SE + +   
Sbjct: 88  GMVVLGVVGPYIRSAVGDNITMTDVVSNRFGYVMRIYIGGISLFYQFICLASEYTCIAQ- 146

Query: 148 LVTLTGVDKLAPVICI---AIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATS 204
           L T+   D   P+I I   A +T LY   GGLRASL TD  QG                 
Sbjct: 147 LTTMMSPDA-HPIITILLVAFLTNLYLTIGGLRASLATDVWQGIDVVALVGLVCIAMFVH 205

Query: 205 IRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVY 264
           + I +     +++    + G+++L  + +AV+ + LF  GFWQR +++ +DR L  +A  
Sbjct: 206 VSIPEGAWKKTNVAAFTTSGFEVLVTLVIAVTASNLFITGFWQRVYTAVDDRTLYKAAFM 265

Query: 265 GSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMS 324
            SI+L    V L + GM++  A  +P     E  L F  L  +   W   I +V+A+ ++
Sbjct: 266 ASIILTVFTVALAMAGMVSYLA--YP-----EGDLFFAILIDMGRGWQVLIIIVIAM-LA 317

Query: 325 CAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLL 384
               D+L     A  +      +L L   R + ++ N PA+  G +  D++ ++LIADLL
Sbjct: 318 SGVSDSLQVGIAAELTTCF--PKLTLLQARIICVLLNAPAIAIGYQQYDIMTLYLIADLL 375

Query: 385 AASTMPPILLG 395
               + P+LLG
Sbjct: 376 CTIAVGPMLLG 386



>gi|303282763|ref|XP_003060673.1| Na+/solute symporter [Micromonas pusilla CCMP1545]
 gi|226458144|gb|EEH55442.1| Na+/solute symporter [Micromonas pusilla CCMP1545]
          Length = 588

 Score =  148 bits (374), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 107/359 (29%), Positives = 182/359 (50%), Gaps = 14/359 (3%)

Query: 49  LGSNWFASSIGSSILYSFPEVGTIAGLL--GVIMYAFGSIIPLFVFAWLGPLIRKKCPE- 105
           +G ++FA  +G+S+ Y   E+G    L   GV  Y  GS  P  +   + P I+K   + 
Sbjct: 67  VGLSYFAGGMGASVYYGSTEMGANTRLSWWGVFGYTMGSTSPALLLIAIAPAIKKFVGDK 126

Query: 106 -GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNI---LVTLTGVDKLAPVI 161
            GF++T F L+RFGR  Q+  + MS+ YMF  + +EL ++ N+       T   +   + 
Sbjct: 127 NGFSVTDFALQRFGRLTQLVAAFMSVMYMFISLCAELGSIANVATLFADRTSYTRKVVLC 186

Query: 162 CIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSN 221
            +A+VT  YT   G  AS+ITD IQG                   +  S +D+  +  S 
Sbjct: 187 VVALVTMSYTMAAGFPASVITDRIQGVMIISFMLFFAIFLMAENPVTPSEMDS--VSHSR 244

Query: 222 SLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGM 281
           + G+ ++  + +A+  A LF+ G WQR +++K+  +LR     G+ ++F V+ F G+ G+
Sbjct: 245 TSGFVVMVTLIIAIISAELFNAGQWQRVYAAKSTVDLRKGLALGAGLIFIVMWFFGVLGV 304

Query: 282 IAVWAGLWPGEENLES---YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTAN 338
           +A  A  +  + N  +   YLA+F L + L      I ++ A S+  ++ D++ +  T+ 
Sbjct: 305 VA--AAKYNDDFNAYTKFHYLAYFYLVENLAKGWHFIVLIFATSLCVSSVDSIQNGLTSV 362

Query: 339 FSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLI 397
              DI    LP+N  R + L  N+ A+      +DVL +FL+ DL+ A   P + LG+I
Sbjct: 363 MYRDIKKFGLPVNSVRVVCLALNIGAIVVAADKIDVLSLFLMVDLVCAVAAPALYLGMI 421



>gi|401395637|ref|XP_003879646.1| hypothetical protein NCLIV_001050 [Neospora caninum Liverpool]
 gi|325114053|emb|CBZ49611.1| hypothetical protein NCLIV_001050 [Neospora caninum Liverpool]
          Length = 2887

 Score =  148 bits (373), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 110/369 (29%), Positives = 186/369 (50%), Gaps = 18/369 (4%)

Query: 36  DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWL 95
           D LSS G     AL  +  AS +G+ +LY  P+VG   G  GV  Y+F   +P  V  W 
Sbjct: 49  DLLSSRGQHGWFALSISLVASFMGNWVLYLPPDVGAQYGWPGVTGYSFACGLPYVVVLWF 108

Query: 96  GPLIRK-KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGV 154
            PL+++    +GF+ T ++L R+GR  Q+  + +S+ +MF  +  EL+ VG   +T+  V
Sbjct: 109 APLVKRLTLTDGFSGTDYLLSRYGRAVQVGATAISLLFMFFALSGELTTVG---ITMNAV 165

Query: 155 DK-----LAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEK 209
            K      A V+ +A+VT  YT YGGLRAS++TD  QG                + R   
Sbjct: 166 TKGAFPVFAAVVPVAVVTLAYTTYGGLRASILTDVYQGVLVVGLVVPLLVTVFVTARDAT 225

Query: 210 SV----IDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYG 265
            V    + +    +    G   +++  +  SF  LF +G WQR +++K+ R++R++    
Sbjct: 226 GVGFPALASPAAFRDYIAG--AVFLFSIWPSF--LFDQGIWQRVWAAKSLRDVRIAFGLA 281

Query: 266 SIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSGITVVLAVSMS 324
            ++ F  + FLG+ G+      L   +E  E  ++ F  L + LP    G+  VLAV+  
Sbjct: 282 GVVAFACVFFLGMVGIACREQALSHAQERNEGNVSVFGYLAETLPAGWVGVLTVLAVTCV 341

Query: 325 CAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLL 384
            ++ DT  +A  + F+ D+  ++   N  R L ++ N+PA+      LD+L + + A++L
Sbjct: 342 ASSADTYQTALASVFAQDLIRSKRSFNWARVLIVLLNIPAIIVAALQLDLLTLNMTANVL 401

Query: 385 AASTMPPIL 393
               + P+L
Sbjct: 402 CVIAVGPML 410



>gi|494484685|ref|WP_007274158.1| sodium-solute symporter [Haloferax sulfurifontis]
 gi|445744769|gb|ELZ96241.1| sodium-solute symporter [Haloferax sulfurifontis ATCC BAA-897]
          Length = 509

 Score =  147 bits (372), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 200/413 (48%), Gaps = 20/413 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L    L  F G+G++    +  +  D +S+  +  +    +   AS +G  
Sbjct: 1   MVSSTVALGLTVATLVAFTGVGVWFSRGRVGSVEDLISARDSTGSRRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ YA G  +P+ V+A LGP IR   PEG +LT++   R+G   
Sbjct: 61  VLFSAPEAGASFGIAAVVGYAVGEAVPMLVYARLGPRIRDLIPEGHSLTEYAHARYGTAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V L+S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLLVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD +Q                 ++    + ID     N  LL   ++ G Q    +  A+
Sbjct: 181 TDAVQAVVVIPLLLLAFAGALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKN----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR +++ +    +R  R +A+    ++F +  F G+  +        P 
Sbjct: 241 LGAELINQTWWQRIYAADSSETVERSFRTAALANGAIVF-ITAFFGVVAVGNAAVVTDPA 299

Query: 292 EENLESYLAFFTLF-KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
                +  AFF L  +  P+W+    V+LA+ +  ++ DTL +A ++  + D+       
Sbjct: 300 SAGYNADAAFFVLLGEAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEP 359

Query: 345 -NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            + RL L  +R L++   + A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRRLALG-SRALTIAVAIAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|491681725|ref|WP_005537864.1| sodium-solute symporter putative [Haloarcula argentinensis]
 gi|445767761|gb|EMA18854.1| sodium-solute symporter putative [Haloarcula argentinensis DSM
           12282]
          Length = 502

 Score =  147 bits (370), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 120/395 (30%), Positives = 194/395 (49%), Gaps = 21/395 (5%)

Query: 18  IFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT-IAGLL 76
           +F GIG++A   +  +   Y+S+  +  +  L +   AS +G  IL S  E G    GL 
Sbjct: 17  VFTGIGLFAARGRIDSVETYISARDSAGSGTLAATVIASMMGVWILLSPAEAGAAFGGLP 76

Query: 77  GVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCF 136
            V+ YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F
Sbjct: 77  AVLGYAIGSAIPLVLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIF 136

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 196
           + +E++ +   L  +  V      + I     +YT YGGL AS++TD +Q          
Sbjct: 137 LAAEMTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAV 196

Query: 197 XXXXXATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAF 250
                  S+        +V+     L   + G  L + + VA +   A + ++G WQR +
Sbjct: 197 GFGGALLSLGGTSEFHATVVSADPTLLDPTFGPGLQFGLYVAFALLGANMLNQGVWQRVY 256

Query: 251 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLP 309
           ++  +  LR      ++++ P+L+  GL G+ A   GL    E+  + +AFF  + +  P
Sbjct: 257 AADGEGALRRGLGIAAVVVVPMLLLAGLFGIAAAGLGL---TESGSASIAFFLVVAEAFP 313

Query: 310 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL---PLNVT-----RFLSLIAN 361
            WV+   VVLAV +  ++ DT+ +A  +  + D+   RL   P   T     R L++   
Sbjct: 314 TWVTLAIVVLAVLLVMSSADTMFNAIASVVTADL--ARLLDDPDQRTLWLGGRGLTVAVA 371

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           + A++ G +   VL++FL ADLLAA    P L GL
Sbjct: 372 LAAMFIGAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|490652117|ref|WP_004517111.1| sodium-solute symporter putative [Haloarcula vallismortis]
 gi|445755364|gb|EMA06754.1| sodium-solute symporter putative [Haloarcula vallismortis ATCC
           29715]
          Length = 502

 Score =  146 bits (369), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 119/395 (30%), Positives = 193/395 (48%), Gaps = 21/395 (5%)

Query: 18  IFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT-IAGLL 76
           +F G+G++A   +  +   Y+S+  +  +  L +   AS +G  IL S  E G    GL 
Sbjct: 17  VFTGVGLFAARGRIDSVETYISARDSAGSGTLAATVIASMMGVWILLSPAEAGAAFGGLP 76

Query: 77  GVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCF 136
            V+ YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F
Sbjct: 77  AVLGYAIGSAIPLVLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIF 136

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 196
           + +E++ +   L  +  V      + I     +YT YGGL AS++TD +Q          
Sbjct: 137 LAAEMTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAI 196

Query: 197 XXXXXATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAF 250
                  S+        +V+     L     G  L + + VA +   A + ++G WQR +
Sbjct: 197 GFGGALLSLGGTSEFHATVVSADPTLLDPGFGPGLEFGLYVAFALLGANMLNQGVWQRVY 256

Query: 251 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLP 309
           ++  +  LR      ++++ P+L+  GL G+ A   GL    E+  + +AFF  + +  P
Sbjct: 257 AADGEDTLRRGMGIAAVVVVPMLLLSGLFGIAAAGLGL---TESGSASIAFFLVVAEAFP 313

Query: 310 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL---PLNVT-----RFLSLIAN 361
            WV+   VVLAV +  ++ DT+ +A  +  + D+   RL   P   T     R L++   
Sbjct: 314 TWVTLAIVVLAVLLVMSSADTMFNAIASVVTADL--ARLLDDPDQQTLWLGGRGLTVAVA 371

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           + A++ G +   VL++FL ADLLAA    P L GL
Sbjct: 372 LAAIFIGAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|145345452|ref|XP_001417224.1| SSS family transporter: sodium ion/solute [Ostreococcus lucimarinus
           CCE9901]
 gi|144577451|gb|ABO95517.1| SSS family transporter: sodium ion/solute [Ostreococcus lucimarinus
           CCE9901]
          Length = 577

 Score =  146 bits (369), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 108/364 (29%), Positives = 181/364 (49%), Gaps = 20/364 (5%)

Query: 49  LGSNWFASSIGSSILYSFPEVGTIAGL--LGVIMYAFGSIIPLFVFAWLGPLIRKKCPE- 105
           +G ++FA  +G+ + Y   E+G    L   GV  Y+F S  P  +  ++ P I+    + 
Sbjct: 67  VGLSYFAGGMGAWVYYGTTEMGANTRLSWWGVFGYSFASASPAILMIFIAPTIKAFVGDK 126

Query: 106 -GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGV---------D 155
            GF++T F L RFGR  Q+  + MS  Y+F F+ +E+S + N+    + V         D
Sbjct: 127 NGFSVTDFALTRFGRCMQLVAAFMSTMYLFIFLCAEISTIANVAALFSDVQGAESKYSRD 186

Query: 156 KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 215
            +   +C+  +T  YT   GL AS+ITD +QG                  + E +     
Sbjct: 187 VILGTVCV--ITLSYTMIAGLPASVITDRVQG--VMITGFMLLFSCVVLAKNEVTATQMR 242

Query: 216 DLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVF 275
            + KS + G+ ++  + +A   A LF+ G WQR +++++ ++LR     G+ M+F V+ F
Sbjct: 243 AVSKSTTNGFVVMITLIIATLGAELFNAGQWQRVYAARSTQDLRKGLALGAGMIFVVMWF 302

Query: 276 LGLTGMIAVWAGLWPGEENLE--SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLIS 333
            G+ G+ AV A      ++     YLAFF L + L      I ++ A S+  ++ D++ +
Sbjct: 303 FGILGVTAV-AKYRADFDDFSRLHYLAFFELAEGLAKGWHVIILIFATSLCVSSVDSIQN 361

Query: 334 ATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPIL 393
             T+    DI N  LP N  R +    NV A++  +  +DVL +FL+ DL+ A   P + 
Sbjct: 362 GLTSVLYRDILNYDLPANSVRVICAALNVGAIFVAVDKIDVLSLFLMVDLVCALAAPALY 421

Query: 394 LGLI 397
           LGLI
Sbjct: 422 LGLI 425



>gi|495848440|ref|WP_008573019.1| sodium-solute symporter [Haloferax sp. ATCC BAA-646]
 gi|445710004|gb|ELZ61827.1| sodium-solute symporter [Haloferax sp. ATCC BAA-646]
 gi|445710118|gb|ELZ61940.1| sodium-solute symporter [Haloferax sp. ATCC BAA-645]
 gi|445719176|gb|ELZ70858.1| sodium-solute symporter [Haloferax sp. ATCC BAA-644]
          Length = 509

 Score =  146 bits (369), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 200/413 (48%), Gaps = 20/413 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L    L  F G+G++    +  +  D +++  +  +    +   AS +G  
Sbjct: 1   MVSSTVALGLTVATLVAFTGVGVWFSRGRVGSVEDLITARDSAGSRRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ YA G  +P+ V+A LGP IR+  PEG +LT++   R+G   
Sbjct: 61  VLFSAPEAGASFGIAAVVGYAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGTAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V ++S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLVVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD +Q                 ++    + ID     N  LL   ++ G Q    +  A+
Sbjct: 181 TDAVQAVIVIPLLLLAFVGALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR +++ +     R  R +A+    ++F V  F G+  +        P 
Sbjct: 241 LGAELINQTWWQRIYAADSSETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPA 299

Query: 292 EENLESYLAFFTLF-KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
                +  AFF L  +  P+W+    V+LA+ +  ++ DTL +A ++  + D+       
Sbjct: 300 SAGYNADAAFFVLLGEAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEP 359

Query: 345 -NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            + RL L  +R L++   V A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRRLALG-SRALTIAVAVAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|491109342|ref|WP_004968441.1| sodium-solute symporter [Haloferax denitrificans]
 gi|445754912|gb|EMA06306.1| sodium-solute symporter [Haloferax denitrificans ATCC 35960]
          Length = 509

 Score =  146 bits (368), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 198/413 (47%), Gaps = 20/413 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L    L  F G+G++    +  +  D +S+  +  +    +   AS +G  
Sbjct: 1   MVSSTVALGLTVATLVAFTGVGVWFSRGRVGSVEDLISARDSTGSRRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ YA G  +P+ V+A LGP IR   PEG +LT++   R+G   
Sbjct: 61  VLFSAPEAGASFGIAAVVGYAVGEAVPMLVYARLGPRIRDLIPEGHSLTEYAHARYGTAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V L+S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLLVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD +Q                 ++    + ID     N  LL   ++ G Q    +  A+
Sbjct: 181 TDAVQAVVVIPLLLLAFVGALVALGGPAATIDGITATNPALLDLGAVAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR +++ +     R  R +A+    ++F +  F G+  +        P 
Sbjct: 241 LGAELINQTWWQRIYAADSSETVGRSFRTAALANGAIVF-ITAFFGVVAVGNAAVVTDPA 299

Query: 292 EENLESYLAFFTLF-KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
                +  AFF L  +  P+W+    V+LA+ +  ++ DTL +A ++  + D+       
Sbjct: 300 SAGYNADAAFFVLLGEAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEP 359

Query: 345 -NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            + RL    +R L++   V A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRRLAFG-SRALTIAVAVAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|389848875|ref|YP_006351112.1| sodium/proline symporter [Haloferax mediterranei ATCC 33500]
 gi|490157777|ref|WP_004056446.1| sodium:proline symporter [Haloferax mediterranei]
 gi|388246181|gb|AFK21125.1| sodium/proline symporter [Haloferax mediterranei ATCC 33500]
 gi|445753959|gb|EMA05374.1| sodium/proline symporter [Haloferax mediterranei ATCC 33500]
          Length = 509

 Score =  145 bits (365), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 115/413 (27%), Positives = 200/413 (48%), Gaps = 20/413 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S +++  L    L +F GIG++    +  +  D +S+ G+       +   AS +G  
Sbjct: 1   MVSSMIALGLTVATLVLFTGIGVWVSRGRVDSVEDLISARGSTGERRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ YA G  +P+ V+A LGP IR+  P G +LT++   R+G   
Sbjct: 61  VLFSAPEAGAGFGIAAVVGYAIGEAVPMLVYAKLGPRIRRLIPHGHSLTEYAHARYGTAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V L+S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLLVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN------SDLLKSNSLGWQLLYIMPVAV 235
           TD +Q                 ++    + +D         L      G Q    +  A+
Sbjct: 181 TDAVQAVIVLPLLLLAFVGALVALGGPSAALDGITTANPGLLDLGALAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR ++S ++    R  R +A+   +++F V  F G+  +          
Sbjct: 241 LGAELINQTWWQRIYASDSEETVTRSFRNAALTNGLVVF-VTAFFGIIAVGNADVITDVT 299

Query: 292 EENLESYLAFFTLFK-VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
             N  + +AFF L +   P+W+    V+LA+ +  ++ DTL +A ++  + D+       
Sbjct: 300 SSNYNADVAFFVLLQDAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLSSP 359

Query: 345 -NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            + RL    +R L+++  + A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRRLAFG-SRTLTVVVALAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|493648470|ref|WP_006600045.1| sodium-solute symporter [Haloferax alexandrinus]
 gi|445744183|gb|ELZ95662.1| sodium-solute symporter [Haloferax alexandrinus JCM 10717]
          Length = 509

 Score =  144 bits (363), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 118/413 (28%), Positives = 199/413 (48%), Gaps = 20/413 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L    L  F G+G++    +  +  D +S+  +  +    +   AS +G  
Sbjct: 1   MVSSTVALGLTVATLVAFTGLGVWFSRGRVGSVEDLISARDSAGSRRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ YA G  +P+ V+A LGP IR+  PEG +LT++   R+G   
Sbjct: 61  VLFSAPEAGASFGIAAVVGYAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGTAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V L+S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLLVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD +Q                 ++    + ID     N  LL   ++ G Q    +  A+
Sbjct: 181 TDAVQAVVVIPLLLLAFAGALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR +++ +     R  R +A+    ++F V  F G+  +        P 
Sbjct: 241 LGAELINQTWWQRIYAADSSETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPA 299

Query: 292 EENLESYLAFFTLF-KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
                +  AFF L  +  P+W+    V+LA+ +  ++ DTL +A ++  + D+       
Sbjct: 300 SAGYNADAAFFVLLGEAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEP 359

Query: 345 -NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            + RL L  +R L++     A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRRLALG-SRALTIAVAAAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|490163169|ref|WP_004061823.1| sodium-solute symporter [Haloferax lucentense]
 gi|445725920|gb|ELZ77538.1| sodium-solute symporter [Haloferax lucentense DSM 14919]
          Length = 509

 Score =  144 bits (362), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 118/413 (28%), Positives = 199/413 (48%), Gaps = 20/413 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L    L  F G+G++    +  +  D +S+  +  +    +   AS +G  
Sbjct: 1   MVSSTVALGLTVATLVAFTGLGVWFSRGRVGSVEDLISARDSAGSRRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ YA G  +P+ V+A LGP IR+  PEG +LT++   R+G   
Sbjct: 61  VLFSAPEAGASFGIAAVVGYAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGTAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V L+S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLLVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD +Q                 ++    + ID     N  LL   ++ G Q    +  A+
Sbjct: 181 TDAVQAVVVIPLLLLAFAGALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR +++ +     R  R +A+    ++F V  F G+  +        P 
Sbjct: 241 LGAELINQTWWQRIYAADSSETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPA 299

