BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10288_c0_seq3-m.109 5prime_partial 3-1403(+) 467 (+)
         (466 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|343429781|emb|CBQ73353.1| conserved hypothetical protein [Spo...   290   9e-76   Sporisorium reilianum SRZ2
gi|390596564|gb|EIN05965.1| hypothetical protein PUNSTDRAFT_9067...   284   3e-74   Punctularia strigosozonata HHB-11173 SS5
gi|392864120|gb|EJB10754.1| urea transporter [Coccidioides immit...   283   8e-74   
gi|225685269|gb|EEH23553.1| conserved hypothetical protein [Para...   276   7e-72   
gi|226294605|gb|EEH50025.1| urea transport protein [Paracoccidio...   276   1e-71   
gi|388853819|emb|CCF52540.1| uncharacterized protein [Ustilago h...   275   2e-71   Ustilago hordei
gi|501308643|dbj|GAC97537.1| predicted urea transporter [Pseudoz...   275   2e-71   Pseudozyma hubeiensis SY62
gi|315047150|ref|XP_003172950.1| hypothetical protein MGYG_09089...   275   3e-71   Microsporum gypseum CBS 118893
gi|295663094|ref|XP_002792100.1| urea transport protein [Paracoc...   272   1e-70   
gi|443898725|dbj|GAC76059.1| hypothetical protein PANT_19d00093 ...   266   7e-69   Moesziomyces antarcticus T-34
gi|327306029|ref|XP_003237706.1| hypothetical protein TERG_02421...   266   8e-69   Trichophyton rubrum CBS 118892
gi|302664422|ref|XP_003023841.1| hypothetical protein TRV_02038 ...   266   1e-68   Trichophyton verrucosum HKI 0517
gi|358393547|gb|EHK42948.1| hypothetical protein TRIATDRAFT_2470...   261   5e-67   Trichoderma atroviride IMI 206040
gi|367041970|ref|XP_003651365.1| hypothetical protein THITE_2111...   256   1e-65   Thielavia terrestris NRRL 8126
gi|303313113|ref|XP_003066568.1| hypothetical protein CPC735_057...   254   3e-65   Coccidioides posadasii C735 delta SOWgp
gi|119192082|ref|XP_001246647.1| hypothetical protein CIMG_00418...   254   4e-65   
gi|340519811|gb|EGR50049.1| hypothetical protein TRIREDRAFT_3412...   250   7e-64   Trichoderma reesei QM6a
gi|407918302|gb|EKG11573.1| Sodium/solute symporter [Macrophomin...   247   6e-63   Macrophomina phaseolina MS6
gi|326471561|gb|EGD95570.1| hypothetical protein TESG_03046 [Tri...   246   9e-63   Trichophyton tonsurans CBS 112818
gi|408392233|gb|EKJ71591.1| hypothetical protein FPSE_08230 [Fus...   246   1e-62   Fusarium pseudograminearum CS3096
gi|322709553|gb|EFZ01129.1| urea transporter [Metarhizium anisop...   245   2e-62   
gi|261193629|ref|XP_002623220.1| urea transporter [Ajellomyces d...   244   3e-62   Blastomyces gilchristii SLH14081
gi|239613852|gb|EEQ90839.1| urea transporter [Ajellomyces dermat...   244   3e-62   
gi|399166435|emb|CCE32710.1| uncharacterized protein CPUR_06574 ...   244   4e-62   Claviceps purpurea 20.1
gi|440633300|gb|ELR03219.1| hypothetical protein GMDG_01202 [Geo...   243   9e-62   Pseudogymnoascus destructans 20631-21
gi|350297242|gb|EGZ78219.1| hypothetical protein NEUTE2DRAFT_154...   243   1e-61   Neurospora tetrasperma FGSC 2509
gi|451997584|gb|EMD90049.1| hypothetical protein COCHEDRAFT_1022...   242   2e-61   Bipolaris maydis C5
gi|336463537|gb|EGO51777.1| hypothetical protein NEUTE1DRAFT_125...   242   2e-61   Neurospora tetrasperma FGSC 2508
gi|402086111|gb|EJT81009.1| urea transporter [Gaeumannomyces gra...   241   3e-61   Gaeumannomyces graminis var. tritici R3-111a-1
gi|71017739|ref|XP_759100.1| hypothetical protein UM02953.1 [Ust...   241   3e-61   
gi|406868486|gb|EKD21523.1| urea transporter [Marssonina brunnea...   241   3e-61   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|241955795|ref|XP_002420618.1| urea transporter, putative; ure...   241   4e-61   Candida dubliniensis CD36
gi|451852092|gb|EMD65387.1| hypothetical protein COCSADRAFT_3544...   241   4e-61   Bipolaris sorokiniana ND90Pr
gi|258573539|ref|XP_002540951.1| conserved hypothetical protein ...   241   5e-61   Uncinocarpus reesii 1704
gi|302505048|ref|XP_003014745.1| hypothetical protein ARB_07307 ...   240   6e-61   Arthroderma benhamiae CBS 112371
gi|389637038|ref|XP_003716160.1| urea transporter [Magnaporthe o...   239   1e-60   Magnaporthe oryzae 70-15
gi|440469250|gb|ELQ38367.1| urea transport protein [Magnaporthe ...   239   1e-60   Magnaporthe oryzae Y34
gi|296414011|ref|XP_002836698.1| hypothetical protein [Tuber mel...   238   3e-60   Tuber melanosporum Mel28
gi|505755900|gb|EOR00094.1| putative urea active transporter 1 [...   238   3e-60   Wallemia ichthyophaga EXF-994
gi|296804300|ref|XP_002843002.1| urea transport protein [Arthrod...   237   5e-60   Arthroderma otae CBS 113480
gi|345566015|gb|EGX48962.1| hypothetical protein AOL_s00079g183 ...   237   7e-60   Arthrobotrys oligospora ATCC 24927
gi|378730007|gb|EHY56466.1| hypothetical protein HMPREF1120_0454...   236   9e-60   Exophiala dermatitidis NIH/UT8656
gi|320590557|gb|EFX03000.1| urea transport protein [Grosmannia c...   236   1e-59   Grosmannia clavigera kw1407
gi|326481865|gb|EGE05875.1| hypothetical protein TEQG_04886 [Tri...   236   1e-59   Trichophyton equinum CBS 127.97
gi|367021828|ref|XP_003660199.1| hypothetical protein MYCTH_2298...   234   3e-59   Myceliophthora thermophila ATCC 42464
gi|500255736|gb|EON99074.1| putative urea transporter protein [T...   234   5e-59   Phaeoacremonium minimum UCRPA7
gi|325094525|gb|EGC47835.1| urea transporter [Ajellomyces capsul...   234   5e-59   Histoplasma capsulatum H88
gi|225558773|gb|EEH07057.1| urea transporter [Ajellomyces capsul...   234   5e-59   Histoplasma capsulatum G186AR
gi|512203105|gb|EPE31930.1| hypothetical protein GLAREA_12012 [G...   233   6e-59   Glarea lozoyensis ATCC 20868
gi|358384934|gb|EHK22531.1| hypothetical protein TRIVIDRAFT_1798...   233   7e-59   Trichoderma virens Gv29-8
gi|154286680|ref|XP_001544135.1| conserved hypothetical protein ...   233   9e-59   Histoplasma capsulatum NAm1
gi|330917930|ref|XP_003298017.1| hypothetical protein PTT_08598 ...   233   9e-59   Pyrenophora teres f. teres 0-1
gi|164429597|ref|XP_964341.2| hypothetical protein NCU11204 [Neu...   233   1e-58   
gi|240275165|gb|EER38680.1| urea transporter [Ajellomyces capsul...   232   2e-58   Histoplasma capsulatum H143
gi|512188743|gb|EPE04513.1| urea transporter [Ophiostoma piceae ...   231   3e-58   Ophiostoma piceae UAMH 11346
gi|402086110|gb|EJT81008.1| urea transporter, variant [Gaeumanno...   231   3e-58   Gaeumannomyces graminis var. tritici R3-111a-1
gi|171676089|ref|XP_001902998.1| hypothetical protein [Podospora...   231   3e-58   Podospora anserina S mat+
gi|302919081|ref|XP_003052786.1| predicted protein [Nectria haem...   231   5e-58   Nectria haematococca mpVI 77-13-4
gi|68489472|ref|XP_711409.1| hypothetical protein CaO19.6656 [Ca...   230   6e-58   Candida albicans SC5314
gi|238882735|gb|EEQ46373.1| conserved hypothetical protein [Cand...   230   7e-58   Candida albicans WO-1
gi|482808759|gb|EOA85644.1| hypothetical protein SETTUDRAFT_1696...   229   1e-57   Setosphaeria turcica Et28A
gi|388578764|gb|EIM19102.1| hypothetical protein WALSEDRAFT_6164...   228   4e-57   Wallemia mellicola CBS 633.66
gi|50423383|ref|XP_460274.1| DEHA2E22396p [Debaryomyces hansenii...   226   1e-56   Debaryomyces hansenii CBS767
gi|346320510|gb|EGX90110.1| urea transporter [Cordyceps militari...   226   1e-56   Cordyceps militaris CM01
gi|46129398|ref|XP_389060.1| hypothetical protein FG08884.1 [Fus...   225   2e-56   
gi|477518870|gb|ENH71070.1| hypothetical protein FOC1_g10008443 ...   225   2e-56   Fusarium oxysporum f. sp. cubense race 1
gi|149237959|ref|XP_001524856.1| conserved hypothetical protein ...   224   3e-56   Lodderomyces elongisporus NRRL YB-4239
gi|340975607|gb|EGS22722.1| hypothetical protein CTHT_0011960 [C...   224   3e-56   Chaetomium thermophilum var. thermophilum DSM 1495
gi|494831159|gb|EON67651.1| hypothetical protein W97_06794 [Coni...   224   5e-56   Coniosporium apollinis CBS 100218
gi|400595550|gb|EJP63345.1| urea transporter [Beauveria bassiana...   223   7e-56   Beauveria bassiana ARSEF 2860
gi|485923385|gb|EOD48562.1| putative urea transporter protein [N...   223   1e-55   Neofusicoccum parvum UCRNP2
gi|322696792|gb|EFY88579.1| urea transporter [Metarhizium acridu...   222   1e-55   Metarhizium acridum CQMa 102
gi|336264692|ref|XP_003347122.1| hypothetical protein SMAC_05421...   222   1e-55   Sordaria macrospora k-hell
gi|310794094|gb|EFQ29555.1| hypothetical protein GLRG_04699 [Glo...   222   2e-55   Colletotrichum graminicola M1.001
gi|344301867|gb|EGW32172.1| hypothetical protein SPAPADRAFT_6126...   221   4e-55   Spathaspora passalidarum NRRL Y-27907
gi|477525718|gb|ENH77590.1| urea transporter [Colletotrichum orb...   220   7e-55   Colletotrichum orbiculare MAFF 240422
gi|342878048|gb|EGU79459.1| hypothetical protein FOXB_10044 [Fus...   219   1e-54   Fusarium oxysporum Fo5176
gi|354547251|emb|CCE43985.1| hypothetical protein CPAR2_502100 [...   218   4e-54   Candida parapsilosis
gi|361125484|gb|EHK97525.1| putative Eukaryotic translation init...   216   9e-54   Glarea lozoyensis 74030
gi|50554165|ref|XP_504491.1| YALI0E27984p [Yarrowia lipolytica] ...   216   9e-54   Yarrowia lipolytica CLIB122
gi|396469553|ref|XP_003838434.1| hypothetical protein LEMA_P1137...   216   1e-53   Leptosphaeria maculans JN3
gi|459369699|gb|EMG48026.1| Urea transporter, putative (Urea/pol...   215   2e-53   Candida maltosa Xu316
gi|448515648|ref|XP_003867382.1| Dur3 urea transporter [Candida ...   215   2e-53   Candida orthopsilosis Co 90-125
gi|380471757|emb|CCF47122.1| hypothetical protein CH063_15636 [C...   215   2e-53   Colletotrichum higginsianum
gi|448084999|ref|XP_004195745.1| Piso0_005156 [Millerozyma farin...   213   9e-53   Millerozyma farinosa CBS 7064
gi|406605512|emb|CCH43156.1| Sodium/glucose cotransporter 1 [Wic...   213   1e-52   Wickerhamomyces ciferrii
gi|255732433|ref|XP_002551140.1| conserved hypothetical protein ...   211   3e-52   Candida tropicalis MYA-3404
gi|189202288|ref|XP_001937480.1| conserved hypothetical protein ...   210   8e-52   Pyrenophora tritici-repentis Pt-1C-BFP
gi|448080486|ref|XP_004194649.1| Piso0_005156 [Millerozyma farin...   209   2e-51   Millerozyma farinosa CBS 7064
gi|38567077|emb|CAE76374.1| hypothetical protein [Neurospora cra...   209   2e-51   Neurospora crassa
gi|363755328|ref|XP_003647879.1| hypothetical protein Ecym_7216 ...   207   8e-51   Eremothecium cymbalariae DBVPG#7215
gi|366999438|ref|XP_003684455.1| hypothetical protein TPHA_0B035...   206   1e-50   Tetrapisispora phaffii CBS 4417
gi|255718783|ref|XP_002555672.1| KLTH0G14718p [Lachancea thermot...   206   1e-50   Lachancea thermotolerans CBS 6340
gi|471566473|gb|EMR66770.1| putative urea transporter protein [E...   206   2e-50   Eutypa lata UCREL1
gi|126137249|ref|XP_001385148.1| urea transport protein [Scheffe...   204   5e-50   Scheffersomyces stipitis CBS 6054
gi|156847319|ref|XP_001646544.1| hypothetical protein Kpol_1055p...   203   1e-49   Vanderwaltozyma polyspora DSM 70294
gi|429848401|gb|ELA23890.1| urea transporter [Colletotrichum glo...   203   1e-49   Colletotrichum gloeosporioides Nara gc5
gi|50551147|ref|XP_503047.1| YALI0D19866p [Yarrowia lipolytica] ...   202   1e-49   Yarrowia lipolytica CLIB122
gi|50305545|ref|XP_452732.1| hypothetical protein [Kluyveromyces...   198   2e-48   Kluyveromyces lactis NRRL Y-1140
gi|169594868|ref|XP_001790858.1| hypothetical protein SNOG_00164...   198   3e-48   Parastagonospora nodorum SN15
gi|366987111|ref|XP_003673322.1| hypothetical protein NCAS_0A037...   192   2e-46   Naumovozyma castellii CBS 4309
gi|344233479|gb|EGV65351.1| hypothetical protein CANTEDRAFT_1196...   191   3e-46   Candida tenuis ATCC 10573
gi|465795812|emb|CCV00245.1| unnamed protein product [Malassezia...   191   3e-46   Malassezia sympodialis ATCC 42132
gi|453084248|gb|EMF12293.1| hypothetical protein SEPMUDRAFT_4620...   191   3e-46   Sphaerulina musiva SO2202
gi|365985345|ref|XP_003669505.1| hypothetical protein NDAI_0C060...   187   7e-45   Naumovozyma dairenensis CBS 421
gi|398408051|ref|XP_003855491.1| hypothetical protein MYCGRDRAFT...   187   8e-45   Zymoseptoria tritici IPO323
gi|320581949|gb|EFW96168.1| urea transporter, putative urea/poly...   185   2e-44   
gi|116193701|ref|XP_001222663.1| hypothetical protein CHGG_06568...   181   6e-43   Chaetomium globosum CBS 148.51
gi|367008374|ref|XP_003678687.1| hypothetical protein TDEL_0A014...   180   6e-43   Torulaspora delbrueckii
gi|164656775|ref|XP_001729515.1| hypothetical protein MGL_3550 [...   180   1e-42   Malassezia globosa CBS 7966
gi|254567718|ref|XP_002490969.1| hypothetical protein [Komagatae...   179   2e-42   Komagataella phaffii GS115
gi|452984112|gb|EME83869.1| hypothetical protein MYCFIDRAFT_1627...   168   3e-39   Cercospora fijiensis CIRAD86
gi|513034046|gb|AGO14012.1| AaceriAGR155Cp [Saccharomycetaceae s...   166   2e-38   Saccharomycetaceae sp. 'Ashbya aceri'
gi|403216744|emb|CCK71240.1| hypothetical protein KNAG_0G01820 [...   165   3e-38   Kazachstania naganishii CBS 8797
gi|50290383|ref|XP_447623.1| hypothetical protein [Candida glabr...   164   5e-38   Candida glabrata CBS 138
gi|302419953|ref|XP_003007807.1| urea transport protein [Vertici...   164   5e-38   Verticillium alfalfae VaMs.102
gi|260943103|ref|XP_002615850.1| hypothetical protein CLUG_04732...   155   2e-35   Clavispora lusitaniae ATCC 42720
gi|302309420|ref|NP_986821.2| AGR155Cp [Ashbya gossypii ATCC 108...   134   6e-29   Eremothecium gossypii ATCC 10895
gi|507524472|ref|YP_008046085.1| solute symporter-like protein [...   124   5e-26   
gi|384254250|gb|EIE27724.1| NAD(P)-binding protein [Coccomyxa su...   119   2e-24   Coccomyxa subellipsoidea C-169
gi|496243989|ref|WP_008957374.1| sodium:solute symporter [Halomo...   118   3e-24   Halomonas sp. HAL1
gi|328771326|gb|EGF81366.1| hypothetical protein BATDEDRAFT_3491...   118   4e-24   Batrachochytrium dendrobatidis JAM81
gi|501087544|ref|WP_012137811.1| solute symporter-like protein [...   116   1e-23   Marinobacter lipolyticus
gi|428175810|gb|EKX44698.1| hypothetical protein GUITHDRAFT_8737...   115   2e-23   Guillardia theta CCMP2712
gi|494264168|ref|WP_007153677.1| sodium:solute symporter [Marino...   112   3e-22   Marinobacter algicola
gi|219129440|ref|XP_002184897.1| predicted protein [Phaeodactylu...   110   1e-21   Phaeodactylum tricornutum CCAP 1055/1
gi|223993879|ref|XP_002286623.1| predicted protein [Thalassiosir...   108   5e-21   Thalassiosira pseudonana CCMP1335
gi|496591109|ref|WP_009288217.1| Sodium/solute symporter [Halomo...   105   4e-20   Halomonas
gi|323455936|gb|EGB11803.1| hypothetical protein AURANDRAFT_6101...   104   5e-20   Aureococcus anophagefferens
gi|323456367|gb|EGB12234.1| hypothetical protein AURANDRAFT_6136...   104   5e-20   Aureococcus anophagefferens
gi|158321712|ref|YP_001514219.1| Na+/solute symporter [Alkaliphi...   104   6e-20   
gi|385331874|ref|YP_005885825.1| solute symporter-like protein [...   104   6e-20   
gi|512441197|ref|WP_016416980.1| sodium:solute symporter [Halomo...   103   1e-19   Halomonas anticariensis
gi|490716886|ref|WP_004579451.1| solute symporter-like protein [...   103   2e-19   Marinobacter nanhaiticus
gi|428171596|gb|EKX40511.1| hypothetical protein GUITHDRAFT_7539...   102   2e-19   Guillardia theta CCMP2712
gi|494173757|ref|WP_007113484.1| sodium:solute symporter [Halomo...   102   2e-19   
gi|497407386|ref|WP_009721584.1| sodium:solute symporter [Halomo...   101   5e-19   Halomonas sp. TD01
gi|307544110|ref|YP_003896589.1| hypothetical protein HELO_1521 ...   100   1e-18   
gi|348678595|gb|EGZ18412.1| hypothetical protein PHYSODRAFT_3322...   100   1e-18   Phytophthora sojae
gi|145345452|ref|XP_001417224.1| SSS family transporter: sodium ...    99   3e-18   Ostreococcus lucimarinus CCE9901
gi|294900101|ref|XP_002776900.1| Osmoregulated proline transport...    98   5e-18   Perkinsus marinus ATCC 50983
gi|346977478|gb|EGY20930.1| urea transport protein [Verticillium...    98   7e-18   Verticillium dahliae VdLs.17
gi|308802840|ref|XP_003078733.1| unnamed protein product [Ostreo...    97   1e-17   Ostreococcus tauri
gi|348689995|gb|EGZ29809.1| hypothetical protein PHYSODRAFT_3099...    97   1e-17   Phytophthora sojae
gi|303282763|ref|XP_003060673.1| Na+/solute symporter [Micromona...    95   3e-17   Micromonas pusilla CCMP1545
gi|344233258|gb|EGV65131.1| hypothetical protein CANTEDRAFT_1135...    95   5e-17   Candida tenuis ATCC 10573
gi|332283893|ref|YP_004415804.1| sodium transporter family prote...    92   3e-16   
gi|401395637|ref|XP_003879646.1| hypothetical protein NCLIV_0010...    90   2e-15   Neospora caninum Liverpool
gi|348678575|gb|EGZ18392.1| hypothetical protein PHYSODRAFT_3010...    87   1e-14   Phytophthora sojae
gi|401410997|ref|XP_003884946.1| conserved hypothetical protein ...    86   2e-14   Neospora caninum Liverpool
gi|385305452|gb|EIF49423.1| urea urea polyamine [Dekkera bruxell...    85   5e-14   Brettanomyces bruxellensis AWRI1499
gi|344212553|ref|YP_004796873.1| sodium-solute symporter putativ...    84   1e-13   
gi|330813504|ref|YP_004357743.1| sodium:solute transporter famil...    84   1e-13   
gi|159478048|ref|XP_001697116.1| hypothetical protein CHLREDRAFT...    83   2e-13   Chlamydomonas reinhardtii
gi|221507030|gb|EEE32634.1| hypothetical protein TGVEG_093120 [T...    83   2e-13   
gi|495587964|ref|WP_008312543.1| sodium-solute symporter putativ...    83   2e-13   Haloarcula amylolytica
gi|325185496|emb|CCA19979.1| Solute:Sodium Symporter (SSS) Famil...    82   3e-13   Albugo laibachii Nc14
gi|491681725|ref|WP_005537864.1| sodium-solute symporter putativ...    80   1e-12   Haloarcula argentinensis
gi|490652117|ref|WP_004517111.1| sodium-solute symporter putativ...    80   2e-12   Haloarcula vallismortis
gi|495594848|ref|WP_008319427.1| sodium/proline symporter [Halof...    79   3e-12   Haloferax mucosum
gi|493564321|ref|WP_006517691.1| Na+/proline symporter [Leptolyn...    79   4e-12   Leptolyngbya sp. PCC 7375
gi|452837940|gb|EME39881.1| hypothetical protein DOTSEDRAFT_6579...    78   6e-12   Dothistroma septosporum NZE10
gi|494345167|ref|WP_007188843.1| sodium-solute symporter putativ...    77   1e-11   Haloarcula californiae
gi|302828314|ref|XP_002945724.1| hypothetical protein VOLCADRAFT...    77   2e-11   Volvox carteri f. nagariensis
gi|167042009|gb|ABZ06745.1| putative Sodium:solute symporter fam...    76   2e-11   uncultured marine microorganism HF4000_141F21
gi|495289883|ref|WP_008014637.1| Na+/solute symporter [Haloterri...    76   2e-11   
gi|221482350|gb|EEE20705.1| sodium/proline symporter, putative [...    76   2e-11   
gi|237842017|ref|XP_002370306.1| sodium:solute symporter family ...    76   2e-11   Toxoplasma gondii ME49
gi|493500829|ref|WP_006455347.1| transporter, SSS family, putati...    75   3e-11   Synechococcus sp. PCC 7335
gi|55378520|ref|YP_136370.1| sodium-solute symporter [Haloarcula...    75   5e-11   
gi|167042081|gb|ABZ06816.1| putative sodium:solute symporter fam...    75   5e-11   uncultured marine microorganism HF4000_141I21
gi|491096221|ref|WP_004957825.1| sodium-solute symporter putativ...    74   1e-10   Haloarcula sinaiiensis