Query: 292 EENLESYLAFFTLF-KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
                +  AFF L  +  P+W+    V+LA+ +  ++ DTL +A ++  + D+       
Sbjct: 300 SAGYNADAAFFVLLGEAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEP 359

Query: 345 -NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            + RL L  +R L++     A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRRLALG-SRALTIAVAAAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|494345167|ref|WP_007188843.1| sodium-solute symporter putative [Haloarcula californiae]
 gi|445769530|gb|EMA20604.1| sodium-solute symporter putative [Haloarcula californiae ATCC
           33799]
          Length = 502

 Score =  144 bits (362), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 123/409 (30%), Positives = 198/409 (48%), Gaps = 17/409 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V   L    + +F GIG++A   +  +   Y+S+  +  +  L +   AS +G  
Sbjct: 1   MVSSAVVLGLTAATVLVFTGIGLFAARGRIDSVETYISARDSAGSGTLAATVIASMMGVW 60

Query: 62  ILYSFPEVGT-IAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRF 120
           IL S  E G    GL  V+ YA GS IPL +F  +G  IR+  P G +LT+F   RFG  
Sbjct: 61  ILLSPAEAGAAFGGLPAVLGYAIGSAIPLVLFIPVGARIREVMPAGHSLTEFAYARFGSG 120

Query: 121 NQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 180
             + V L+S+ YMF F+ +E++ +   L  +  V      + I     +YT YGGL AS+
Sbjct: 121 MYLLVLLVSVFYMFIFLAAEMTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASI 180

Query: 181 ITDNIQGWAXXXXXXXXXXXXATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVS 236
           +TD +Q                 S+        +V+     L   + G  L + + VA +
Sbjct: 181 VTDTVQTLVILPLLAVGFGGALLSLGGTSEFHATVVSADPTLLDPTFGPGLQFGLYVAFA 240

Query: 237 F--ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN 294
              A + ++G WQR +++  +R LR       +++ P+L+  GL G+ A   GL    E+
Sbjct: 241 LLGANMLNQGVWQRVYAADGERALRRGMGIAGLVVVPMLLLSGLFGIAAAGLGL---TES 297

Query: 295 LESYLAFF-TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------NNR 347
             + +AFF  L +  P WV+   VVLAV +  ++ DT+ +A  +  + D+       + R
Sbjct: 298 GSASIAFFLVLAEAFPTWVTLAVVVLAVLLVMSSADTMFNAIASVVTADLARLLDDPDQR 357

Query: 348 LPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
                 R L++   + A++ G +   VL++FL ADLLAA    P L GL
Sbjct: 358 TLWLGGRGLTVAVALAAMFIGAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|491113813|ref|WP_004972271.1| sodium-solute symporter [Haloferax gibbonsii]
 gi|445733395|gb|ELZ84965.1| sodium-solute symporter [Haloferax gibbonsii ATCC 33959]
          Length = 509

 Score =  144 bits (362), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 119/413 (28%), Positives = 201/413 (48%), Gaps = 20/413 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L    L  F G+G++    +  +  D +S+  +  +    +   AS +G  
Sbjct: 1   MVSSTVALGLTVATLVAFTGVGVWFSRGRVGSVEDLISARDSAGSRRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ YA G  +P+ V+A LGP IR+  PEG +LT++   R+G   
Sbjct: 61  VLFSAPEAGASFGIAAVVGYAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGSAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V L+S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLLVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD +Q                 ++    + ID     N  LL   ++ G Q    +  A+
Sbjct: 181 TDAVQAVIVIPLLLLAFAGTLVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR +++ +     R  R +A+    ++F V  F G+  +        P 
Sbjct: 241 LGAELINQTWWQRIYAADSSETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPA 299

Query: 292 EENLESYLAFFTLF-KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
                +  AFF L  +  P+W+    V+LA+ +  ++ DTL +A ++  + D+       
Sbjct: 300 SAGYNADAAFFVLLGEAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEP 359

Query: 345 -NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            + RL L  +R L+++  V A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRRLALG-SRALTVVVAVAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|495819990|ref|WP_008544569.1| sodium:solute transporter family protein [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082653|gb|EDZ60079.1| sodium:solute transporter family protein [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 480

 Score =  143 bits (361), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 111/396 (28%), Positives = 202/396 (51%), Gaps = 18/396 (4%)

Query: 11  LIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVG 70
           L+ ++  +F  +G+Y   KK K  ++YL++       +L ++  AS++G+ IL+      
Sbjct: 15  LVIIISLLFAILGLYHT-KKFKGINNYLTANRNVGLFSLTTSLVASALGAWILFGPASAA 73

Query: 71  TIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSI 130
           T  G+  VI YA G+  P+    +LG  IRK+ P+G +L +F+ ++FG+     + LM+I
Sbjct: 74  TWGGIGAVIGYALGTAFPMIFLIYLGKKIRKEFPKGSSLIEFMRKKFGKSLFKLILLMTI 133

Query: 131 AYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ---- 186
            YMF F+ +E++AV  ++  ++G +     I +   T  YT YGGLRAS+ TDNIQ    
Sbjct: 134 FYMFIFLCAEVTAVAVLINYISGTELWITAIIVLFATLTYTLYGGLRASIFTDNIQMIVI 193

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLL-KSNSLGWQLLYIMPVAVSFATLFHEGF 245
           G               +          N  LL +S S  +       +AV+   LFH+G 
Sbjct: 194 GILLLISVTYIISFTGSEFSFAYIEQKNPQLLSRSYSPNYTAGLTFFIAVAATNLFHQGN 253

Query: 246 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-L 304
           WQR +++K+ + L+   +   +++ P++ F+G  GM++     +  + +    L FFT L
Sbjct: 254 WQRVYAAKDYQTLKKGLIIAFLIIVPIVFFMGFAGMVS-----FSIDSSARPDLGFFTLL 308

Query: 305 FKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSND-----IFNNRLP-LNVTRFLSL 358
            +   + +S I V L ++++ +  DTL++A ++ F  D      FN +   L ++++  +
Sbjct: 309 LREQTEILSLIIVTLGLALTISTVDTLVNAISSLFVVDGKATFNFNKKTDYLKLSKYFII 368

Query: 359 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILL 394
             +V       K  D+L +FL+ADL   + +  + L
Sbjct: 369 FLSVITFIVASKGYDILYLFLLADLFCCAFVLTVFL 404



>gi|428171596|gb|EKX40511.1| hypothetical protein GUITHDRAFT_75395, partial [Guillardia theta
           CCMP2712]
          Length = 447

 Score =  142 bits (358), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 107/382 (28%), Positives = 189/382 (49%), Gaps = 28/382 (7%)

Query: 32  KNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFV 91
           +    +L++  +Q    +  +++A S+GS  + S     T AG +G+I  A G+ +PL V
Sbjct: 43  QTSEGFLTAKKSQGMYRIAWSFYAGSVGSWCITSPSNYATYAGWIGMIFMAIGTGVPLIV 102

Query: 92  FAWLGPLIRKKCPEGFTLTQFVLERFG---RFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
            ++ G +++ K P   +   F+  RFG   +   I V+L+++A M   M++E + +G + 
Sbjct: 103 QSYFGSMVQSKYPTVNSFGDFITARFGPTAKLACIGVALINMAVM---MLAEFTTIGGLF 159

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIE 208
               G +    ++ +A VTT+YT YGGL  S++TD +QG              A + + E
Sbjct: 160 RDFVGTEGFPIILIVATVTTVYTMYGGLLVSIVTDQVQGITSVVLITTISIYVAATFKRE 219

Query: 209 KSVIDNSDLLKS----NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVY 264
             +  N   LK     N  G+  + +MP ++  + +F+EG WQR +++K+ + L+   V 
Sbjct: 220 --LPPNFGSLKQSLGPNQSGYSSILVMPASLMSSVMFNEGMWQRVWAAKDPQSLKRGGVL 277

Query: 265 GSIMLFPVLVFLGLTGMIAVWAGL---WPGEENLESYLAFFTLFKVLPD--------WVS 313
             + +  V+   GL G +A W GL     G  NL  YL  F +FK  P+        ++ 
Sbjct: 278 ACLAVVSVVFLFGLGGFLAAWGGLIDFQTGNPNL--YL--FQVFKSSPNQNNVHVNQFIE 333

Query: 314 GITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD 373
            + +VLA  M+ +A D++ +   A  S      + PL   R   L+  V  V + L +  
Sbjct: 334 VLVLVLAAVMNESAIDSVQNGLAATISTQFLRGK-PLIWARGCVLVITVIIVPFALANYA 392

Query: 374 VLRVFLIADLLAASTMPPILLG 395
           VL +FL+  +LA   + P++LG
Sbjct: 393 VLSIFLLPSILAVCWLFPVMLG 414



>gi|55378520|ref|YP_136370.1| sodium-solute symporter [Haloarcula marismortui ATCC 43049]
 gi|499543045|ref|WP_011223828.1| sodium:proline symporter [Haloarcula marismortui]
 gi|55231245|gb|AAV46664.1| sodium-solute symporter putative [Haloarcula marismortui ATCC
           43049]
          Length = 502

 Score =  142 bits (357), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 118/393 (30%), Positives = 191/393 (48%), Gaps = 17/393 (4%)

Query: 18  IFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT-IAGLL 76
           +F GIG++A   +  +   Y+S+  +  +  L +   AS +G  IL S  E G    GL 
Sbjct: 17  VFTGIGLFAARGRIDSVETYISARDSAGSGTLAATVIASMMGVWILLSPAEAGAAFGGLP 76

Query: 77  GVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCF 136
            V+ YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F
Sbjct: 77  AVLGYAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIF 136

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 196
           + +E++ +   L  +  V      + I     +YT YGGL AS++TD +Q          
Sbjct: 137 LAAEMTGIAGALALVADVPLWQTSLLIGGFVLVYTAYGGLLASIVTDTVQTLVILPLLAV 196

Query: 197 XXXXXATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAF 250
                  S+        +V+     L     G  L + + VA +   A + ++G WQR +
Sbjct: 197 GFGGALLSLGGTSEFHATVVSADPTLLDPGFGPGLEFGLYVAFALLGANMLNQGVWQRVY 256

Query: 251 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLP 309
           ++  D  LR      ++++ P+L+  GL G+ A   GL    E+  + +AFF  + +  P
Sbjct: 257 AADGDGALRRGMGIAAVVVVPMLLLSGLFGIAAAGLGL---TESGSASIAFFLVVAEAFP 313

Query: 310 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANVP 363
            WV+   VVLAV +  ++ DT+ +A  +  + D+       + R      R L++   + 
Sbjct: 314 TWVTLAVVVLAVLLVMSSADTMFNAIASVVTADLARLLDDPDQRTLWLGGRGLTVAVALA 373

Query: 364 AVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           A++ G +   VL++FL ADLLAA    P L GL
Sbjct: 374 AMFIGAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|332283893|ref|YP_004415804.1| sodium transporter family protein [Pusillimonas sp. T7-7]
 gi|503507058|ref|WP_013741719.1| sodium:solute symporter [Pusillimonas sp. T7-7]
 gi|330427846|gb|AEC19180.1| sodium transporter family protein [Pusillimonas sp. T7-7]
          Length = 479

 Score =  141 bits (356), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 114/403 (28%), Positives = 193/403 (47%), Gaps = 48/403 (11%)

Query: 28  YKKTKNKS--DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGS 85
           Y + +  S  DY+ +  +Q+ +A      A+S+G+ IL++  +  T  GL  +I Y  G+
Sbjct: 25  YSRHERNSLEDYVVARNSQSTIATILTLLATSLGAWILFAPAQAATWGGLAAIIGYGLGA 84

Query: 86  IIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVG 145
             P ++   LG  +R+  P+G TLT+FV+ R+G+       ++ + YMF  + +E++A+ 
Sbjct: 85  ASPRWLMIPLGRRMRELIPQGHTLTEFVIVRYGKPMYGLALIIMMFYMFITLAAEITAIA 144

Query: 146 NILVTLTGVDKLAPV---ICIAIV---TTLYTGYGGLRASLITDNIQ------------- 186
            +      V  LAPV   +  AIV   T LYT YGGLRAS+ TD +Q             
Sbjct: 145 KL------VQLLAPVPLWVTAAIVMGSTLLYTSYGGLRASIFTDKVQMAVIVPLLLVLLV 198

Query: 187 -GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLK-SNSLGWQLLYIMPVAVSFATLFHEG 244
            GW               +  IE   I    LL  ++ +G +  +   VA+    LFH+G
Sbjct: 199 LGW---------QATGGLAPAIEGLQIKAPQLLSLTDPVGVKAGFTFFVAILLTGLFHQG 249

Query: 245 FWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTL 304
            WQR +S+K+ R +R   + G +   P +  +GL G+   + GL  G     S   F  L
Sbjct: 250 NWQRVYSAKDTRSMRRGFLLGGLFAGPFIFVMGLFGL--AFVGL--GHTGDSSVALFSVL 305

Query: 305 FKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI------FNNRLPLNVTRFLSL 358
              +P W +   + L +++  +  DT ISA ++  + D+       N R  + ++R+L  
Sbjct: 306 LGHIPGWFAIALIPLGLALVMSTADTTISAVSSLIAVDVRRLTPAINKRALMALSRWLIF 365

Query: 359 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 401
           +  +P +    +   VL +FL+ADL  ++   P+  GL +  Y
Sbjct: 366 LLAIPVMIVAAQGYSVLYLFLLADLFCSAAAFPVFFGLFNRRY 408



>gi|495372393|ref|WP_008097106.1| sodium-solute symporter [Haloferax prahovense]
 gi|445711601|gb|ELZ63391.1| sodium-solute symporter [Haloferax prahovense DSM 18310]
          Length = 509

 Score =  141 bits (356), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 199/413 (48%), Gaps = 20/413 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L    L  F G+G++    +  +  D +S+  +  +    +   AS +G  
Sbjct: 1   MVSSTVALGLTVATLVAFTGVGVWFSRGRVGSVEDLISARDSAGSRRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ YA G  +P+ V+A LGP IR+  PEG +LT++   R+G   
Sbjct: 61  VLFSAPEAGASFGIAAVVGYAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGSAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V L+S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLLVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD +Q                 ++    + ID     N  LL   ++ G Q    +  A+
Sbjct: 181 TDAVQAVVVIPLLLLAFAGALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR +++ +     R  R +A+    ++F V  F G+  +        P 
Sbjct: 241 LGAELINQTWWQRIYAADSSETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPA 299

Query: 292 EENLESYLAFFTLF-KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
                +  AFF L  +  P+W+    V+LA+ +  ++ DTL +A ++  + D+       
Sbjct: 300 SAGYNADAAFFVLLGEAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEP 359

Query: 345 -NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            +  L L  +R L+++    A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRHLALG-SRALTVVVAAAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|292494311|ref|YP_003533454.1| sodium-solute symporter [Haloferax volcanii DS2]
 gi|490140807|ref|WP_004041156.1| sodium:proline symporter [Haloferax volcanii]
 gi|291369368|gb|ADE01598.1| sodium-solute symporter putative [Haloferax volcanii DS2]
 gi|445582492|gb|ELY36833.1| sodium-solute symporter [Haloferax volcanii DS2]
          Length = 509

 Score =  141 bits (356), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 199/413 (48%), Gaps = 20/413 (4%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L    L  F G+G++    +  +  D +S+  +  +    +   AS +G  
Sbjct: 1   MVSSTVALGLTVATLVAFTGVGVWFSRGRVGSVEDLISARDSAGSRRTTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           +L+S PE G   G+  V+ YA G  +P+ V+A LGP IR+  PEG +LT++   R+G   
Sbjct: 61  VLFSAPEAGASFGIAAVVGYAVGEAVPMLVYARLGPRIRELIPEGHSLTEYAHARYGTAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V L+S  YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ 
Sbjct: 121 YAFVLLVSALYMFIFLAAELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD +Q                 ++    + ID     N  LL   ++ G Q    +  A+
Sbjct: 181 TDAVQAVVVIPLLLLAFAGALVALGGPAAAIDGITATNPALLDLGAVAGLQFGLALAFAI 240

Query: 236 SFATLFHEGFWQRAFSSKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 291
             A L ++ +WQR +++ +     R  R +A+    ++F V  F G+  +        P 
Sbjct: 241 LGAELINQTWWQRIYAADSSETVGRSFRTAALANGAIVF-VTAFFGVVAVGNAAVVTDPA 299

Query: 292 EENLESYLAFFTLF-KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------ 344
                +  AFF L  +  P+W+    V+LA+ +  ++ DTL +A ++  + D+       
Sbjct: 300 SAGYNADAAFFVLLGEAFPEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADLARLLAEP 359

Query: 345 -NNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            +  L L  +R L+++    A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 360 SDRHLALG-SRALTVVVAAAAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|491096221|ref|WP_004957825.1| sodium-solute symporter putative [Haloarcula sinaiiensis]
 gi|445764745|gb|EMA15889.1| sodium-solute symporter putative [Haloarcula sinaiiensis ATCC
           33800]
          Length = 502

 Score =  141 bits (355), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 121/395 (30%), Positives = 194/395 (49%), Gaps = 21/395 (5%)

Query: 18  IFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT-IAGLL 76
           +F GIG++A   +  +   Y+S+  +  +  L +   AS +G  IL S  E G    GL 
Sbjct: 17  VFTGIGLFAARGRIDSVETYISARDSAGSGTLAATVIASMMGVWILLSPAEAGAAFGGLP 76

Query: 77  GVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCF 136
            V+ YA GS IPL +F  +G  IR+  P G +LT+F   RFG    + V L+S+ YMF F
Sbjct: 77  AVLGYAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSGMYLLVLLVSVFYMFIF 136

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 196
           + +E++ +   L  +  V      + I     +YT YGGL AS++TD +Q          
Sbjct: 137 LAAEMTGIAGALALVADVPLWQTSLLIGGFVLVYTTYGGLLASIVTDTVQTLVILPLLAV 196

Query: 197 XXXXXATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF--ATLFHEGFWQRAF 250
                  S+        +V+     L   + G  L + + VA +   A + ++G WQR +
Sbjct: 197 GFGGALLSLGGTSEFHATVVSADPTLLDPTFGPGLQFGLYVAFALLGANMLNQGVWQRVY 256

Query: 251 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF-TLFKVLP 309
           ++  +  LR      ++++ P+L+  GL G+ A   GL    E+  + +AFF  L +  P
Sbjct: 257 AADGEGALRRGMGIAALVVVPMLLLSGLFGIAAAGLGL---TESGSASIAFFLVLAEAFP 313

Query: 310 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL---PLNVT-----RFLSLIAN 361
            WV+   VVLAV +  ++ DT+ +A  +  + D+   RL   P   T     R L++   
Sbjct: 314 TWVTLAVVVLAVLLVMSSADTMFNAIASVVTADL--ARLLDDPDQRTLWLGGRGLTVAVA 371

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           + A++ G +   VL++FL ADLLAA    P L GL
Sbjct: 372 LAAMFIGAQGYSVLQLFLTADLLAAGVFVPFLAGL 406



>gi|308802840|ref|XP_003078733.1| unnamed protein product [Ostreococcus tauri]
 gi|116057186|emb|CAL51613.1| unnamed protein product [Ostreococcus tauri]
          Length = 630

 Score =  141 bits (355), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 111/412 (26%), Positives = 206/412 (50%), Gaps = 25/412 (6%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYKKTKN-----KSDYLSSLGTQNAV---ALGSNWFASSIG 59
           + +L +VV   F   G   G+ + ++     K+  +  L  +N++    +G ++FA  +G
Sbjct: 75  TTLLFFVVALTFAFRGKDGGWMRARDFVEAVKTPSVHWLSAKNSLPWRQVGLSYFAGGMG 134

Query: 60  SSILYSFPEVGTIAGL--LGVIMYAFGSIIPLFVFAWLGPLIRKKCPE--GFTLTQFVLE 115
           + + Y   EVG    L   G+  Y+  S  P  V  ++ P I+    +  GF++T F L 
Sbjct: 135 AWVYYGTTEVGAKPRLSWWGIFGYSVASASPALVMIFIAPTIKAFVGDKNGFSVTDFALS 194

Query: 116 RFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLT----GVDKLAP---VICIAIVTT 168
           R+GR  Q+  + +S+ YMF  + +EL+ + N+    +      D+ A    ++ + ++T 
Sbjct: 195 RYGRSMQLVSAFISVMYMFISLCAELTTIANVSALFSDDYGATDEKARTTVLVTVCVITL 254

Query: 169 LYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLL 228
            YT   GL AS+ITD +QG                  R+ K+  + +   KS   G+ ++
Sbjct: 255 TYTMLAGLPASVITDRLQGVMITGFMLLFTVILLADNRVTKAQYERAS--KSTDEGFVVM 312

Query: 229 YIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGL 288
             + +AV  A LF+ G WQR +++K+  +LR     G+ ++F V+ F G+ G++++ A  
Sbjct: 313 ITLIIAVLSAELFNAGQWQRVYAAKSTADLRKGLALGAGLIFFVMWFFGVLGVVSL-AKY 371

Query: 289 WPGEE---NLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFN 345
           +   E      +YL FF L + L      + ++ A S+  ++ D++ +  T+    D+ N
Sbjct: 372 YDDYEVSYTKYAYLGFFYLAESLNKGWHVLILIFATSLCVSSVDSIQNGLTSVLYRDVLN 431

Query: 346 NRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLI 397
             +P+NV R +    NV A++  +  +DVL +FL+ DL+ A   P + LGL+
Sbjct: 432 FGVPVNVIRVVCAALNVGAIFVAIDKIDVLSLFLMVDLVCALGAPALYLGLM 483



>gi|313117273|ref|YP_004044256.1| Na+/proline symporter [Halogeometricum borinquense DSM 11551]
 gi|492947951|ref|WP_006056036.1| sodium:proline symporter [Halogeometricum borinquense]
 gi|312294164|gb|ADQ68595.1| Na+/proline symporter [Halogeometricum borinquense DSM 11551]
 gi|445570976|gb|ELY25534.1| Na+/proline symporter [Halogeometricum borinquense DSM 11551]
          Length = 526

 Score =  139 bits (351), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 121/416 (29%), Positives = 204/416 (49%), Gaps = 26/416 (6%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  ++  L    L IF GIG++    K ++  D +++        + +   AS +G  
Sbjct: 1   MVSSTIALALTVATLVIFTGIGVWFSRGKVESVEDLITARNATGEGQMSATLIASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           IL S PE G + G+  VI Y  G  +P+  ++ LGP IR+  PEG +LT++   R+G   
Sbjct: 61  ILLSAPEAGALYGIAAVIGYGIGEAVPMLAYSRLGPRIRELIPEGHSLTEYAYARYGGAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V ++S+ YMF F+ +EL+ +   L  + G+ +    + +     LYTGYGGLRAS+ 
Sbjct: 121 YAFVIVVSVLYMFVFLAAELTGISLALNHVAGIPQWQTAVLVGGFVLLYTGYGGLRASIF 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSI----RIEKSVID-NSDLLKSNSL-GWQLLYIMPVAV 235
           TD IQ                 ++     I + V++ N+ LL    + G +    +  AV
Sbjct: 181 TDTIQTMVILPLLVLSVAAVILTLGGPGAIHQGVVEANATLLDPGFVPGLRFGIALVFAV 240

Query: 236 SFATLFHEGFWQRAFSSKN----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG---L 288
             A L ++ +WQR +++ +    +R  R + V   +    +LV   L G++AV       
Sbjct: 241 LGAELVNQTWWQRIYAATDSGVLERGFRTATVANGL----ILVLATLLGVVAVGNADVVT 296

Query: 289 WPGEENLESYLAFFTLFK-VLPDWVSGITVVLAVSMSCAAYDTLISA----TTANFS--- 340
             G EN  + +AFF L + V  +W+    ++LA+++  +  DTL +A     TA+     
Sbjct: 297 QLGSENYNAGIAFFVLLEGVFGEWLVLGVLLLALTLVMSTADTLFNALSSLVTADLPRLL 356

Query: 341 NDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           ND  +  L L       ++A   A+   L+   VLR+F +ADLL A+   P++ GL
Sbjct: 357 NDPDDRTLRLGARAVTVVVAVA-AIAVSLRARSVLRLFFVADLLGAAVGFPLVYGL 411



>gi|490728987|ref|WP_004591385.1| sodium-solute symporter putative [Haloarcula japonica]
 gi|445782306|gb|EMA33153.1| sodium-solute symporter putative [Haloarcula japonica DSM 6131]
          Length = 502

 Score =  139 bits (351), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 122/411 (29%), Positives = 201/411 (48%), Gaps = 21/411 (5%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V   L    + +F G+G++A   +  +   Y+S+  +  +  L +   AS +G  
Sbjct: 1   MVSSAVVLGLTAATVLVFTGVGLFAARGRIDSVETYISARDSAGSGTLAATVIASMMGVW 60

Query: 62  ILYSFPEVGT-IAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRF 120
           IL S  E G    GL  V+ YA GS IPL +F  +G  IR+  P G +LT+F   RFG  
Sbjct: 61  ILLSPAEAGAAFGGLPAVLGYAIGSAIPLLLFIPVGARIREVMPAGHSLTEFAYARFGSG 120

Query: 121 NQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 180
             + V L+S+ YMF F+ +E++ + + L  +  V      + I     +YT YGGL AS+
Sbjct: 121 MYLLVLLVSVFYMFIFLAAEMTGIASALALVADVPLWQTSLLIGGFVLVYTTYGGLLASI 180

Query: 181 ITDNIQGWAXXXXXXXXXXXXATSI----RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVS 236
           +TD +Q                 S+        +V+     L   + G  L + + VA +
Sbjct: 181 VTDTVQTLVILPLLAVGFGGALLSLGGTSEFHATVVSADPTLLDPTFGPGLEFGLYVAFA 240

Query: 237 F--ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN 294
              A + ++G WQR +++  +  LR      ++++ P+L+  GL G+ A   GL    E+
Sbjct: 241 LLGANMLNQGVWQRVYAADGEGALRRGMGIAAVVVVPMLLLSGLFGIAATGLGL---TES 297

Query: 295 LESYLAFF-TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL---PL 350
             + +AFF  + +  P WV+   VVLAV +  ++ DT+ +A  +  + D+   RL   P 
Sbjct: 298 GSASIAFFLVVAEAFPQWVTLAVVVLAVLLVMSSADTMFNAIASVVTADL--ARLLDDPD 355

Query: 351 NVT-----RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
             T     R L++   + A++ G +   VL++FL ADLLA+    P L GL
Sbjct: 356 QRTLWLGGRGLTVAVALGAIFIGAQGYSVLQLFLTADLLASGVFVPFLAGL 406



>gi|495289883|ref|WP_008014637.1| Na+/solute symporter [Haloterrigena limicola]
 gi|445664725|gb|ELZ17430.1| Na+/solute symporter [Haloterrigena limicola JCM 13563]
          Length = 505

 Score =  139 bits (349), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 112/407 (27%), Positives = 195/407 (47%), Gaps = 26/407 (6%)

Query: 11  LIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVG 70
           L   VL  F  +G++   ++     D +++  +       +   AS +G  IL + PE G
Sbjct: 5   LTIAVLVGFTAVGLWYSRRRIGTVEDLITARNSTGTGRTTATLVASVMGVWILLAAPEAG 64

Query: 71  TIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSI 130
              G+  V+ YA G  +P+  ++ +GP IR+  P G +LT++   R+G     +V L+S 
Sbjct: 65  ASFGIAAVVGYAIGEALPMLAYSRVGPRIREVIPNGHSLTEYAHARYGTAMYAFVLLVSC 124

Query: 131 AYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAX 190
            YMF F+ +EL+ +   L  + GV +    + +     LYT YGGLRAS+ TD+IQ    
Sbjct: 125 LYMFVFLAAELTGIAGALSLVAGVPQWQTAVLVGGFVLLYTSYGGLRASIFTDSIQALLV 184

Query: 191 XXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEG 244
                        S+     + D     N  LL    + G Q    +  A+  A L ++ 
Sbjct: 185 LPLLVVAFAGAIVSLGGAGEIHDGIASTNPSLLDPGFIPGLQFGLALAFAILGAELINQL 244

Query: 245 FWQRAFSSKN----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY-- 298
           +WQR +++++    +R  R + +   +++F      GL G++A        +    +Y  
Sbjct: 245 WWQRIYAAEDGQTVERGFRNATIANGLIVF----LAGLFGLVAAGNADVVTDVTSSAYNA 300

Query: 299 -LAFFTLFK-VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI-------FNNRLP 349
            +AFF L +   P+W+    V+LA+ +  ++ DTL +A ++  + D+        +  L 
Sbjct: 301 DIAFFVLLQTAFPEWIVLAVVLLALLLVMSSVDTLFNALSSIVTADLPRLLSDPDDRSLK 360

Query: 350 LNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           L   R L+++  V A+Y  L+   VLR+F +ADLL A+   P+L GL
Sbjct: 361 LG-ARLLTIVVAVSAIYVSLRARSVLRLFFLADLLGAAVAFPLLYGL 406



>gi|71083513|ref|YP_266232.1| sodium/solute transporter family [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|499601231|ref|WP_011281965.1| sodium/solute transporter family [Candidatus Pelagibacter ubique]
 gi|71062626|gb|AAZ21629.1| sodium:solute transporter family [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 482

 Score =  138 bits (348), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 111/378 (29%), Positives = 194/378 (51%), Gaps = 31/378 (8%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
           KK +  ++YL++       +L ++  AS++G+ IL+      T  G+  VI YA G+  P
Sbjct: 32  KKYQGINNYLTANRNIGFFSLTTSLIASALGAWILFGPASAATWGGIGAVIGYALGTAFP 91

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
           +     LG  IR   P+G TL +F+ +RFG+     + LM++ YMF F+ +E++AV  ++
Sbjct: 92  MIFLISLGKKIRTDFPKGSTLIEFLRKRFGKSLFKLILLMTVFYMFVFLCAEITAVAILI 151

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXAT----- 203
             ++G +     + I I T  YT YGGLRAS+ TDNIQ                +     
Sbjct: 152 NYISGTELWVTSLIILIATLAYTLYGGLRASIFTDNIQMIVIVALLLISVFYLTSFTGDQ 211

Query: 204 ---SIRIEKS-VIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 259
              S   EKS  + ++  + + + G        +AV+   LFH+G WQR +++KN+  L+
Sbjct: 212 FSFSFIKEKSPHLLSASYIPNYTAGLTFF----IAVAATNLFHQGNWQRVYAAKNNEVLK 267

Query: 260 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSGITVV 318
            S +   I++ P++ F+G +G++AV A        +   L FF+ L     +++S I V+
Sbjct: 268 KSLIVAFIVIIPIVFFMGFSGLVAVSA-----NPKVIPDLGFFSLLLSEQTEFLSLIIVI 322

Query: 319 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV---TRFLSL------IANVPAVYWGL 369
           L +S++ +  DTL++A +   S  + + +  LN+   T +L+L      + ++ A     
Sbjct: 323 LGLSLTISTVDTLVNAIS---SLIVVDGKATLNLNKKTNYLTLSKYFIVVLSIIAFVIAS 379

Query: 370 KDLDVLRVFLIADLLAAS 387
           K   VL +FL+ADL   +
Sbjct: 380 KGFSVLYLFLLADLFCCA 397



>gi|494055010|ref|WP_006997107.1| sodium:solute transporter family protein [Candidatus Pelagibacter
           ubique]
 gi|91717870|gb|EAS84520.1| sodium:solute transporter family protein [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 482

 Score =  137 bits (346), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 108/378 (28%), Positives = 193/378 (51%), Gaps = 31/378 (8%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
           KK +  ++YL++       +L ++  AS++G+ IL+      T  G+  VI YA G+  P
Sbjct: 32  KKYQGINNYLTANRNIGFFSLTTSLIASALGAWILFGPASAATWGGIGAVIGYALGTAFP 91

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
           +     LG  IR   P+G TL +F+ +RFG+     + LM++ YMF F+ +E++AV  ++
Sbjct: 92  MIFLISLGKKIRTDFPKGSTLIEFLRKRFGKSLFKLILLMTVFYMFVFLCAEVTAVAILI 151

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIE 208
             ++G +     + I I T  YT YGGLRAS+ TDNIQ                TS + +
Sbjct: 152 NYISGTELWVTSLIILIATLAYTLYGGLRASIFTDNIQ-MIVIVALLLISVFYLTSFKGD 210

Query: 209 KSVIDNSDLLKSNSLGWQLLYIMP---------VAVSFATLFHEGFWQRAFSSKNDRELR 259
           +    +   +K  S     +  +P         +AV+   LFH+G WQR +++KN+  L+
Sbjct: 211 QF---SFSFIKEKSPHLLSVSYIPNYTAGLTFFIAVAATNLFHQGNWQRVYAAKNNEVLK 267

Query: 260 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSGITVV 318
            S +   I++ P++ F+G +G++AV A        +   L FF+ L     +++S I V+
Sbjct: 268 KSLIVAFIVIIPIVFFMGFSGLVAVSA-----NPKVIPDLGFFSLLLSEQTEFLSLIIVI 322

Query: 319 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV---------TRFLSLIANVPAVYWGL 369
           L +S++ +  DTL++A +   S  + + +  LN+         +++  ++ ++ A     
Sbjct: 323 LGLSLTISTVDTLVNAIS---SLIVVDGKATLNLNKKTNYLTFSKYFIVVLSIIAFIIAS 379

Query: 370 KDLDVLRVFLIADLLAAS 387
           K   VL +FL+ADL   +
Sbjct: 380 KGFSVLYLFLLADLFCCA 397



>gi|494805783|ref|WP_007541191.1| sodium/proline symporter [Haloferax larsenii]
 gi|445728902|gb|ELZ80502.1| sodium/proline symporter [Haloferax larsenii JCM 13917]
          Length = 511

 Score =  137 bits (346), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 190/405 (46%), Gaps = 22/405 (5%)

Query: 11  LIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVG 70
           L  V L +F G+GI+    +  +  D +S+  +       +   AS +G  IL++ PE G
Sbjct: 10  LTVVTLVVFAGLGIWYSRGRVTSVEDLVSARDSAGERRTTATLVASVMGVWILFAAPEAG 69

Query: 71  TIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSI 130
              G+  VI YA G  +P+ V+A LGP IR+  P+G +LT++   R+G     +V ++S 
Sbjct: 70  AGFGIAAVIGYAIGEAVPMAVYAKLGPRIRELMPDGHSLTEYAHARYGDAMYAFVLVVSA 129

Query: 131 AYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAX 190
            YMF F+ +EL+ +   L  + GV      I +      YT YGGL AS+ TD +Q    
Sbjct: 130 LYMFIFVAAELTGIAGALAFVAGVPHWQTAILVGGAVLAYTTYGGLEASMFTDTVQALVV 189

Query: 191 XXXXXXXXXXXATSIR-----IEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEG 244
                        S+       E     N  LL    + G Q    +  A+  A L ++ 
Sbjct: 190 FPLLIVALVGVLVSLGGVGPVYEGVAATNPALLDPGFVPGLQFGIALAFAILGAELVNQT 249

Query: 245 FWQRAFSSKN----DRELR-LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYL 299
           +WQR ++ K      R  R  + V G+++    LV +   G   + A +     N +  +
Sbjct: 250 WWQRIYAGKTSETVSRGFRNATVVNGAVVFLAALVGVVAVGHADIVADVTSAGYNAD--V 307

Query: 300 AFFTLFK-VLPDWVSGITVVLAVSMSCAAYDTLISATT-------ANFSNDIFNNRLPLN 351
           AFF L +  +P WV    V++A+ +  ++ DTL +A +       A    D  + +L L 
Sbjct: 308 AFFVLLESAVPSWVVLAVVLVALLLVMSSVDTLFNALSCLVTVDLARMLPDSSDKQLTLG 367

Query: 352 VTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
              F  L+A + AVY  L+   VLR+F +ADLL A+   P++ GL
Sbjct: 368 ARAFTVLVA-LAAVYVSLRAQSVLRLFFLADLLGAAVAFPLVYGL 411



>gi|452837940|gb|EME39881.1| hypothetical protein DOTSEDRAFT_65790 [Dothistroma septosporum
           NZE10]
          Length = 410

 Score =  137 bits (345), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 117/439 (26%), Positives = 196/439 (44%), Gaps = 80/439 (18%)

Query: 60  SSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGR 119
           S +L        IAG+ G+++YA  + +PL +FA LGP++RKKCPEGF LT++  +R+G 
Sbjct: 12  SPMLVRIHVCAAIAGVQGLLVYALTARLPLLLFATLGPILRKKCPEGFVLTEWTRQRYGA 71

Query: 120 FNQIYVSLM----SIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGG 175
              +Y+S +      A +  +M++ELSA+  ++  LTG+  L  VI     TT++T  GG
Sbjct: 72  VPALYLSFLGELDDCATVRLYMVAELSALQQVVNLLTGLSGLPAVIIQCFTTTVHTTAGG 131

Query: 176 LRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAV 235
            R S +T+N+QG                                             VA+
Sbjct: 132 FRISFVTENVQG--------------------------------------------DVAI 147

Query: 236 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENL 295
                F  GFW RAF+ K D++L +     ++++  V V + +TG+IA W+G        
Sbjct: 148 LANDFFLCGFWMRAFALKTDKDLSIGVSISAVVVIVVTVLVDVTGVIAGWSG-------- 199

Query: 296 ESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRF 355
                   +F V P  +    +V+ +++S +A+D   SA  +  S+  F N L + V R 
Sbjct: 200 --------VFGVSPMPI----LVMVMTISTSAFDFPRSALISTGSDAFFRNTLDICVVRL 247

Query: 356 LSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXX 415
           + +I  V  V   LK    L++FLI+D+++ S +P +++GL    YF    +        
Sbjct: 248 IVVILIVATVVVALKSPSTLQIFLISDVISTSIIPRLVIGLTSRAYFWRGFEVVVGRLGR 307

Query: 416 XXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLIS 475
                   S  +      + L+ L    Y T + +L            F+ + +  ++  
Sbjct: 308 ILAVASWESFEFDRGDVCLRLVCLWGLRYCTGWRLL------------FSIIEYAGKIGF 355

Query: 476 MWVFTKIRGEEFVFPKKPE 494
            W   KI G  FV   + E
Sbjct: 356 EWAMAKIHGTRFVALDRDE 374



>gi|495600235|ref|WP_008324814.1| sodium/proline symporter [Haloferax elongans]
 gi|445733213|gb|ELZ84788.1| sodium/proline symporter [Haloferax elongans ATCC BAA-1513]
          Length = 511

 Score =  137 bits (345), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 191/405 (47%), Gaps = 22/405 (5%)

Query: 11  LIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVG 70
           L  V L +F G+GI+    +  +  D +S+  +       +   AS +G  IL++ PE G
Sbjct: 10  LTVVTLVVFAGLGIWYSRGRVTSVEDLVSARDSAGERRTTATLVASVMGVWILFAAPEAG 69

Query: 71  TIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSI 130
              G+  VI YA G  +P+ V+A LGP IR+  P+G +LT++   R+G     +V ++S 
Sbjct: 70  AGFGIAAVIGYAIGEAVPMAVYAKLGPRIRELMPDGHSLTEYAHARYGDAMYAFVLVVSA 129

Query: 131 AYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAX 190
            YMF F+ +EL+ +   L  + GV      I +      YT YGGL AS+ TD +Q    
Sbjct: 130 LYMFIFVAAELTGIAGALAFVAGVPHWQTAILVGGAVLAYTTYGGLEASMFTDTVQALVV 189

Query: 191 XXXXXXXXXXXATSIR-----IEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEG 244
                        S+       E     N  LL    + G Q    +  A+  A L ++ 
Sbjct: 190 FPLLIVALVGVLVSLGGVGPVYEGVAATNPALLDPGFVPGLQFGIALAFAILGAELVNQT 249

Query: 245 FWQRAFSSKN----DRELR-LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYL 299
           +WQR ++ K+     R  R  + V G+++    LV +   G   + A +     N +  +
Sbjct: 250 WWQRIYAGKSSETVSRGFRNATVVNGAVVFLAALVGVVAVGHADIVADVTSAGYNAD--V 307

Query: 300 AFFTLFK-VLPDWVSGITVVLAVSMSCAAYDTLISATT-------ANFSNDIFNNRLPLN 351
           AFF L +  +P WV    V++A+ +  ++ DTL +A +       A    D  + +L L 
Sbjct: 308 AFFVLLESAVPSWVVLAVVLVALLLVMSSVDTLFNALSCLVTVDLARMLPDSSDKQLTLG 367

Query: 352 VTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
              F  L+A + AVY  L+   VLR+F +ADLL A+   P++ GL
Sbjct: 368 ARAFTILVA-LAAVYVSLRAQSVLRLFFLADLLGAAVAFPLVYGL 411



>gi|221507030|gb|EEE32634.1| hypothetical protein TGVEG_093120 [Toxoplasma gondii VEG]
          Length = 2070

 Score =  137 bits (344), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 99/379 (26%), Positives = 183/379 (48%), Gaps = 19/379 (5%)

Query: 32   KNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFV 91
            +  + ++S    ++A++L +++F+S +G+ I Y  P++ ++ G+  V++YA    +PL++
Sbjct: 1602 RRSASFISGARNRSALSLAASFFSSGVGTWIFYCPPQLSSLYGVWPVVLYAVAIALPLWI 1661

Query: 92   FAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILV 149
              + GP++R++      F LT +V  RFGR  QI  +++S       M  EL+ +     
Sbjct: 1662 LMYAGPIVREEMQRHVAFGLTDYVHRRFGRSMQIVTAVVSFFSTVMAMAGELAFLAAAAQ 1721

Query: 150  TLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIE 208
            TL     +LA ++ +A+VT  YT + G  ASL TDN+QG                  ++ 
Sbjct: 1722 TLAPSFPRLAVILSVAMVTFTYTAFLGTNASLETDNLQGILLPLLLLIVPICAFMHSQVS 1781