>gi|343429781|emb|CBQ73353.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 550

 Score =  290 bits (741), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 185/525 (35%), Positives = 281/525 (53%), Gaps = 68/525 (12%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           MLS   +N L+Y  L  F+ +G+YAGYK  +N +D+LS L TQ+ + L  NWFAS++ SS
Sbjct: 1   MLSVQQANALVYSTLCGFMLVGLYAGYK-VRNTNDFLSGLRTQSVLPLTLNWFASNMSSS 59

Query: 62  IL-------------------YSF--------------------PE-------------- 68
           +L                   Y F                    P+              
Sbjct: 60  LLFGYPQLAVIPNAGVLGLVAYCFATVAPLWFFAWLGPLIRRVCPDGFTLAEYIRRRFGW 119

Query: 69  -VGTIAGLLGV-------IIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRAS 120
            VG ++GL+ V       ++EL+  G+ +  L GV+     + +AI TT+YT YGG +AS
Sbjct: 120 PVGVLSGLIFVGFMFCFMLVELNTYGSAVNLLGGVNPTIAALIVAISTTIYTAYGGFKAS 179

Query: 121 LITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFAT 180
           L TDN+                  ++ I+ + +++S LL+   LG +L YI+P A+ F+ 
Sbjct: 180 LWTDNVNAVIILIFIVIASIAVGVNLDIDHARVESSGLLRPQQLGGELWYILPAALIFSQ 239

Query: 181 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLES 238
           +F++GFWQRAF+SKN++ L LS ++ +I LF V + +G+ G +A W+GL+  P  E+ + 
Sbjct: 240 MFNQGFWQRAFASKNNKTLYLSVIFATIPLFAVCMLVGMAGPLAWWSGLFNGPTAED-DG 298

Query: 239 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 298
            L FF +   LP+W++GI +VL   +S +AYDT  SA  +   ND+F  RL +   R + 
Sbjct: 299 SLTFFYILATLPNWLTGIVIVLCGCLSSSAYDTFQSAQISTIQNDVFLGRLNIWWCRAIL 358

Query: 299 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXX 358
           ++ NVP+V   +K++D+L VFLIADL A + +P  LLGL+  LYFLN +D          
Sbjct: 359 VLINVPSVVLAVKNIDILEVFLIADLAAIACIPAFLLGLVPQLYFLNGVDAVGGAVGGFF 418

Query: 359 XXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 418
                 +IF+ +A  GI LI LP GLY+ DYSVLGAF  APL S+ +TF +  +R    W
Sbjct: 419 TVFIFGTIFFGSASKGIALISLPTGLYVDDYSVLGAFFAAPLGSLGWTFATCAIRAGVTW 478

Query: 419 VFTKIRGEEFVFPKKPEVVDTKKYA--GNKFKDDTEIIQSSDPDE 461
           V+ +  G +F   +  E  D  K+A   ++  D   I  S +P +
Sbjct: 479 VYCRYTGHKFTVFEYRE-FDVSKFALPEDRPADFHGIHGSGNPHD 522



>gi|390596564|gb|EIN05965.1| hypothetical protein PUNSTDRAFT_90679 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 495

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 158/408 (38%), Positives = 243/408 (59%), Gaps = 9/408 (2%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGL 117
           I +++  SF  V T+   + ++ EL+A+  ++ +LTG++ +   I   ++T LYT +GG 
Sbjct: 62  ITTALFLSFFSVVTM--FIYMVSELTAITGVINSLTGLNAIPATIVEVVITMLYTAWGGF 119

Query: 118 RASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVS 177
           R SL+TD +QG                +IRI++++I+ S LLK+N LGWQLLYI+PVA+ 
Sbjct: 120 RTSLVTDYVQGVLILVLLVVCSAAMGANIRIDRALIEESGLLKANLLGWQLLYILPVAIV 179

Query: 178 FATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE 237
           +   F  G+WQRAF+SK +R+L +     +I++F +L  +G TG+IAVW+ L+PG E  +
Sbjct: 180 WNNFFLSGYWQRAFASKTNRDLWIGCSGAAIIVFVMLTIVGFTGLIAVWSRLYPGYEGDD 239

Query: 238 SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFL 297
               FF +   LP WV G  +V A+S+SCAAYDTL +A  A  SND+F N+L +   R L
Sbjct: 240 GSFTFFEILATLPAWVVGFVLVFAISLSCAAYDTLQNAIVATISNDVFRNKLNIWWVR-L 298

Query: 298 SLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXX 357
            LI NVPAV    K+L++L ++LI+DL++A+ MPPI LGLI  LYFLN  D         
Sbjct: 299 VLIVNVPAVVVATKNLNILVLYLISDLVSAAIMPPIFLGLIPRLYFLNSFDIIIGGVGGF 358

Query: 358 XXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISM 417
                  +I+Y++AK G  ++ L  G+Y  D+S  GAF+ AP+ SI +TF +F +R  + 
Sbjct: 359 FTVFIWGAIYYNDAKKGAGVLILQAGIYADDWSTFGAFVAAPVGSILWTFGAFALRAGAT 418

Query: 418 WVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIEIR 465
           +++ +  G  F       V D ++    +F ++      S PDE E+ 
Sbjct: 419 YLYARRTGAHF------GVFDKREIDVARFAEEAAQAGISVPDEAELE 460



>gi|392864120|gb|EJB10754.1| urea transporter [Coccidioides immitis RS]
          Length = 541

 Score =  283 bits (724), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 175/487 (35%), Positives = 249/487 (51%), Gaps = 60/487 (12%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL  G+Y  Y  + + K  +L+S GTQ A+ L  N+ AS +GS IL+++
Sbjct: 9   SNALIYLTYGAFLIAGLYIAYLLRKQTKGQFLASNGTQKALPLALNFIASGLGSGILFTY 68

Query: 67  PEVGTIA-------------------GLLGVII--------------------------- 80
           PE+ TIA                   G LG II                           
Sbjct: 69  PEIATIAGVQGLVVYGLSSSLPLLVFGYLGPIIRKKCPEGFVLTEWTRERYGVVTAIYLS 128

Query: 81  -------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                        ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDN+Q
Sbjct: 129 LLTLITLFLYMVAELSALQQIVNALTGLNGLPAVIVQVAVTTIYTSLGGFKVSFMTDNLQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G               T   I++S+ID+S  L ++ LGWQL+YI+PVA+     F   FW
Sbjct: 189 GAMVVGLIIIGVITVGTKTTIDRSLIDSSGYLNASLLGWQLIYILPVAILTNDFFLSNFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R F+SK DR+LR+     S  +  +LV +G TG++A W+G WPG+      +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGVSIASFTVLCILVLVGCTGLLAAWSGAWPGDPPQSGSIAFFLLLE 308

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP WV GI +V+ V +S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V 
Sbjct: 309 RLPSWVVGIVLVMTVVLSTAAFDSLQSAMVSTASNDLFRNKLPLIYIRVGVVLCIIPVVV 368

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             LK   VL++FLI+DL++AS +P ++LGL D  YF    +                +I+
Sbjct: 369 VALKSPSVLQIFLISDLVSASAIPVLILGLWDKCYFWKGFEVIAGGLGGILSVFIFGTIY 428

Query: 368 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 427
           Y +A +G  LI L  GLY  D+S  GAF+ AP+    F  ++FG R+   +V  KI+G  
Sbjct: 429 YGSAYEGGRLILLENGLYAEDWSAFGAFVAAPVGGFIFALIAFGSRIAYQFVIAKIQGRR 488

Query: 428 FVFPKKP 434
           F    KP
Sbjct: 489 FDAFDKP 495



>gi|225685269|gb|EEH23553.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 456

 Score =  276 bits (707), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 154/389 (39%), Positives = 226/389 (58%), Gaps = 12/389 (3%)

Query: 59  GSSILYSFPEVGTIAGLLGVII------------ELSAVGNILVTLTGVDKLAPVICIAI 106
           GS IL+++PE+ TIAG+ G++I            ELSA+  I+  LTG++ L  VI   +
Sbjct: 18  GSGILFTYPEIATIAGVQGLVIYGLITLFLYMVAELSALQQIVNALTGLNGLPTVIVQVM 77

Query: 107 VTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGW 166
           VTT+YT  GG + S ITDNIQG               T   I++S+ID+S LL  + LGW
Sbjct: 78  VTTIYTSLGGFKVSFITDNIQGAMVVGLVIIAVITVGTKTTIDRSLIDSSGLLDPSLLGW 137

Query: 167 QLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVW 226
           QL+YI+P+A+     F   FW R F+SK+DR+LR+     S  +F +L  +G+TG++A W
Sbjct: 138 QLIYILPIAIFTNDFFLSNFWLRTFASKSDRDLRIGVSIASATVFCILTLVGVTGLLAAW 197

Query: 227 AGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFN 286
           +G WPG     + +AFF L + LP WV GI +V+ VS+S AA+D+L SA  +  SND+F 
Sbjct: 198 SGAWPGNPPQRASIAFFLLLEKLPGWVVGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFR 257

Query: 287 NRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNW 346
           NRLPL   R L ++  +P V   LK   VL++FLI+DL++AS++P +  GL +  Y+   
Sbjct: 258 NRLPLIYVRILVVLCIIPVVVVALKSPSVLQIFLISDLVSASSIPVLTFGLWEKAYWWKG 317

Query: 347 IDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFT 406
            +                +I++ +AK+G +LI L  GLY  D+SV GAF+ APL  I F 
Sbjct: 318 FEVVVGGLGGIFSVFIFGAIYFKDAKEGAKLILLGNGLYAQDWSVFGAFLAAPLGGILFG 377

Query: 407 FLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
             + G+RL   ++ +K +   F    KP 
Sbjct: 378 IAALGLRLGYQFLLSKYQHHRFDALDKPS 406



>gi|226294605|gb|EEH50025.1| urea transport protein [Paracoccidioides brasiliensis Pb18]
          Length = 558

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 154/389 (39%), Positives = 226/389 (58%), Gaps = 12/389 (3%)

Query: 59  GSSILYSFPEVGTIAGLLGVII------------ELSAVGNILVTLTGVDKLAPVICIAI 106
           GS IL+++PE+ TIAG+ G++I            ELSA+  I+  LTG++ L  VI   +
Sbjct: 120 GSGILFTYPEIATIAGVQGLVIYGLITLFLYMVAELSALQQIVNALTGLNGLPTVIVQVM 179

Query: 107 VTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGW 166
           VTT+YT  GG + S ITDNIQG               T   I++S+ID+S LL  + LGW
Sbjct: 180 VTTIYTSLGGFKVSFITDNIQGAMVVGLVIIAVITVGTKTTIDRSLIDSSGLLDPSLLGW 239

Query: 167 QLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVW 226
           QL+YI+P+A+     F   FW R F+SK+DR+LR+     S  +F +L  +G+TG++A W
Sbjct: 240 QLIYILPIAIFTNDFFLSNFWLRTFASKSDRDLRIGVSIASGTVFCILTLVGVTGLLAAW 299

Query: 227 AGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFN 286
           +G WPG     + +AFF L + LP WV GI +V+ VS+S AA+D+L SA  +  SND+F 
Sbjct: 300 SGAWPGNPPQRASIAFFLLLEKLPGWVVGIVLVMTVSLSTAAFDSLQSAMVSTGSNDLFR 359

Query: 287 NRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNW 346
           NRLPL   R L ++  +P V   LK   VL++FLI+DL++AS++P +  GL +  Y+   
Sbjct: 360 NRLPLIYVRILVVLCIIPVVVVALKSPSVLQIFLISDLVSASSIPVLTFGLWEKAYWWKG 419

Query: 347 IDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFT 406
            +                +I++ +AK+G +LI L  GLY  D+SV GAF+ APL  I F 
Sbjct: 420 FEVVVGGLGGIFSVFIFGAIYFKDAKEGAKLILLGNGLYAQDWSVFGAFLAAPLGGILFG 479

Query: 407 FLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
             + G+RL   ++ +K +   F    KP 
Sbjct: 480 IAALGLRLGYQFLLSKYQHHRFDALDKPS 508



>gi|388853819|emb|CCF52540.1| uncharacterized protein [Ustilago hordei]
          Length = 553

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 179/524 (34%), Positives = 267/524 (50%), Gaps = 66/524 (12%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSN--------- 52
           ML    +N L+Y  L  FL +G++AGYK  +N +D+LS L TQ+   L  N         
Sbjct: 1   MLPTSQANALVYSTLCGFLLVGLFAGYK-VRNTTDFLSGLRTQSVFPLTLNWIASNMSSS 59

Query: 53  ------------------------------WFASSIGSSILYSFPE-------------- 68
                                         W  + +G  I    P+              
Sbjct: 60  LFFGYPQLAVIPNAGILGLAAYCFSTVAPLWVFAWLGPQIRRICPDGFTLSEYIRRRYGW 119

Query: 69  -VGTIAGLLGV-------IIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRAS 120
            VG ++ L+ V       ++EL+  G+ +  L GV+     + IA++TT+YT YGG +AS
Sbjct: 120 PVGVLSALIFVGFMFCFMLVELNTYGSTVNVLGGVNPTIAALVIALITTIYTAYGGFKAS 179

Query: 121 LITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFAT 180
           L TDN                   ++ I+ + +++S LLK   LG +L YI+  A+ F+ 
Sbjct: 180 LYTDNANAIIIMIFIVIASIAVGVNLDIDHARVESSGLLKPQRLGGELWYILTAALVFSQ 239

Query: 181 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLES 238
           +F++GFWQR F+SKN++ L LS  + +I LF +   +G+ G +A W+GL+  P  E+ + 
Sbjct: 240 MFNQGFWQRVFASKNNKALYLSVAFATIPLFAICFIVGMAGPLAWWSGLFDGPTAED-DG 298

Query: 239 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 298
            L FF +   LP+WV+GI +VLA  +S +AYDT  SA  +   ND+F  RL +   R + 
Sbjct: 299 SLTFFYIINTLPNWVTGIVIVLAGCLSSSAYDTFQSAQISTIQNDVFLGRLNIWWCRLIL 358

Query: 299 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXX 358
           +  NVP+V   +K++D+L VFLIADL   + +P  LLGLI  LYFLN +D          
Sbjct: 359 VCINVPSVVLAVKNIDILEVFLIADLAGIACIPAFLLGLIPKLYFLNGVDAVGGAVGGFL 418

Query: 359 XXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 418
                 + FY NA DGI+LIGLP GLY+ D+SVLGAF  APL SI +TF +  +R    W
Sbjct: 419 TVFLFGTAFYGNAADGIKLIGLPNGLYLDDFSVLGAFFAAPLGSIGWTFATCAIRAGLTW 478

Query: 419 VFTKIRGEEF-VFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDE 461
           ++ +  G E+ VF  +   V       ++  D   I  S +PD+
Sbjct: 479 LYCRYTGNEYKVFEYREFDVSKWALPEDRPADFHGIHGSGNPDD 522



>gi|501308643|dbj|GAC97537.1| predicted urea transporter [Pseudozyma hubeiensis SY62]
          Length = 523

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 150/369 (40%), Positives = 228/369 (61%), Gaps = 10/369 (2%)

Query: 69  VGTIAGLLGV-------IIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 121
           VG ++GL+ V       ++EL+  G+ + TL GV+     + +A+ TT+YT YGG +ASL
Sbjct: 95  VGVLSGLIFVGFMFCFMLVELNTYGSAVNTLGGVNPTIAALIVALSTTIYTAYGGFKASL 154

Query: 122 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATL 181
            TDN+                  ++ I+ + +++S LL+   LG +L YI+P A+ F+ +
Sbjct: 155 YTDNVNAVIILIFIVIASVAVGVNLDIDHARVESSGLLRPQRLGGELWYILPAAIIFSQM 214

Query: 182 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLESY 239
           F++GFWQRAF+SKN++ L LS ++ +I LF V + +G+ G +A W+GL+  P  E+ +  
Sbjct: 215 FNQGFWQRAFASKNNKTLYLSVIFATIPLFAVCMLVGMAGPLAWWSGLFNGPTAED-DGS 273

Query: 240 LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 299
           L FF +   LP+W++GI +VL   +S +AYDT  SA  +   ND+F  RL +   R + +
Sbjct: 274 LTFFYILNTLPNWLTGIVIVLCGCLSSSAYDTFQSAQISTIQNDVFLGRLNIWWCRAILV 333

Query: 300 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXX 359
           + NVP+V   +K++D+L VFLIADL A + +P  LLGL+  LYFLN +D           
Sbjct: 334 LINVPSVVLAVKNIDILEVFLIADLAAIACIPAFLLGLVPQLYFLNGLDAVGGAVGGFLT 393

Query: 360 XXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 419
                ++F+ +A  GI LIGLP GLYI DYSVLGAFI APL S+ +TF++FG+R   MWV
Sbjct: 394 VFLFGTVFFRSAAQGIALIGLPNGLYIDDYSVLGAFIAAPLGSLGWTFVTFGIRATVMWV 453

Query: 420 FTKIRGEEF 428
           + +  GE+F
Sbjct: 454 WCRRTGEKF 462



>gi|315047150|ref|XP_003172950.1| hypothetical protein MGYG_09089 [Arthroderma gypseum CBS 118893]
 gi|311343336|gb|EFR02539.1| hypothetical protein MGYG_09089 [Arthroderma gypseum CBS 118893]
          Length = 536

 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 176/516 (34%), Positives = 263/516 (50%), Gaps = 61/516 (11%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL  G+Y  ++ + + K ++LSS GTQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALIYLTYGAFLVAGLYIAWRLRNQTKGEFLSSNGTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEV------------------------------------------------GTIAGL--- 75
           PE+                                                G +AG+   
Sbjct: 69  PEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRKKFPEVFVLTEWTRQRYGVVAGIYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDNIQ
Sbjct: 129 ILTLITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFKVSFLTDNIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W
Sbjct: 189 GAMVVGLIIIAVITVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG+      +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLE 308

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP WV GI +V+ V++S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V 
Sbjct: 309 KLPSWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIIPVVV 368

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             L+   VLR+FLI+DL++AS +P ++LGL D  Y+    +                +I+
Sbjct: 369 VALRSPSVLRIFLISDLVSASAIPVLVLGLSDKFYWWTAFEVIVGGLGGILSVFIFGTIY 428

Query: 368 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 427
           Y NA DG  LI L  GLY  D+S  GAF+ AP+  + F  L+ G+R+   ++ +K  G  
Sbjct: 429 YGNATDGGNLILLQNGLYANDWSAFGAFVAAPVGGLIFACLALGLRVGYKFILSKTTGRH 488

Query: 428 FVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 463
           F     P +  +   AG    D+ E I +     I 
Sbjct: 489 FDVFDLP-LPRSHMAAGPMHLDEPEFIATGTDATIR 523



>gi|295663094|ref|XP_002792100.1| urea transport protein [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226279275|gb|EEH34841.1| urea transport protein [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 503

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/416 (37%), Positives = 231/416 (55%), Gaps = 34/416 (8%)

Query: 54  FASSIGSSILYSFPEVGTIAGLLGVII--------------------------------- 80
           F +++GS IL+++PE+ TIAG+ G++I                                 
Sbjct: 38  FLAALGSGILFTYPEIATIAGVQGLVIYGLASALPLLRYGLVTAIYLSILTLITLFLYMV 97

Query: 81  -ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX 139
            ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S ITDNIQG           
Sbjct: 98  AELSALQQIVSALTGLNGLPTVIVQVMVTTIYTSLGGFKVSFITDNIQGAMVVGLVIIAV 157

Query: 140 XXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 199
               T   I++S+ID+S LL ++ LGWQL+YI+P+A+     F   FW R F+SK+DR+L
Sbjct: 158 ITVGTKTNIDRSLIDSSGLLDASLLGWQLIYILPIAIFTNDFFLSNFWLRTFASKSDRDL 217

Query: 200 RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVV 259
           R+     S  +F +L  +G+TG++A W+G WPG     + +AFF L + LP WV GI +V
Sbjct: 218 RIGVSIASGTVFCILTLVGVTGLLAAWSGAWPGNPPQRASIAFFLLLEKLPGWVVGIVLV 277

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 319
           + VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   L+   VL++F
Sbjct: 278 MTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLKYVRILVVLCIIPVVVVALRSPSVLQIF 337

Query: 320 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 379
           LI+DL++AS++P +  GL +  Y+    +                +I++ +A++G +LI 
Sbjct: 338 LISDLVSASSIPVLTFGLWEKAYWWKGFEVVVGGLGGIFSVFVFGAIYFKDAQEGAKLIL 397

Query: 380 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
           L  GLY  D+SV GAF+ APL  I F   + G+RL   ++  K +   F    KPE
Sbjct: 398 LGNGLYAQDWSVFGAFLAAPLGGILFGIAALGLRLGYQFLLCKHQHRRFDALDKPE 453



>gi|443898725|dbj|GAC76059.1| hypothetical protein PANT_19d00093 [Pseudozyma antarctica T-34]
          Length = 493

 Score =  266 bits (681), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 152/408 (37%), Positives = 239/408 (58%), Gaps = 12/408 (2%)

Query: 64  YSFPEVGTIAGLLGV-------IIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGG 116
           Y +P VG ++GL+ V       ++EL+  G+ +  L GV+     + +A+ TT+YT YGG
Sbjct: 62  YGWP-VGVLSGLIFVGFMFCFMLVELNTYGSTVNVLGGVNPTIAALIVALSTTIYTAYGG 120