Query: 209  KSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIM 268
            +     +    +      +L ++    ++A    +G WQR  +    RE+R     GS++
Sbjct: 1782 QDAWKAAATWTAEGASSGVLMVLSCCPAYA--MDQGMWQRVMTGSGSREVRFGLFGGSLL 1839

Query: 269  LFPVLVFLGLTGMIAVWA-------GLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAV 321
            +   +  LG+TG++A          G    E++L +   FF +   L   +  +  VLAV
Sbjct: 1840 VLMTVSLLGVTGIVARATAVTLETQGFTVDEDSLVAAPFFFLILPSLSRGLVAVVFVLAV 1899

Query: 322  SMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV----YWGLKDLDVLRV 377
             ++  + DT  SA  +  + ++    +  +    +S IAN PAV    +W       +++
Sbjct: 1900 ILTVGSVDTFQSALPSLVAGELNTKGVSFDWALLVSFIANFPAVLLAYHW---TESFIQL 1956

Query: 378  FLIADLLAASTMPPILLGL 396
             LI +LL A+  PPI LGL
Sbjct: 1957 LLIGNLLTAAIFPPIFLGL 1975



>gi|167042009|gb|ABZ06745.1| putative Sodium:solute symporter family protein [uncultured marine
           microorganism HF4000_141F21]
          Length = 484

 Score =  135 bits (341), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 97/315 (30%), Positives = 175/315 (55%), Gaps = 11/315 (3%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
           +K +  S+YL++       +L ++  AS++G+ IL+      T  G+  VI Y+ G+  P
Sbjct: 33  RKHQGLSNYLTAGRNVGTTSLTTSLVASALGAWILFGPASAATWGGIGSVIGYSLGTAFP 92

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
           +  F +LG  IRK  P G TLT+F+  +FG+     + +++I YMF F+ +E++AV  ++
Sbjct: 93  MIAFIFLGTKIRKVFPRGHTLTEFIHYKFGKNLFKLILILTIFYMFIFLCAEVTAVSMLV 152

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX----XXXATS 204
             ++G         + + T +YT YGGLRAS++TDNIQ +                 + S
Sbjct: 153 NYISGTPLWLTATLVIVTTLVYTLYGGLRASILTDNIQFFIVIILLLICAYYLFSLNSDS 212

Query: 205 IRIEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAV 263
           I  +    ++  LL S  +  +       +AV+   LFH+G WQR F++KN++ L+ S +
Sbjct: 213 ISFQVIQTNSQHLLSSKYIPNYTAGLTFFIAVAATNLFHQGNWQRVFAAKNNKVLKKSLL 272

Query: 264 YGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSGITVVLAVS 322
              I++ P++ F+G++G+IA+       +  +   LAFF+ L K   +++S I ++LAVS
Sbjct: 273 ISFIIIIPIVFFMGISGIIAI-----SLDSAVNPDLAFFSILLKNKTEFLSVIIIILAVS 327

Query: 323 MSCAAYDTLISATTA 337
           ++ +  DTL++A ++
Sbjct: 328 LAISTIDTLVNAISS 342



>gi|167042081|gb|ABZ06816.1| putative sodium:solute symporter family protein [uncultured marine
           microorganism HF4000_141I21]
          Length = 484

 Score =  134 bits (338), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 97/315 (30%), Positives = 175/315 (55%), Gaps = 11/315 (3%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
           +K +  S+YL++       +L ++  AS++G+ IL+      T  G+  VI Y+ G+  P
Sbjct: 33  RKHQGLSNYLTAGRNVGTTSLTTSLVASALGAWILFGPASAATWGGIGSVIGYSLGTAFP 92

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
           +  F +LG  IRK  P G TLT+F+  +FG+     + +++I YMF F+ +E++AV  ++
Sbjct: 93  MIAFIFLGTKIRKVFPRGHTLTEFIHYKFGKNLFKLILILTIFYMFIFLCAEVTAVSMLV 152

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX----XXXATS 204
             ++G         + + T +YT YGGLRAS++TDNIQ +                 + S
Sbjct: 153 NYISGTPLWLTATLVIVTTLVYTLYGGLRASILTDNIQFFIVIILLLICAYYLFSLNSDS 212

Query: 205 IRIEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAV 263
           I  +    ++  LL S  +  +       +AV+   LFH+G WQR F++KN++ L+ S +
Sbjct: 213 ISFQVIQTNSQYLLSSKYIPNYTAGLTFFIAVAATNLFHQGNWQRVFAAKNNKVLKKSLL 272

Query: 264 YGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSGITVVLAVS 322
              I++ P++ F+G++G+IA+       +  +   LAFF+ L K   +++S I ++LAVS
Sbjct: 273 ISFIIIIPIVFFMGISGIIAI-----SLDSAVNPDLAFFSILLKDKTEFLSVIIIILAVS 327

Query: 323 MSCAAYDTLISATTA 337
           ++ +  DTL++A ++
Sbjct: 328 LAISTIDTLVNAISS 342



>gi|491920183|ref|WP_005672666.1| sodium:solute symporter [Lautropia mirabilis]
 gi|319743287|gb|EFV95692.1| transporter, SSS family [Lautropia mirabilis ATCC 51599]
          Length = 500

 Score =  134 bits (337), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 116/402 (28%), Positives = 194/402 (48%), Gaps = 36/402 (8%)

Query: 17  AIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLL 76
           A+F   GI    +  ++  D++ +  TQ  +A  +   AS++G+ IL+S PE  T  G+ 
Sbjct: 19  ALFAAAGILYARRWRESLEDFVVARNTQGPIATFATLLASALGAWILFSPPEAATWGGIP 78

Query: 77  GVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCF 136
            VI YA GS+ PL     LG  +R+  P G TLT+F+L R+GR        + + Y+F  
Sbjct: 79  AVIGYALGSMSPLVAMLLLGRRMRQLMPHGHTLTEFLLTRYGRPMYALTLAIMVFYVFIE 138

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ---------- 186
           + +E++A+  ++  L  V        +     LYT  GGLRAS+ TD +Q          
Sbjct: 139 LTAEITAISMLMTLLAPVPMGLTATVVMGTVLLYTAVGGLRASIFTDKVQILIIVPMLLA 198

Query: 187 ----GWAXXXXXXXXXXXXATSIRIEKSVIDNSDL--LKSNSLGWQLLYIMPVAVSFATL 240
               GW             A       +++D  D   LK+ +  +       VA+    +
Sbjct: 199 LVAIGWHVSGGASGVTSRLAEK---APALLDFGDAGGLKAGATFF-------VAILLTGI 248

Query: 241 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLA 300
           FH+G WQR +++++ ++++   + G + + P ++ +GL G+   W  + PG E   S   
Sbjct: 249 FHQGNWQRIYAARSIQDMQRGFLLGGLFVVPFILLMGLFGL--AWVAMEPGGE--ASVAL 304

Query: 301 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSND---IFNNRLP---LNVTR 354
           F  +   LP WV+   + L +++  ++ DT ISA T+  + D   +     P   L + R
Sbjct: 305 FALVMPNLPAWVALAFIPLGLALVMSSADTAISAITSIIAVDGARLLPQARPARLLRLAR 364

Query: 355 FLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            L L+  +P V    + L VL +FL+ADLL A+   P+ LGL
Sbjct: 365 ILVLVLAIPVVVVAAQGLSVLYLFLLADLLCAAAAFPVFLGL 406



>gi|159478048|ref|XP_001697116.1| hypothetical protein CHLREDRAFT_175912 [Chlamydomonas reinhardtii]
 gi|158274590|gb|EDP00371.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 485

 Score =  133 bits (335), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 101/393 (25%), Positives = 187/393 (47%), Gaps = 25/393 (6%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
              +    +++  GT     +  ++FAS++G+  + + P      G++G++MYAF S +P
Sbjct: 38  HHDQTAEQFITGRGTAGRWRIAWSFFASAVGAWCITAPPSFAVYTGIVGLVMYAFASGLP 97

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
           + + A  G  I+KK P+  T+  FV +R+G   +    ++S+  M   +++E + +G + 
Sbjct: 98  IIIIALFGARIQKKHPDVCTMPDFVGKRYGPVARTTCVVISLINMAIVLLAEYTTIGILF 157

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIE 208
               G      VI + ++T  YT YGG+  S++TD  QG              A + R E
Sbjct: 158 KYFVGSVDYPIVIVVGVLTMFYTAYGGVYISIVTDQAQGIMTSLFIMILIIYTAITYRPE 217

Query: 209 K--------SVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRL 260
                    +  +    L +N  G+  ++ MP ++  AT+F E  WQ+ ++S + + +  
Sbjct: 218 NLPKPLPNDTTYETGWPLGANKFGYSAIFSMPCSLMAATVFSEAMWQKVWASTDRKSVVF 277

Query: 261 SAVYG-SIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK------------V 307
               G ++ +F V +F G  G +A WAG     E+ +  L  F LF              
Sbjct: 278 GGFVGFALTMFAVFIF-GFGGWLAAWAGY--VTEDTDPNLYLFQLFADERDSATPGASVT 334

Query: 308 LPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYW 367
           +  W+  ++++LA +M+ AA D+L +  T+  +   F  +  +   R + L+ N+P +  
Sbjct: 335 IQSWIGVVSLILATTMNEAAVDSLQNGITSVLAYHFFKGQHTV-FPRIIVLLINIPLIII 393

Query: 368 GLKDLDVLRVFLIADLLAASTMPPILLGLIDSL 400
            L+   VL +FLI ++L       I LGL+D L
Sbjct: 394 SLQGFKVLALFLITNMLTTCMFLLIGLGLVDRL 426



>gi|330813504|ref|YP_004357743.1| sodium:solute transporter family [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|503460508|ref|WP_013695169.1| sodium:solute symporter [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486599|gb|AEA81004.1| sodium:solute transporter family [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 492

 Score =  133 bits (334), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 116/404 (28%), Positives = 196/404 (48%), Gaps = 27/404 (6%)

Query: 12  IYVVLAIFL----GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFP 67
           IY  + IFL     IG +   KK K+   YL++  +  + +L ++  AS  G  IL    
Sbjct: 5   IYTFILIFLCGAFAIGGFFFSKKEKSVPAYLNASRSIRSPSLTASIVASCFGVWILIGPA 64

Query: 68  EVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSL 127
           E  T  G+  +  YA G   P       G  +RK  PEG +LTQFV  R+G      V +
Sbjct: 65  EAATWGGIGAITGYALGQATPFLAMTVFGKRLRKIMPEGNSLTQFVYARYGSKMLKIVLV 124

Query: 128 MSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG 187
           +S+ Y+F ++ +E++A+  I+  + GV+     + I I T +YT  GGL+ S+ITD +Q 
Sbjct: 125 LSLFYVFIYLCAEVTAIAKIVNLIAGVELWKTSLLILISTLIYTLRGGLKISIITDKLQF 184

Query: 188 WAXXXXXXXXXXXXATS--IRIEKSVIDNSDLLKSNSL-------GWQLLYIMPVAVSFA 238
                           S  + I   +I     LK+ +L       G+       +AV   
Sbjct: 185 IIISIFLILIFYYLFISGEVNISSELIS----LKAGNLIDPKYFSGYTAGITFFIAVFAT 240

Query: 239 TLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY 298
            LF +G WQR +++K+D++L  S V    ++ PV++ LG  G++AV      G+    S 
Sbjct: 241 NLFDQGIWQRVYAAKSDQDLHKSFVSSFFIVLPVILILGFCGIVAVSL----GQAKDPSI 296

Query: 299 LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANF---SNDIFNNR---LPLNV 352
           + F  L K    W+S   +VLA+++  ++ DTLI+A ++ F   S  I  ++     L++
Sbjct: 297 VIFSLLLKNGTVWLSISILVLALTLVISSMDTLINAISSLFIIESKKIIRSKSSDFYLSI 356

Query: 353 TRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           ++   ++ +        + + VL +FL+ADLL  +   P+  G+
Sbjct: 357 SKIFLILISCLVFMIASQGMSVLYMFLLADLLCCAAAIPVFYGM 400



>gi|257051772|ref|YP_003129605.1| Na+/solute symporter [Halorhabdus utahensis DSM 12940]
 gi|506268677|ref|WP_015788452.1| sodium:proline symporter [Halorhabdus utahensis]
 gi|256690535|gb|ACV10872.1| Na+/solute symporter [Halorhabdus utahensis DSM 12940]
          Length = 507

 Score =  131 bits (330), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 118/414 (28%), Positives = 193/414 (46%), Gaps = 24/414 (5%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  V+  L  + L  F G+G+     +  +  D +++  +     + +   AS +G  
Sbjct: 1   MVSTGVALGLTVLTLVAFSGLGLLHSRGRVGSVEDLITARDSVGEKRMTATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           IL S PE G   G+  V+ YA G  +P+  +A +GP +R   P+G +LT++   R+G   
Sbjct: 61  ILLSAPEAGASFGIAAVVGYAIGEALPMLAYAKIGPRVRAVIPDGHSLTEYAHARYGASM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V  +S  YMF F+ +EL+ +   L  +  V +    + +     LYTGYGGLRAS+ 
Sbjct: 121 YAFVLAVSGLYMFVFLAAELTGISRALAMVADVPQWQTAVLVGGFVLLYTGYGGLRASIF 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSL------GWQLLYIMPVAV 235
           TD +Q                 ++    +V D         L      G Q    +  A+
Sbjct: 181 TDTLQAIIVMPLLVIAAAGAVFALGGPGAVYDGIVATDPTLLDPGFWPGLQFGLALSFAI 240

Query: 236 SFATLFHEGFWQRAFSSKNDRE-----LRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP 290
             A L ++ +WQR ++  +        LR S   G I+L  V  F G+  + A  A +  
Sbjct: 241 LGAELINQTWWQRIYAGSDSETVERGFLRASLANGLIVL--VAAFFGV--IAAGHANVVT 296

Query: 291 GEENLESYLAFFTLF-KVLPDWVSGITVVLAVSMSCAAYDTLISA----TTANFS---ND 342
             E   + L+FF L  +  P+W+    V+LA+ +  ++ DTL +A     TA+     +D
Sbjct: 297 ASEGYNADLSFFLLLNESFPEWLVLAVVLLALLLVMSSVDTLFNALSSLVTADLPRLIDD 356

Query: 343 IFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
             +  L L    F  +IA V A+Y  L+   V+R+F +ADLL A+   P+L GL
Sbjct: 357 PDDRTLALGARAFTVVIA-VAAIYVSLRARSVIRLFFLADLLGAAVAFPLLYGL 409



>gi|495593381|ref|WP_008317960.1| Na+/proline symporter [Leptolyngbya sp. PCC 6406]
 gi|442781696|gb|ELR91790.1| Na+/proline symporter [Leptolyngbya sp. PCC 6406]
          Length = 496

 Score =  130 bits (327), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 116/416 (27%), Positives = 208/416 (50%), Gaps = 35/416 (8%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSS---LGTQNAVALGSNWFASSI 58
           M  G V   +  V  A+F  +G+    ++  +  D++ S    GT  A+A      AS++
Sbjct: 1   MAIGAVGLWVTLVTAAVFTVLGVIQASRQAVDLEDFMVSRNRFGTGMALA---TVVASAM 57

Query: 59  GSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFG 118
           G+ IL+S PEVG  +G+ G++ Y  G   P   FA LGP IR   P+G +L ++VL RFG
Sbjct: 58  GAWILFSPPEVGATSGVAGILGYCIGQATPAVAFAVLGPRIRHLMPQGHSLNEYVLYRFG 117

Query: 119 RFNQIY-VSLMSIA-YMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGL 176
             N +Y V+L  I  YMF ++ +EL+A+   +  + GV      + +     +YT  GGL
Sbjct: 118 --NAMYWVTLAIITFYMFVYLTAELTAIAKAVELMAGVPLWVTALVVMGAVFVYTTVGGL 175

Query: 177 RASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSN----SLGW----QLL 228
            A++ TD IQ                 ++   ++ I  + +L+S     SLG+    +  
Sbjct: 176 GATIFTDAIQFALIVPLLLLSFGVVVVALGGWEAAI--APVLQSAPELFSLGYGPGQKFG 233

Query: 229 YIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGL 288
             + +A+  A +F++  WQR ++ +ND  +R + +   +++ P+L   GL G++ +  G 
Sbjct: 234 LTLIIAIIAAEMFNQANWQRIYACRNDGVVRRAFLGSFLVIVPLLFIAGLLGILGMHFG- 292

Query: 289 WPGEENLESYLAFFTLFK--VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFN- 345
                       FF L +   LP  V+   +VL +++  ++ DTL++   + F+ D+   
Sbjct: 293 ------FSDDRTFFALIQELALPRIVTIGVLVLVLALVMSSLDTLVNGIASVFTTDLLRL 346

Query: 346 -----NRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
                 +  L + R ++++  +PA+    +  +VL +FL+ADL+ A  + P+L GL
Sbjct: 347 FPGMATQGILRLCRGMAVVVGIPAIAIAARGYNVLYLFLLADLVCAGALFPVLFGL 402



>gi|496768627|ref|WP_009366258.1| sodium:proline symporter [Halogranum salarium]
 gi|399239614|gb|EJN60540.1| hypothetical protein HSB1_11430 [Halogranum salarium B-1]
          Length = 488

 Score =  130 bits (326), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 96/336 (28%), Positives = 166/336 (49%), Gaps = 16/336 (4%)

Query: 19  FLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT-IAGLLG 77
           F G+G++       +  +++S+  +     L +   ASS+G+ IL+S  E G    G+  
Sbjct: 18  FAGVGVWYARDGVDSVEEFVSARDSVGTATLTATVVASSMGAWILFSPAEAGAAFGGVTA 77

Query: 78  VIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFM 137
           V+ YA GS +PLF +A LGP IR+  PEG +LT++   R+G     YV L+++AYMF F+
Sbjct: 78  VVGYAVGSALPLFCYASLGPRIRQLVPEGHSLTEYAYARYGTVFAAYVLLVTVAYMFVFL 137

Query: 138 ISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXX 197
            +E + +  +   L GV        +  +   YT YGGLRAS++TD IQ           
Sbjct: 138 AAEFTGIALVFARLAGVPGWQTATLVGTIVLAYTAYGGLRASIVTDRIQTLVVLPLLFVG 197

Query: 198 XXXXATSIRIEKSVIDNSDLLKSN--SLGW----QLLYIMPVAVSFATLFHEGFWQRAFS 251
                 ++    +V+ +    +    SLG+    +    + VA+  A L ++ +WQR ++
Sbjct: 198 VVATLVALGGPTAVVSSVTSTRPELLSLGYLPGIEFGVYVTVAILGAELLNQAWWQRIYA 257

Query: 252 SKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKV 307
            ++D    R  R++A     ++  V +F    G +A   G      +    L F  + +V
Sbjct: 258 GRDDETVKRSFRVAAACVVPLVLVVGLF----GPVAAARGFVSTPSDASVAL-FLVVERV 312

Query: 308 LPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI 343
           LPDW   + V+LA+ +  ++ DTL +A  +  + D+
Sbjct: 313 LPDWAVLVFVLLALVLVVSSADTLFNAIASVVTVDV 348



>gi|497072234|ref|WP_009458289.1| sodium:solute symporter family protein 2 [Alcaligenes sp. HPC1271]
 gi|422887781|gb|EKU30178.1| sodium:solute symporter family protein 2 [Alcaligenes sp. HPC1271]
          Length = 537

 Score =  128 bits (322), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 107/388 (27%), Positives = 190/388 (48%), Gaps = 18/388 (4%)

Query: 28  YKKTKNKS--DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGS 85
           Y +  N S  D++ +  +Q++VA      ASS+G+ IL+S  +  +  GL  VI YA GS
Sbjct: 83  YARHYNSSLEDFVVARNSQSSVATILTLLASSLGAWILFSPAQAASWGGLSAVIGYAIGS 142

Query: 86  IIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVG 145
           + P      LG  +R+  P G +L++FV+ R+GR       ++ + YMF  M +E++A+ 
Sbjct: 143 MSPRLAMIPLGKRMRELLPRGHSLSEFVIARYGRPMYALTLVIMLFYMFISMTAEITAMS 202

Query: 146 NILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI 205
            ++  +  +        + + T +YT YGGLRAS+ TD +Q +               ++
Sbjct: 203 KMITLIAPIPLWVTASIVLLATLIYTSYGGLRASIFTDKVQMFVILPMLFLIVMFGWQAV 262

Query: 206 RIEKSVIDNSDLLK------SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 259
                + DN  L        S+ +G +      VA+    LFH+G WQR +++K+ + +R
Sbjct: 263 GGPVQLFDNVKLEAPRLIELSDPVGVKAGLTFFVAILLTGLFHQGNWQRIYAAKDTKSMR 322

Query: 260 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 319
              + G + + P +  +GL G+  V  G  PG+ ++     F  +   +P W   + + L
Sbjct: 323 RGFLLGGLFVAPFIFLMGLFGLAFVGLG-SPGDSSVA---LFNVILPHVPVWFLVLLIPL 378