Query: 117 LRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAV 176
            +ASL TDN+                  ++ I+ + +++S LLK   LG +L YI+  A+
Sbjct: 121 FKASLYTDNVNAVIIMIFVVIATIAVGVNLDIDHARVESSGLLKPQRLGGELWYILTAAL 180

Query: 177 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEE 234
            F+ +F++GFWQRAF+SKN++ L LS ++ ++ LF +   +G+ G +A WAGL+  P  E
Sbjct: 181 VFSQMFNQGFWQRAFASKNNKTLYLSVIFATVPLFAICFIVGMAGPLAWWAGLFDGPTAE 240

Query: 235 NLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVT 294
           + +  L FF +   LP+WV+GI +VLA  +S +AYDT  SA  +   ND+F  R+ +   
Sbjct: 241 D-DGSLTFFYIINTLPNWVTGIVIVLAGCLSSSAYDTFQSAQISTIQNDVFLGRVNIWWC 299

Query: 295 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXX 354
           R + ++ NVP+V   +K++D+L VFL+ADL A + +P  LLGL+  LYFLN +D      
Sbjct: 300 RAILVLINVPSVVLAVKNIDILEVFLVADLAAIACIPAFLLGLVPQLYFLNGVDAVGGAV 359

Query: 355 XXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRL 414
                     + FY +A+ GI+L+GLP GLYI D+SVLGAF  APL S+ +TF +FG+R 
Sbjct: 360 GGFLTVFLFGTAFYGSAEQGIKLLGLPNGLYIDDFSVLGAFFAAPLGSLGWTFATFGMRA 419

Query: 415 ISMWVFTKIRGEEF-VFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDE 461
            + WV+ +  G  F VF  +   V       ++  D   +  S +P++
Sbjct: 420 AATWVYCRYTGRAFNVFEYREFDVTKWALPEDRPADFHGVHGSGNPND 467



>gi|327306029|ref|XP_003237706.1| hypothetical protein TERG_02421 [Trichophyton rubrum CBS 118892]
 gi|326460704|gb|EGD86157.1| hypothetical protein TERG_02421 [Trichophyton rubrum CBS 118892]
          Length = 536

 Score =  266 bits (681), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 176/525 (33%), Positives = 270/525 (51%), Gaps = 67/525 (12%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL +G+Y  ++ + + K ++LSS GTQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALIYLTYGSFLVVGLYIAWRLRNQTKGEFLSSNGTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEV------------------------------------------------GTIAGL--- 75
           PE+                                                G +AG+   
Sbjct: 69  PEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRKKFPEVFVLTEWTRQRYGVVAGIYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+Q
Sbjct: 129 ILTMITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W
Sbjct: 189 GAMVVGLIIIAVITVGARTNIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG       +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGNPPQAGSIAFFLLLE 308

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP+WV GI +V+ V++S AA+D+L SA  +  SND+F N+LPL   R   ++  VP V 
Sbjct: 309 KLPNWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIVPVVV 368

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             L+   VLR+FLI+DL++AS +P ++LGL + +Y+    +                +I+
Sbjct: 369 VALRSPSVLRIFLISDLVSASAIPVLVLGLSNRMYWWTAFEVIVGGLGGILSVFIFGTIY 428

Query: 368 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 427
           Y NA +G +LI L  GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  
Sbjct: 429 YGNATEGGKLILLQNGLYANDWSAFGAFVAAPVGGLIFACIALGLRVGYKYVLSKTTGRH 488

Query: 428 F-VF----PKKPEVVDTKKYAGNKF--KDDTEIIQSSDPDEIEIR 465
           F VF    P+ P            F       II+++D +  + R
Sbjct: 489 FDVFDRPLPRSPMAAGPMHLDQPDFIATGTDAIIRNNDEEGAKFR 533



>gi|302664422|ref|XP_003023841.1| hypothetical protein TRV_02038 [Trichophyton verrucosum HKI 0517]
 gi|291187859|gb|EFE43223.1| hypothetical protein TRV_02038 [Trichophyton verrucosum HKI 0517]
          Length = 536

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 173/516 (33%), Positives = 266/516 (51%), Gaps = 61/516 (11%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL +G+Y  ++ + + K ++LSS GTQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALIYLTYGAFLVVGLYIAWRLRNQTKGEFLSSNGTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEV------------------------------------------------GTIAGL--- 75
           PE+                                                G +AG+   
Sbjct: 69  PEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+Q
Sbjct: 129 ILTLITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W
Sbjct: 189 GAMVVGLIIIAVITVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG+      +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLE 308

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP+WV GI +V+ V++S AA+D+L SA  +  SND+F N+LPL   R   ++  VP V 
Sbjct: 309 KLPNWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDVFRNKLPLIYVRIGVVLCIVPVVV 368

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             L+   VLR+FLI+DL++AS +P ++LGL + +Y+    +                +I+
Sbjct: 369 VALRSPSVLRIFLISDLVSASAIPVLVLGLSERMYWWTAFEVIVGGLGGILSVFIFGTIY 428

Query: 368 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 427
           Y NA +G +LI L  GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  
Sbjct: 429 YGNATEGGKLILLQNGLYANDWSAFGAFVAAPIGGLIFACIALGLRVGYAFVLSKTTGRH 488

Query: 428 FVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 463
           F     P +  +   AG    D  + I +     I 
Sbjct: 489 FDVFDHP-LPRSHMAAGPMHLDQPDFIATGTDATIR 523



>gi|358393547|gb|EHK42948.1| hypothetical protein TRIATDRAFT_247013 [Trichoderma atroviride IMI
           206040]
          Length = 521

 Score =  261 bits (666), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 173/488 (35%), Positives = 256/488 (52%), Gaps = 62/488 (12%)

Query: 8   SNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           SN +IYV    FL  G GI    +K  N +D+L+   TQ A  L  N+ AS++GS IL+S
Sbjct: 9   SNAIIYVTYGFFLVMGTGIAWRMRKQPN-TDFLAGNRTQTAWPLAFNFIASALGSGILFS 67

Query: 66  FPEV------------------------------------------------GTIAGL-- 75
           +P++                                                GT+A L  
Sbjct: 68  YPQLATIAGVQGVVVYALASALPLLIFAALGPILRRKCPDGFVLTEWTRERYGTVAMLYL 127

Query: 76  ---------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 126
                    L ++ ELSAVG ++  LTG+D L  +I   +VTT+YT  GG R S +TD +
Sbjct: 128 SFMTLVTLFLYMVAELSAVGQVVNALTGLDGLPVIIVECVVTTIYTSLGGFRISFLTDVV 187

Query: 127 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 186
           QG                   I++ +ID+S L K++ +GWQL+YI+PVAV     F   F
Sbjct: 188 QGAMVVGLIIIATITIGVKAEIDRDLIDSSGLTKASLVGWQLVYILPVAVLTNDFFLSNF 247

Query: 187 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 246
           W R FSSK D++L +     ++ +  +L  +G TG+IA W G WPGE +++  LAFF L 
Sbjct: 248 WLRTFSSKTDKDLWIGVSVATVAVLCILTLVGATGLIAAWTGAWPGESDIDGSLAFFALL 307

Query: 247 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 306
           + LP+WV GI +V+ VS+S +A+D+L SA  ++ SND+F NRL + + R L ++  +P V
Sbjct: 308 EQLPNWVVGIVLVMVVSLSVSAFDSLQSAMISSASNDLFRNRLNIWIIRVLVVLVIIPTV 367

Query: 307 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 366
              LK   +L++FLI+DL +A+T+PP+ LGLID  Y+    +                +I
Sbjct: 368 VIALKAPSILQIFLISDLASAATIPPLCLGLIDGFYWWRGFEVVVGGLGGILSVFIYGAI 427

Query: 367 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 426
           +Y +AK G ELI L  GLY  D+   GAF++AP+  I + F++  +RL   +V  K RGE
Sbjct: 428 YYGDAKSGGELILLEQGLYEGDWGAFGAFVMAPVGGIIWGFIALVLRLSVQFVQAKSRGE 487

Query: 427 EFVFPKKP 434
            F    +P
Sbjct: 488 RFDALDRP 495



>gi|367041970|ref|XP_003651365.1| hypothetical protein THITE_2111546 [Thielavia terrestris NRRL 8126]
 gi|346998627|gb|AEO65029.1| hypothetical protein THITE_2111546 [Thielavia terrestris NRRL 8126]
          Length = 538

 Score =  256 bits (653), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 172/523 (32%), Positives = 276/523 (52%), Gaps = 77/523 (14%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV   +FL +G    +K K+++KS++L+   TQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNAIIYVTYGLFLLVGTGVAWKFKSQSKSEFLAGNRTQTALPLALNFIASALGSGILFAY 68

Query: 67  -------------------------------------PE-----------VGTIAGL--- 75
                                                PE            GT A L   
Sbjct: 69  PQLATLAGVQGVVVYALSSALPLLIFAALGPIIRRKCPEGFVLTEWTRQRYGTFAALYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSA+G ++  LTG+D L  +I   IVTT+YT  GG + S  TDNIQ
Sbjct: 129 FMTLVTLFLYMVSELSAIGQVVNLLTGLDGLPVLIVECIVTTVYTSMGGFKISFFTDNIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                  +I+ S+ID+S L K++ LGWQLLYI+PVA+     F   FW
Sbjct: 189 GAMVLGLILIATITIGVETKIDTSLIDSSGLTKASLLGWQLLYILPVAILTNDFFLSNFW 248

Query: 188 QRAFSSKNDRELRLS---AVYGSIMLFPVLVFLGLTGMIAVWAGLWPG--EENLESYLAF 242
            R F+SK DR+L L    AV G+++   ++  +G TG++A WAG+WPG  ++ ++  +AF
Sbjct: 249 LRTFASKTDRDLWLGISGAVVGTLI---IVTLVGATGLVAAWAGIWPGPADDPVDGSVAF 305

Query: 243 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 302
           F L + LP WV GI +V++V++S AA+D+L SA   + SND+F NRL + + R   ++  
Sbjct: 306 FALLEQLPSWVVGIVLVMSVTLSTAAFDSLQSAMVTSASNDLFRNRLNIWLIRAGVVLVM 365

Query: 303 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXX 362
           +P V   ++   +L+++LI+DL++A+++P +++GL D+ Y+    +              
Sbjct: 366 IPVVVIAIRAPSILQIYLISDLVSAASIPVLMIGLCDACYWWRGFEVVVGGLGGLFTVFL 425

Query: 363 XXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 422
             +++Y NA+ G EL+ L  GLY  D+   GAF+ AP+  + + F + G+RL   ++  +
Sbjct: 426 FGTVYYGNAQLGAELMLLEQGLYTADWGAFGAFVAAPVGGLLWGFGALGLRLGIQYIRAR 485

Query: 423 IRGEEFVFPKKP-------EVVDTKKYAGNKFKDDTEIIQSSD 458
            +GE F    +P        VVD +      F +++EI  SSD
Sbjct: 486 AKGERFDALDRPLATGGPRPVVDPEVGGNAGFGEESEI--SSD 526



>gi|303313113|ref|XP_003066568.1| hypothetical protein CPC735_057930 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240106230|gb|EER24423.1| hypothetical protein CPC735_057930 [Coccidioides posadasii C735
           delta SOWgp]
 gi|320036548|gb|EFW18487.1| urea transporter [Coccidioides posadasii str. Silveira]
          Length = 403

 Score =  254 bits (650), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 203/357 (56%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDN+QG         
Sbjct: 1   MVAELSALQQIVNALTGLNGLPAVIVQVAVTTIYTSLGGFKVSFMTDNLQGAMVVGLIII 60

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T   I++S+ID+S  L ++ LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 61  GVITVGTKTTIDRSLIDSSGYLNASLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 120

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 121 DLRIGVSIASFTVLCILVLVGCTGLLAAWSGAWPGDPPQSGSIAFFLLLERLPSWVVGIV 180

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ V +S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V   LK   VL+
Sbjct: 181 LVMTVVLSTAAFDSLQSAMVSTASNDLFRNKLPLIYIRVGVVLCIIPVVVVALKSPSVLQ 240

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++AS +P ++LGL D  YF    +                +I+Y +A +G  L
Sbjct: 241 IFLISDLVSASAIPVLILGLWDKCYFWKGFEVIAGGLGGILSVFIFGTIYYGSAYEGGRL 300

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 434
           I L  GLY  D+S  GAF+ AP+    F  ++FG R+   +V  KI+G  F    KP
Sbjct: 301 ILLENGLYAEDWSAFGAFVAAPVGGFIFALIAFGSRIAYQFVIAKIQGRRFDAFDKP 357



>gi|119192082|ref|XP_001246647.1| hypothetical protein CIMG_00418 [Coccidioides immitis RS]
          Length = 490

 Score =  254 bits (649), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 140/357 (39%), Positives = 203/357 (56%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDN+QG         
Sbjct: 88  MVAELSALQQIVNALTGLNGLPAVIVQVAVTTIYTSLGGFKVSFMTDNLQGAMVVGLIII 147

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T   I++S+ID+S  L ++ LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 148 GVITVGTKTTIDRSLIDSSGYLNASLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 207

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 208 DLRIGVSIASFTVLCILVLVGCTGLLAAWSGAWPGDPPQSGSIAFFLLLERLPSWVVGIV 267

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ V +S AA+D+L SA  +  SND+F N+LPL   R   ++  +P V   LK   VL+
Sbjct: 268 LVMTVVLSTAAFDSLQSAMVSTASNDLFRNKLPLIYIRVGVVLCIIPVVVVALKSPSVLQ 327

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++AS +P ++LGL D  YF    +                +I+Y +A +G  L
Sbjct: 328 IFLISDLVSASAIPVLILGLWDKCYFWKGFEVIAGGLGGILSVFIFGTIYYGSAYEGGRL 387

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 434
           I L  GLY  D+S  GAF+ AP+    F  ++FG R+   +V  KI+G  F    KP
Sbjct: 388 ILLENGLYAEDWSAFGAFVAAPVGGFIFALIAFGSRIAYQFVIAKIQGRRFDAFDKP 444



>gi|340519811|gb|EGR50049.1| hypothetical protein TRIREDRAFT_3412 [Trichoderma reesei QM6a]
          Length = 520

 Score =  250 bits (638), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 170/487 (34%), Positives = 252/487 (51%), Gaps = 60/487 (12%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYKKTKN-KSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV    FL +G    +K  K   +D+LS   TQ A+ L  N+ AS++GS IL+S+
Sbjct: 9   SNAIIYVTYGFFLILGTSIAWKMRKQPNTDFLSGNRTQTALPLAFNFIASALGSGILFSY 68

Query: 67  PEV------------------------------------------------GTIAGL--- 75
           PE+                                                GT+A L   
Sbjct: 69  PELATIAGVQGVVVYALASALPLLVFAALGPMIRRKCPDGFVLTEWTRNRYGTVAMLYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSAVG ++  LTG+D L  +I    VTT+YT  GG R S +TD IQ
Sbjct: 129 FMTLVTLFLYMVAELSAVGQVVNALTGLDGLPVIIVECAVTTIYTSLGGFRISFLTDVIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I++ +ID+S L K++ +GWQL+YI+PVAV     F   FW
Sbjct: 189 GAMVVGLIIIATITIGVKAEIDRDLIDSSGLTKASLVGWQLVYILPVAVLTNDFFLSNFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R FSSK D++L +     ++ +  +L  +G TG+IA W G WPGE +++  LAFF L +
Sbjct: 249 LRTFSSKTDKDLWVGVSIATVAVLCILTLVGATGLIAAWTGAWPGESDIDGSLAFFALLE 308

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP WV GI +V+ VS+S +A+D+L SA  ++ SND+F NRL + + R + ++  +P V 
Sbjct: 309 QLPSWVVGIVLVMVVSLSVSAFDSLQSAMISSASNDLFRNRLNIWIIRVIVVLVIIPTVV 368

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             LK   +L++FLI+DL +A+T+P + LGL D+ Y+    +                +I+
Sbjct: 369 IALKAPSILQIFLISDLASAATIPALCLGLFDTFYWWRGFEVVVGGLGGILTVFIYGAIY 428

Query: 368 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 427
           Y +AK G ELI L  GLY  D+   GAF+ AP+  I + F++  +RL   +   K+RGE 
Sbjct: 429 YGDAKSGGELILLEQGLYAGDWGAFGAFVAAPVGGIIWGFIALALRLSVQFTLAKMRGER 488

Query: 428 FVFPKKP 434
           F    +P
Sbjct: 489 FDALDRP 495



>gi|407918302|gb|EKG11573.1| Sodium/solute symporter [Macrophomina phaseolina MS6]
          Length = 468

 Score =  247 bits (630), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 163/458 (35%), Positives = 243/458 (53%), Gaps = 60/458 (13%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IY+    FL  G++  +K + ++K+DYLSS  TQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNAIIYLTYGAFLICGVFVAWKLRHQSKTDYLSSNRTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEVGT-------------------IAGLLGVII--------------------------- 80
           PE+ T                   I G LG +I                           
Sbjct: 69  PEIATIAGVQGLVVYALSSGLPLLIFGYLGPLIRKKCPEGFVLTEWTRQRYGTVAALFLS 128

Query: 81  -------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                        ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDNIQ
Sbjct: 129 LMTLITLFLYMVSELSALQQIITALTGLDGLPAVIVQCAVTTIYTSVGGFKVSFVTDNIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I++S+ID+S  L S+ LGWQL+YI+PVA+     F  GFW
Sbjct: 189 GVMVLGLIIIACITVGVETEIDRSLIDSSGYLNSSLLGWQLIYILPVAILTNDFFLSGFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R F+S+ DR+LR++    ++ +  +L  +G TG++A W+G+WPG       +AFFTL  
Sbjct: 249 LRTFASRTDRDLRIAVSIAAVTVTIILTLVGCTGLLATWSGVWPGNPPQVGSIAFFTLLG 308

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP WV GI +V+ V++S AA+D+  SA  +  SND+F NRLPL   R L ++A VP V 
Sbjct: 309 TLPAWVVGIVLVMVVALSTAAFDSFQSAMVSTGSNDLFRNRLPLWWIRALVVVAIVPVVV 368

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             L+   VL+V+LI+DL++AS +P +++GL D  ++ +  +                +++
Sbjct: 369 VALRSPSVLQVYLISDLVSASLVPVLVIGLSDRCWWWSGTEVVVGGLGGIFSVFLFGTVY 428

Query: 368 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFF 405
           Y NA+DG  LI L  GLY  D+S  GAF+ AP+  + +
Sbjct: 429 YGNARDGANLILLENGLYGDDWSAFGAFVAAPVGGLLW 466



>gi|326471561|gb|EGD95570.1| hypothetical protein TESG_03046 [Trichophyton tonsurans CBS 112818]
          Length = 509

 Score =  246 bits (629), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 168/516 (32%), Positives = 257/516 (49%), Gaps = 88/516 (17%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY+    FL +G+Y  ++ + + K ++LSS GTQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALIYLTYGAFLVVGLYIAWRLRNQTKGEFLSSNGTQKAIPLALNFIASALGSGILFTY 68

Query: 67  PEV------------------------------------------------GTIAGL--- 75
           PE+                                                G +AG+   
Sbjct: 69  PEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSA+  I+  L+G++ L  VI   +VTT+YT  GG + S +TDN+Q
Sbjct: 129 ILTMITLFLYMVAELSALQQIVTALSGLNGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I+KS+ID+S LLK   LGWQL+YI+PVA+     F    W
Sbjct: 189 GAMVVGLIIIAVITVGARTDIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNLW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R F+SK DR+LR+     S ++  +LV +G TG++A W+G+WPG+      +AFF L +
Sbjct: 249 LRTFASKTDRDLRIGISIASFVVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLE 308

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP+WV GI +V+ V++S AA+D+L SA  +  SND F N+LPL   R   ++  VP V 
Sbjct: 309 KLPNWVVGIVLVMTVALSTAAFDSLQSAMVSTASNDAFRNKLPLIYVRIGVVLCIVPVVV 368

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             L+   VLR+FLI+DL++AS +P ++LGL D +Y+    +                   
Sbjct: 369 VALRSPSVLRIFLISDLVSASAIPVLVLGLSDRMYWWTAFEV------------------ 410

Query: 368 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 427
                    +I L  GLY  D+S  GAF+ AP+  + F  ++ G+R+   +V +K  G  
Sbjct: 411 ---------IILLQNGLYANDWSAFGAFVAAPIGGLIFACIALGLRVGYKFVLSKTTGRH 461

Query: 428 FVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 463
           F    +P +  +   AG    D  + I +     I 
Sbjct: 462 FDVFDRP-LPHSHVPAGPMHLDQPDFIATGTDATIR 496



>gi|408392233|gb|EKJ71591.1| hypothetical protein FPSE_08230 [Fusarium pseudograminearum CS3096]
          Length = 522

 Score =  246 bits (628), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 166/488 (34%), Positives = 252/488 (51%), Gaps = 61/488 (12%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV    FL +G    +K + ++K+D+LS  GTQ A  L  N+ AS++GS IL+S+
Sbjct: 9   SNAVIYVTYGAFLIMGTGIAWKMRNQSKADFLSGNGTQTAFPLALNFIASALGSGILFSY 68

Query: 67  PEVGTIA-------------------GLLGVII--------------------------- 80
           PE+ TI+                   G LG II                           
Sbjct: 69  PELATISGVQGMMVYALASALPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGIITMLYLS 128

Query: 81  -------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                        ELSA+G ++  LTG+D L  +I    +TT+YT  GG R S +TD +Q
Sbjct: 129 FMSMVTLFLYMVSELSAIGQVVQALTGLDPLPVMIVQCAITTIYTSLGGFRISFMTDVVQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I++ +ID S L K N LGWQLLYI+PVAV     F   FW
Sbjct: 189 GTMVIGLVIIAAITIGAKTEIQRPLIDESGLTKPNLLGWQLLYILPVAVLTNDFFLSSFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLF 246
            R F+SK D++LR+     +I++  VL  +G TG+IAVW+G  P  ++     +AFF L 
Sbjct: 249 LRTFASKTDKDLRIGTTIATIVILCVLTLVGSTGLIAVWSGALPLADKAGSGSVAFFVLL 308

Query: 247 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 306
           + LP WV GI +V+ V+MS AA+D+L SA  ++ SND+F N+L +   R + ++  +P +
Sbjct: 309 ETLPSWVVGIVLVMVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAIVVLIIIPVI 368