Query: 320 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL------IANVPAVYWGLKDLD 373
            +S+  ++ DT ISA ++  + D+       N  + +SL      I ++P +Y   +   
Sbjct: 379 GLSLVMSSADTAISAVSSLIAVDLSRIMPHRNTAQMMSLARSLIWICSIPVLYASSQGFS 438

Query: 374 VLRVFLIADLLAASTMPPILLGLIDSLY 401
           VL +FL+ADLL ++   P+  GL    Y
Sbjct: 439 VLYLFLLADLLCSAAAFPVFFGLYSRRY 466



>gi|452206656|ref|YP_007486778.1| sodium/solute symporter [Natronomonas moolapensis 8.8.11]
 gi|505221751|ref|WP_015408853.1| sodium/solute symporter [Natronomonas moolapensis]
 gi|452082756|emb|CCQ36026.1| sodium/solute symporter [Natronomonas moolapensis 8.8.11]
          Length = 525

 Score =  128 bits (322), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 110/386 (28%), Positives = 182/386 (47%), Gaps = 14/386 (3%)

Query: 23  GIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT-IAGLLGVIMY 81
           G+ A   +  +  D++S+  +     + +   AS +G+ IL+S  E G    GL  ++ Y
Sbjct: 22  GLLAARGRVDSVEDFISARDSAGHGTVTATVVASMMGAWILFSPAEAGAAFGGLPAILGY 81

Query: 82  AFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISEL 141
           A GS IPL +F  +G  IR   P G +LT+F   RFG    ++V ++S+ YMF F+ +E+
Sbjct: 82  AVGSTIPLLLFIPVGSRIRSVMPSGHSLTEFAYARFGAAMYLFVLVVSVFYMFVFLAAEM 141

Query: 142 SAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG------WAXXXXXX 195
           + +   L  + GV +    + +     +YT YGGL AS++TD IQ        A      
Sbjct: 142 TGIAGALSLVAGVPQWQTALLVGGFVLVYTVYGGLVASIVTDTIQTLVVLPLLAVGFGGA 201

Query: 196 XXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 255
                    I       D + L      G +    +  A+  A + ++G WQR +++  +
Sbjct: 202 LVALGGTGEIHAAAVAADATLLDPGFRPGVEFGIYVAFAILGANMLNQGIWQRVYAADGE 261

Query: 256 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGI 315
             LR      ++++ P+++  GL G+ A   GL     +  S   F  L    P WV+  
Sbjct: 262 TSLRRGFGAAAVVVVPMILLAGLFGVAAAALGLT--GPDTASVAFFLVLEAAFPTWVTLA 319

Query: 316 TVVLAVSMSCAAYDTLISATTANFSNDI-----FNNRLPLNVTRFLSLIANVPAVYWGLK 370
            VVL V +  ++ DT+ +A  +  + D+      + R      R L++   V A++ G +
Sbjct: 320 VVVLVVLLVMSSADTMFNAIASVVTADLARLVDADQRTLWLGGRGLTVAVAVGAIFIGAQ 379

Query: 371 DLDVLRVFLIADLLAASTMPPILLGL 396
              VLR+FL ADLLAA+   P L GL
Sbjct: 380 GYSVLRLFLSADLLAAAVFFPFLAGL 405



>gi|237842017|ref|XP_002370306.1| sodium:solute symporter family domain-containing protein
           [Toxoplasma gondii ME49]
 gi|211967970|gb|EEB03166.1| sodium:solute symporter family domain-containing protein
           [Toxoplasma gondii ME49]
          Length = 541

 Score =  127 bits (320), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 103/368 (27%), Positives = 179/368 (48%), Gaps = 11/368 (2%)

Query: 34  KSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFA 93
             D LSS G      L  +  AS +G+ +LY  P+VG   G  G+  YAF   +P  +  
Sbjct: 47  SEDLLSSRGKHGWFPLCISLVASFMGNWVLYLPPDVGAQYGWPGITGYAFACGLPYVLLL 106

Query: 94  WLGPLIRK-KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL--VT 150
           W  P +++    +GF+ T ++L R+GR  Q   + +S+ YMF  +  EL+ VG  +  VT
Sbjct: 107 WFAPHVKRLTLTDGFSGTDYLLSRYGRLVQAAATTISLLYMFFALSGELTTVGVTMNAVT 166

Query: 151 LTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKS 210
                  A VI +A+VT  YT YGGLRAS++TD  QG               ++ R +  
Sbjct: 167 NGAFPVFAGVIPVAVVTLAYTTYGGLRASILTDVYQGLLVVGLVVPLLIIVFSTAR-DNM 225

Query: 211 VIDNSDLLKSNSLGWQLL----YIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGS 266
            +DN+  + + S   Q +    ++  +  SF  L  +G WQR +++++  ++R++    +
Sbjct: 226 FVDNAATVAAPSGYSQYIAGGVFLFSIWPSF--LLDQGIWQRVWAARSLTDIRIAFAGAA 283

Query: 267 IMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSGITVVLAVSMSC 325
            + F  +   G+ G+      L    +  E  ++ F  L + LP    G+  VLA++   
Sbjct: 284 FVAFSCVFLFGMVGIACRDQALSQAMQRQEENVSIFGYLAETLPAGWVGVLTVLAITCVA 343

Query: 326 AAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLA 385
           ++ DT  +A    F+ D+  ++   N  R L ++ N+PA+      LD+L + + A++L 
Sbjct: 344 SSADTYQTALAVVFAQDLLRSKRSFNWARVLIVLLNIPAILVASLQLDLLTLNMTANVLC 403

Query: 386 ASTMPPIL 393
                P+L
Sbjct: 404 VVAAGPLL 411



>gi|221482350|gb|EEE20705.1| sodium/proline symporter, putative [Toxoplasma gondii GT1]
 gi|221502757|gb|EEE28471.1| hypothetical protein TGVEG_106540 [Toxoplasma gondii VEG]
          Length = 541

 Score =  127 bits (319), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 103/368 (27%), Positives = 179/368 (48%), Gaps = 11/368 (2%)

Query: 34  KSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFA 93
             D LSS G      L  +  AS +G+ +LY  P+VG   G  G+  YAF   +P  +  
Sbjct: 47  SEDLLSSRGKHGWFPLCISLVASFMGNWVLYLPPDVGAQYGWPGITGYAFACGLPYVLLL 106

Query: 94  WLGPLIRK-KCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL--VT 150
           W  P +++    +GF+ T ++L R+GR  Q   + +S+ YMF  +  EL+ VG  +  VT
Sbjct: 107 WFAPHVKRLTLTDGFSGTDYLLSRYGRLVQAAATTISLLYMFFALSGELTTVGVTMNAVT 166

Query: 151 LTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKS 210
                  A VI +A+VT  YT YGGLRAS++TD  QG               ++ R +  
Sbjct: 167 NGAFPVFAGVIPVAVVTLAYTTYGGLRASILTDVYQGLLVVGLVVPLLIIVFSTAR-DNM 225

Query: 211 VIDNSDLLKSNSLGWQLL----YIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGS 266
            +DN+  + + S   Q +    ++  +  SF  L  +G WQR +++++  ++R++    +
Sbjct: 226 FVDNAATVAAPSGYSQYIAGGVFLFSIWPSF--LLDQGIWQRVWAARSLTDIRIAFAGAA 283

Query: 267 IMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSGITVVLAVSMSC 325
            + F  +   G+ G+      L    +  E  ++ F  L + LP    G+  VLA++   
Sbjct: 284 FVAFSCVFLFGMVGIACRDQALSQAMQRQEENVSIFGYLAETLPAGWVGVLTVLAITCVA 343

Query: 326 AAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLA 385
           ++ DT  +A    F+ D+  ++   N  R L ++ N+PA+      LD+L + + A++L 
Sbjct: 344 SSADTYQTALAVVFAQDLLRSKRSFNWARVLIVLLNIPAILVASLQLDLLTLNMTANVLC 403

Query: 386 ASTMPPIL 393
                P+L
Sbjct: 404 VVAAGPLL 411



>gi|385803739|ref|YP_005840139.1| sodium/proline symporter [Haloquadratum walsbyi C23]
 gi|504368979|ref|WP_014556081.1| sodium:proline symporter [Haloquadratum walsbyi]
 gi|339729231|emb|CCC40465.1| sodium/solute symporter [Haloquadratum walsbyi C23]
          Length = 523

 Score =  127 bits (319), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 105/391 (26%), Positives = 187/391 (47%), Gaps = 18/391 (4%)

Query: 23  GIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYA 82
           G++    +  +  D +S+     A  + +   AS +G  IL++ PE G   G+  VI YA
Sbjct: 22  GMWYSQGRVTSIEDLISARNQAGANRITATLVASVMGVWILFAAPEAGAGFGVAAVIGYA 81

Query: 83  FGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELS 142
            G  +P++V++ +GP IR+  P G +LT++   R+G     +V  +S  YMF F+ +EL+
Sbjct: 82  VGEAVPMYVYSRVGPRIRELIPSGHSLTEYARARYGTAMYAFVVGVSGLYMFVFVAAELT 141

Query: 143 AVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG------WAXXXXXXX 196
            +   L  +  V +      +     LYTGYGGLRAS+ TD +Q        A       
Sbjct: 142 GIAGALAFVADVPQWQTATLVGGFVLLYTGYGGLRASIFTDTVQAVVVIPLLAVAFIATV 201

Query: 197 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 256
                 +S+    +  D   L  + + G+Q    +  A+  A L ++ +WQR ++  +  
Sbjct: 202 FALGGPSSVLGNITAADPGLLDPTAAAGFQFGLALAFAILGAELLNQTWWQRIYAGTDSE 261

Query: 257 EL----RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK-VLPDW 311
            +    R + V   +++F +  FLG+           P      + +AFF L +  +P+W
Sbjct: 262 SIAVAFRRATVLNGLIVF-IAAFLGVVAAGHTDIVTNPTSAAYNADVAFFVLLETAVPEW 320

Query: 312 VSGITVVLAVSMSCAAYDTLISATTANFSNDIFN------NRLPLNVTRFLSLIANVPAV 365
           V  + V+LA+S+  ++ DTL +A ++  + D+        +R    + R  +L     A+
Sbjct: 321 VILVVVLLALSLVMSSVDTLFNALSSLITVDLARIYPGSTDRQLRWIARGFTLCIAFAAI 380

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           Y  ++   VLR+F +ADLL  +   P++ GL
Sbjct: 381 YVSVRAQSVLRLFFLADLLGTALAFPLVYGL 411



>gi|110668293|ref|YP_658104.1| sodium/proline symporter [Haloquadratum walsbyi DSM 16790]
 gi|499890880|ref|WP_011571614.1| sodium:proline symporter [Haloquadratum walsbyi]
 gi|109626040|emb|CAJ52490.1| sodium/solute symporter [Haloquadratum walsbyi DSM 16790]
          Length = 523

 Score =  127 bits (319), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 105/391 (26%), Positives = 187/391 (47%), Gaps = 18/391 (4%)

Query: 23  GIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYA 82
           G++    +  +  D +S+     A  + +   AS +G  IL++ PE G   G+  VI YA
Sbjct: 22  GMWYSQGRVTSIEDLISARNQAGANRITATLVASVMGVWILFAAPEAGAGFGVAAVIGYA 81

Query: 83  FGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELS 142
            G  +P++V++ +GP IR+  P G +LT++   R+G     +V  +S  YMF F+ +EL+
Sbjct: 82  VGEAVPMYVYSRVGPRIRELIPSGHSLTEYARARYGTAMYAFVVGVSGLYMFVFVAAELT 141

Query: 143 AVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQG------WAXXXXXXX 196
            +   L  +  V +      +     LYTGYGGLRAS+ TD +Q        A       
Sbjct: 142 GIAGALAFVADVPQWQTATLVGGFVLLYTGYGGLRASIFTDTVQAVVVIPLLAVAFIATV 201

Query: 197 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 256
                 +S+    +  D   L  + + G+Q    +  A+  A L ++ +WQR ++  +  
Sbjct: 202 FALGGPSSVLGNITAADPGLLDPTAAAGFQFGLALAFAILGAELLNQTWWQRIYAGTDSE 261

Query: 257 EL----RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK-VLPDW 311
            +    R + V   +++F +  FLG+           P      + +AFF L +  +P+W
Sbjct: 262 SIAVAFRRATVLNGLIVF-IAAFLGVVAAGHTDIVTNPTSAAYNADVAFFVLLETAVPEW 320

Query: 312 VSGITVVLAVSMSCAAYDTLISATTANFSNDIFN------NRLPLNVTRFLSLIANVPAV 365
           V  + V+LA+S+  ++ DTL +A ++  + D+        +R    + R  +L     A+
Sbjct: 321 VILVVVLLALSLVMSSVDTLFNALSSLITVDLARIYPGSTDRQLRWIARGFTLCIAFAAI 380

Query: 366 YWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           Y  ++   VLR+F +ADLL  +   P++ GL
Sbjct: 381 YVSVRAQSVLRLFFLADLLGTALAFPLVYGL 411



>gi|406706436|ref|YP_006756789.1| sodium:solute symporter [alpha proteobacterium HIMB5]
 gi|504766341|ref|WP_014953443.1| sodium:solute symporter [alpha proteobacterium HIMB5]
 gi|406652212|gb|AFS47612.1| sodium:solute symporter [alpha proteobacterium HIMB5]
          Length = 477

 Score =  126 bits (316), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 122/412 (29%), Positives = 205/412 (49%), Gaps = 36/412 (8%)

Query: 6   VVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           V+S  LI+  L IF         K+ K  S+YL++     + +L  +  AS++G+ IL+ 
Sbjct: 15  VISISLIFSFLGIFYS-------KQFKGLSNYLTANRNIESFSLTLSLVASALGAWILFG 67

Query: 66  FPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYV 125
                T  G+  VI YA G+  P+  F +LG  IRK   +G T+ +FV ++FG+     V
Sbjct: 68  PASAATWGGIGAVIGYALGTAFPMIAFIFLGKKIRKDFKKGSTIIEFVRKKFGKSLFKLV 127

Query: 126 SLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 185
            LMSI YMF F+ +EL+AV  ++  ++G +       I I T +YT YGGLRAS+ TDNI
Sbjct: 128 LLMSIFYMFIFLCAELTAVAFLINYISGTELWITSFIIIISTLVYTLYGGLRASIFTDNI 187

Query: 186 QGWAXXXXXXXX--------XXXXATSIRIEKS-VIDNSDLLKSNSLGWQLLYIMPVAVS 236
           Q                       + S   EKS  + +++ + S + G        +AV+
Sbjct: 188 QMIVIFILLIVSFNYILNINADQFSFSFIKEKSPHLVSANYIPSYTAGITFF----IAVA 243

Query: 237 FATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE 296
              LFH+G WQR +++KN   L+ S +    ++ P++ F+G +G++AV          + 
Sbjct: 244 ATNLFHQGNWQRVYAAKNYETLKKSLLVSFFIIVPIVFFMGFSGLVAV-----SINSKVI 298

Query: 297 SYLAFFT-LFKVLPDWVSGITVVLAVSMSCAAYDTLISATT--------ANFSNDIFNNR 347
             L FFT L      ++S + +VLA++++ +  DTLI+A +        A  + D   + 
Sbjct: 299 PDLGFFTLLLNENTKYISLLIIVLALALTISTVDTLINAISSLIVVDGKATLNLDKKTDY 358

Query: 348 LPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDS 399
           L L  ++++ +  ++ A +   K   +L +FL+ADL   + +  I     D 
Sbjct: 359 LKL--SKYIIVGLSLIAFFVASKGFSILYLFLLADLFCCAFVFTIFYSFYDK 408



>gi|493057507|ref|WP_006114744.1| sodium/proline symporter [Halorubrum coriense]
 gi|445691497|gb|ELZ43684.1| sodium/proline symporter [Halorubrum coriense DSM 10284]
          Length = 495

 Score =  125 bits (315), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 112/401 (27%), Positives = 192/401 (47%), Gaps = 23/401 (5%)

Query: 15  VLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAG 74
           VLA    IG++    +  +  D +++  +     +     AS +G  IL+S PE G   G
Sbjct: 3   VLAGSAAIGVWYSRGQVGSVEDLITARDSIGERRMTGTLVASVMGVWILFSAPEAGASFG 62

Query: 75  LLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMF 134
           +  V+ YA G  +P+  +A +GP IRK  P+G +LT++   R+G     ++ ++S  YMF
Sbjct: 63  IAAVVGYAVGEAVPMLAYARIGPQIRKLIPDGHSLTEYAHARYGTAMYAFILVVSALYMF 122

Query: 135 CFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXX 194
            F+ +EL+ +   L  + GV +    + +  V  LYTGYGGL AS++TD +Q        
Sbjct: 123 VFVSAELTGIAGALSLVAGVPQWQTAVLVGGVVLLYTGYGGLTASIVTDTVQALLVIPLL 182

Query: 195 XXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQR 248
                    ++     V D     N  LL    + G Q    +  A+  A L ++ +WQR
Sbjct: 183 VATFIAVLVTVGGVGPVYDGVTAANPALLDPGFIPGLQFGLALSFAILGAELINQTWWQR 242

Query: 249 AFSSKND----RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTL 304
            ++ ++D    R  R ++V   +++F   +F    G++AV +           Y A   L
Sbjct: 243 VYAGESDDVVRRGFRTASVANGVLVFLAALF----GIVAVGSTDIVTNVTSAGYNADVAL 298

Query: 305 FKVL----PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI-----FNNRLPLNVTRF 355
           F +L    P+ V     +LA+ +  ++ DTL +A  +  + D+      ++R  L  +R 
Sbjct: 299 FVLLEEAFPEPVVLGVTLLALLLVISSVDTLFNALASLVAVDLGRLTATDDRWLLLASRL 358

Query: 356 LSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            ++   + AVY  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 359 FTVAVALAAVYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 399



>gi|489896677|ref|WP_003800124.1| sodium:solute symporter [Alcaligenes faecalis]
 gi|393165696|gb|EJC65745.1| sodium:solute symporter family protein 2 [Alcaligenes faecalis
           subsp. faecalis NCIB 8687]
          Length = 479

 Score =  125 bits (313), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 105/388 (27%), Positives = 188/388 (48%), Gaps = 18/388 (4%)

Query: 28  YKKTKNKS--DYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGS 85
           Y +  N S  D++ +  +Q+++A      ASS+G+ IL+S  +  +  GL  VI YA GS
Sbjct: 25  YARHYNSSLEDFVVARNSQSSLATILTLLASSLGAWILFSPAQAASWGGLSAVIGYAIGS 84

Query: 86  IIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVG 145
           + P      LG  +R+  P G +L++FV+ R+GR       L+ + YMF  M +E++A+ 
Sbjct: 85  MSPRLAMIPLGKRMRELLPRGHSLSEFVIARYGRPMYALTLLIMLFYMFISMTAEITAMS 144

Query: 146 NILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI 205
            ++  +  +        + + T +YT YGGLRAS+ TD +Q                 ++
Sbjct: 145 KMITLIAPIPLWVTASIVLLATLIYTSYGGLRASIFTDKVQMLVILPMLFLIVMFGWQAV 204

Query: 206 RIEKSVIDNSDLLK------SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 259
               ++ D+  L        S+ +G +      VA+    LFH+G WQR +++K+ + +R
Sbjct: 205 GGPVNLFDSVKLQAPRLIELSDPVGMKAGMTFFVAILLTGLFHQGNWQRIYAAKDTQSMR 264

Query: 260 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 319
              + G + + P +  +GL G+   + GL  G     S   F  +   +P W   + + L
Sbjct: 265 RGFLLGGLFVAPFIFLMGLFGL--AFVGL--GSHGDSSVALFNVILPHVPVWFLVLLIPL 320

Query: 320 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL------IANVPAVYWGLKDLD 373
            +S+  ++ DT ISA ++  + D+       N  + +SL      + ++P +Y   +   
Sbjct: 321 GLSLVMSSADTAISAVSSLIAVDLGRIMPHRNTAQMMSLARSLIWVCSIPVLYASSQGFS 380

Query: 374 VLRVFLIADLLAASTMPPILLGLIDSLY 401
           VL +FL+ADLL ++   P+  GL    Y
Sbjct: 381 VLYLFLLADLLCSAAAFPVFFGLYSRRY 408



>gi|401410997|ref|XP_003884946.1| conserved hypothetical protein [Neospora caninum Liverpool]
 gi|325119365|emb|CBZ54918.1| conserved hypothetical protein [Neospora caninum Liverpool]
          Length = 598

 Score =  122 bits (307), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 114/426 (26%), Positives = 194/426 (45%), Gaps = 31/426 (7%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPE--GFTLTQFVLE 115
           +G+ ILY   ++ ++ G+  V++YA    +P+++F   GP++R++  +   F LT +V  
Sbjct: 169 VGTWILYCPAQLSSLYGMWPVLLYAVAIAVPMWIFMLAGPMVREEMKKHVAFGLTDYVHV 228

Query: 116 RFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGV-DKLAPVICIAIVTTLYTGYG 174
           RFGR  QI  +++S   +   M  EL+ V     TL     +LA ++ +A+VT  YT + 
Sbjct: 229 RFGRSMQIVTAVVSFFSIMVAMAGELAFVAAAAQTLAPAFPRLAVILSVAVVTFAYTAFA 288

Query: 175 GLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVA 234
           G  ASL+TD  Q +                 ++ ++   ++           +L ++   
Sbjct: 289 GTNASLVTDKFQSFLLPLLLSIVLVAPCLHSQVSEATWKDAATWTPEGAFSGVLMVLSCC 348

Query: 235 VSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWA-------G 287
            ++A     G WQR  S K  RE+R   + GS+++ P +  LGLTG++A          G
Sbjct: 349 PAYA--MDPGMWQRVLSGKGTREVRWGLLGGSLLVLPTIALLGLTGILARATAVALEAQG 406

Query: 288 LWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNR 347
               E+NL S   FF +   L   +  +  +LAV ++  + DT  SA  +  + ++   R
Sbjct: 407 YTVNEDNLVSAPFFFLVLPSLSRGLVAVVFILAVILTAGSVDTFQSALPSLVAVELNAKR 466

Query: 348 LPLNVTRFLSLIANVPAVYWGLK-DLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWI 406
           L       +SL+AN+PAV          +++ LI +LL A+  PPI LGL      L  +
Sbjct: 467 LSFGWGLLVSLVANIPAVLLAFSWTESFIQLMLIGNLLTAAIFPPIFLGLCKRTTALGSV 526

Query: 407 DXXXXXXXXXXXXXXXXSIFYH-------NAKDGIELIGLPLGLYITDYSVLGAFIVAPL 459
                            SIF+        +A      I LPLG+   D S +  F++ P 
Sbjct: 527 ---------VGSIAGAVSIFFSGLIFTRGDASMAARWIVLPLGM--DDPSAVYTFLIVPA 575

Query: 460 SSIFFT 465
           ++   T
Sbjct: 576 TAALVT 581



>gi|237829741|ref|XP_002364168.1| hypothetical protein TGME49_108990 [Toxoplasma gondii ME49]
 gi|211961832|gb|EEA97027.1| hypothetical protein TGME49_108990 [Toxoplasma gondii ME49]
          Length = 617

 Score =  122 bits (305), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 99/379 (26%), Positives = 183/379 (48%), Gaps = 19/379 (5%)

Query: 32  KNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFV 91
           +  + ++S    ++A++L +++F+S +G+ I Y  P++ ++ G+  V++YA    +PL++
Sbjct: 149 RRSASFISGARNRSALSLAASFFSSGVGTWIFYCPPQLSSLYGVWPVVLYAVAIALPLWI 208

Query: 92  FAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILV 149
             + GP++R++      F LT +V  RFGR  QI  +++S       M  EL+ +     
Sbjct: 209 LMYAGPIVREEMQRHVAFGLTDYVHRRFGRSMQIVTAVVSFFSTVMAMAGELAFLAAAAQ 268

Query: 150 TLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIE 208
           TL     +LA ++ +A+VT  YT + G  ASL TDN+QG                  ++ 
Sbjct: 269 TLAPSFPRLAVILSVAMVTFTYTAFLGTNASLETDNLQGILLPLLLLIVPICAFMHSQVS 328

Query: 209 KSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIM 268
           +     +    +      +L ++    ++A    +G WQR  +    RE+R     GS++
Sbjct: 329 QDAWKAAATWTAEGASSGVLMVLSCCPAYA--MDQGMWQRVMTGSGSREVRFGLFGGSLL 386

Query: 269 LFPVLVFLGLTGMIAVWA-------GLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAV 321
           +   +  LG+TG++A          G    E++L +   FF +   L   +  +  VLAV
Sbjct: 387 VLMTVSLLGVTGIVARATAVTLETQGFTVDEDSLVAAPFFFLILPSLSRGLVAVVFVLAV 446

Query: 322 SMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV----YWGLKDLDVLRV 377
            ++  + DT  SA  +  + ++    +  +    +S IAN PAV    +W       +++
Sbjct: 447 ILTVGSVDTFQSALPSLVAGELNTKGVSFDWALLVSFIANFPAVLLAYHW---TESFIQL 503

Query: 378 FLIADLLAASTMPPILLGL 396
            LI +LL A+  PPI LGL
Sbjct: 504 LLIGNLLTAAIFPPIFLGL 522



>gi|221481082|gb|EEE19490.1| conserved hypothetical protein [Toxoplasma gondii GT1]
          Length = 616

 Score =  121 bits (303), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 97/379 (25%), Positives = 183/379 (48%), Gaps = 19/379 (5%)

Query: 32  KNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFV 91
           +  + ++S    ++A++L +++F+S +G+ I Y  P++ ++ G+  V++YA    +PL++
Sbjct: 148 RRSASFISGARNRSALSLAASFFSSGVGTWIFYCPPQLSSLYGVWPVVLYAVAIALPLWI 207

Query: 92  FAWLGPLIRKKCPE--GFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILV 149
             + GP++R++      F LT +V  RFGR  QI  +++S       M  EL+ +     
Sbjct: 208 LMYAGPIVREEMQRHVAFGLTDYVHRRFGRSMQIVTAVVSFFSTVMAMAGELAFLAAAAQ 267

Query: 150 TLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIE 208
           TL     +LA ++ +A+VT  YT + G  ASL TDN+QG                  ++ 
Sbjct: 268 TLAPSFPRLAVILSVAMVTFTYTAFLGTNASLETDNLQGILLPLLLLIVPICAFMHSQVS 327

Query: 209 KSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIM 268
           +     +    +      +L ++    ++A    +G WQR  +    RE+R     GS++
Sbjct: 328 QDAWKAAATWTAEGASSGVLMVLSCCPAYA--MDQGMWQRVMTGSGSREVRFGLFGGSLL 385

Query: 269 LFPVLVFLGLTGMIAVWAGLWPGEE----NLESYLAFFTLFKVLPDWVSGITVVLAVS-- 322
           +   +  LG+TG++A    +    +    + +S +A    F +LP    G+  V+ V   
Sbjct: 386 VLMTVSLLGVTGIVARATAVTLETQGFTVDKDSLVAAPFFFLILPSLSRGLVAVVFVLAV 445

Query: 323 -MSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV----YWGLKDLDVLRV 377
            ++  + DT  SA  +  + ++    +  +    +S IAN PAV    +W       +++
Sbjct: 446 ILTVGSVDTFQSALPSLVAGELNTKGVSFDWALLVSFIANFPAVLLAYHW---TESFIQL 502

Query: 378 FLIADLLAASTMPPILLGL 396
            LI +LL A+  PPI LGL
Sbjct: 503 LLIGNLLTAAIFPPIFLGL 521



>gi|301099137|ref|XP_002898660.1| Solute:Sodium Symporter (SSS) Family [Phytophthora infestans T30-4]
 gi|262104733|gb|EEY62785.1| Solute:Sodium Symporter (SSS) Family [Phytophthora infestans T30-4]
          Length = 353

 Score =  120 bits (300), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 144/284 (50%), Gaps = 1/284 (0%)

Query: 1   IMLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           ++ SGV   V+   ++A+     I +   +  +  +++S+  +   + L   +F++ IG+
Sbjct: 1   MLASGVTYGVMATTLIAVAAYAIIVSRRLEINSVKNFVSAKNSTTTLRLAWCFFSAGIGA 60

Query: 61  SILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRF 120
             L+S+P++G  AG  GVI YA   +I + V A +GP  R    E  T+T  V  RFG  
Sbjct: 61  GTLFSYPQIGVDAGSWGVIGYALSGVIGMIVLAQVGPYTRSALGENVTMTDVVSNRFGYV 120

Query: 121 NQIYVSLMSIAYMFCFMISELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRAS 179
            Q+YV  +S+ Y F  + SE +++  +   ++     +  ++ +A +T LY   GGLRAS
Sbjct: 121 MQVYVGFISMFYQFICLASEYTSIAQLTTMMSPNAHPIVTILIVAFLTNLYLVIGGLRAS 180

Query: 180 LITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFAT 239
           L TD  QG                 + I      ++++    S G++ L  + +AV+ + 
Sbjct: 181 LATDVWQGIGVVALVAVVCVAMFVHVSIPSGAWSSTNVAAFTSAGFETLVTLVIAVTASN 240

Query: 240 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIA 283
           LF  GFWQR +++ +D  LR +A   SI++    V L + GM++
Sbjct: 241 LFFTGFWQRVYAAYDDNTLRKAAYIASIIIALFTVALAMAGMVS 284



>gi|496388369|ref|WP_009097359.1| sodium:solute symporter [Halomonas sp. GFAJ-1]
 gi|359297406|gb|EHK61641.1| sodium transporter family protein [Halomonas sp. GFAJ-1]
          Length = 481

 Score =  119 bits (299), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 111/400 (27%), Positives = 192/400 (48%), Gaps = 34/400 (8%)

Query: 23  GIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYA 82
           G+    +   N  DY+ +  +QN  A      A+++G+ IL+   +  T  G+  V+ YA
Sbjct: 23  GLLYARRHRDNLEDYIIARNSQNTRATVLTLVATTLGTWILFGPAQAATWGGIGAVLGYA 82

Query: 83  FGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELS 142
           FGS++P  V   LG  +R+  PEG  LT+FV+ R+GR    +  ++ + Y+F  + + L+
Sbjct: 83  FGSMVPRLVMIPLGRRMRELIPEGHGLTEFVIHRYGRTMYAFTLVIMLFYLFILLAAGLT 142

Query: 143 AVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ--------------GW 188
           AV  ++  L  +        + + T +YT YGGLRAS+ TD +Q              GW
Sbjct: 143 AVARMVGLLAPIPLWVTASVVMVATLIYTFYGGLRASIYTDKLQMVVIMPLLGLLLVFGW 202

Query: 189 AXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQR 248
                        A S      ++  SD+     +   L + +  AV+   LF++G WQR
Sbjct: 203 QAAGGVAPTLAGLAES---APQLLQVSDI---GGIRAGLTFFL--AVALTGLFYQGTWQR 254

Query: 249 AFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVL 308
            +++K+ + LR       +  F V+  +GL G+  V  GL    E   S   F  L   +
Sbjct: 255 IYAAKDTKVLRRGFWISGVCSFIVVALMGLFGLAFVGLGL----EGDGSVALFSVLLADV 310

Query: 309 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLP-------LNVTRFLSLIAN 361
           P W +   V L +++  ++ D+ ISAT++  + D+    LP       ++++R+L ++A 
Sbjct: 311 PLWFALALVPLGLALVMSSADSTISATSSIIAVDM-GRLLPNASSASLMSMSRWLIVLAA 369

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 401
           +P  +   +   VL +FL+ADLL ++   P+  GL    Y
Sbjct: 370 IPVTWVASQGYSVLYLFLLADLLCSAAAFPVFFGLFYRRY 409



>gi|495436760|ref|WP_008161455.1| sodium:solute symporter [Achromobacter arsenitoxydans]
 gi|359364713|gb|EHK66424.1| sodium:solute symporter family protein 2 [Achromobacter
           arsenitoxydans SY8]
          Length = 483

 Score =  119 bits (299), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/353 (26%), Positives = 163/353 (46%), Gaps = 30/353 (8%)

Query: 8   SNVLIYVVL--AIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           S  LI+++L    F    ++   +K     DY+ +  +Q ++       AS++G+ IL+S
Sbjct: 5   STALIWLLLFSGGFAAASVFYTRRKRSTLEDYIVARNSQGSIGTILTLMASTLGAWILFS 64

Query: 66  FPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYV 125
             +  T  GL  VI YA GS+ P  V   LG  +R+  P G TLT+F++ R+GR      
Sbjct: 65  PAQAATWGGLAAVIGYALGSMSPRLVMIPLGRRMRELIPHGHTLTEFLMARYGRPMYGLA 124

Query: 126 SLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 185
             + + Y+F  + +E++A+  ++  L  V   A    +   T LYT YGGLR+S+ TD +
Sbjct: 125 LFIMLFYLFIALSAEITAIAKLVAMLAPVPLWATAAIVMGTTLLYTTYGGLRSSIFTDQV 184

Query: 186 Q--------------GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLK-SNSLGWQLLYI 230
           Q              GW                  +E        LL  ++ +G +    
Sbjct: 185 QMMIIVPLLVVLCFVGWQATGGVLPT---------VEALQAKAPQLLDLTDPVGVKAGLT 235

Query: 231 MPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP 290
             VA+    +FH+G WQR +++++ R +R   + G  ++ P +  +GL G+   +  L P
Sbjct: 236 FFVAILLTGIFHQGNWQRIYAARDARTMRNGFLLGGALVAPFIFLMGLFGL--AFVALAP 293

Query: 291 GEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI 343
           G ++  S   F  +    P W     + L +S+  +  DT ISA T+  + D+
Sbjct: 294 GGDS--SIALFGVIMPHAPAWFVIALIPLGLSLVMSTADTAISAVTSIIAVDL 344



>gi|493251055|ref|WP_006218923.1| sodium:solute symporter [Achromobacter piechaudii]
 gi|292816713|gb|EFF75797.1| transporter, SSS family [Achromobacter piechaudii ATCC 43553]
          Length = 483

 Score =  119 bits (297), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 93/330 (28%), Positives = 153/330 (46%), Gaps = 28/330 (8%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
           +K     DY+ +  +Q A        AS++G+ IL+S  +  T  GL  VI YA GS+ P
Sbjct: 28  RKRGTLEDYIVARNSQGAFGTILTLMASTLGAWILFSPAQAATWGGLAAVIGYALGSMSP 87

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
             V   LG  +R+  P G TLT+F++ R+GR        + + Y+F  + +E++A+  ++
Sbjct: 88  RLVMIPLGRRMRELIPHGHTLTEFLMARYGRPMYGLALFIMLFYLFIALSAEVTAIAKLV 147

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ--------------GWAXXXXX 194
             L  V   A    +   T LYT YGGLR+S+ TD +Q              GW      
Sbjct: 148 TMLAPVPLWATAAIVMGTTLLYTTYGGLRSSIFTDQVQMMVILPLLVILCVVGW------ 201

Query: 195 XXXXXXXATSIRIEKSVIDNSDLLK-SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSK 253
                   T   I+        LL  ++ +G +      VA+    +FH+G WQR +++K
Sbjct: 202 ---QAAGGTLPTIQALQAKAPQLLDLTDPVGVKAGLTFFVAILLTGIFHQGNWQRIYAAK 258

Query: 254 NDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVS 313
           + R +R   + G I+  P +  +GL G+   + GL P  ++  S   F  +    P W  
Sbjct: 259 DARSMRNGFLLGGILAAPFIFLMGLFGL--AFVGLAPQGDS--SIALFSVIMPHAPAWFV 314

Query: 314 GITVVLAVSMSCAAYDTLISATTANFSNDI 343
              + L +S+  +  DT ISA ++  + D+
Sbjct: 315 IALIPLGLSLVMSTADTAISAVSSIVAVDM 344



>gi|311105765|ref|YP_003978618.1| sodium:solute symporter family protein 2 [Achromobacter
           xylosoxidans A8]
 gi|503158562|ref|WP_013393223.1| sodium:solute symporter [Achromobacter xylosoxidans]
 gi|310760454|gb|ADP15903.1| sodium:solute symporter family protein 2 [Achromobacter
           xylosoxidans A8]
          Length = 483

 Score =  118 bits (296), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 164/358 (45%), Gaps = 38/358 (10%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
           +K     DY+ +  +Q A        AS++G+ IL+S  +  T  GL  VI YA GS+ P
Sbjct: 28  RKRGTLEDYIVARNSQGAFGTILTLMASTLGAWILFSPAQAATWGGLAAVIGYALGSMSP 87

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
             V   LG  +R+  P G TLT+F++ R+GR        + + Y+F  + +E++A+  ++
Sbjct: 88  RLVMIPLGRRMRELIPHGHTLTEFLMARYGRPMYGLALFIMLFYLFIALSAEVTAIAKLV 147

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ--------------GWAXXXXX 194
             L  V   A    +   T LYT YGGLR+S+ TD +Q              GW      
Sbjct: 148 TMLAPVPLWATAAIVMGTTLLYTTYGGLRSSIFTDQVQMMVIVPLLVILCLVGWQAAGGA 207

Query: 195 XXXXXXXATSIRIEKSVIDNSDLLK-SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSK 253
                       IE        LL  ++ +G +      VA+    +FH+G WQR ++++
Sbjct: 208 MPT---------IEALQAKAPQLLDLTDPVGIKAGLTFFVAILLTGIFHQGNWQRIYAAR 258

Query: 254 NDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVS 313
           + R +R   + G +++ P +  +GL G+   + GL P  ++  S   F  +    P W  
Sbjct: 259 DARSMRNGFLLGGLLVAPFIFLMGLFGL--AFVGLAPQGDS--SIALFSVIMPHAPAWFV 314

Query: 314 GITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLN--------VTRFLSLIANVP 363
              + L +S+  +  DT ISA ++  + D+   RL  N        + R+L L+  +P
Sbjct: 315 IALIPLGLSLVMSTADTAISAVSSIIAVDM--RRLMPNAKSMTMKRLARWLVLLMAIP 370



>gi|493260372|ref|WP_006224090.1| sodium:solute symporter [Achromobacter piechaudii]
 gi|400198325|gb|EJO31284.1| sodium:solute symporter family protein 2 [Achromobacter piechaudii
           HLE]
          Length = 483

 Score =  118 bits (295), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 151/329 (45%), Gaps = 26/329 (7%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
           +K     DY+ +  +Q A        AS++G+ IL+S  +  T  GL  VI YA GS+ P
Sbjct: 28  RKRGTLEDYIVARNSQGAFGTILTLMASTLGAWILFSPAQAATWGGLAAVIGYALGSMSP 87

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
             V   LG  +R+  P G TLT+F++ R+GR        + + Y+F  + +E++A+  ++
Sbjct: 88  RLVMIPLGRRMRELIPHGHTLTEFLMARYGRPMYGLALFIMLFYLFIALSAEVTAIAKLV 147

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ--------------GWAXXXXX 194
             L  V   A    +   T LYT YGGLR+S+ TD +Q              GW      
Sbjct: 148 TMLAPVPLWATAAIVMGTTLLYTTYGGLRSSIFTDQVQMMVIVPLLVILCVVGW------ 201

Query: 195 XXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 254
                   T   ++       D+     +   L +   VA+    +FH+G WQR +++K+
Sbjct: 202 QAAGGALPTIEALQAKAPQLLDVTDPGGVKAGLTFF--VAILLTGIFHQGNWQRIYAAKD 259

Query: 255 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 314
            R +R   + G I+  P +  +GL G+   + GL P  ++  S   F  +    P W   
Sbjct: 260 ARAMRNGFLLGGILAAPFIFLMGLFGL--AFVGLAPAGDS--SIALFSVIMPHAPAWFVI 315

Query: 315 ITVVLAVSMSCAAYDTLISATTANFSNDI 343
             + L +S+  +  DT ISA ++  + D+
Sbjct: 316 ALIPLGLSLVMSTADTAISAVSSIVAVDM 344



>gi|493564321|ref|WP_006517691.1| Na+/proline symporter [Leptolyngbya sp. PCC 7375]
 gi|425762470|gb|EKV03323.1| Na+/proline symporter [Leptolyngbya sp. PCC 7375]
          Length = 502

 Score =  117 bits (294), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 100/384 (26%), Positives = 187/384 (48%), Gaps = 27/384 (7%)

Query: 28  YKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGT-IAGLLGVIMYAFGSI 86
           Y   +N+    S+L T  A ALG+ W        IL+S  E G+   G+  ++ Y  GS 
Sbjct: 37  YMVNRNQVGGWSALATVTASALGA-W--------ILFSPQEAGSAFGGVSAILGYCLGSA 87

Query: 87  IPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGN 146
             + +F  +GP +R   P+G +L ++V  RFG      V  + + YMF ++ +EL+A+  
Sbjct: 88  GAVALFFVVGPRLRHLMPQGHSLNEYVKYRFGGPMYWLVEAVIVFYMFIYLSAELTAIAK 147

Query: 147 ILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIR 206
            L  +  V      + +     +YT  GGL  +++TD +Q                 ++ 
Sbjct: 148 ALQLVADVPLGVTALVVITAVFIYTTVGGLGTTILTDVVQFVVIVPLLLICAGVIVVALG 207

Query: 207 IEKS----VIDNSDLLK-SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLS 261
              +    V    +LL   N  G +    + +A+  A +F++G WQR ++ ++ + +R +
Sbjct: 208 GSDAFGAVVAQQPELLSLGNIGGIRFGATLMIAIVAAEVFNQGNWQRVYACRDSQTVRRA 267

Query: 262 AVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK--VLPDWVSGITVVL 319
            +  ++++ P++   GL G++AV   L   + ++    A F L     +P WV    +VL
Sbjct: 268 FLGSAVIILPLIFIAGLLGVLAV--PLAEVQPDIIGETALFGLLNQLAMPGWVVVSVIVL 325