Query: 307 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 366
              LK   VL+++LI DL++A+T+P +++GL++  Y+    +                 +
Sbjct: 369 AIALKAPSVLQIWLITDLISAATIPVLVIGLVEKFYWWRGFEVVVGGLGGILTVFIFGCV 428

Query: 367 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 426
           +Y NAK+  EL+ +  GLY  D+S  GAF+ AP+ S+ +   +  VR+   +V  K+RG 
Sbjct: 429 YYGNAKEAGELLLVQKGLYGNDWSAFGAFVAAPVGSLLWGCGAMIVRITFQYVHAKVRGH 488

Query: 427 EFVFPKKP 434
            F    +P
Sbjct: 489 HFDALDRP 496



>gi|322709553|gb|EFZ01129.1| urea transporter [Metarhizium anisopliae ARSEF 23]
          Length = 510

 Score =  245 bits (626), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 169/510 (33%), Positives = 261/510 (51%), Gaps = 75/510 (14%)

Query: 8   SNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           SN +IY+    FL  G GI A   + ++K D+LSS GTQ+A           +G+ IL+S
Sbjct: 9   SNAIIYLTYGAFLVLGTGI-AWTMRNQSKQDFLSSNGTQSA-----------LGAGILFS 56

Query: 66  FPEVGTIA-------------------GLLGVII-------------------------- 80
           +PE+ TI                    G LG II                          
Sbjct: 57  YPELATITGVQGVIIYALASALPMLIFGALGPIIRRKCPEGFVLTEWTRQRYGTVAMLYL 116

Query: 81  --------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 126
                         ELSA+G ++ TLTG+D L  +I   ++TT+YT  GG + S +TD +
Sbjct: 117 SFMTLVTLFLYMVAELSALGQVVSTLTGIDSLPVIIVECVITTIYTSLGGFKISFLTDVV 176

Query: 127 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 186
           QG                   I++ +ID+S LL+ + LGWQLLYI+PVAV     F   F
Sbjct: 177 QGGMVVGLIIIATITVGAKTEIKRELIDSSHLLEPSLLGWQLLYILPVAVLTNDFFLSNF 236

Query: 187 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 246
           W R FSSK+D++L +      +++  +L  +G +G+IA W+G WPGE   E  LAFF L 
Sbjct: 237 WLRTFSSKSDKDLWVGVSVAMVVILCILTLVGCSGLIAAWSGAWPGEPEQEGSLAFFLLL 296

Query: 247 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 306
           + LP WV GI +V+ VS+S AA+D+L SA  ++ SND+F NRL +   R + ++  +P V
Sbjct: 297 QQLPSWVVGIILVMVVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWYIRGMVVLIIIPVV 356

Query: 307 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 366
              L+   +L+++LI+DLL+A+T+P + LGL D LY+    +                +I
Sbjct: 357 VVALRASSILQIYLISDLLSAATIPVLCLGLSDRLYWWRGFEVVVGGLGGILTVFIFGAI 416

Query: 367 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 426
           +Y +A+ G +L+ +  GLY  D+S  GAF+ AP+  I + F +  +RL   ++  ++R E
Sbjct: 417 YYKDAEQGAQLLLIQNGLYANDWSAFGAFVAAPVGGIVWGFGALALRLSFQYIKARLRRE 476

Query: 427 EFVFPKKPEVVDTKKYAGNKFKDDTEIIQS 456
            F    +P  + T+  + ++  D+  I  S
Sbjct: 477 RFDALDRP--LMTRTVSDSEMPDEVVIASS 504



>gi|261193629|ref|XP_002623220.1| urea transporter [Ajellomyces dermatitidis SLH14081]
 gi|239588825|gb|EEQ71468.1| urea transporter [Ajellomyces dermatitidis SLH14081]
          Length = 417

 Score =  244 bits (624), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 203/351 (57%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDN+QG         
Sbjct: 1   MVAELSALQQIITALTGLDGLPVVIVEVAVTTIYTSLGGFKVSFVTDNLQGAMVVGLIII 60

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T + I+++++++S  L+ + LGWQL+YI+P+A+     F   FW R F+SK DR
Sbjct: 61  AVITVGTEVNIDRALVESSGFLEPSLLGWQLIYILPIAILTNDFFLSNFWLRTFASKTDR 120

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     S  +F +L  +G++G++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 121 DLRIGVSIASGAIFCILTLVGVSGLLAAWSGAWPGDPPQLGSIAFFLLLEKLPAWVVGIV 180

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P +   L    VL+
Sbjct: 181 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVIVVALMSPSVLQ 240

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++AS++P ++ GL D +Y+    +                +I+Y +A  G +L
Sbjct: 241 IFLISDLVSASSIPVLVFGLWDKVYWWTGFEVVVGGLGGIFSVFIFGTIYYGDAHAGAKL 300

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 428
           I L  GLY  D+SV GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 301 ILLENGLYAKDWSVFGAFLAAPLGGILFAIAALILRLGYHYLLAKSQHRRF 351



>gi|239613852|gb|EEQ90839.1| urea transporter [Ajellomyces dermatitidis ER-3]
 gi|327349966|gb|EGE78823.1| urea transporter [Ajellomyces dermatitidis ATCC 18188]
          Length = 520

 Score =  244 bits (624), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 203/351 (57%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDN+QG         
Sbjct: 104 MVAELSALQQIITALTGLDGLPVVIVEVAVTTIYTSLGGFKVSFVTDNLQGAMVVGLIII 163

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T + I+++++++S  L+ + LGWQL+YI+P+A+     F   FW R F+SK DR
Sbjct: 164 AVITVGTEVNIDRALVESSGFLEPSLLGWQLIYILPIAILTNDFFLSNFWLRTFASKTDR 223

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     S  +F +L  +G++G++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 224 DLRIGVSIASGAIFCILTLVGVSGLLAAWSGAWPGDPPQLGSIAFFLLLEKLPAWVVGIV 283

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P +   L    VL+
Sbjct: 284 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVIVVALMSPSVLQ 343

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++AS++P ++ GL D +Y+    +                +I+Y +A  G +L
Sbjct: 344 IFLISDLVSASSIPVLVFGLWDKVYWWTGFEVVVGGLGGIFSVFIFGTIYYGDAHAGAKL 403

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 428
           I L  GLY  D+SV GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 404 ILLENGLYAKDWSVFGAFLAAPLGGILFAIAALILRLGYHYLLAKSQHRRF 454



>gi|399166435|emb|CCE32710.1| uncharacterized protein CPUR_06574 [Claviceps purpurea 20.1]
          Length = 515

 Score =  244 bits (623), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 138/380 (36%), Positives = 216/380 (56%), Gaps = 6/380 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+G ++ TLTG+D L  +I   ++TTLYT  GG + S +TD IQG         
Sbjct: 131 MVAELSALGQVVSTLTGLDSLPAIIVECVITTLYTSLGGFKISFLTDTIQGVMVVGLIIV 190

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     +++ ++D S LL+ + LGWQLLYI+PVAV     F   FW R FSS++D+
Sbjct: 191 ATITVGVKADVKRELVDASHLLEPSLLGWQLLYILPVAVLTNDFFLSNFWLRTFSSRSDK 250

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +L L     ++++  +L  +G TG+I+VW+G WP + +    LAFF L + LP WV GI 
Sbjct: 251 DLMLGVSMATVVVLCILTLIGCTGLISVWSGAWPLDGSQPGSLAFFLLLEQLPTWVIGII 310

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ V++SCAA+D+L SA  ++ SND+F NRL +   R + ++  +P V   L+   +L+
Sbjct: 311 LVMVVALSCAAFDSLQSAMVSSASNDLFRNRLNIWWIRAMVVVIIIPVVIVALRASSILQ 370

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DLL+A+T+P + LGLID LY+    +                 I+Y N+ D  +L
Sbjct: 371 IFLISDLLSAATIPVLCLGLIDRLYWWRGFEVVVGGLGGILTIFIFGVIYYGNSYDAGQL 430

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 437
           + +  GLY  D+S  GAF+  PL  I + F + G+RL   ++  K R E F    +P + 
Sbjct: 431 LLVKNGLYAKDWSTFGAFVAGPLGGIVWGFGALGLRLSFQYLKAKYRHERFDALDRPAIA 490

Query: 438 DTKKYAGNKFKDDTEIIQSS 457
            T          D ++++ S
Sbjct: 491 LTSG------DSDVDVLRQS 504



>gi|440633300|gb|ELR03219.1| hypothetical protein GMDG_01202 [Geomyces destructans 20631-21]
          Length = 530

 Score =  243 bits (620), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 144/388 (37%), Positives = 218/388 (56%), Gaps = 12/388 (3%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG+D L  +I  A+VTT+YT  GG + S ITDNIQ          
Sbjct: 139 MVAELSAMQQIVGALTGMDGLPAIIVQAVVTTIYTSLGGFKISFITDNIQAVMVFFLVTV 198

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     +++S++D+S LL +  LGWQLLYI+PVAV     F   FW R F+S+ D+
Sbjct: 199 ATITIGVKTNVDRSLVDSSGLLNATLLGWQLLYILPVAVLTNDFFLSNFWIRTFASRTDK 258

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGI 256
           +L +     S ++  +L  +G+TG++AVW G L PGE+     +AFF L + LP WV GI
Sbjct: 259 DLFIGVSSASAIVLVILTLVGVTGLLAVWTGALAPGEDG---SIAFFLLLETLPSWVVGI 315

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 316
            +V+ V++S AA+D+  SA  ++ SND+F N+L + V R   +    P V   LK   +L
Sbjct: 316 VLVMTVTLSTAAFDSFQSAMVSSASNDLFGNKLNIWVIRAGIVALIFPVVVIALKAPSIL 375

Query: 317 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIE 376
           +++LI+DL++AST+P +++GL D  Y+    +                +I++ NA DG +
Sbjct: 376 QIYLISDLVSASTIPVLVIGLSDRFYWWRGFEVVIGGLGGILTVFIFGTIYFGNALDGAK 435

Query: 377 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF------VF 430
           LI L  GLY  D+SV GAF+ AP   + + F +  VRL   W+  KI+G+ F       +
Sbjct: 436 LILLEGGLYANDWSVFGAFVAAPFGGLLWGFGALVVRLGFQWLIAKIKGQRFDSLDKPDY 495

Query: 431 PKKPEVVDTKKY--AGNKFKDDTEIIQS 456
             +P +VD  +Y   G+    D E I S
Sbjct: 496 LTRPRIVDANEYTDGGDITAADEEFITS 523



>gi|350297242|gb|EGZ78219.1| hypothetical protein NEUTE2DRAFT_154667 [Neurospora tetrasperma
           FGSC 2509]
          Length = 564

 Score =  243 bits (619), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 168/551 (30%), Positives = 265/551 (48%), Gaps = 101/551 (18%)

Query: 4   SGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASS----- 57
           S   SN +IY  L IFL +G    +  + ++K D+L+   TQ A+ L  N+ AS      
Sbjct: 5   SSEASNAIIYTTLGIFLIMGTGVAWTMRNQSKGDFLAGNRTQTAIPLALNFIASGDNGIS 64

Query: 58  -----------------------IGSSILYSFPEVGTIAG-------------------L 75
                                  +GS IL+++PE+ T+AG                   L
Sbjct: 65  EDREDEPGGDLATCWTTKLRLYPLGSGILFTYPEIATLAGLQGVLVYALASALPLFVFAL 124

Query: 76  LGVII----------------------------------------ELSAVGNILVTLTGV 95
           LG II                                        ELS +G ++  LTG+
Sbjct: 125 LGPIIRRKCPEGFVLTEWTRQRYGTIAALYLSFVTLVTLFLYMVAELSGIGQVVEVLTGL 184

Query: 96  DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN 155
           + L  +I   ++TT+YT  GG R S ITDNIQG                  +I+ S+I+ 
Sbjct: 185 NGLPVLIVECVITTIYTSLGGFRISFITDNIQGAMVIGLLVVASIAIGVETKIDTSLIEP 244

Query: 156 SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLV 215
           S LLK + LGWQLLYI+PVA+     F   FW R F+SK DR+L +     ++ +  ++ 
Sbjct: 245 SGLLKDSLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDRDLWIGITLAALFILIIIT 304

Query: 216 FLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL 272
            +G TG+IA W+G+WPG   E  L   +AFF L + LP WV G  +V++V++S AA+D+L
Sbjct: 305 MIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGLLENLPAWVVGFVLVMSVTLSTAAFDSL 364

Query: 273 ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPP 332
            SA  ++ SND+F N+L +   R   ++  +P V   +K   +L+++LI+DL++A+T+P 
Sbjct: 365 QSAMVSSASNDLFRNKLSVWWIRVAVVLVIIPIVVLAIKAPSILQIYLISDLVSAATIPV 424

Query: 333 ILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVL 392
           +++GL D  Y+    +                +I+Y++A  G +LI L  G+Y   ++  
Sbjct: 425 LIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYNDAYKGAQLILLEDGIYQEGWAAF 484

Query: 393 GAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTE 452
           GAF+ AP+  + + F +  +RL   WV  K +G  F    +P VV++          D+E
Sbjct: 485 GAFVAAPVGGLLWGFGALALRLAVQWVQAKRKGVRFDALDRPVVVES----------DSE 534

Query: 453 IIQSSDPDEIE 463
            IQ     ++E
Sbjct: 535 AIQYVAGGDLE 545



>gi|451997584|gb|EMD90049.1| hypothetical protein COCHEDRAFT_1022148 [Bipolaris maydis C5]
 gi|477592667|gb|ENI09737.1| hypothetical protein COCC4DRAFT_29696 [Bipolaris maydis ATCC 48331]
          Length = 530

 Score =  242 bits (617), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 159/517 (30%), Positives = 255/517 (49%), Gaps = 61/517 (11%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           M S   SN +IY+ L  FL +G +  ++ + ++K+++LSS  TQ  + L  N+ AS++GS
Sbjct: 3   MPSQPASNAIIYLTLGSFLVLGCFIAWRLRHQSKTEWLSSNRTQKGIPLAFNFIASALGS 62

Query: 61  SILYSFPEVGTIA-------------------GLLGVII--------------------- 80
            IL+++P++ TIA                   G LG II                     
Sbjct: 63  GILFTYPQIATIAGVQGLLVYALSSSLPLLIFGALGPIIRRKCPEGFVLTEWTRQRYGAV 122

Query: 81  -------------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 121
                              ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S 
Sbjct: 123 AGIFLSLCTLITMFLYMVAELSALQQIVNLLTGLNGLPVVIVECAVTTIYTSLGGFKVSF 182

Query: 122 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATL 181
           +TDNIQG                   I++S+ID S  LK + LGWQL+YI+PVA+     
Sbjct: 183 VTDNIQGAMVSGLIILGVIAVGVETDIDRSLIDQSGYLKPSLLGWQLIYILPVAILTNDF 242

Query: 182 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLA 241
           F  GFW R F+S+ D++L +     ++ +  +L  LG+ GM+A W+G +   +   S LA
Sbjct: 243 FLSGFWMRTFASRTDKDLWIGVSLATMGILIILTLLGVGGMLAAWSGAYTIGDEANSSLA 302

Query: 242 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIA 301
           FF L + LP WV G+ +V+ VS+S AA+D+  SA  +  SND F N+L + V R   +  
Sbjct: 303 FFLLLEKLPAWVVGVILVMTVSLSTAAFDSFQSAMISTASNDFFRNKLNIWVIRAFVVAI 362

Query: 302 NVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXX 361
             P V   L+  D+L++FLI+DL++A+ +P +++GL +  Y+    D             
Sbjct: 363 IFPVVVVALRSPDILQIFLISDLVSAAVVPCLVIGLSERFYWYRGFDFVVGGLGGIFTIF 422

Query: 362 XXXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 420
               ++Y  +A    +L+ L  GLY  D+S  GAF+ AP+  + + F +  +R+  +W  
Sbjct: 423 LFGLVYYDGDATLASKLLLLEGGLYANDWSAFGAFVAAPVGGLLWAFGACALRISFLWAK 482

Query: 421 TKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSS 457
            +I+G  F    +P      +       D   ++++S
Sbjct: 483 ARIQGRRFDAFDRPIPQSFDRPGAFDNHDSDAVLENS 519



>gi|336463537|gb|EGO51777.1| hypothetical protein NEUTE1DRAFT_125428 [Neurospora tetrasperma
           FGSC 2508]
          Length = 564

 Score =  242 bits (617), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 167/551 (30%), Positives = 265/551 (48%), Gaps = 101/551 (18%)

Query: 4   SGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASS----- 57
           S   SN +IY  L +FL +G    +  + ++K D+L+   TQ A+ L  N+ AS      
Sbjct: 5   SSEASNAIIYTTLGVFLIMGTGVAWTMRNQSKGDFLAGNRTQTAIPLALNFIASGDNGIS 64

Query: 58  -----------------------IGSSILYSFPEVGTIAG-------------------L 75
                                  +GS IL+++PE+ T+AG                   L
Sbjct: 65  EDREDEQGGDLATCWTTKLRLYPLGSGILFTYPEIATLAGLQGVLVYALASALPLFVFAL 124

Query: 76  LGVII----------------------------------------ELSAVGNILVTLTGV 95
           LG II                                        ELS +G ++  LTG+
Sbjct: 125 LGPIIRRKCPEGFVLTEWTRQRYGTIAALYLSFVTLVTLFLYMVAELSGIGQVVEVLTGL 184

Query: 96  DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN 155
           + L  +I   ++TT+YT  GG R S ITDNIQG                  +I+ S+I+ 
Sbjct: 185 NGLPVLIVECVITTIYTSLGGFRISFITDNIQGAMVIGLLVVASIAIGVETKIDTSLIEP 244

Query: 156 SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLV 215
           S LLK + LGWQLLYI+PVA+     F   FW R F+SK DR+L +     ++ +  ++ 
Sbjct: 245 SGLLKDSLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDRDLWIGITLAALFILIIIT 304

Query: 216 FLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL 272
            +G TG+IA W+G+WPG   E  L   +AFF L + LP WV G  +V++V++S AA+D+L
Sbjct: 305 MIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGLLENLPAWVVGFVLVMSVTLSTAAFDSL 364

Query: 273 ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPP 332
            SA  ++ SND+F N+L +   R   ++  +P V   +K   +L+++LI+DL++A+T+P 
Sbjct: 365 QSAMVSSASNDLFRNKLSVWWIRVAVVLIIIPIVVLAIKAPSILQIYLISDLVSAATIPV 424

Query: 333 ILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVL 392
           +++GL D  Y+    +                +I+Y++A  G +LI L  G+Y   ++  
Sbjct: 425 LIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYNDAYKGAQLILLEDGIYQEGWAAF 484

Query: 393 GAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTE 452
           GAF+ AP+  + + F +  +RL   WV  K +G  F    +P VV++          D+E
Sbjct: 485 GAFVAAPVGGLLWGFGALALRLTVQWVQAKRKGVRFDALDRPVVVES----------DSE 534

Query: 453 IIQSSDPDEIE 463
            IQ     ++E
Sbjct: 535 AIQYVAGGDLE 545



>gi|402086111|gb|EJT81009.1| urea transporter [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 533

 Score =  241 bits (616), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 156/493 (31%), Positives = 254/493 (51%), Gaps = 63/493 (12%)

Query: 4   SGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           S   S+ ++Y     FL +G    ++ + ++KSD+L+   TQ A+ L  N+ AS++GS I
Sbjct: 5   SSEASHAIVYATYGAFLVLGTGIAWRMRNQSKSDFLNGNRTQTALPLALNFIASAMGSGI 64

Query: 63  LYSF-------------------------------------PE-----------VGTIAG 74
           L+++                                     PE            G +A 
Sbjct: 65  LFAYPQLATIAGIQGVVVYALSSALPLLIFAALGPAIRRRCPEGFVLTEWTRQRYGAVAA 124

Query: 75  L-----------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 123
           L           L ++ ELSA+  ++ TL+ +D L  VI    +TT+YT  GG + S +T
Sbjct: 125 LYLGFMTLLTLFLYMVAELSAISQVVTTLSNLDGLPVVIVQCAITTIYTSMGGFKISFLT 184

Query: 124 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 183
           DN+QG                  RI+ ++I++S LL+   LGWQL+YI+PVA+     F 
Sbjct: 185 DNVQGAMVLGLIIIATITIGVETRIDPALIESSGLLQPTLLGWQLVYILPVAILTNDFFL 244

Query: 184 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 243
             FW R F+SK DR+L +     S     +L  +G TG++AVW+G WPG +N +  +AFF
Sbjct: 245 SSFWLRTFASKTDRDLWIGVGMASAATLCILTLVGTTGLVAVWSGAWPGPDNADGSVAFF 304

Query: 244 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 303
           TL ++LP+WV GI +V+AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +
Sbjct: 305 TLLQLLPNWVVGIVLVMAVTLSTAAFDSLQSAMVSSASNDLFRNRLGIWYIRAAVVLVII 364

Query: 304 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXX 361
           P +   L+   +L+++LI+D+++A+T+P ++LGL D  YF  W   D             
Sbjct: 365 PVIVIALRAPSILQIYLISDMVSAATIPVLVLGLSDR-YFYWWRGFDVVCGGLGGILSVF 423

Query: 362 XXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFT 421
              + +Y + + G  LI L  GLY  D+ V GAF+ AP+  + F F++  +R+  ++   
Sbjct: 424 IFGTAYYGDVEAGGRLILLEQGLYTGDWGVFGAFVAAPVGGMVFGFIAMLLRVGFLFAQA 483

Query: 422 KIRGEEFVFPKKP 434
           K  G +F   ++P
Sbjct: 484 KATGGQFTAFERP 496



>gi|71017739|ref|XP_759100.1| hypothetical protein UM02953.1 [Ustilago maydis 521]
 gi|46098892|gb|EAK84125.1| hypothetical protein UM02953.1 [Ustilago maydis 521]
          Length = 503

 Score =  241 bits (616), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 146/369 (39%), Positives = 222/369 (60%), Gaps = 10/369 (2%)

Query: 69  VGTIAGLLGV-------IIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 121
           VG ++GL+ V       ++EL+  G+ +  L GV+     + IAI+TT+YT YGG +ASL
Sbjct: 66  VGVLSGLIFVGFMFCFMLVELNTYGSAVNLLGGVNPTIAALVIAIITTIYTTYGGFKASL 125

Query: 122 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATL 181
            TDN+                   + I+ + +++S LLK   LG +L YI+P A+ F+ +
Sbjct: 126 YTDNVNAIIILIFIVIASIAVGVKLDIDHARVESSGLLKPQRLGGELWYILPAALIFSQM 185

Query: 182 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLESY 239
           F++GFWQRAF+SK+++ L +S +  +I LF V + +G+ G +A W+GL+  P  E+ +  
Sbjct: 186 FNQGFWQRAFASKDNKTLYISVICATIPLFAVCMLVGMAGPLAWWSGLFNGPTAED-DGS 244

Query: 240 LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 299
           L FF +   LP+W++GI +VL   +S +AYDT  SA  +   ND+F  R+ +   R + +
Sbjct: 245 LNFFYILGTLPNWLTGIVIVLCGCLSSSAYDTFQSAQISTIQNDVFLGRVNIWWCRAILI 304

Query: 300 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXX 359
           + N+P+V   +K++D+L VFLIADL A + +P  LLGL+  LYFLN +D           
Sbjct: 305 LINIPSVVLAVKNIDILEVFLIADLAAIACIPAFLLGLVPRLYFLNGVDAVGGAVGGFLT 364

Query: 360 XXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 419
                +IF+ +A  GI LIGLP GLYI DYSVLGAFI APL S+ +TF++  +R    WV
Sbjct: 365 VFLFGTIFFGSASQGIALIGLPNGLYIDDYSVLGAFIAAPLGSLGWTFVTCAIRAAVTWV 424

Query: 420 FTKIRGEEF 428
           + K  G +F
Sbjct: 425 WCKKTGRKF 433



>gi|406868486|gb|EKD21523.1| urea transporter [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 552

 Score =  241 bits (615), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 139/401 (34%), Positives = 222/401 (55%), Gaps = 3/401 (0%)

Query: 60  SSILYSFPEVGTIAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRA 119
           ++I  SF  + T+   L ++ ELSA+  I+  LTG+D L  VI    VTT+YT  GG + 
Sbjct: 141 TAIYLSFMTMATM--FLYMVAELSALQQIMTALTGMDGLPMVIVQCAVTTIYTSVGGFKI 198

Query: 120 SLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFA 179
           S ITDNIQ                   +I+KS+ DNS LL+ + LGWQLLYI+PV++   
Sbjct: 199 SFITDNIQATMVISLIIIATITIGVQTKIDKSLRDNSVLLEPSKLGWQLLYILPVSIITN 258

Query: 180 TLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW-PGEENLES 238
             F   FW RAF++K DR+L       ++++  +L  +G+TG+IA W+G + P   + + 
Sbjct: 259 VFFLSSFWIRAFAAKTDRDLWTGVTIATLVVLIILTLVGVTGLIATWSGAYDPTNPDQDG 318

Query: 239 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 298
            +AFF L + LP W  G+ +V+ +SMS AA+D++ SA  +  SND+F N+L +   R   
Sbjct: 319 SIAFFLLLESLPTWTIGLILVIVISMSTAAFDSIQSAMVSTASNDLFRNKLNIWFIRASV 378

Query: 299 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXX 358
           ++   P V   LK   VLR++LI++L++ ST+P ++LGL+D  Y+    +          
Sbjct: 379 VLLIFPVVVIALKSPSVLRIYLISNLVSTSTIPVLVLGLMDRFYWWRGFEVVVGGLGGLL 438

Query: 359 XXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 418
                 +I++ +A+ G  L+ +  GL+  D+SV GAF+ AP+ SI + F +  VRL   +
Sbjct: 439 SVFVFGTIYFGDAEQGANLLIIDSGLFANDWSVFGAFVAAPVGSILWGFGALAVRLGYRF 498

Query: 419 VFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDP 459
           V  K++G  F    +P  +  +      + DD + + S  P
Sbjct: 499 VEAKVKGHRFDALDRPAYMQERAEGVTDYVDDHDEVHSDAP 539



>gi|241955795|ref|XP_002420618.1| urea transporter, putative; urea/polyamine transporter, putative
           [Candida dubliniensis CD36]
 gi|223643960|emb|CAX41700.1| urea transporter, putative [Candida dubliniensis CD36]
          Length = 523

 Score =  241 bits (615), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 163/523 (31%), Positives = 261/523 (49%), Gaps = 67/523 (12%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N +IY+  A  L  G++  +K + NK D+LSS GTQ  + L  N+ AS++G  I
Sbjct: 4   LSSQGNNAIIYLSYAFMLATGLFLAWKFSSNK-DFLSSNGTQRGIPLALNFIASAMGVGI 62

Query: 63  LYSFPEVG-----------TIAG--------LLGVII----------------------- 80
           + ++ ++            TI G        L+G II                       
Sbjct: 63  ITTYAQIANIAGLHGLLVYTICGAIPIVGFALVGPIIRRKCPDGFILTEWVRHRFGMVTA 122

Query: 81  -----------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 123
                            ELSA+ + + TLTG++ L  VI   +VTT+YT +GG R S IT
Sbjct: 123 LYLSAFTCLTMFLFMVGELSALRSAVETLTGLNALGAVIVECVVTTIYTFFGGFRVSFIT 182

Query: 124 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 183
           DN QG               + I I+ S I  S LLK+N LGWQL+YI+ VA+     F 
Sbjct: 183 DNFQGVCVLLLLIICAAGMGSYIEIDTSKIGPSGLLKANKLGWQLIYILFVAIVTNDCFM 242

Query: 184 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAF 242
            GFW R F+SK D++L +     + + F +   +G TG +AVW+G L  G+EN   Y AF
Sbjct: 243 SGFWLRTFASKTDKDLWIGTSIAAFVTFAICTLIGTTGFLAVWSGDLTVGDEN--GYDAF 300

Query: 243 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 302
           F L   +P W+    ++  + +S   +D+L SA  +  SND+F N+L +N  R + ++  
Sbjct: 301 FILLSKMPRWLVAFVLIFCIVLSTCTFDSLQSAMVSTISNDVFRNKLHINYVRIMLVLIM 360

Query: 303 VPAVYWGLKDL-DVLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXX 360
           VP V   +K   ++L+++LIADL++A+ +P + LGL DS  ++L   D            
Sbjct: 361 VPIVVLAVKVANNILQIYLIADLVSAAIIPSVFLGLADSWFWYLRGFDVMAGGLGALVGV 420

Query: 361 XXXXSIFYHNAKDGIELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 419
               +++YH+A++G +L+ +  GLY  +D+   GAF++AP+  +  T  S  +R+  ++ 
Sbjct: 421 FIFGTVYYHSAREGGKLLLIWNGLYDPSDWGAFGAFVIAPVGGVVITLASAALRIAVLYA 480

Query: 420 FTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEI 462
           ++K+ G EF    KP  V+       K+    +    SD  ++
Sbjct: 481 YSKVTGGEFTALDKPIAVEVDN-EDQKYGSIDDDDDESDTKKV 522



>gi|451852092|gb|EMD65387.1| hypothetical protein COCSADRAFT_35445 [Bipolaris sorokiniana
           ND90Pr]
          Length = 530

 Score =  241 bits (614), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 154/494 (31%), Positives = 247/494 (50%), Gaps = 61/494 (12%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           M S   SN +IY+ L  FL +G +  ++ + ++K+++LSS  TQ  + L  N+ AS++GS
Sbjct: 3   MPSQPASNAIIYLTLGAFLVLGCFIAWRLRHQSKTEWLSSNRTQKGIPLAFNFIASALGS 62

Query: 61  SILYSFPEVGTIA-------------------GLLGVII--------------------- 80
            IL+++P++ TIA                   G LG II                     
Sbjct: 63  GILFTYPQIATIAGIQGLLIYALSSSLPLLVFGALGPIIRRKCPEGFVLTEWTRQRYGAV 122

Query: 81  -------------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 121
                              ELSA+  I+  LTG++ L  VI    +TT+YT  GG + S 
Sbjct: 123 AGIFLSLCTLITMFLYMVAELSALQQIVTLLTGLNGLPVVIVECAITTIYTSLGGFKVSF 182

Query: 122 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATL 181
           +TDNIQG                   I++S+ID S  LK + LGWQL+YI+PVA+     
Sbjct: 183 VTDNIQGAMVIGLIILGVIAVGVETDIDRSLIDQSGYLKPSLLGWQLIYILPVAILTNDF 242

Query: 182 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLA 241
           F  GFW R F+S+ D++L +     S+ +  +L  LG+ GM+A W+G +   +     LA
Sbjct: 243 FLSGFWMRTFASRTDKDLWIGVSLASMGILIILTLLGVGGMLAAWSGAYTIGDEANGSLA 302

Query: 242 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIA 301
           FF L + LP WV G+ +V+ +S+S AA+D+  SA  +  SND F N+L + V R   +  
Sbjct: 303 FFLLLEKLPAWVVGVVLVMTISLSTAAFDSFQSAMISTGSNDFFRNKLNIWVIRAFVVAL 362

Query: 302 NVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXX 361
             P V   L+  D+L++FLI+DL++A+ +P +++GL +  Y+    D             
Sbjct: 363 IFPVVVVALRSPDILQIFLISDLVSAAVVPCLVIGLSERFYWYRGFDFVVGGLGGIFTIF 422

Query: 362 XXXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 420
               ++Y  +A    +L+ L  GLY  D+S  GAF+ AP+  + + F +  +R+  +W  
Sbjct: 423 LFGLVYYDGDATLASKLLLLEGGLYANDWSAFGAFVAAPVGGLLWAFGACALRISFLWAK 482

Query: 421 TKIRGEEFVFPKKP 434
            +++G  F    +P
Sbjct: 483 ARVQGRRFDAFDRP 496



>gi|258573539|ref|XP_002540951.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237901217|gb|EEP75618.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 463

 Score =  241 bits (614), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 150/397 (37%), Positives = 222/397 (55%), Gaps = 9/397 (2%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDNIQG         
Sbjct: 60  MVAELSALQQIVNALTGLNGLPAVIVQVVVTTIYTSLGGFKVSFMTDNIQGAMVVGLIII 119

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T  +I +S+ID+S LL+ + LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 120 GVITVGTKTQINRSLIDSSGLLEPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 179

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     S  +  +LV +G TG++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 180 DLRIGVSIASFTVLCILVLVGSTGLLAAWSGAWPGDPPQSGSIAFFLLLEKLPGWVVGIV 239

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ V++S AA+D+L SA  +  SND+F N+L L   R   ++  VP V   LK   VL+
Sbjct: 240 LVMTVALSTAAFDSLQSAMVSTASNDLFRNKLSLIYIRIGVVLCIVPVVVVALKSPSVLQ 299

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++AS +P +++ L D  YF    +                +I+Y +A +G  L
Sbjct: 300 IFLISDLVSASAIPVLVISLWDKCYFWKGSEVIAGGLGGILSIFIFGTIYYGSAYEGGRL 359

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP--- 434
           I L  GLY  D+SV GAF+ AP+    F  ++F +R+   +V +K+RGE F    KP   
Sbjct: 360 ILLENGLYADDWSVFGAFVAAPVGGFIFALIAFALRIAYQFVVSKVRGEHFDAFDKPIKP 419

Query: 435 -----EVVDTKKYAGNKFKDDTEIIQSSDPDEIEIRG 466
                +V D  +  GN  +D+ +  Q+  P     RG
Sbjct: 420 VRTTSQVDDPIRPVGNA-RDEEDGKQNDSPAVEADRG 455



>gi|302505048|ref|XP_003014745.1| hypothetical protein ARB_07307 [Arthroderma benhamiae CBS 112371]
 gi|291178051|gb|EFE33842.1| hypothetical protein ARB_07307 [Arthroderma benhamiae CBS 112371]
          Length = 497

 Score =  240 bits (613), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 153/428 (35%), Positives = 230/428 (53%), Gaps = 23/428 (5%)

Query: 58  IGSSILYSFPEV-----------GTIAGL-----------LGVIIELSAVGNILVTLTGV 95
           +G  I   FPEV           G +AG+           L ++ ELSA+  I+  L+G+
Sbjct: 58  VGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLSILTLITLFLYMVAELSALQQIVTALSGL 117

Query: 96  DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN 155
           + L  VI   +VTT+YT  GG + S +TDN+QG                   I+KS+ID+
Sbjct: 118 NGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQGAMVVGLIIIAVITVGARTDIDKSLIDS 177

Query: 156 SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLV 215
           S LLK   LGWQL+YI+PVA+     F    W R F+SK DR+LR+     S ++  +LV
Sbjct: 178 SGLLKPTLLGWQLIYILPVAILTNDFFLSNLWLRTFASKTDRDLRIGISIASFVVLCILV 237

Query: 216 FLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISA 275
            +G TG++A W+G+WPG+      +AFF L + LP+WV GI +V+ V++S AA+D+L SA
Sbjct: 238 LVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLEKLPNWVVGIVLVMTVALSTAAFDSLQSA 297

Query: 276 TTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILL 335
             +  SND+F N+LPL   R   ++  VP V   L+   VLR+FLI+DL++AS +P ++L
Sbjct: 298 MVSTASNDVFRNKLPLIYVRIGVVLCIVPVVVVALRSPSVLRIFLISDLVSASAIPVLVL 357

Query: 336 GLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAF 395
           GL D +Y+    +                +I+Y NA +G +LI L  GLY  D+S  GAF
Sbjct: 358 GLSDRMYWWTAFEVIVGGLGGILSVFIFGTIYYGNATEGGKLILLQNGLYANDWSAFGAF 417

Query: 396 IVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQ 455
           + AP+  + F  ++ G+R+   +V +K  G  F    +P +  +   AG    D  + I 
Sbjct: 418 VAAPIGGLIFACIALGLRVGYAFVLSKTTGRHFDVFDRP-LPRSHMAAGPMHLDQPDFIA 476

Query: 456 SSDPDEIE 463
           +     I 
Sbjct: 477 TGTDATIR 484



>gi|389637038|ref|XP_003716160.1| urea transporter [Magnaporthe oryzae 70-15]
 gi|351641979|gb|EHA49841.1| urea transporter [Magnaporthe oryzae 70-15]
          Length = 511

 Score =  239 bits (611), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 138/388 (35%), Positives = 215/388 (55%), Gaps = 3/388 (0%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+G ++ TLT ++ L  +I   IVTT YT  GG + S +TDN+QG         
Sbjct: 113 MVAELSAIGQVISTLTTMNPLPVMIVQCIVTTAYTSMGGFKISFLTDNVQGAMVLGLILI 172

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                    RI+ ++ID+S L K   LGWQLLYI+PVA+     F   FW R F+SK D+
Sbjct: 173 ATIAIGVETRIDLALIDSSGLTKPTLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDK 232

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +L +     +  +  +L  +G+TG++AVW+G WPG +N +  +AFF L + LP+WV G+ 
Sbjct: 233 DLWIGISLATGAILCILTLVGVTGLVAVWSGAWPGPDNADGSVAFFMLLQQLPNWVVGMV 292

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +++AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +   L+   +L+
Sbjct: 293 LLMAVTLSTAAFDSLQSAMVSSASNDLFRNRLGVWPIRAAVVLVMIPVIVIALRAPSILQ 352

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXXXXXSIFYHNAKDGI 375
           ++LI+DL++AST+P ++LGL D  YF  W   D                + +Y +A+ G 
Sbjct: 353 IYLISDLVSASTIPVLVLGLSDH-YFYWWRGFDVVCGGLGGILSVFIFGTAYYGSAQAGG 411

Query: 376 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
           ELI L  GLY  D+ V GAF+ AP   + F FL+   R+  ++V  K+ G  F    +P 
Sbjct: 412 ELILLQQGLYTGDWGVFGAFVAAPAGGLIFAFLAMLGRVGFLFVRAKMIGAPFTAFDRPM 471

Query: 436 VVDTKKYAGNKFKDDTEIIQSSDPDEIE 463
                        +D E+ +     E E
Sbjct: 472 AEVALPARAEPEYEDGELREEDSITEQE 499



>gi|440469250|gb|ELQ38367.1| urea transport protein [Magnaporthe oryzae Y34]
 gi|440486720|gb|ELQ66559.1| urea transport protein [Magnaporthe oryzae P131]
          Length = 537

 Score =  239 bits (610), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 138/388 (35%), Positives = 215/388 (55%), Gaps = 3/388 (0%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+G ++ TLT ++ L  +I   IVTT YT  GG + S +TDN+QG         
Sbjct: 139 MVAELSAIGQVISTLTTMNPLPVMIVQCIVTTAYTSMGGFKISFLTDNVQGAMVLGLILI 198

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                    RI+ ++ID+S L K   LGWQLLYI+PVA+     F   FW R F+SK D+
Sbjct: 199 ATIAIGVETRIDLALIDSSGLTKPTLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDK 258

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +L +     +  +  +L  +G+TG++AVW+G WPG +N +  +AFF L + LP+WV G+ 
Sbjct: 259 DLWIGISLATGAILCILTLVGVTGLVAVWSGAWPGPDNADGSVAFFMLLQQLPNWVVGMV 318

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +++AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +   L+   +L+
Sbjct: 319 LLMAVTLSTAAFDSLQSAMVSSASNDLFRNRLGVWPIRAAVVLVMIPVIVIALRAPSILQ 378

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXXXXXSIFYHNAKDGI 375
           ++LI+DL++AST+P ++LGL D  YF  W   D                + +Y +A+ G 
Sbjct: 379 IYLISDLVSASTIPVLVLGLSDH-YFYWWRGFDVVCGGLGGILSVFIFGTAYYGSAQAGG 437

Query: 376 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
           ELI L  GLY  D+ V GAF+ AP   + F FL+   R+  ++V  K+ G  F    +P 
Sbjct: 438 ELILLQQGLYTGDWGVFGAFVAAPAGGLIFAFLAMLGRVGFLFVRAKMIGAPFTAFDRPM 497

Query: 436 VVDTKKYAGNKFKDDTEIIQSSDPDEIE 463
                        +D E+ +     E E
Sbjct: 498 AEVALPARAEPEYEDGELREEDSITEQE 525



>gi|296414011|ref|XP_002836698.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630533|emb|CAZ80889.1| unnamed protein product [Tuber melanosporum]
          Length = 541

 Score =  238 bits (607), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 212/377 (56%), Gaps = 7/377 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELS++  ++ TLTG++ L  VI   +VT++YT  GG R S +TDNIQG         
Sbjct: 159 MVAELSSLQQVISTLTGLNGLPVVIVEVVVTSIYTSLGGFRISFLTDNIQGVLIAVLIAI 218

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 TS+ I++S I  S L     LG+QL+YI+   + F+ +F   FW RAF+SK D+
Sbjct: 219 CTIAIGTSVEIDRSRIGPSGLTHDTLLGYQLIYILFTGILFSFMFLSSFWMRAFASKTDK 278

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +L +     ++++F +L+ +  TG IA WAG+W  E  +   +AFF L   LP WV G T
Sbjct: 279 DLWIGVSIAAVVIFVILLLVSSTGFIAAWAGVW--EPGMYGGMAFFLLLAELPSWVVGFT 336

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           VV+ V++SCA +D+  SA  +  SND+F N+L L   RF  L+ ++PA+   LK   +LR
Sbjct: 337 VVMVVALSCAIFDSQQSAMVSTISNDLFKNKLSLIWVRFFVLLVSIPAIVVALKSPSILR 396

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+++ + + MP ILLGL+D++YFL  +D                  +Y +AK   EL
Sbjct: 397 IFLISNIFSCAAMPSILLGLLDTMYFLRGVDIIIAGVGGMLSVFLFGCAYYGDAKKAAEL 456

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF-----VFPK 432
           I L  GLY  D+SV G F+ AP+ S+ F  L+   R+  +WV  K++G  F       P+
Sbjct: 457 IILTTGLYANDWSVFGVFVAAPVGSLIFLALAVACRMGGVWVRCKVQGGRFDCLDKPLPR 516

Query: 433 KPEVVDTKKYAGNKFKD 449
           +  V +     G   +D
Sbjct: 517 EGGVCEGDGTPGGSLED 533



>gi|505755900|gb|EOR00094.1| putative urea active transporter 1 [Wallemia ichthyophaga EXF-994]
          Length = 560

 Score =  238 bits (606), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 161/513 (31%), Positives = 265/513 (51%), Gaps = 74/513 (14%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI----- 62
           S  +IYV L +FL IG+   +  TK K+D+L++  T N+  +  N+ A  +G+ +     
Sbjct: 9   SMAIIYVTLGVFLIIGLVISFFVTKTKTDFLAAAKTANSGVIMCNFAAQGLGAGLQLTYP 68

Query: 63  --------------------LYSFPEV----------------------GTIAGL----- 75
                               L +FP +                      G  AGL     
Sbjct: 69  EIATYGLQPLITYSLAASLPLLTFPPLASQLRKKCPEGFILTEFIRARFGVPAGLFLSTF 128

Query: 76  ------LGVIIELSAVGNILVTLTG-------VDKLAPVICIAIVTTLYTGYGGLRASLI 122
                 + ++ E++++ +++ +LTG       V  + P++   +VT +YT +GG + SL+
Sbjct: 129 TIITLYVFMLSEMTSIHSVIQSLTGWSSETQNVWLIMPIVVEMLVTMMYTAWGGFKVSLV 188

Query: 123 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN-SDLLKSNSLGWQLLYIMPVAVSFATL 181
           TD IQ               A ++ I+  +I   SDLLK + LGWQLLYI+PVAV F   
Sbjct: 189 TDTIQASFFIILVVVCTIAVAVNVEIDTDLIHQRSDLLKDSQLGWQLLYILPVAVVFNNY 248

Query: 182 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE---- 237
           F   +WQR +++K+ ++L +  +  + ++F +   +G +G+IA W+ ++PG  N+     
Sbjct: 249 FLSSYWQRCYAAKSQKDLTIGCILAACLIFCLTFLVGFSGLIASWSNVYPGPNNVNEDSS 308

Query: 238 SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFL 297
           S + F  + +  P W++G+ +VL+V++SCAAYDTL +A  A  SNDIF N++ +  TR +
Sbjct: 309 STVLFLLVNRFCPAWINGLMMVLSVALSCAAYDTLQTALVATVSNDIFRNKINVWWTRLI 368

Query: 298 SLI-ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXX 356
            ++ A V       K  DVL ++LIADL++A+ MP +LLG  D LYFLN  D        
Sbjct: 369 LIVNAAVIGPVASNKVNDVLILYLIADLVSAAIMPAMLLGFTDRLYFLNGFDVIIGGLGG 428

Query: 357 XXXXXXXXSIFYH-NAKDGIELIGLPLGLYIT--DYSVLGAFIVAPLSSIFFTFLSFGVR 413
                    ++Y+ +A     L+ +  GLY +   +  LG FI AP+ SI +T  +FGVR
Sbjct: 429 ILTVFLFGLVYYNGDASSAGALLIINEGLYPSYNSFEALGTFIAAPVGSILWTIAAFGVR 488