Query: 320 AVSMSCAAYDTLISATTANFSNDIFNNRLP-------LNVTRFLSLIANVPAVYWGLKDL 372
           A+++  ++ DT+++   + F+ D+    LP       L V+R L+++  VPA+    +  
Sbjct: 326 ALALVMSSLDTMLNGIASVFTLDLM-RMLPDPSANNVLRVSRILTVLVGVPAIAIAAQGY 384

Query: 373 DVLRVFLIADLLAASTMPPILLGL 396
            VL +F +ADL+ A+ + P+L GL
Sbjct: 385 SVLYLFFVADLICAAVLFPMLYGL 408



>gi|495661125|ref|WP_008385704.1| Na+/proline symporter [Halosarcina pallida]
 gi|445679162|gb|ELZ31636.1| Na+/proline symporter [Halosarcina pallida JCM 14848]
          Length = 530

 Score =  117 bits (293), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 112/413 (27%), Positives = 198/413 (47%), Gaps = 22/413 (5%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           M+S  ++  L  V LA+F G+G++    +  +  D +++ G  N   L +   AS +G  
Sbjct: 1   MVSSALALGLTVVTLAVFAGLGLWFSRGRVGSVEDLITARGAANEGQLSATLVASVMGVW 60

Query: 62  ILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFN 121
           IL S PE G + G+   + Y  G   P+  ++ LGP IR+  PEG +LT++   R+G   
Sbjct: 61  ILLSAPEAGALYGIAAAVGYGLGEAAPMLAYSRLGPRIRELIPEGHSLTEYAYARYGGAM 120

Query: 122 QIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 181
             +V ++S  YMF F+ +EL+ +      + GV +      +A    LYT YGGLRAS+ 
Sbjct: 121 YAFVVVISALYMFVFLAAELTGISLAFHYVAGVPQWQTATLVAGFVLLYTAYGGLRASIA 180

Query: 182 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAV 235
           TD +Q +               ++    +V D     N  LL    + G +    +  AV
Sbjct: 181 TDAVQLFVVLPLLVGSVAALLFALGGTGAVYDGIADANPALLDPGYVPGLRFGAALVFAV 240

Query: 236 SFATLFHEGFWQRAFSSKN----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVW-AGLWP 290
             A L ++ +WQR ++  +    +R  R++ V        +L+   L G++AV  +G+  
Sbjct: 241 LGAELLNQTWWQRIYAGDDSETVERSFRVATVANGF----ILLLATLLGVVAVGNSGVLT 296

Query: 291 GEENLESYLAFFTLFK-VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI------ 343
                 + +AFF L      +W+    ++LA+ +  +  D+L +A ++  + D+      
Sbjct: 297 QGAEYNAGVAFFVLLDGAFSEWLVLGVLLLALLLVTSTADSLFNALSSLVTADLPRAMDD 356

Query: 344 FNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            ++R      R ++++  V AV   L+   VL +F +ADLL A+   P++ GL
Sbjct: 357 PDDRTLRLAARLVTVVVAVAAVAVSLRARSVLSLFFVADLLGAAVGIPLVYGL 409



>gi|91776138|ref|YP_545894.1| Na+/solute symporter [Methylobacillus flagellatus KT]
 gi|499799273|ref|WP_011480007.1| sodium:solute symporter [Methylobacillus flagellatus]
 gi|91710125|gb|ABE50053.1| Na+/solute symporter [Methylobacillus flagellatus KT]
          Length = 483

 Score =  117 bits (292), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 93/352 (26%), Positives = 167/352 (47%), Gaps = 34/352 (9%)

Query: 33  NKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVF 92
           N  +Y+ +  +Q  +A      ASS+G+ IL+S  +  T  GL  VI YA G++ P    
Sbjct: 32  NLEEYIVARNSQGTLASIMTLLASSLGAWILFSPAQAATWGGLTAVIGYAIGAMSPRLAM 91

Query: 93  AWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLT 152
             LG  +R+  P G +LT+F++ R+G+   +    + + Y+F  M +E++A+  ++  L 
Sbjct: 92  IPLGKRMRELMPSGHSLTEFLIARYGKPMYLLALTIMLFYLFIAMSAEITAIAKMVTLLA 151

Query: 153 GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ--------------GWAXXXXXXXXX 198
            V   A    +   T LYT YGGLRAS+ TD +Q              GW          
Sbjct: 152 PVPLWATAAIVLGFTLLYTTYGGLRASIFTDKVQIVIIIPLLAALVFIGW------QATG 205

Query: 199 XXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 258
                + +++ +     DL     +   L +   VA+    +FH+G WQR +S+K+   +
Sbjct: 206 GIAPIAEKLQHTAPQLIDLEDIGGIKAGLTFF--VAILLTGIFHQGNWQRIYSAKDIPTM 263

Query: 259 RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVV 318
           R   + G I++ P +  +GL G+   +  + P  ++  S   F  +   +P W++   + 
Sbjct: 264 RNGFLLGGILVVPFIFIMGLFGL--AFMAMTPDGDS--SVALFSVIMPNIPLWLAVALIP 319

Query: 319 LAVSMSCAAYDTLISATTANFSNDIFNNRLP-------LNVTRFLSLIANVP 363
           L +S+   + DT ISA ++  + DI    +P       + ++R+L L+  +P
Sbjct: 320 LGISLVMCSVDTAISAISSIVAVDI-GRVMPRSSAASLMRLSRWLVLLVAIP 370



>gi|485648251|gb|EOD41160.1| hypothetical protein EMIHUDRAFT_199381 [Emiliania huxleyi CCMP1516]
          Length = 536

 Score =  116 bits (290), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 106/395 (26%), Positives = 183/395 (46%), Gaps = 25/395 (6%)

Query: 25  YAGYKKTK------NKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGV 78
           Y  YK+ K      +  +++++ G  +++++  +WFA+S+GS  L + P  G+ AGLLGV
Sbjct: 33  YLDYKRRKRLTAELSPEEFITARGRVSSLSIAFSWFATSMGSWCLVTPPSYGSFAGLLGV 92

Query: 79  IMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERF-------GRFNQIYVSLMSIA 131
           IMYA      +   A++G   R   PE  +L  F+  RF       GR  Q     M++ 
Sbjct: 93  IMYAVACGGAVVSMAYIGGAARALYPEACSLPDFMRRRFSGRAAASGRLAQGLAVTMNLF 152

Query: 132 YMFCFMISELSAVGNILVTLTGVD---KLAPVICIAIVTTLYTGYGGLRASLITDNIQGW 188
            M   + +E +    +L + +G+     L  +I +A+ T  YT  GGL  S++TD +Q  
Sbjct: 153 NMCVALAAEYTTFLELLRSYSGLPFRIALCLLIAMALATLAYTIAGGLFVSIMTDRLQAI 212

Query: 189 AXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSF-ATLFHEGFWQ 247
           A            A+ +  +     + +L      G+  +  MP+ +     LF E  WQ
Sbjct: 213 AALSLVGVLLVFTASVVPWDGLPPLSPELKGYTYSGYSSILTMPLGLLVGGALFSEAMWQ 272

Query: 248 RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKV 307
           R ++ +  R +  +A      +  V+ F G  G +AVW+G    E N+  Y  FF +F  
Sbjct: 273 RVWAIEERRAMARAAWTAGFAVAAVIFFFGFVGFLAVWSGKATAETNMNLY--FFAIFND 330

Query: 308 LP-----DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 362
            P     +    ++++ A  MS  A D++ +A  A   + +   R PL  TR   ++ N 
Sbjct: 331 SPIASLTNLPGYLSMLCACIMSAGAADSMQNAIAATVGSSLLRGR-PLWTTRACVVLCNA 389

Query: 363 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLI 397
             +      + VL +FL ++L A   MP +++ LI
Sbjct: 390 ALLLVACASVPVLSLFLTSNLAATCLMPSVMMSLI 424



>gi|399546779|ref|YP_006560087.1| Sodium/pantothenate symporter [Marinobacter sp. BSs20148]
 gi|504685906|ref|WP_014873008.1| sodium:solute symporter [Marinobacter sp. BSs20148]
 gi|399162111|gb|AFP32674.1| Sodium/pantothenate symporter [Marinobacter sp. BSs20148]
          Length = 479

 Score =  114 bits (284), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 115/418 (27%), Positives = 208/418 (49%), Gaps = 38/418 (9%)

Query: 8   SNVLIYVVL--AIFLGIG-IYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILY 64
           S  L+++VL  A+F   G IYA +K+ K   D+L +  +Q++ A      A+++G+ IL+
Sbjct: 5   STALVWLVLFAALFAIPGLIYARHKQDK-LDDFLVARNSQSSSATLLTLLATTMGTWILF 63

Query: 65  SFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIY 124
              +  T  G+  V  YA G++ P  +   LG  IR   PEG TLT+FVL R+GR    +
Sbjct: 64  GPAQAATWGGIGAVTGYALGALAPRLIMIPLGKRIRTLMPEGHTLTEFVLGRYGRVMYGF 123

Query: 125 VSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDN 184
           V ++ + Y+F  + + L+A+  ++  L  V        +   T LYT YGGLR ++ TD 
Sbjct: 124 VLVIMVFYLFISLTAGLTAIAKMVSLLAPVPLWLTASIVMGATLLYTLYGGLRVTIFTDR 183

Query: 185 IQ--------------GWAXXXXXXXXXXXXATSIR-IEKSVIDNSDLLKSNSLGWQLLY 229
           +Q              GW             A +++ +++      D L  N L   L +
Sbjct: 184 VQMLVILPFLALLIGFGWQ-------ATGGLAPALQGLQEKAPHLLDPLDINGLKSGLTF 236

Query: 230 IMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW 289
            +  AV    LF++G WQR F++++++ +R   +   ++ FP++  +GL G+  V  GL 
Sbjct: 237 FL--AVVLTGLFYQGAWQRIFAARDNKVIRNGFIISGLLSFPIIFIMGLFGLAFVGLGL- 293

Query: 290 PGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI------ 343
           PG+ ++     F  L   +P W +   +   +++  ++ D+ IS  T+    D+      
Sbjct: 294 PGDGSVA---LFSVLLADVPVWFAIGLLPFGLALIMSSADSTISGLTSIMVIDLRRLLPK 350

Query: 344 FNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 401
             N   L+++R+L ++ ++P ++   +   VL +FL+ADLL  +   P+  G  ++ Y
Sbjct: 351 LGNHSLLSLSRWLIVLLSIPVLFVAAQGYSVLYLFLLADLLCCAAAFPVFFGFYNARY 408



>gi|374333905|ref|YP_005090592.1| sodium transporter family protein [Oceanimonas sp. GK1]
 gi|504056584|ref|WP_014290578.1| sodium:solute symporter [Oceanimonas sp. GK1]
 gi|372983592|gb|AEX99841.1| sodium transporter family protein [Oceanimonas sp. GK1]
          Length = 478

 Score =  113 bits (283), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 106/406 (26%), Positives = 193/406 (47%), Gaps = 34/406 (8%)

Query: 17  AIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLL 76
           A+F   G+    ++     D++ +  +Q+  A      A+++G+ IL+   +  T  G+ 
Sbjct: 16  AVFAIPGLLYARRQNDQPEDFIVARNSQSGSATTLTLLATTMGTWILFGPAQAATWGGIG 75

Query: 77  GVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCF 136
            V  YA G + P  V   LG  IR+  P G TLT+FVL R+GR    +V ++ + Y+F  
Sbjct: 76  AVTGYALGVLAPRLVMIPLGKRIRELMPAGHTLTEFVLGRYGRGMYGFVLVIMLFYLFIS 135

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ---------- 186
           + + L+A+  ++  L  V   A    +   T LYT YGGLR ++ TD +Q          
Sbjct: 136 LTAGLTAIAQMVALLAPVPLWATAGIVMAATLLYTLYGGLRVTIFTDRVQMLVILPFLLT 195

Query: 187 ----GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 242
               GW                  ++++     D L +  L   L + +  AV    LF+
Sbjct: 196 LIVLGWQATGGLAPVLAG------LQQTAPHLLDPLDTTGLKSGLTFFL--AVVLTGLFY 247

Query: 243 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 302
           +G WQR F++++++ +R   +   ++ FP++  +GL G+  V   L PG+ ++     F 
Sbjct: 248 QGTWQRVFAARDNKVIRNGFILSGVLSFPIIFIMGLFGLAFVGLAL-PGDGSVA---LFS 303

Query: 303 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLP-------LNVTRF 355
            L   +P W +   +   +++  ++ D+ IS  T+    D+    LP       L ++R+
Sbjct: 304 VLMPNMPLWFAIGLLPFGLALIMSSADSTISGLTSMLVVDL-RRLLPQTSVHTLLGLSRW 362

Query: 356 LSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 401
           L ++ ++P +Y   +   VL +FL+ADLL  +   P+  G  ++LY
Sbjct: 363 LIVLVSIPVLYVASQGYSVLYLFLLADLLCCAAAFPVFFGFYNALY 408



>gi|494589580|ref|WP_007348174.1| sodium:solute symporter [Marinobacter sp. ELB17]
 gi|126630788|gb|EBA01402.1| sodium:solute transporter family protein [Marinobacter sp. ELB17]
          Length = 479

 Score =  112 bits (281), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 114/418 (27%), Positives = 208/418 (49%), Gaps = 38/418 (9%)

Query: 8   SNVLIYVVL--AIFLGIG-IYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILY 64
           S  L+++VL  A+F   G IYA +K+ K   D+L +  +Q++ A      A+++G+ IL+
Sbjct: 5   STALVWLVLFAALFAIPGLIYARHKQDK-LDDFLVARNSQSSSATLLTLLATTMGTWILF 63

Query: 65  SFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIY 124
              +  T  G+  V  YA G++ P  +   LG  IR   PEG TLT+FVL R+GR    +
Sbjct: 64  GPAQAATWGGIGAVTGYALGALAPRLIMIPLGKRIRTLMPEGHTLTEFVLGRYGRIMYGF 123

Query: 125 VSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDN 184
           V ++ + Y+F  + + L+A+  ++  L  V        +   T LYT YGGLR ++ TD 
Sbjct: 124 VLVIMVFYLFISLTAGLTAIAKMVSLLAPVPLWLTASIVMGATLLYTLYGGLRVTIFTDR 183

Query: 185 IQ--------------GWAXXXXXXXXXXXXATSIR-IEKSVIDNSDLLKSNSLGWQLLY 229
           +Q              GW             A +++ +++      + L  N L   L +
Sbjct: 184 VQMLVILPFLALLIGFGWQ-------ATGGLAPALQGLQEKAPHLLNPLDINGLKSGLTF 236

Query: 230 IMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW 289
            +  AV    LF++G WQR F++++++ +R   +   ++ FP++  +GL G+  V  GL 
Sbjct: 237 FL--AVVLTGLFYQGTWQRVFAARDNKVIRNGFILSGLLSFPIIFIMGLFGLAFVGLGL- 293

Query: 290 PGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI------ 343
           PG+ ++     F  L   +P W +   +   +++  ++ D+ IS  T+    D+      
Sbjct: 294 PGDGSVA---LFSVLLADVPVWFAIGLLPFGLALIMSSADSTISGLTSIMVIDLRRLLPK 350

Query: 344 FNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 401
             N   L+++R+L ++ ++P ++   +   VL +FL+ADLL  +   P+  G  ++ Y
Sbjct: 351 LGNHSLLSLSRWLIVLLSIPVLFVAAQGYSVLYLFLLADLLCCAAAFPVFFGFYNARY 408



>gi|493500829|ref|WP_006455347.1| transporter, SSS family, putative [Synechococcus sp. PCC 7335]
 gi|196190635|gb|EDX85599.1| transporter, SSS family, putative [Synechococcus sp. PCC 7335]
          Length = 538

 Score =  107 bits (266), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 120/456 (26%), Positives = 209/456 (45%), Gaps = 76/456 (16%)

Query: 9   NVLIYVV-LAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFP 67
           N+LI +V  A F  +G+    K++ +  DY+ S          +   AS++G+ IL+S  
Sbjct: 4   NLLILLVATATFALLGLTQVGKRSIDLEDYMVSRNQIGGPMALATITASALGAWILFSPA 63

Query: 68  EVG-TIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGR------F 120
           E G T  GL  ++ Y  GS   +F+F ++GP +R+  P G +L ++V  RFG+      F
Sbjct: 64  EAGSTFGGLSAILGYCIGSAAAVFMFFFVGPRLRQIMPWGHSLNEYVRYRFGQPIKQPPF 123

Query: 121 NQ------------------------------------------------IYVSLMSIAY 132
            Q                                                + VS+M + Y
Sbjct: 124 EQPLGQSSPGQPSSERTLSDHTVGERTPKHTPNQRDQTASSNLWGQAMYLLTVSVM-LLY 182

Query: 133 MFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 192
           MF ++ +EL+A+  +L  +  V  L   + +     +YT YGGL+ +++TD  Q      
Sbjct: 183 MFVYLAAELTAIAQVLQLVANVPLLVTSLVVIAAVFIYTTYGGLKVTILTDAAQFILIVP 242

Query: 193 XXXXXXXXXATSI-----RIEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFW 246
                      S+            D    L   +L G +    + +A+  A LF++G W
Sbjct: 243 LLLICFIATVASLGGWSGAFGPVAQDLPAFLSLGNLDGLRFGATLMIAIIAAELFNQGNW 302

Query: 247 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 306
           QR ++ K+D+ +R + +  ++++ P+L   GL G+IA  AG      +L    AFF L +
Sbjct: 303 QRVYACKDDQTVRRAFLGSALVILPLLFLSGLLGIIA--AGF-----DLSGTTAFFDLLQ 355

Query: 307 VLP--DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFN-NRLP---LNVTRFLSLIA 360
            L    W+ G  V+LAV++  ++ DTL++  +A F+ D+   +R P   L ++R L++  
Sbjct: 356 ALEISGWLLGSIVLLAVALVMSSLDTLLNGISAVFTVDLLRLSRQPAQVLMISRILTVAV 415

Query: 361 NVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
            + AV    +   VL +F +ADL+ A+ + PI+  L
Sbjct: 416 GLLAVPIAAQGYSVLYLFFVADLICAALLFPIVFSL 451



>gi|496121833|ref|WP_008846340.1| Na+/solute symporter [Glaciecola lipolytica]
 gi|410141308|dbj|GAC16538.1| Na+/solute symporter [Glaciecola lipolytica E3]
          Length = 479

 Score = 96.3 bits (238), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/331 (25%), Positives = 148/331 (44%), Gaps = 28/331 (8%)

Query: 28  YKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSII 87
           Y+      D + +  +Q + A      A+++G+ IL+   E  T  G+  ++ YA GS++
Sbjct: 27  YRSQDGLEDVIVARNSQTSKATFYTLLATNMGTWILFGPAESATWGGIGTILGYALGSLL 86

Query: 88  PLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNI 147
           P  +   LG  IR+  P G TLT+FV  R+G    I+V  + + Y+F  + + L+ +  +
Sbjct: 87  PSLLMIPLGSRIRQIMPNGHTLTEFVYARYGVSVYIFVLFIMLFYLFIGLTAGLTGIAQM 146

Query: 148 LVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ--------------GWAXXXX 193
           +  L  V        + + T LY  YGGL+ ++ TD IQ              GW     
Sbjct: 147 VAILAPVPLWVTASIVMLCTLLYALYGGLKVTIFTDRIQMLVILPFILLILIIGWQ---- 202

Query: 194 XXXXXXXXATSIRIEKSVIDNSDLLKS-NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSS 252
                     +  I+        LL   ++ G Q      +AV    LF++G WQR F++
Sbjct: 203 -----ATGGFTPTIKGLQEQAPHLLNPFDTDGMQTGITFFLAVCLTGLFYQGTWQRVFAA 257

Query: 253 KNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWV 312
           K+++ +R   +   ++ FP++  LGL G+  V   L PG     S   F  +    P W+
Sbjct: 258 KDNKAIRNGFIVSGLVSFPIVFALGLFGLAFVGLSL-PGS---GSTALFSVVLNEAPYWL 313

Query: 313 SGITVVLAVSMSCAAYDTLISATTANFSNDI 343
               +   +++  ++ D+ IS   + F  D+
Sbjct: 314 LIGMIFFGLALIMSSADSTISGLQSLFIVDL 344



>gi|302828314|ref|XP_002945724.1| hypothetical protein VOLCADRAFT_115669 [Volvox carteri f.
           nagariensis]
 gi|300268539|gb|EFJ52719.1| hypothetical protein VOLCADRAFT_115669 [Volvox carteri f.
           nagariensis]
          Length = 528

 Score = 94.7 bits (234), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 88/384 (22%), Positives = 163/384 (42%), Gaps = 64/384 (16%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIP 88
            + +   +++++ GTQN   +  ++FAS++G+  + + P      G++G +MYAF S IP
Sbjct: 19  HRDQTAEEFITARGTQNKWRIAWSFFASAVGAWCITAPPSFAVSTGIVGCVMYAFASGIP 78

Query: 89  LFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISELSAVGNIL 148
                                      RFG   +  V ++S+  M   +++E + +G + 
Sbjct: 79  ---------------------------RFGPVARTLVVVISLYNMSIALLAEYTTIGLLF 111