Query: 414 LISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNK 446
           ++ M++ +KI G EF   +KP+ +D    AGN+
Sbjct: 489 VLYMYIRSKITGAEFSVFEKPKPLDPAVVAGNE 521



>gi|296804300|ref|XP_002843002.1| urea transport protein [Arthroderma otae CBS 113480]
 gi|238845604|gb|EEQ35266.1| urea transport protein [Arthroderma otae CBS 113480]
          Length = 513

 Score =  237 bits (605), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 144/380 (37%), Positives = 206/380 (54%), Gaps = 36/380 (9%)

Query: 56  SSIGSSILYSFPEVGTIAGLLGVII----------------------------------- 80
           S++GS IL+++PE+ TIAG+ G+++                                   
Sbjct: 134 STLGSGILFTYPEIATIAGVQGLVVYGLSSALPLLAFAFVGPIIRRKFPEVLITLFLYMV 193

Query: 81  -ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX 139
            ELSA+  I+  LTG+D L  VI   +VTT+YT  GG + S +TDNIQG           
Sbjct: 194 AELSALQQIVTALTGLDGLPAVIVQVVVTTIYTSLGGFQVSFLTDNIQGGMVVGLIIIAV 253

Query: 140 XXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 199
                   I+KS+ID+S LLK   LGWQL+YI+PVA+     F   FW R F+SK DR+L
Sbjct: 254 ITVGARTNIDKSLIDSSGLLKPTLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDRDL 313

Query: 200 RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVV 259
           R+     S  +  +LV +G TG++A W+G+WPG+      +AFF L + LP WV GI +V
Sbjct: 314 RIGISIASFAVLCILVLVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLEKLPSWVVGIVLV 373

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 319
           + VS+S AA+D+L SA  +  SNDIF N+LPL   R   ++  +P V   L+   VL++F
Sbjct: 374 MTVSLSTAAFDSLQSAMVSTASNDIFQNKLPLIYVRIGVVLCIIPVVVVALRSPSVLQIF 433

Query: 320 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 379
           LI+DL++AS +P ++LGL D LY+    +                +I+Y NA +G +LI 
Sbjct: 434 LISDLVSASAIPVLVLGLSDKLYWWTAFEVIIGGLGGILSVFIFGTIYYGNATEGGKLIL 493

Query: 380 LPLGLYITDYSVLGAFIVAP 399
           L  GLY  D+S  G     P
Sbjct: 494 LQNGLYANDWSAFGIITPTP 513



>gi|345566015|gb|EGX48962.1| hypothetical protein AOL_s00079g183 [Arthrobotrys oligospora ATCC
           24927]
          Length = 532

 Score =  237 bits (604), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 140/361 (38%), Positives = 213/361 (59%), Gaps = 6/361 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSAV +++  LTG++ L  +I   +VTT+YT  GG R S +TDNIQG         
Sbjct: 139 MVAELSAVNSVINLLTGLNGLPALIVEVVVTTIYTSLGGFRVSFVTDNIQGALVLCLIII 198

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T   I+ S+I+ S L ++  LGW+LLYI+PVA+S   +F   FW R+F+S+ D+
Sbjct: 199 CTISIGTKSHIDTSLIEPSGLTRATLLGWKLLYILPVAISTNFMFLSPFWMRSFASRTDK 258

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG---LWPGEENLESYLAFFTLFKVLPDWVS 254
           +L + +    + +F +L   G TG+IAVWA     W G  +  S +AFF L   LP WV 
Sbjct: 259 DLYIGSAIAGVWIFVILTVTGFTGIIAVWAHGVDKW-GPVSEWSSVAFFYLIAELPAWVV 317

Query: 255 GITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLK-DL 313
           G+ +++ V++S A +D+L SA  +  SND+F N+LPL   R    I  +P +   +K D 
Sbjct: 318 GLVLLMVVALSTAIFDSLQSALISTASNDLFRNKLPLTYIRVGVAILTIPVIVVAIKADA 377

Query: 314 DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKD 373
            VL++FLI+D+++A+ +P +LLGL+DSLYFL+ +D                +I+Y +AK 
Sbjct: 378 SVLQIFLISDIVSAAAIPALLLGLVDSLYFLSGLDVIIAGCGGILSVFIFGTIYYGSAKA 437

Query: 374 GIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 433
           G ELI +   LY+ D+ V GA++ AP+  + F F S  +RL  +WVF K++G  F    K
Sbjct: 438 GGELIAMKT-LYVDDWGVFGAYVAAPVGGLLFLFGSCAIRLAGLWVFAKVKGRRFDGLDK 496

Query: 434 P 434
           P
Sbjct: 497 P 497



>gi|378730007|gb|EHY56466.1| hypothetical protein HMPREF1120_04548 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 541

 Score =  236 bits (603), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 162/502 (32%), Positives = 242/502 (48%), Gaps = 62/502 (12%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IY   A FL  G+   +  + + K +YL+SL TQ  + L  N+ AS++GS IL+++
Sbjct: 9   SNAIIYTTYAGFLIFGLAVAWTLRHQTKGEYLASLRTQKGIPLALNFIASALGSGILFTY 68

Query: 67  PEV------------------------------------------------GTIAGL--- 75
           PE+                                                GTI GL   
Sbjct: 69  PEIATIAGVQGLVVYSLASALPLLVFAYLGPIIRKKCPEGFVLTEWTRQRYGTITGLYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSA+  I+  LTG++ L  VI    VTT+YT  GG R S ITDNIQ
Sbjct: 129 ALTLITIFLYMVAELSALQQIVNALTGLNGLPAVIVECAVTTIYTSLGGFRVSFITDNIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I + +ID S  L ++ LGWQL+YI+ VA+     F  GFW
Sbjct: 189 GGMVVALIIIACITVGVKTDINRDLIDRSGYLDASLLGWQLIYILSVAIITNDFFISGFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R F++K D++L + A   +  +  +L  +G+TG++A WAG+  G+   ES +AFF L  
Sbjct: 249 MRTFAAKTDKDLWIGAGVATGAVAVILTLVGVTGLLAGWAGIL-GDPPEESSIAFFLLLG 307

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP WV GI +V+ + +S AA+D+L SA  +  SND+F N+L     R   +I   P V 
Sbjct: 308 QLPAWVVGIVLVMTICLSTAAFDSLQSAMVSTGSNDLFRNKLNFWFIRAAVVIIIFPVVV 367

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             LK   VL+++LI+DL++AS++P +L+GL D  Y     +                 ++
Sbjct: 368 VALKSPSVLQIYLISDLISASSIPCLLIGLSDRFYVWRGFEVVVGGLGGIVTVFLFGLVY 427

Query: 368 YHNAKDGI-ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 426
           YH  +     LI L  GLY  D+S  GAF+ AP+    ++  +F +R+   W   K +G 
Sbjct: 428 YHGDRQAAGNLILLEQGLYGNDWSAFGAFVAAPVGGFLWSLGAFALRIAIQWSMAKYKGT 487

Query: 427 EFVFPKKPEVVDTKKYAGNKFK 448
            F    KP       Y G++ +
Sbjct: 488 RFDAFDKPAAPSAAFYTGDQIR 509



>gi|320590557|gb|EFX03000.1| urea transport protein [Grosmannia clavigera kw1407]
          Length = 493

 Score =  236 bits (603), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 144/409 (35%), Positives = 215/409 (52%), Gaps = 16/409 (3%)

Query: 58  IGSSILYSFPEVGTIAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGL 117
           I ++I   F  + T+   L ++ ELSA+G ++  LTG+D L  VI   IVTT+YT  GG 
Sbjct: 75  IPATIFLGFVTLATL--FLYMMAELSAIGQVVTALTGLDGLPAVIVECIVTTIYTAIGGF 132

Query: 118 RASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVS 177
             S +TDNIQG                   I++S I  S LLK N LGWQLLYI+PVA+ 
Sbjct: 133 HISFVTDNIQGAMVLGLIVIATIAIGAETHIDRSTIAESGLLKGNLLGWQLLYILPVAIL 192

Query: 178 FATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGE---- 233
               F   FW R F+S+ DR+L +     +  +  +   +G TG++AVW+G WPG     
Sbjct: 193 TNDFFLSNFWLRTFASRTDRDLWIGISIAAAAILVIATLVGCTGLVAVWSGAWPGAGQDA 252

Query: 234 ENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV 293
            + +S  AFF L ++LP+WV G  +V+++S+S A++D+L SA  ++ SNDIF NRL    
Sbjct: 253 SDADSSTAFFNLLQLLPNWVVGFVLVMSISLSTASFDSLQSAMVSSASNDIFRNRLSSIY 312

Query: 294 TRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXX 353
            R    I  VP V   L+   VL+++LI+DL++A+ +P +++GL D     N  D     
Sbjct: 313 IRIAVAIVIVPTVVLALRTPSVLQIYLISDLVSAAIIPVLVVGLSDRCSAWNGTDVVVGG 372

Query: 354 XXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 413
                      +I+Y +A  G +L+ L  GLY  D+   GAF+ AP+  + F   SF +R
Sbjct: 373 LGGLLAVFAFGAIYYQDAYSGAKLLLLEQGLYEGDWGAFGAFVAAPIGGVLFGLASFLLR 432

Query: 414 LISMWVFTKIRGEEF-VFPKKPEVVDTK--------KYAGN-KFKDDTE 452
           +  +++  +  G  F    K  + V T          Y G  +  DD E
Sbjct: 433 MAYLYIRARATGRPFDPVSKGKQAVGTSVVEEPVLDPYVGQPELHDDEE 481



>gi|326481865|gb|EGE05875.1| hypothetical protein TEQG_04886 [Trichophyton equinum CBS 127.97]
          Length = 552

 Score =  236 bits (602), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 151/421 (35%), Positives = 227/421 (53%), Gaps = 23/421 (5%)

Query: 58  IGSSILYSFPEV-----------GTIAGL-----------LGVIIELSAVGNILVTLTGV 95
           +G  I   FPEV           G +AG+           L ++ ELSA+  I+  L+G+
Sbjct: 113 VGPIIRRKFPEVFVLTEWTRQRYGVVAGIYLSILTMITLFLYMVAELSALQQIVTALSGL 172

Query: 96  DKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN 155
           + L  VI   +VTT+YT  GG + S +TDN+QG                   I+KS+ID+
Sbjct: 173 NGLPAVIVQVVVTTIYTSLGGFQVSFLTDNVQGAMVVGLIIIAVITVGARTDIDKSLIDS 232

Query: 156 SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLV 215
           S LLK   LGWQL+YI+PVA+     F    W R F+SK DR+LR+     S ++  +LV
Sbjct: 233 SGLLKPTLLGWQLIYILPVAILTNDFFLSNLWLRTFASKTDRDLRIGISIASFVVLCILV 292

Query: 216 FLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISA 275
            +G TG++A W+G+WPG+      +AFF L + LP+WV GI +V+ V++S AA+D+L SA
Sbjct: 293 LVGSTGLLAAWSGVWPGDPPQAGSIAFFLLLEKLPNWVVGIVLVMTVALSTAAFDSLQSA 352

Query: 276 TTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILL 335
             +  SND F N+LPL   R   ++  VP V   L+   VLR+FLI+DL++AS +P ++L
Sbjct: 353 MVSTASNDAFRNKLPLIYVRIGVVLCIVPVVVVALRSPSVLRIFLISDLVSASAIPVLVL 412

Query: 336 GLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAF 395
           GL D +Y+    +                +I+Y NA +G +LI L  GLY  D+S  GAF
Sbjct: 413 GLSDRMYWWTAFEVIVGGLGGILSVFIFGTIYYGNATEGGKLILLQNGLYANDWSAFGAF 472

Query: 396 IVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQ 455
           + AP+  + F  ++  +R+   +V +K  G  F    +P +  +   AG    D  + I 
Sbjct: 473 VAAPIGGLIFACIALCLRVGYKFVLSKTTGRHFDVFDRP-LTHSHVPAGPMHLDQPDFIA 531

Query: 456 S 456
           +
Sbjct: 532 T 532



>gi|367021828|ref|XP_003660199.1| hypothetical protein MYCTH_2298205 [Myceliophthora thermophila ATCC
           42464]
 gi|347007466|gb|AEO54954.1| hypothetical protein MYCTH_2298205 [Myceliophthora thermophila ATCC
           42464]
          Length = 542

 Score =  234 bits (598), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 140/389 (35%), Positives = 223/389 (57%), Gaps = 10/389 (2%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           +I ELSA+G ++  LTG+D L  +I   ++TT+YT  GG + S  TDNIQG         
Sbjct: 144 MISELSAIGQVVNLLTGIDGLPVLIVECVITTIYTSVGGFKVSFFTDNIQGAMVLGLILI 203

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                    +I+ S+I++S L K++ LGWQLLYI+PVA+     F   FW R FS+K DR
Sbjct: 204 ATITIGVETKIDTSLIESSGLTKASLLGWQLLYILPVAILTNDFFLSNFWLRTFSAKTDR 263

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN--LESYLAFFTLFKVLPDWVSG 255
           +L L      +    ++  +G TG+IA WAG+WPG E+  ++  +AFF L   LP+WV G
Sbjct: 264 DLWLGITGAVVATLVIITLVGSTGLIAAWAGVWPGPEDAPVDGSVAFFALLTQLPNWVVG 323

Query: 256 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 315
           + VV++V++S AA+D+L SA   + SND+F NRL +   R   ++  +P V   ++   +
Sbjct: 324 VVVVMSVTLSTAAFDSLQSAMVTSASNDLFRNRLNIWWIRAGVVLIMIPVVVIAIRAPSI 383

Query: 316 LRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGI 375
           L+++LI+DL++A+T+P +++GL D+ Y+    +                +++Y +A+ G 
Sbjct: 384 LQIYLISDLVSAATIPVLVIGLSDACYWWRGFEVVVGGLGGLFTVFLFGTVYYGDAQLGA 443

Query: 376 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF------V 429
           EL+ L  GLY  D+   GAF+ AP+  + + F + G+RL   +V  ++RG+ F      V
Sbjct: 444 ELMLLEQGLYTADWGAFGAFVAAPVGGLLWGFGALGLRLGIQYVSARLRGQRFDALDRPV 503

Query: 430 FPKKPEVVDTKKYAGNKFKDDTEIIQSSD 458
               P++VD +        D+TEI  SSD
Sbjct: 504 AVSGPQLVDPEAGRDGGTWDNTEI--SSD 530



>gi|500255736|gb|EON99074.1| putative urea transporter protein [Togninia minima UCRPA7]
          Length = 515

 Score =  234 bits (596), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 140/381 (36%), Positives = 213/381 (55%), Gaps = 1/381 (0%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSAVG ++ TLTG+D L  VI   +VTT+YT  GG + S ITDNIQG         
Sbjct: 124 MVAELSAVGQVVTTLTGLDGLPVVIVECVVTTIYTSLGGFQISFITDNIQGALVVGLVII 183

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     I++ +ID+S LLK N LGWQLLYI+P+A+     F   FW R F+SK D+
Sbjct: 184 ATITIGVKTDIDQDLIDSSGLLKGNLLGWQLLYILPIAILTNDFFLSNFWLRTFASKTDK 243

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     + ++  +L  +G+TG++A W+G WPG+   E  +AFF L + LP WV GI 
Sbjct: 244 DLRIGVSIATCVILVILTLVGMTGVLAAWSGAWPGDPPQEGSIAFFLLLEQLPSWVVGIV 303

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ V +S A++D+L SA  ++ SND+F NRL +   R   ++  +P V   LK   +L+
Sbjct: 304 LVMVVCLSTASFDSLQSAMVSSASNDLFRNRLNIWFIRGAVVLIIIPVVVLALKAPSILQ 363

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           ++LI+DL++A+T+P + LGL D LY+    +                +I+Y +A  G +L
Sbjct: 364 IYLISDLVSAATIPVLCLGLSDRLYWWRGFEIVVGGLGGILTVFIFGTIYYGDALTGAQL 423

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 437
           + L  GLY  D+   GAF+ AP+  + + F    +RL    V  K+ G  F    +P  +
Sbjct: 424 MLLEQGLYEGDWGAFGAFVAAPVGGLLWGFGGCALRLAFQLVKAKVTGRRFDALDRPAFL 483

Query: 438 DTKKYAGN-KFKDDTEIIQSS 457
              + AG     DD + +  S
Sbjct: 484 SADEGAGAYGSADDADALYQS 504



>gi|325094525|gb|EGC47835.1| urea transporter [Ajellomyces capsulatus H88]
          Length = 428

 Score =  234 bits (596), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 203/351 (57%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG         
Sbjct: 11  MVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVGLIVI 70

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 71  AVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 130

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     S  +F +L  +G+TG++A W+G WPG       +AFF L + LP WV GI 
Sbjct: 131 DLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGNPPQLGSIAFFLLLEQLPGWVVGIV 190

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK   VL+
Sbjct: 191 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSPSVLQ 250

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  G +L
Sbjct: 251 IFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHAGAKL 310

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 428
           I L  GLY  D+S  GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 311 ILLGNGLYAEDWSAFGAFVAAPLGGILFGIGALLLRLSYHYLLAKWQHRRF 361



>gi|225558773|gb|EEH07057.1| urea transporter [Ajellomyces capsulatus G186AR]
          Length = 418

 Score =  234 bits (596), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 204/351 (58%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG         
Sbjct: 1   MVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVGLIVI 60

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 61  AVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 120

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     S  +F +L  +G+TG++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 121 DLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGDPPQLGSIAFFLLLEQLPGWVVGIV 180

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK   VL+
Sbjct: 181 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSPSVLQ 240

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  G +L
Sbjct: 241 IFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHAGAKL 300

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 428
           I L  GLY  D+S  GAF+ APL  I F   +  +RL   ++  K +   F
Sbjct: 301 ILLGNGLYGEDWSAFGAFVAAPLGGILFGIGALLLRLSYHYLLAKRQHRRF 351



>gi|512203105|gb|EPE31930.1| hypothetical protein GLAREA_12012 [Glarea lozoyensis ATCC 20868]
          Length = 488

 Score =  233 bits (595), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 144/395 (36%), Positives = 222/395 (56%), Gaps = 3/395 (0%)

Query: 60  SSILYSFPEVGTIAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRA 119
           +++  SF  + T+   L ++ ELSA+  I+  LTG+D L  VI   +V T+YT  GG + 
Sbjct: 78  AALYISFLSMATM--FLYMVAELSALQQIMTALTGMDGLPMVIVQCVVATIYTSLGGFKI 135

Query: 120 SLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFA 179
           S ITDNIQG                   I+ S+ID+S L +++ LGWQLLYI+PVAV   
Sbjct: 136 SFITDNIQGAMVVCLIIIATITIGVKTDIDTSLIDSSGLTQASLLGWQLLYILPVAVLTN 195

Query: 180 TLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLES 238
             F   FW RAF+SK D++L +     ++++  +L  +G TG+IAVW+G L P +     
Sbjct: 196 DFFLSNFWIRAFASKTDKDLWIGISIAAVVVLIILTLIGCTGLIAVWSGALGPDDIESSG 255

Query: 239 YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLS 298
            +AFF L + LP WV GI +V+ VS+S AA+D+  SA  +  SND+F N+L +   R   
Sbjct: 256 SIAFFLLLERLPAWVVGIVLVMVVSLSTAAFDSFQSAMVSMGSNDLFRNKLNIWFIRAAV 315

Query: 299 LIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXX 358
           ++  VP +   LK   +L+++LI+DL +AS++P ++LGL D  Y+    +          
Sbjct: 316 VLLIVPVIILALKAPSILQIYLISDLFSASSIPVLILGLSDRFYWWRGFEVVVGGLGGII 375

Query: 359 XXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMW 418
                 +I+Y NA+ G +LI L  GLY  D+SV GAF+ AP+  + + F +F VR+   +
Sbjct: 376 TVFIFGTIYYGNAQAGADLILLEGGLYANDWSVFGAFVAAPVGGLLWGFGAFVVRIAFQF 435

Query: 419 VFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEI 453
           +F KI G  F    +P  ++ +     ++ D  EI
Sbjct: 436 IFAKITGRHFGALDRPAYLNRRVMGAPEYADSDEI 470



>gi|358384934|gb|EHK22531.1| hypothetical protein TRIVIDRAFT_179853 [Trichoderma virens Gv29-8]
          Length = 510

 Score =  233 bits (595), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 167/508 (32%), Positives = 252/508 (49%), Gaps = 79/508 (15%)

Query: 8   SNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           SN +IYV    FL  G GI    +K  N +D+LS   TQ A  L  N+ AS++GS IL+S
Sbjct: 9   SNAIIYVTYGFFLILGTGIAWRMRKQPN-TDFLSGNRTQTAWPLAFNFIASALGSGILFS 67

Query: 66  FPEV------------------------------------------------GTIAGL-- 75
           +PE+                                                GT+A L  
Sbjct: 68  YPELATIAGVQGVVVYALASALPLLIFAYLGPMIRRKCPDGFVLTEWTRNRYGTVAMLYL 127

Query: 76  ---------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNI 126
                    L ++ ELSAVG ++  LTG+D L  +I   +VTT+YT             I
Sbjct: 128 SFMTLVTLFLYMVAELSAVGQVVNALTGLDGLPVIIVECVVTTIYTYV-----------I 176

Query: 127 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 186
           QG                   I + +ID+S L K++ +GWQL+YI+PVAV     F   F
Sbjct: 177 QGAMVVGLIIIATITIGVKAEINRDLIDSSGLTKASLVGWQLVYILPVAVLTNDFFLSNF 236

Query: 187 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLF 246
           W R FSSK D++L +     ++ +  +L  +G TG+IA W G WPG+ +++  LAFF L 
Sbjct: 237 WLRTFSSKTDKDLWVGISVATVAVLCILTLVGATGLIAAWTGAWPGDSDIDGSLAFFALL 296

Query: 247 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 306
           + LP WV GI +V+ VS+S +A+D+L SA  ++ SND+F N+L + + R L ++  +P V
Sbjct: 297 EQLPSWVVGIVLVMVVSLSVSAFDSLQSAMISSASNDLFRNKLNIWIIRVLVVLVIIPTV 356

Query: 307 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 366
              LK   +L++FLI+DL +A+T+P + LGL D+ Y+    +                +I
Sbjct: 357 VIALKAPSILQIFLISDLASAATIPVLCLGLFDTFYWWRGFEVVVGGLGGILTVFIYGAI 416