Query: 149 VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIE 208
               G      +I +  +T +YT YGG+  S+ITD  QG               T++ I 
Sbjct: 112 KYFVGSVDYPVIIVVGALTMIYTAYGGVYISIITDQAQG-------------IFTALFIL 158

Query: 209 KSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIM 268
             VI  +   + +SL   L            L     WQ+ ++S++ R +      G ++
Sbjct: 159 ILVIYTAVTFRPDSLPKPLP---------ENLGPNAMWQKVWASESRRAVVFGGGVGFLL 209

Query: 269 LFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPD------------WVSGIT 316
           +   +   G  G +A W G      +   YL  F +F    D            WV  +T
Sbjct: 210 IMVAVFLFGFGGWLAAWGGYITDVTDYNLYL--FQVFSSERDAAATGASVQVSSWVGVVT 267

Query: 317 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 376
           ++LA +M+ +A D++ +  TA  +   F  +  +   R +++  N+P +   L+   VL 
Sbjct: 268 LILAATMNESAIDSIQNGITAVLAQHFFKGQHTV-FPRLVTVCVNIPLIIIALQGYKVLS 326

Query: 377 VFLIADLLAASTMPPILLGLIDSL 400
           +FL  +LL+      + LGL + L
Sbjct: 327 LFLTTNLLSTCCFLLVGLGLSNRL 350



>gi|344233258|gb|EGV65131.1| hypothetical protein CANTEDRAFT_113558 [Candida tenuis ATCC 10573]
          Length = 249

 Score = 94.4 bits (233), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 127/248 (51%), Gaps = 12/248 (4%)

Query: 272 VLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDT 330
           +   +G+ G +AVW+G L  G+EN    +AFF L   +P W+    ++  +++    +D+
Sbjct: 3   ICTLVGVPGFLAVWSGDLTVGDEN--GSMAFFILLAKMPGWIIAFVLIFTITICTCTFDS 60

Query: 331 LISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRVFLIADLLAASTM 389
           L SA  +  SNDIF NR      R + +I  VP V   +K  D +L+++LIADL+++S +
Sbjct: 61  LQSAFVSTISNDIFRNRFKTIWARAMVVIMIVPIVVLAVKVADNILQIYLIADLISSSII 120

Query: 390 PPILLGLIDSLY-FLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLY-ITD 447
           P I LGL D  + FL  +D                +++Y  AK+G +L+ +  GLY   D
Sbjct: 121 PIIFLGLSDRFFWFLTGVDVMVGGLGALVAIFIFGTVYYGTAKEGGKLLLIWNGLYDPED 180

Query: 448 YSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP---EVVDTK---KY 501
           +   GAF +AP   I    +    R+ ++WV+ KI  + F   ++P   E+V+ +    Y
Sbjct: 181 WGAFGAFEIAPFGGILIALVCVVARVGAIWVYCKITKKPFRALQRPVPVEIVEEEFDSAY 240

Query: 502 AGNKFKDD 509
                K D
Sbjct: 241 GSTNAKSD 248



>gi|495015305|ref|WP_007741316.1| sodium-solute symporter putative [Halococcus thailandensis]
 gi|445801467|gb|EMA51801.1| sodium-solute symporter putative [Halococcus thailandensis JCM
           13552]
          Length = 516

 Score = 92.4 bits (228), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 190/398 (47%), Gaps = 21/398 (5%)

Query: 15  VLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS-FPEVGTIA 73
           VLA    +G+     +  +  DY+S+  + +     +   AS +G+ IL+S         
Sbjct: 14  VLAAMTALGVAHSRTRMLSVEDYISARNSADTGTTAATLIASGMGAWILFSPAEAGAGFG 73

Query: 74  GLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYM 133
           GL  V  YA GS +PL +F  +G  +R+  P+G +LT++V  R+G +   Y  L+++ YM
Sbjct: 74  GLAAVGGYAIGSAVPLVLFISVGVRLREYLPQGHSLTEYVYGRYGAWMYGYALLIAVFYM 133

Query: 134 FCFMISELSAVGNILVTLTGVDKLAPVICIAIV---TTLYTGYGGLRASLITDNIQGWAX 190
           F   IS  + +      L  V  + P I  AI+     +YTGYGGL AS+ TD +Q    
Sbjct: 134 F---ISLAAGMTAAADALAFVADVPPWITAAIIGGFVLVYTGYGGLVASIFTDTVQTLVI 190

Query: 191 XXXXXXXXXXXATSI----RIEKSVID-NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEG 244
                         +     I +++   N  LL    + G      + +A++ +++F++G
Sbjct: 191 LPLLTLSFAAVVVGLGGTGAIHQAIASANPHLLDLGFVPGLAFGGYVVIAITGSSVFNQG 250

Query: 245 FWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTL 304
            WQR F++ +D  LR      +++  P+++  GL G+ A   GL  G+    S   F  +
Sbjct: 251 RWQRVFAAADDTSLRRGFAIAAVVTVPMIMLAGLLGVSAAGLGLM-GDAG-PSVALFVAI 308

Query: 305 FKVLPDWVSGITVVLAVSMSCAAYDTLI----SATTANFSN--DIFNNRLPLNVTRFLSL 358
              LP+W +   VVL V +  +  DTL     S  TA+ S   D  + R      R L++
Sbjct: 309 AAALPEWATLGVVVLVVLLVTSTTDTLFNGIASIVTADLSRVLDDPDERTLQYAARALTV 368

Query: 359 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           +  + A+  G +   VL +FL+ADLL A+T  P L GL
Sbjct: 369 VVAIAAIAVGAQGYSVLELFLLADLLGAATFIPFLHGL 406



>gi|490154212|ref|WP_004052888.1| sodium-solute symporter putative [Halococcus morrhuae]
 gi|445795862|gb|EMA46382.1| sodium-solute symporter putative [Halococcus morrhuae DSM 1307]
          Length = 516

 Score = 90.1 bits (222), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 112/395 (28%), Positives = 187/395 (47%), Gaps = 15/395 (3%)

Query: 15  VLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS-FPEVGTIA 73
           VLA    +G+     +  +  DY+S+  + +     +   AS +G+ IL+S         
Sbjct: 14  VLAAMTALGVAHSRTRMLSVEDYISARNSADTGTTAATLIASGMGAWILFSPAEAGAGFG 73

Query: 74  GLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYM 133
           GL  V  YA GS +PL +F  +G  +R+   +G +LT++V  R+G +   Y  L+++ YM
Sbjct: 74  GLAAVGGYAIGSAVPLLLFISVGVRLREYLSQGHSLTEYVYGRYGAWMYGYALLIAVFYM 133

Query: 134 FCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXX 193
           F  + + ++A  + L  +  V        I     +YTGYGGL AS+ TD +Q       
Sbjct: 134 FISLAAGMTAAADALAFVADVPPWITATIIGGFVLVYTGYGGLVASIFTDTVQTLVILPL 193

Query: 194 XXXXXXXXATSI----RIEKSVID-NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQ 247
                      +     I +++   N  LL    + G      + +A++ +++F++G WQ
Sbjct: 194 LTLSFAAVVVGLGGTGAIHQAIASANPHLLDLGFVPGLAFGGYVVIAITGSSVFNQGRWQ 253

Query: 248 RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKV 307
           R F++ +D  LR      +++  P+++  GL G+ A   GL  G+    S   F  +   
Sbjct: 254 RVFAAADDASLRRGFAIAAVVTVPMILLAGLLGVSAAGLGLM-GDAG-PSVALFVAIAAA 311

Query: 308 LPDWVSGITVVLAVSMSCAAYDTLI----SATTANFSN--DIFNNRLPLNVTRFLSLIAN 361
           LPDW +   VVL V +  +  DTL     S  TA+ S   D  + R      R L+++  
Sbjct: 312 LPDWATLGVVVLVVLLVTSTTDTLFNGIASIVTADLSRVLDDPDERTLQYAARALTVVVA 371

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           + A+  G +   VL +FL+ADLL A+T  P L GL
Sbjct: 372 IAAIAVGAQGYSVLELFLLADLLGAATFIPFLHGL 406



>gi|492986221|ref|WP_006079325.1| sodium-solute symporter putative [Halococcus saccharolyticus]
 gi|445791894|gb|EMA42513.1| sodium-solute symporter putative [Halococcus saccharolyticus DSM
           5350]
          Length = 571

 Score = 87.8 bits (216), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 110/395 (27%), Positives = 193/395 (48%), Gaps = 15/395 (3%)

Query: 15  VLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS-FPEVGTIA 73
           +LA    +G+     +  +  DY+S+  + ++    +   AS +G+ IL+S         
Sbjct: 14  MLAAMTTLGVAHSRTRMLSVEDYISARNSADSGTTAATLIASGMGAWILFSPAEAGAAFG 73

Query: 74  GLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYM 133
           GL     YA GS +PL +F  +G  +R+  P+G +LT++V  R+G +   Y  L+++ YM
Sbjct: 74  GLAAAAGYAVGSAVPLLLFVSVGVRLREYLPQGHSLTEYVYARYGTWMYGYALLIAVFYM 133

Query: 134 FCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXX 193
           F  + + ++A  + L  + GV        I     +YTGYGGL AS+ TD +Q       
Sbjct: 134 FISLAAGMTAAADALAFVAGVPGWVTASVIGGFVLVYTGYGGLVASIFTDTVQTLVILPL 193

Query: 194 XXXXXXXXATSI----RIEKSVI-DNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQ 247
                      +     I ++++  N  LL    + G      + +A++ A++F++G WQ
Sbjct: 194 LTLSFAAVVVGLGGTGEIHRAIVASNPHLLDPGFVPGLAFGGYVVIAITGASVFNQGRWQ 253

Query: 248 RAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKV 307
           R F++ +D  LR      +++  P+++  GL G+ A   GL  G+    S   F  +   
Sbjct: 254 RVFAAADDDALRRGFAVAAVVTVPMILLAGLLGVAAAGLGLI-GDAG-PSVALFVVVAAA 311

Query: 308 LPDWVS-GITVVLAVSMSCAA---YDTLISATTANFSN--DIFNNRLPLNVTRFLSLIAN 361
           LP+W + G+ V++ + ++  A   ++ L S  TA+ S   D  + R      R L++I  
Sbjct: 312 LPEWATLGVVVLVVLLVTSTADTLFNGLASIVTADLSRVLDDPDERTLQYAARGLTIIVA 371

Query: 362 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 396
           + A+  G +   VL +FL+ADLL A+T  P L GL
Sbjct: 372 LAAIVVGAQGYSVLELFLLADLLGAATFVPFLHGL 406



>gi|328771325|gb|EGF81365.1| hypothetical protein BATDEDRAFT_24273 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 582

 Score = 83.6 bits (205), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 91/413 (22%), Positives = 176/413 (42%), Gaps = 49/413 (11%)

Query: 25  YAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS----FPEVGTIAGLLGVIM 80
           Y       + S YL++  TQ  + +    F +++G+ ++ +      +  T AG LG++ 
Sbjct: 84  YNAKNADHSISYYLTARNTQPMLLVIWGLFGTAVGAGVINNPAAFITDYHTGAGYLGMVA 143

Query: 81  YAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCFMISE 140
               + +PL +   LGP  R K P+  ++  F   RFG    I V+++S+  M   + +E
Sbjct: 144 MCVFTGLPLLLAGILGPTFRSKLPQATSIAAFAKWRFGAEFGILVTIVSLITMATTLATE 203

Query: 141 LSAVGNILVTLTGV---DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXX 197
           L ++ N+ + + G+    +  P+IC   +  LY    GL AS+ +   Q           
Sbjct: 204 LQSLSNMYIQVLGLPFEKRSGPIICAGTIPLLYILMNGLSASMSSVQFQSLFAMLIFMLT 263

Query: 198 XXXXATSIR-----IEKSVIDNSDLLKSN--SLGWQLLYIMPVAVSFATLFHEGFWQRAF 250
                   R     +  + +D +   +++  SLG QL        + + +F +  WQ  +
Sbjct: 264 LLYLGAVFRPGDMDVIPAYLDTTAKGQASFISLGSQL--------TSSAMFSDAMWQLVW 315

Query: 251 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGL----WPGEENLE-SYLAFFTLF 305
           S+++D  +R+S+    I+   V     +   +A W GL    W    +   S +AFF   
Sbjct: 316 SAQSDATIRISSSVACILASSVTFIFSIFSFLAGWLGLVTHSWDATSSTSNSGIAFFQAL 375

Query: 306 K------------VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL----- 348
           +            V P W++ +  +   +++     + +SA      N I +  L     
Sbjct: 376 RMATPKNDPQFTPVGPAWLATLICMAGTALNA----SFVSAYQVGLVNTITSVVLVRGFC 431

Query: 349 -PLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSL 400
              ++ RF+ L  N+P +   +  +DV      A L+A   + P L+G+++SL
Sbjct: 432 PSTHLARFILLAVNIPIIVASVALIDVAAWACCARLIATCFLAPTLMGMLESL 484



>gi|493966265|ref|WP_006909607.1| urea transporter [Cyanobium sp. PCC 7001]
 gi|197625147|gb|EDY37706.1| Na+/solute symporter [Cyanobium sp. PCC 7001]
          Length = 472

 Score = 79.0 bits (193), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 92/170 (54%), Gaps = 3/170 (1%)

Query: 18  IFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGS-NWFASSIGSSILYSFPEVGTIAGLL 76
           +++ +GI+ G +   +  DYL + G    +AL +    AS +  +   + PEVG   GL 
Sbjct: 17  LWIALGIWWGKRGKGDADDYLLA-GRNIGLALSTATLMASWVTGNTTLAAPEVGYTLGLW 75

Query: 77  GVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVSLMSIAYMFCF 136
           G+  YA   +  LF+FA L   I++  P   T   FV  R+GR       L+++AY   F
Sbjct: 76  GMFGYALAGL-GLFLFAPLAVRIKRLMPTARTSGDFVRLRYGRACWAIFLLITMAYTLGF 134

Query: 137 MISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           +I++    G +L +L+G D    ++C+  V+T+YT +GG+RA + TD IQ
Sbjct: 135 LITQGMGAGLLLQSLSGFDYRLGMVCVIGVSTIYTLFGGMRAVVGTDFIQ 184



>gi|495978123|ref|WP_008702702.1| sodium/solute transporter family urea transporter [Rhodopirellula
           maiorica]
 gi|460163646|gb|EMI17814.1| sodium/solute transporter family urea transporter [Rhodopirellula
           maiorica SM1]
          Length = 494

 Score = 77.4 bits (189), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/302 (28%), Positives = 131/302 (43%), Gaps = 30/302 (9%)

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           P+     G+ G + YA  S   LF FA +   IRK  P G+T  +FV  R+G +  I   
Sbjct: 72  PQFALQLGVWGAVAYATASF-GLFAFAPMSGRIRKLMPNGYTAVEFVRRRYGTWGTIPFL 130

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           ++S+ Y   ++IS   A G +L  L+G+   A +  + +V  LYT +GG+ A + TD IQ
Sbjct: 131 IISLFYALTWLISMSMAGGKLLNVLSGIPYEAGMSVVLLVCVLYTLFGGMFAVIGTDFIQ 190

Query: 187 GWAXXXXXXXXXXXXATSIRI----EKSVIDNSDLLKSNSLGWQLLYIMPVAV------- 235
                             I I    EK  +D   LL      W L    P A+       
Sbjct: 191 SLIILVGLVVVAIAVLVKIDIADVHEKLTLDRPMLL------WVLF---PAALMSLFNNM 241

Query: 236 --SFATLFHEG-FWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGE 292
             SF  +FH   +W RAF+ +     +  A+ G ++  PV V  G  G+ A   G+   +
Sbjct: 242 LFSFGEIFHSNVWWSRAFAMREGVGPKAYAL-GGLLWLPVPVLAGFLGLAAPTLGIGVSQ 300

Query: 293 ENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCA-AYDTLISATTANFSNDIFNNRLPLN 351
            +    L   TL      W   + V + V  S A + D+L++AT+    ND+     P  
Sbjct: 301 PDTVGPLVAATLL----GWGGALLVFVIVFCSLASSIDSLLAATSDLIVNDVIERWSPGP 356

Query: 352 VT 353
           +T
Sbjct: 357 LT 358



>gi|56460634|ref|YP_155915.1| Na+/proline symporter [Idiomarina loihiensis L2TR]
 gi|507385955|ref|YP_008035034.1| Na+/proline symporter [Idiomarina loihiensis GSL 199]
 gi|499553988|ref|WP_011234771.1| urea transporter [Idiomarina loihiensis]
 gi|56179644|gb|AAV82366.1| Na+/proline symporter [Idiomarina loihiensis L2TR]
 gi|507120020|gb|AGM36400.1| Na+/proline symporter [Idiomarina loihiensis GSL 199]
          Length = 478

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 161/350 (46%), Gaps = 31/350 (8%)

Query: 67  PEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLERFGRFNQIYVS 126
           P++    G+ G++ Y+F ++  L +FA +   I++  P G+T   FV  R+G    +   
Sbjct: 69  PQLTYQFGIWGMVGYSFAAL-GLVLFAPMAKRIKELLPNGYTSGDFVRLRYGNLAWLVFI 127

Query: 127 LMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 186
           ++S+ Y F ++IS   A G +L +L+G+D    +  I ++   YT +GG+RA + TD IQ
Sbjct: 128 IISVVYAFGWLISLGMAGGILLESLSGLDYHIGMTTILVICVGYTLFGGMRAVIATDFIQ 187

Query: 187 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLL-YIMPVAVSF-------- 237
                            ++ +E     +S+L   +    QLL  + P AV F        
Sbjct: 188 ALIIIVGVSFIAYWIIDNVGLESI---HSNLTSEHP---QLLDMLFPAAVMFLFNNIFFG 241

Query: 238 -ATLFHEG-FWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENL 295
              +FH   +W RA S K +   + + + G ++  P+ +  G   + A   G++P   ++
Sbjct: 242 LGEIFHSNVWWSRALSFKKNVAYK-AYLTGGLLWLPIPIVTGFIALAAPQLGIFPPSPDM 300

Query: 296 ESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVT-- 353
              +       VL    + I  ++  S   ++ D+L++AT+   + DIF+ +L    +  
Sbjct: 301 ---IGPTVAAAVLGKAGAIIVFIVIFSALASSLDSLLAATSDLVTQDIFHKKLKPKASDK 357

Query: 354 ---RF-LSLIANVPAVYW--GLKDLDVLRVFL-IADLLAASTMPPILLGL 396
              RF  S I  +  V W   L  +  L   L  A    AST+ PI+LGL
Sbjct: 358 TLMRFNRSCILGLGVVTWLLCLPRVATLGALLNFAGAFVASTIWPIVLGL 407



>gi|496394523|ref|WP_009103513.1| sodium/solute transporter family urea transporter [Rhodopirellula
           sp. SWK7]
 gi|460843756|gb|EMI41366.1| sodium/solute transporter family urea transporter [Rhodopirellula
           sp. SWK7]
          Length = 493

 Score = 75.1 bits (183), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 94/362 (25%), Positives = 160/362 (44%), Gaps = 35/362 (9%)

Query: 1   IMLSGVVSNVLIYVVLAIF----LGIGIYAGYKKTKNKSDYLSSLGTQNAVALGS-NWFA 55
           ++ + V+S    YV+LA F    + +GI+ G + T    D  +  G    +ALG+    A
Sbjct: 10  VVATAVLSPTAGYVMLACFSVLWISLGIWWGRRATSY--DGFAVAGRNVGLALGTATAVA 67

Query: 56  SSIGSSILYSFPEVGTIAGLLGVIMYAFGSIIPLFVFAWLGPLIRKKCPEGFTLTQFVLE 115
           + I S+     P+     G+ G + Y+  S   LF FA +   IR+  P+G+T  +FV  
Sbjct: 68  TWITSNTTMLAPQFALQLGVWGAVAYSTASF-GLFAFAPMSGRIRQLMPKGYTAVEFVRR 126

Query: 116 RFGRFNQIYVSLMSIAYMFCFMISELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGG 175
           R+G    +   L+SI Y   ++IS   A G +L  L+G+     +  +  V   YT +GG
Sbjct: 127 RYGSLGSVPFLLISIFYAITWLISMSMAGGKLLEVLSGIPYPVGMSVVVAVCVTYTLFGG 186

Query: 176 LRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYI-MPVA 234
           + A + TD IQ               A ++     + D    L++N     LL +  P A
Sbjct: 187 MYAVIGTDFIQ----SLIILVGLIVVAVAVLTRIDIADVHSKLETNRP--MLLSVFFPAA 240

Query: 235 V---------SFATLFHEG-FWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAV 284
           +          F  +FH   +W RAF+ +     +  A+ G ++  PV +  G  G+ A 
Sbjct: 241 LMALFNNMLFGFGEIFHSNVWWSRAFAMREGVGPKAYAL-GGVLWLPVPIVAGFLGLAAP 299

Query: 285 WAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSC---AAYDTLISATTANFSN 341
             G+   + +    L   TL        +G  +++ V + C   ++ D+L++AT     N
Sbjct: 300 ALGIGISQPDTVGPLVAATLLG------TGGALLVFVVVFCSLASSIDSLLAATADLIVN 353

Query: 342 DI 343
           DI
Sbjct: 354 DI 355