Query: 367 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 426
           +Y +AK G ELI L  GLY  D+   GAF+ AP+  I + F++  +RL   +   K+RGE
Sbjct: 417 YYGDAKSGGELILLEQGLYAGDWGAFGAFVAAPVGGIIWGFIALALRLSVQFTQAKMRGE 476

Query: 427 EFVFPKKPEVVDTKKYAGNKFKDDTEII 454
            F    +P      +      +DD +++
Sbjct: 477 RFDGLDRPLATSEVE------EDDAQLV 498



>gi|154286680|ref|XP_001544135.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150407776|gb|EDN03317.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 485

 Score =  233 bits (594), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 204/351 (58%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG         
Sbjct: 69  MVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVGLIVI 128

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 129 AVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 188

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     S  +F +L  +G+TG++A W+G WPG+      +AFF L + LP WV GI 
Sbjct: 189 DLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGDPPQLGSIAFFLLLEQLPGWVVGIV 248

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L +++ +P V   LK   VL+
Sbjct: 249 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLSIIPVVVVALKSPSVLQ 308

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  G +L
Sbjct: 309 IFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHAGAKL 368

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 428
           I L  GLY  D+S  GAF+ APL    F   +  +RL   ++  K +   F
Sbjct: 369 ILLGNGLYAEDWSAFGAFVAAPLGGTLFGMGALLLRLSYHYLLAKRQHRRF 419



>gi|330917930|ref|XP_003298017.1| hypothetical protein PTT_08598 [Pyrenophora teres f. teres 0-1]
 gi|311328989|gb|EFQ93864.1| hypothetical protein PTT_08598 [Pyrenophora teres f. teres 0-1]
          Length = 524

 Score =  233 bits (594), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 154/507 (30%), Positives = 251/507 (49%), Gaps = 61/507 (12%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IY+ L  FL +G +  +K + ++KS++LSS  TQ  V L  N+ AS++GS IL+++
Sbjct: 9   SNAIIYLTLGAFLVLGCFVAWKLRHQSKSEWLSSNRTQKGVPLAFNFIASALGSGILFTY 68

Query: 67  PEVGTIA-------------------GLLGVII--------------------------- 80
           P++  IA                   G LG II                           
Sbjct: 69  PQIAIIAGVQGLLVYALSSALPLLVFGALGPIIRRKCPEGFVLTEWTRQRYGAVAGLFLS 128

Query: 81  -------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                        ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQ
Sbjct: 129 VCTLITMFLYMVAELSALQQIISLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFVTDNIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                  +I++S+ID S  L+ + LGWQL+YI+PVA+     F  GFW
Sbjct: 189 GIMVIGLIIMGVIAVGVETKIDRSLIDKSGYLEPSLLGWQLIYILPVAIMTNDFFLSGFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R F+++ D++L +     S  +  +L  LG+ GM+A W+G +   +     LAFF L +
Sbjct: 249 MRTFAARTDKDLWIGVSLASGGVLIILTLLGVGGMLAAWSGAYTIGDEANRSLAFFLLLE 308

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP WV G+ +V+ +S+S AA+D+  SA  +  SND F N+L + + R   +    P V 
Sbjct: 309 TLPAWVIGVVLVMTISLSAAAFDSFQSAMISTGSNDFFRNKLNIWIIRACVVALIFPVVV 368

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             L+  D+L++FLI+DL++A+ +P +++GL D  Y+    D                 ++
Sbjct: 369 VALRSPDILQIFLISDLVSAAVVPCLVIGLSDKFYWYRGFDFVVGGLGGVFTIFLFGLVY 428

Query: 368 YH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 426
           Y  +     +L+ L  GLY  D+S  GAF+ AP   + + F +  +R+  +WV  +++G 
Sbjct: 429 YDGDVTKAGKLLLLEGGLYGNDWSAFGAFVAAPFGGLLWAFGACALRISFLWVRARVQGT 488

Query: 427 EFVFPKKPEVVDTKKYAGNKFKDDTEI 453
            F    +P  ++   + G+   + + +
Sbjct: 489 RFDAFDRPISLNNDDHDGDAVLEHSSL 515



>gi|164429597|ref|XP_964341.2| hypothetical protein NCU11204 [Neurospora crassa OR74A]
 gi|157073543|gb|EAA35105.2| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 542

 Score =  233 bits (593), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 161/534 (30%), Positives = 257/534 (48%), Gaps = 101/534 (18%)

Query: 20  LGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASS---------------------- 57
           +G G+ A   + ++K D+L+   TQ A+ L  N+ AS                       
Sbjct: 1   MGTGV-AWTMRNQSKGDFLAGNRTQTAIPLALNFIASGEYGISEDREDEHRGDLATCWTT 59

Query: 58  ------IGSSILYSFPEVGTIAG-------------------LLGVII------------ 80
                 +GS IL+++PE+ T+AG                   LLG II            
Sbjct: 60  KLRLYPLGSGILFTYPEIATLAGLQGVLVYALASALPLFVFALLGPIIRRKCPEGFVLTE 119

Query: 81  ----------------------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYT 112
                                       ELS +G ++  LTG++ L  +I   ++TT+YT
Sbjct: 120 WTRQRYGTIAALYLSFVTLVTLFLYMVAELSGIGQVVEVLTGLNGLPVLIVECVITTIYT 179

Query: 113 GYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIM 172
             GG R S ITDNIQG                  +I+ S+I+ S LLK + LGWQLLYI+
Sbjct: 180 SLGGFRISFITDNIQGAMVIGLLVVASIAIGVETKIDTSLIEPSGLLKDSLLGWQLLYIL 239

Query: 173 PVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG 232
           PVA+     F   FW R F+SK DR+L +     ++ +  ++  +G TG+IA W+G+WPG
Sbjct: 240 PVAILTNDFFLSSFWLRTFASKTDRDLWIGITLAALFILIIITMIGCTGLIAAWSGVWPG 299

Query: 233 ---EENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL 289
              E  L   +AFF L + LP WV G  +V++V++S AA+D+L SA  ++ SND+F N+L
Sbjct: 300 SDPENPLPGSVAFFGLLENLPAWVVGFVLVMSVTLSTAAFDSLQSAMVSSASNDLFRNKL 359

Query: 290 PLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDX 349
            +   R   ++  +P V   +K   +L+++LI+DL++A+T+P +++GL D  Y+    + 
Sbjct: 360 SVWWIRVAVVLIIIPIVVLAIKAPSILQIYLISDLVSAATIPVLIVGLSDRCYWWRGFEV 419

Query: 350 XXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLS 409
                          +I+Y++A  G +LI L  G+Y   ++  GAF+ AP+  + + F +
Sbjct: 420 VVGGLGGIFTVFIFGAIYYNDAYKGAQLILLEDGIYQEGWAAFGAFVAAPVGGLLWGFGA 479

Query: 410 FGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 463
             +RL   WV  K +G  F    +P VV++          D+E IQ     ++E
Sbjct: 480 LALRLAVQWVQAKRKGVRFDALDRPVVVES----------DSEAIQYVAGGDLE 523



>gi|240275165|gb|EER38680.1| urea transporter [Ajellomyces capsulatus H143]
          Length = 428

 Score =  232 bits (592), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 202/351 (57%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG++ L  VI   +VTT+YT  GG + S +TDN+QG         
Sbjct: 11  MVAELSALQQIINALTGLNGLPVVIVEVVVTTVYTSLGGFKVSFVTDNVQGAMVVGLIVI 70

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T + I+KS+ID+S LL  + LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 71  AVITVGTEVHIDKSLIDSSGLLGPSLLGWQLIYILPVAILTNDFFLSNFWLRTFASKTDR 130

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     S  +F +L  +G+TG++A W+G WPG       +AFF L + LP WV GI 
Sbjct: 131 DLRIGVSLASGAVFCILTLVGVTGLLAAWSGAWPGNPPQLGSIAFFLLLEQLPGWVVGIV 190

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ VS+S AA+D+L SA  +  SND+F NRLPL   R L ++  +P V   LK   VL+
Sbjct: 191 LVMTVSLSTAAFDSLQSAMVSTGSNDLFRNRLPLIYVRILVVLCIIPVVVVALKSPSVLQ 250

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++AS++P ++ GL D +Y+    +                +I++ +A  G +L
Sbjct: 251 IFLISDLVSASSIPVLVFGLWDKMYWWTGFEVVVGGLGGILSVFIFGTIYFGDAHAGAKL 310

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 428
           I L  GLY  D+S  GAF+ APL  I F   +  +RL    +  K +   F
Sbjct: 311 ILLGNGLYAEDWSAFGAFVAAPLGGILFGIGALLLRLSYHHLLAKWQHRRF 361



>gi|512188743|gb|EPE04513.1| urea transporter [Ophiostoma piceae UAMH 11346]
          Length = 511

 Score =  231 bits (590), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 141/383 (36%), Positives = 212/383 (55%), Gaps = 7/383 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+G ++ TLTG+D L  VI   +VTT+YT  GG R S ITDNIQG         
Sbjct: 107 MVAELSAIGQVVSTLTGLDGLPVVIVECVVTTIYTAVGGFRISFITDNIQGAIVLCMIII 166

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 T   I++  + +S LLKSN LGWQLLYI+PVA+     F   FW R F+S+ D+
Sbjct: 167 ATITVGTKTHIDRQDVIDSGLLKSNLLGWQLLYILPVAILTNDFFLSNFWLRTFASRTDK 226

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLFKVLPDWVSGI 256
           +L L     ++ +  +L  +G  G++AVW+G +   + + +S +AFF L + LP WV GI
Sbjct: 227 DLWLGVSMAALAILIILTLVGCGGLVAVWSGAYDMSDPDADSSVAFFLLLEQLPSWVVGI 286

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 316
            +V++VS+S AA+D+L SA  ++ SNDIF NRL     R   ++  +P V   LK   +L
Sbjct: 287 VLVMSVSLSTAAFDSLQSAMISSASNDIFRNRLSTKWIRGGVVLVIIPIVVLALKAPSIL 346

Query: 317 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIE 376
           +++LI+DL++AST+P +++GL +     N  D                +I+Y +A+ G E
Sbjct: 347 QIYLISDLVSASTIPVLIIGLSNRFPLWNGTDVIIGGLGGLMTVFIFGTIYYGSAQSGAE 406

Query: 377 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 436
           L+ L  GLY  D+   GAF+ AP+  + F   SF  R+     +T IR      P +P  
Sbjct: 407 LLLLEQGLYEGDWGAFGAFVAAPIGGLLFGLASFLARM----AYTYIRARASGRPFQP-- 460

Query: 437 VDTKKYAGNKFKDDTEIIQSSDP 459
           ++ + Y       D   I + DP
Sbjct: 461 LNPRAYIIGPDNSDDASIGAFDP 483



>gi|402086110|gb|EJT81008.1| urea transporter, variant [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 482

 Score =  231 bits (590), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 132/385 (34%), Positives = 214/385 (55%), Gaps = 3/385 (0%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  ++ TL+ +D L  VI    +TT+YT  GG + S +TDN+QG         
Sbjct: 88  MVAELSAISQVVTTLSNLDGLPVVIVQCAITTIYTSMGGFKISFLTDNVQGAMVLGLIII 147

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                    RI+ ++I++S LL+   LGWQL+YI+PVA+     F   FW R F+SK DR
Sbjct: 148 ATITIGVETRIDPALIESSGLLQPTLLGWQLVYILPVAILTNDFFLSSFWLRTFASKTDR 207

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +L +     S     +L  +G TG++AVW+G WPG +N +  +AFFTL ++LP+WV GI 
Sbjct: 208 DLWIGVGMASAATLCILTLVGTTGLVAVWSGAWPGPDNADGSVAFFTLLQLLPNWVVGIV 267

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+AV++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +   L+   +L+
Sbjct: 268 LVMAVTLSTAAFDSLQSAMVSSASNDLFRNRLGIWYIRAAVVLVIIPVIVIALRAPSILQ 327

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNW--IDXXXXXXXXXXXXXXXXSIFYHNAKDGI 375
           ++LI+D+++A+T+P ++LGL D  YF  W   D                + +Y + + G 
Sbjct: 328 IYLISDMVSAATIPVLVLGLSDR-YFYWWRGFDVVCGGLGGILSVFIFGTAYYGDVEAGG 386

Query: 376 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
            LI L  GLY  D+ V GAF+ AP+  + F F++  +R+  ++   K  G +F   ++P 
Sbjct: 387 RLILLEQGLYTGDWGVFGAFVAAPVGGMVFGFIAMLLRVGFLFAQAKATGGQFTAFERPL 446

Query: 436 VVDTKKYAGNKFKDDTEIIQSSDPD 460
              T          +     S+D +
Sbjct: 447 PESTAISENGPADGEVRFDDSADRE 471



>gi|171676089|ref|XP_001902998.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936110|emb|CAP60770.1| unnamed protein product [Podospora anserina S mat+]
          Length = 504

 Score =  231 bits (590), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 209/379 (55%), Gaps = 6/379 (1%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSAVG ++  L G+D L  +I   I+TT+YT  GG + S  TDNIQG            
Sbjct: 103 ELSAVGQVVNMLAGIDGLPVLIVECIITTIYTSLGGFKISFFTDNIQGTMVMALVVIATI 162

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
                 +I+ S+I+ S LLK N LGWQL+YI+PVA+   + F   FW R F+SK DR+L 
Sbjct: 163 SIGVETKIDTSLIEESGLLKGNLLGWQLVYILPVALLTNSFFLSHFWLRTFASKTDRDLW 222

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVSGIT 257
                  + +  + V +G TG++AVWAGL PG   E  ++  +AFF L + LP+WV GI 
Sbjct: 223 TGISLAVVAILVIFVLVGCTGLVAVWAGLVPGDDLENPVDGGIAFFALLQQLPNWVVGIV 282

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V++V++S AA+D+  +A   + SND+F NRL +   R   ++  VP V   ++   +L+
Sbjct: 283 IVMSVTLSTAAFDSFQTAMVTSASNDLFRNRLNIWWIRAGVVVIMVPVVVIAIRAPSILQ 342

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           ++LI DL++A+T+P + LGL +  YF    +                 ++Y +A+ G EL
Sbjct: 343 IYLITDLVSAATIPVLCLGLSEKFYFWRGFEVVVGGLGGLFTVFLFGLVYYQDAQKGAEL 402

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 437
           + L  GL+  D+   GAF+ AP+  I + F + G+RL   +   K +G  F    KP VV
Sbjct: 403 LLLQQGLFTGDWGCFGAFVAAPVGGILWGFGALGLRLSIQYFSAKRKGVRFDALDKPFVV 462

Query: 438 DTKKYAGNKFKDDTEIIQS 456
           D  +    +   DT+ + S
Sbjct: 463 DGGQ---QQLVGDTQHVDS 478



>gi|302919081|ref|XP_003052786.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256733726|gb|EEU47073.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 521

 Score =  231 bits (588), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 166/503 (33%), Positives = 258/503 (51%), Gaps = 65/503 (12%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSIL--- 63
           SN ++Y+    FL +G    ++ + ++K D+LS  GTQ A  L  N+ AS++GS+IL   
Sbjct: 9   SNAVMYLTYGAFLIVGTGIAWRMRNQSKKDFLSGNGTQTAFPLALNFIASALGSAILFSY 68

Query: 64  --------------YSF--------------------PE-----------VGTIAGL--- 75
                         YSF                    PE            GT+  L   
Sbjct: 69  PELATIAGVQGMIVYSFSSAIPILMFGYIGPVIRRRCPEGFVLTEWTRQRYGTLTMLYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSA+G ++  LTG+D L  +I   ++TT+YT  GG R S +TD IQ
Sbjct: 129 FMTLVTLFLYMVSELSAIGQVVTALTGLDGLPVMIVQCVITTIYTSLGGFRISFLTDVIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I++S+ID+S LL +N LGWQLLYI PVAV   + F   FW
Sbjct: 189 GAMVIGLVIIATITIGAKTSIDRSLIDSSGLLDANLLGWQLLYIFPVAVVTNSFFLSSFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLF 246
            R F+SK D++L L  +  +I++  VL  +G TG+IA+W+G    +E   S  +AFF L 
Sbjct: 249 LRTFASKTDKDLHLGTIIATIVVLCVLTLVGSTGLIAIWSGALQEDETASSGAIAFFALL 308

Query: 247 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 306
           + LP WV G+ +V+ V++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P +
Sbjct: 309 EQLPSWVVGVVLVMVVTLSTAAFDSLQSAMVSSASNDLFRNRLNVWFIRGGVVLIIIPVI 368

Query: 307 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 366
              LK   +L+++LI DL++A+T+P + +GLI S Y+    +                 +
Sbjct: 369 VLALKAPSILQIYLITDLISAATIPVLCIGLIKSCYWWRGFEVVVGGLGGIFTVFLFGLV 428

Query: 367 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 426
           +Y NA++  EL+ +  GLY  D+S  GAF+ AP+    +   +  +RL   +V  K++G 
Sbjct: 429 YYGNAQEAGELLLVQKGLYGNDWSAFGAFVAAPVGGFLWGVGALILRLSVQFVMAKVQGR 488

Query: 427 EF---VFP-KKPEVVDTKKYAGN 445
            F     P ++PE  +T + A N
Sbjct: 489 RFDALDRPLERPESRETDEPAEN 511



>gi|68489472|ref|XP_711409.1| hypothetical protein CaO19.6656 [Candida albicans SC5314]
 gi|46432709|gb|EAK92179.1| hypothetical protein CaO19.6656 [Candida albicans SC5314]
          Length = 521

 Score =  230 bits (587), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 135/389 (34%), Positives = 216/389 (55%), Gaps = 14/389 (3%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+ + + TLTG++ L  VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 140 ELSAIRSAIETLTGLNALGAVIVECVVTTIYTFFGGFRVSFITDNFQGVCVLLLLIICAA 199

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + I I+ S I  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 200 GMGSYIEIDTSKIGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 259

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 259
           +     + + F +   +G TG +AVW+G L  G+EN   Y AFF L   +P W+    ++
Sbjct: 260 IGTSIAAFVTFAICTLIGTTGFLAVWSGDLIVGDEN--GYDAFFILLSKMPRWLVAFVLI 317

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 318
             + +S   +D+L SA  +  SND+F N+L +N  R + ++  VP V   +K  D +L++
Sbjct: 318 FCIVLSTCTFDSLQSAMVSTISNDVFRNKLHINYVRIMLILIMVPIVVLAVKVADNILQI 377

Query: 319 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +LIADL++A+ +P + LGL D+  ++L   D                +++YH+A++G +L
Sbjct: 378 YLIADLVSAAIIPSVFLGLADTWFWYLRGFDVMAGGLGALLGVFIFGTVYYHSAREGGKL 437

Query: 378 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 436
           + +  GLY  +D+   GAF++AP+  +  T  S  +R+  ++ ++K+ G+EF    KP  
Sbjct: 438 LLIWNGLYDSSDWGPFGAFVIAPVGGVIITLASAALRIAVLYAYSKVTGKEFTALDKPVT 497

Query: 437 VDTKKYAGNKFKDDTEIIQSSDPDEIEIR 465
           V+ +       +D T    S D DE + +
Sbjct: 498 VEVEN------QDHTY--GSIDDDESDTK 518



>gi|238882735|gb|EEQ46373.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 521

 Score =  230 bits (587), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 135/389 (34%), Positives = 216/389 (55%), Gaps = 14/389 (3%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+ + + TLTG++ L  VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 140 ELSAIRSAIETLTGLNALGAVIVECVVTTIYTFFGGFRVSFITDNFQGVCVLLLLIICAA 199

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + I I+ S I  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 200 GMGSYIEIDTSKIGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 259

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 259
           +     + + F +   +G TG +AVW+G L  G+EN   Y AFF L   +P W+    ++
Sbjct: 260 IGTSIAAFVTFAICTLIGTTGFLAVWSGDLTVGDEN--GYDAFFILLSKMPRWLVAFVLI 317

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 318
             + +S   +D+L SA  +  SND+F N+L +N  R + ++  VP V   +K  D +L++
Sbjct: 318 FCIVLSTCTFDSLQSAMVSTISNDVFRNKLHINYVRIMLILIMVPIVVLAVKVADNILQI 377

Query: 319 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +LIADL++A+ +P + LGL D+  ++L   D                +++YH+A++G +L
Sbjct: 378 YLIADLVSAAIIPSVFLGLADTWFWYLRGFDVMAGGLGALLGVFIFGTVYYHSAREGGKL 437

Query: 378 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 436
           + +  GLY  +D+   GAF++AP+  +  T  S  +R+  ++ ++K+ G+EF    KP  
Sbjct: 438 LLIWNGLYDSSDWGPFGAFVIAPVGGVIITLASAALRIAVLYAYSKVTGKEFTALDKPVT 497

Query: 437 VDTKKYAGNKFKDDTEIIQSSDPDEIEIR 465
           V+ +       +D T    S D DE + +
Sbjct: 498 VEVEN------QDHTY--GSIDDDESDTK 518



>gi|482808759|gb|EOA85644.1| hypothetical protein SETTUDRAFT_169663 [Setosphaeria turcica Et28A]
          Length = 528

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 164/520 (31%), Positives = 257/520 (49%), Gaps = 67/520 (12%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           M S   SN +IY+ L  FL +G +  ++ + ++K+++LSS  TQ  V L  N+ AS++GS
Sbjct: 3   MPSQPASNAIIYLTLGAFLVLGCFIAWRLRHQSKTEWLSSNRTQKGVPLAFNFIASALGS 62

Query: 61  SILYSFPEVGTIA-------------------GLLGVII--------------------- 80
            IL+++P++ TIA                   G LG II                     
Sbjct: 63  GILFTYPQIATIAGVQGLLVYALASALPLLVFGALGPIIRRKCPEGFVLTEWTRQRYGVV 122

Query: 81  -------------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASL 121
                              ELSA+  I+  LTG+  L  VI    VTT+YT  GG + S 
Sbjct: 123 AGIFLSACTLITMFLYMVAELSALQQIVTLLTGLKGLPVVIVECAVTTIYTSLGGFKVSF 182

Query: 122 ITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATL 181
           +TDNIQG                   I++S+ID S  L+ + LGWQL+YI+PVAV     
Sbjct: 183 VTDNIQGVMVIGLIIMGVIAVGVETHIDRSLIDKSGYLEPSLLGWQLIYILPVAVLTNDF 242

Query: 182 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLA 241
           F  GFW R F+S+ D++L +     S+ +  +L  LG+ GM+A W+G +   +     LA
Sbjct: 243 FLSGFWMRTFASRTDKDLWIGVSLASMGILIILTLLGVAGMLAAWSGAYKIGDAATGSLA 302

Query: 242 FFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIA 301
            F L   LP WV G+ +V+ +S+SCAA+D+  SA  +  SND F N+L + V R   +  
Sbjct: 303 LFLLLNQLPSWVVGVVLVMTISLSCAAFDSFQSAMISTGSNDFFRNKLNIWVIRACVVAL 362

Query: 302 NVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXX 361
             P V   L+  D+L++FLI+DL++A+ +P +++GL D  Y+    D             
Sbjct: 363 IFPVVVVALRSPDILQIFLISDLVSAAVVPCLVIGLSDRFYWYRGFDFVVGGLGGIFTIF 422

Query: 362 XXXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 420
               ++Y  +     +L+ L  GLY  D+S  GAF+ AP+  + + F + G+R+  +WV 
Sbjct: 423 LFGLVYYDGDVTLAGKLLLLEGGLYGNDWSAFGAFVAAPVGGLLWAFGACGLRIGFLWVR 482

Query: 421 TKIRGEEF-VFPKK-PEVVDTKKYAGNKFKDDTEIIQSSD 458
            +++G  F  F +  P+ +D        F D   +I++S 
Sbjct: 483 ARVQGRRFDAFDRPIPQPIDRP----GAFDDHDAVIENSS 518



>gi|388578764|gb|EIM19102.1| hypothetical protein WALSEDRAFT_61642 [Wallemia sebi CBS 633.66]
          Length = 564

 Score =  228 bits (580), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 158/513 (30%), Positives = 254/513 (49%), Gaps = 74/513 (14%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI----- 62
           S  +IYV L +FL +G+   Y  TK K+D+LS+  T N   +  N+ A  +G+ +     
Sbjct: 11  SMAIIYVTLGVFLILGLVISYFVTKTKADFLSATKTANYAVIMCNFAAQGLGAGLQLTYP 70

Query: 63  --------------------LYSFPEVGT---------------IAGLLGVII------- 80
                               L +FP +                 I    GV+        
Sbjct: 71  EVATYGLQPLITYSLAASLPLLTFPPLAAQLRKKCPEGFVLTEFIRARFGVVASLFLSLC 130

Query: 81  -----------ELSAVGNILVTLTG-------VDKLAPVICIAIVTTLYTGYGGLRASLI 122
                      E++++ +++ +LTG       V  + P+    +VT LYT +GG + SLI
Sbjct: 131 SIVTLYVFMLSEMTSIYSVIQSLTGWSSETQNVWLIMPIFTEMMVTMLYTAWGGFKTSLI 190

Query: 123 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDN-SDLLKSNSLGWQLLYIMPVAVSFATL 181
           TD IQ                 ++ I+ S+I   S+LL+ + LGWQLLYI+PVA+ F   
Sbjct: 191 TDTIQATLFILLVIICTIAIGVTVEIDTSMIQQRSELLRGSQLGWQLLYILPVAIVFNNY 250

Query: 182 FHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG----EENLE 237
           F   +WQR +++K  ++L +     +I++F +   +G +G+IA WA ++PG     E   
Sbjct: 251 FLSSYWQRCYAAKTQKDLTIGCTLAAILIFCLTFLVGFSGLIAAWADVYPGPDSVNEESS 310

Query: 238 SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFL 297
           S + F  + K  P W+S + +VL+V++SCAAYDTL +A  A  SND+F N++ +   R +
Sbjct: 311 STVLFLLINKYCPPWISALMLVLSVALSCAAYDTLQTALVATVSNDVFRNKINIWWIRLI 370

Query: 298 SLI-ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXX 356
            ++ A V A     K  DVL ++LIADL++A+ MP +LLG  D LYFLN  D        
Sbjct: 371 LVVNAAVIAPVATNKVNDVLILYLIADLVSAAVMPAMLLGFTDKLYFLNGWDVTIGGLGG 430

Query: 357 XXXXXXXXSIFYH-NAKDGIELIGLPLGLYITD--YSVLGAFIVAPLSSIFFTFLSFGVR 413
                    ++Y  +AK    L+ +  GLY ++  +  LG FI AP+ SI +T  +FGVR
Sbjct: 431 IFTVFLFGLVYYDGDAKSAAALLIINEGLYPSENSFECLGTFIAAPVGSILWTIAAFGVR 490

Query: 414 LISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNK 446
           ++  ++ ++  G  F   +K + +D    AGN+
Sbjct: 491 VLYTYIRSRTTGSPFTVFEKTKPLDPYVVAGNE 523



>gi|50423383|ref|XP_460274.1| DEHA2E22396p [Debaryomyces hansenii CBS767]
 gi|49655942|emb|CAG88555.1| DEHA2E22396p [Debaryomyces hansenii CBS767]
          Length = 527

 Score =  226 bits (576), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 135/390 (34%), Positives = 217/390 (55%), Gaps = 11/390 (2%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+   + TLTG+D LA VI   +VT++YT  GG + S +TDN QG            
Sbjct: 140 ELSAIRTAIETLTGLDALAAVIVQCVVTSIYTSIGGFKVSFVTDNFQGVFVLLLVIICAA 199

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + I I+KS +  S LLK+N LGWQLLYI+ VA+     F  GFW R F+S+ +++L 
Sbjct: 200 GMGSYIDIDKSKVGESGLLKANKLGWQLLYILFVAILTNDCFMAGFWLRTFASRTNKDLW 259

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 259
           +     S + F +   +G TG +AVWAG L  G+  ++ Y AFF L   +P W+    ++
Sbjct: 260 IGCSIASFVTFVICTLVGTTGFLAVWAGDLVVGD--VDGYNAFFILLSKMPGWLVAFILI 317

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DVLRV 318
             +S+S   +D+L SA  +  SND+F N+L +N TR L ++  +P +   +K   D+L++
Sbjct: 318 FVISLSTCTFDSLQSAMVSTISNDVFRNKLHINYTRVLVVLIMIPIIVLAVKVADDILQI 377

Query: 319 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +LIADL++A+ +P + LGL D+  +FL  +D                +++Y +AK+G +L
Sbjct: 378 YLIADLVSAAIIPVVFLGLSDTYFWFLRGLDVMCGGLGGLLGVFIFGTVYYGSAKEGGKL 437

Query: 378 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP-- 434
           + +  G+Y   D+   GAF++AP   I   F    +R+   +++++I G  FV   KP  
Sbjct: 438 LLVWNGIYDDADWGPFGAFVIAPFGGIVICFCVAALRIGVTYIYSRISGSPFVALDKPEP 497

Query: 435 -EVVDTKKYAGNKFKDDTE--IIQSSDPDE 461
            E++D+ ++      D TE  I +S D  +
Sbjct: 498 KEIIDSTEFHNGSQYDSTEDNIKKSIDESQ 527



>gi|346320510|gb|EGX90110.1| urea transporter [Cordyceps militaris CM01]
          Length = 573

 Score =  226 bits (575), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 142/380 (37%), Positives = 211/380 (55%), Gaps = 6/380 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+G ++ TLTG+D L  VI   +VTT+YT  GG + S +TD IQG         
Sbjct: 191 MVAELSAIGQVVSTLTGLDGLPVVIVQCVVTTIYTSLGGFKISFLTDVIQGGMVVGLIII 250

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     I+  +ID+S L K+N LGWQLLYI+PVA+     F   FW R FSSK D+
Sbjct: 251 ATITIGVKTEIKTELIDSSGLTKANLLGWQLLYILPVAILTNDFFLSNFWLRTFSSKTDK 310

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+      +++  VL  +G TG+IA W+G WPG+      LAFF L + LP WV GI 
Sbjct: 311 DLRIGVTMAMLVILCVLTLVGSTGLIAAWSGAWPGDPPQGGSLAFFVLLEQLPAWVVGIV 370

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ VS+S AA+D+L SA  ++ SND+F NRL +   R   ++  VP V   LK   +L+
Sbjct: 371 LVMVVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWFIRVGVVVLIVPVVVLALKAPSILQ 430

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+DL++++ +P ++LGL+   +F    +                + +Y +A  G  L
Sbjct: 431 IFLISDLVSSAAIPVLVLGLLPQCWFWRGFEFVVGSLGGIFTVFIFGACYYRDAYRGARL 490

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 437
           I L  GLY  D+SV GAF+ AP   + + F++   RL   +   KI G  F    KP  +
Sbjct: 491 ILLEEGLYAQDWSVFGAFVAAPFGGLVWGFIALVCRLGFQYGKAKITGGVFDALDKP--L 548

Query: 438 DTKKYAGNKFKDDTEIIQSS 457
           DT +        D+E+++ +
Sbjct: 549 DTVR----PLSSDSEVVEQT 564



>gi|46129398|ref|XP_389060.1| hypothetical protein FG08884.1 [Fusarium graminearum PH-1]
          Length = 511

 Score =  225 bits (574), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 160/488 (32%), Positives = 245/488 (50%), Gaps = 72/488 (14%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV    FL +G    +K + ++K+D+LS  GTQ A  L  N+ AS++GS IL+S+
Sbjct: 9   SNAVIYVTYGAFLIMGTGIAWKMRNQSKADFLSGNGTQTAFPLALNFIASALGSGILFSY 68

Query: 67  PEVGTIA-------------------GLLGVII--------------------------- 80
           PE+ TI+                   G LG II                           
Sbjct: 69  PELATISGVQGMMVYALASALPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGIITMLYLS 128

Query: 81  -------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                        ELSA+G ++  LTG+D L  +I    +TT+YT             +Q
Sbjct: 129 FMSMVTLFLYMVSELSAIGQVVQALTGLDPLPVMIVQCAITTIYTYV-----------VQ 177

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I++ +ID S L K N LGWQLLYI+PVAV     F   FW
Sbjct: 178 GTMVVGLVIIAAITIGAKTEIQRPLIDESGLTKPNLLGWQLLYILPVAVLTNDFFLSSFW 237

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAFFTLF 246
            R F+SK D++LR+     +I++  VL  +G TG+IAVW+G  P  ++     +AFF L 
Sbjct: 238 LRTFASKTDKDLRIGTTIATIVILCVLTLVGSTGLIAVWSGALPLADKAGSGSVAFFVLL 297

Query: 247 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 306
           + LP WV GI +V+ V+MS AA+D+L SA  ++ SND+F N+L +   R + ++  +P +
Sbjct: 298 ETLPSWVVGIVLVMVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAIVVLIIIPVI 357

Query: 307 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 366
              LK   VL+++LI DL++A+T+P +++GL++  Y+    +                 +
Sbjct: 358 AIALKAPSVLQIWLITDLISAATIPVLVIGLVEKFYWWRGFEVVVGGLGGILTVFIFGCV 417

Query: 367 FYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGE 426
           +Y NAK+  EL+ +  GLY  D+S  GAF+ AP+ S+ +   +  VR+   +V  K+RG 
Sbjct: 418 YYGNAKEAGELLLVQKGLYGNDWSAFGAFVAAPVGSLLWGCGAMVVRITFQYVHAKVRGH 477

Query: 427 EFVFPKKP 434
            F    +P
Sbjct: 478 RFDALDRP 485



>gi|477518870|gb|ENH71070.1| hypothetical protein FOC1_g10008443 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 569

 Score =  225 bits (574), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 176/564 (31%), Positives = 266/564 (47%), Gaps = 115/564 (20%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFA----------- 55
           SN +IYV  A+FL +G    +K + ++K+D+LS  GTQ A  L  N+ A           
Sbjct: 9   SNAVIYVTYALFLLMGTGIAWKMRNQSKADFLSGNGTQTAFPLALNFIASAQLRSLSAEL 68

Query: 56  ------------------------------------SSIGSSILYSFPEVGTIA------ 73
                                               +S+GS IL+S+PE+ TI+      
Sbjct: 69  GYSNYLLQRGNLGRLGGEDAAHYGRRVDVSSGSNLGASLGSGILFSYPELATISGVQGMI 128

Query: 74  -------------GLLGVII---------------------------------------- 80
                        G LG II                                        
Sbjct: 129 VYALASSLPMLIFGYLGPIIRRRCPEGFVLTEWTRQRYGVITMLYLSFMSLVTLFLYMVG 188

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+G ++  +TG+  L  +I    VTT+YT  GG R S ITD  QG            
Sbjct: 189 ELSAIGQVVNAMTGLKPLPVMIVQCAVTTIYTSLGGFRISFITDVAQGTMVIGLVIIAAI 248

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
                  I++ +I+ S L KSN LGWQLLYI+PVAV     F   FW R F+SK D++LR
Sbjct: 249 TIGAKTEIQRPLIEESGLTKSNLLGWQLLYILPVAVLTNDFFLSSFWLRTFASKTDKDLR 308

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGITVV 259
           +     +I++  +L  +G TG+IAVW+G    E+   S  +AFF L + LP WV GI +V
Sbjct: 309 IGTTIATIVILCILTLVGSTGLIAVWSGALSLEDAAGSGSVAFFVLLETLPSWVVGIVLV 368

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVF 319
           + V+MS AA+D+L SA  ++ SND+F N+L +   R   ++  +P +   LK   VL+++
Sbjct: 369 MVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWYIRAFVVLIIIPVIVIALKAPSVLQIW 428

Query: 320 LIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIG 379
           LI DL++A+T+P +++GL+D  Y+    +                 I+Y NA++  EL+ 
Sbjct: 429 LITDLISAATIPVLVIGLVDKFYWWRGFEVVVGGLGGILTVFIFGCIYYGNAQEAGELLL 488

Query: 380 LPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDT 439
           +  GLY  D+S  GAF+ AP+ S+ +   +  +RL   ++  KIRG  F    +P  VD 
Sbjct: 489 VQKGLYGNDWSAFGAFVAAPVGSLLWGCGALALRLSYQYMSAKIRGHRFDALDRP--VDL 546

Query: 440 KKYAGNKFKDD--TEIIQSSDPDE 461
           +    +  ++D  TE + SS P +
Sbjct: 547 RP---SSTEEDVPTENLVSSTPGK 567



>gi|149237959|ref|XP_001524856.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451453|gb|EDK45709.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 479

 Score =  224 bits (572), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 134/388 (34%), Positives = 216/388 (55%), Gaps = 10/388 (2%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+   + TLTG++ L  VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 83  ELSAIRGAIETLTGLNALGAVIVECVVTTIYTFFGGFRVSFITDNFQGACVLILIIICAC 142

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              T I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 143 GMGTYIEIDPSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 202

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 259
           +     + + F +   +G  G +AVW+G +  G+EN   Y AFF L   +P W+    ++
Sbjct: 203 IGCSIAAFVTFVICTLVGTPGFLAVWSGDITVGDEN--GYNAFFILLAKMPRWLVAFVLI 260

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DVLRV 318
             + +S   +D+L SA  +  SND+F N+L  N TR L ++  VP V   +K   D+L++
Sbjct: 261 FCIMLSTCTFDSLQSAMVSTISNDVFRNKLHTNWTRGLVVLICVPIVVLAVKVADDILQI 320

Query: 319 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +LIADL++A+ +P + LGL ++  ++L  ID                +++YH+A++G +L
Sbjct: 321 YLIADLVSAAIIPAVFLGLSNTYFWYLRGIDVMCGGLGALLGVFIFGTVYYHSAREGGKL 380

Query: 378 IGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 436
           + +  G+Y   D+   GAF++AP   +  T    GVR++ +++++KI G+ F   +KP  
Sbjct: 381 LLIWNGIYSPEDWGAFGAFVIAPFGGLVITMAVAGVRILGLYLYSKITGKPFTALEKP-- 438

Query: 437 VDTKKYAGNKFKDDTEIIQSSDPDEIEI 464
             T+    ++ + +TE + SS    I +
Sbjct: 439 --TQVIYVDEQERETESLTSSSNINITV 464



>gi|340975607|gb|EGS22722.1| hypothetical protein CTHT_0011960 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 557

 Score =  224 bits (572), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 217/391 (55%), Gaps = 8/391 (2%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+G ++  LTG+D L  +I   +VTT+YT  GG + S  TDNIQG         
Sbjct: 170 MVSELSAIGQVVNLLTGLDGLPVLIVECLVTTIYTSLGGFKISFFTDNIQGAMVLGLIII 229

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                    +I+  +I++S L K N LGWQLLYI+PVA+     F   FW R F+SK DR
Sbjct: 230 ATITIGVETKIDTGLIESSGLTKGNLLGWQLLYILPVAILTNDFFLSQFWLRTFASKTDR 289

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN--LESYLAFFTLFKVLPDWVSG 255
           +L L      + +  ++  +G TG+IA W+G+WPG  +  ++  +AFF L + LP WV G
Sbjct: 290 DLWLGISAAVVAIIIIVTLVGSTGLIAAWSGVWPGPPDNPVDGSVAFFALLQQLPSWVVG 349

Query: 256 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 315
           I +V++V++S AA+D+  SA   + S D+F N+L +   R   ++  +P V   ++   +
Sbjct: 350 IVLVMSVTLSTAAFDSFQSAMVTSASTDLFRNKLSIWWIRAGVVLTMIPVVVIAIRAPSI 409

Query: 316 LRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGI 375
           L+++LI+DL++A+T+P ++LGL D+ Y+    +                +++Y + K G 
Sbjct: 410 LQIYLISDLVSAATIPVLILGLSDACYWWRGFEVVVGGLGGLFTVFLFGTVYYGDVKSGA 469

Query: 376 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
           EL+ L  GL+  D+   GAF+ AP+  + + F +  +RL   +   K++G+ F    +P 
Sbjct: 470 ELMLLQQGLFTGDWGCFGAFVAAPIGGLLWGFGALALRLGIQYTRAKLQGKRFDSLDRPV 529

Query: 436 VVDTKKYAGNKFKDDTEIIQSSDPDEIEIRG 466
            +D +   G+ ++ ++    S +P   E  G
Sbjct: 530 SLDEE---GHGWETESS---SDNPGIAETTG 554



>gi|494831159|gb|EON67651.1| hypothetical protein W97_06794 [Coniosporium apollinis CBS 100218]
          Length = 479

 Score =  224 bits (570), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 140/384 (36%), Positives = 220/384 (57%), Gaps = 6/384 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG+D L  VI   +VTT+YT  GG + S ITDNIQG         
Sbjct: 84  MVAELSALQQIVSALTGLDGLPAVIVQCVVTTIYTSLGGFKVSFITDNIQGAMVVGLIII 143

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                  +  I+KS++D+S LL+S+ LGWQLLYI+PVA+     F  GFW R F+S+ D+
Sbjct: 144 GVITVGVNTEIDKSLVDSSGLLESSLLGWQLLYILPVAIFTNVFFISGFWLRTFASRTDK 203

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     ++ +  +L F+G TG++A W+G WPG+   +  ++FF L   LP WV GI 
Sbjct: 204 DLRIGTGIATVAVAIILAFVGSTGLLAAWSGAWPGDPPQDGAISFFLLLGQLPAWVVGIV 263

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ VS+S AA+D+  SA  +N SNDIF NRL +   R   ++  VP V   LK  D+L 
Sbjct: 264 LVMVVSLSTAAFDSFQSAMVSNGSNDIFRNRLNIWFIRLSVVLIIVPVVVVALKSPDILT 323

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           ++LI+DL++AS +P +++GL D  Y+    +                +++Y +A  G +L
Sbjct: 324 IYLISDLVSASLVPVLVIGLSDRCYWWRGFEVVVGALGGIFTVFLFGTVYYGDAGRGAKL 383

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVV 437
           I L  GLY  D+   GAF+ AP+ ++ +   +F +R+  +++  K++G  F    +P   
Sbjct: 384 ILLEGGLYAEDWGAFGAFVAAPVGALLWALAAFILRIAFLFIKAKVQGRRFDAFDRPIPA 443

Query: 438 DTKKYAGNKFKDDTEIIQSSDPDE 461
           D  ++AG      T+ + +   DE
Sbjct: 444 DPGRFAG------TDALSTGTGDE 461



>gi|400595550|gb|EJP63345.1| urea transporter [Beauveria bassiana ARSEF 2860]
          Length = 521

 Score =  223 bits (569), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 165/487 (33%), Positives = 235/487 (48%), Gaps = 60/487 (12%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQN---------AVALGSN----- 52
           SN +IY+   +FL +G    +K + + K+D+LSS GTQ          A ALGS      
Sbjct: 9   SNAIIYLTYGLFLVMGTGIAWKLRNQAKTDFLSSNGTQTAFPLALNFIASALGSGILFSY 68

Query: 53  ---------------WFASSI--------GSSILYSFPE--------------------- 68
                            ASS+        G  I    PE                     
Sbjct: 69  PELATIAGVQGVVVYALASSLPMLVFGYLGPVIRRRCPEGFVLTEWTRQRYGIPGMLFLS 128

Query: 69  -VGTIAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
            +  I   L ++ ELSA+G ++ TLTG+D L  VI   IVTT+YT  GG + S +TD IQ
Sbjct: 129 VLTLITLFLYMVAELSAIGQVVSTLTGLDGLPVVIVQCIVTTIYTSLGGFKISFLTDVIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I+  +ID S L K   LGWQLLYI+PVAV     F   FW
Sbjct: 189 GGMVVGLIIIATITIGVKTEIQTELIDASGLTKPTLLGWQLLYILPVAVLTNDFFLSNFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            R FSSK D++LR+      +++  VL  +G TG+IA W+G WPG+      LAFF L +
Sbjct: 249 LRTFSSKTDKDLRVGVTMAMVVILCVLTLVGCTGLIAAWSGAWPGDPAQAGSLAFFVLLE 308

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVY 307
            LP WV GI +V+ VS+S AA+D+L SA  ++ SND+F NRL +   R   ++  +P V 
Sbjct: 309 RLPGWVVGIVLVMVVSLSTAAFDSLQSAMVSSASNDLFRNRLNIWFIRGFVVLVIIPVVV 368

Query: 308 WGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIF 367
             LK   +L++FLI+DL++++ +P + +GL+   +     +                + +
Sbjct: 369 LALKAPSILQIFLISDLVSSAAIPVLCIGLLPQAWVWRGFEFVVGTLGGILTVFIFGACY 428

Query: 368 YHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE 427
           Y +A  G  LI L  GLY  D+SV GAF+ AP   + +  ++   RL   +   KI G  
Sbjct: 429 YKDAYRGARLILLEEGLYAQDWSVFGAFVAAPFGGLVWGCIALACRLTFQYAKAKITGGV 488

Query: 428 FVFPKKP 434
           F    KP
Sbjct: 489 FDALDKP 495



>gi|485923385|gb|EOD48562.1| putative urea transporter protein [Neofusicoccum parvum UCRNP2]
          Length = 349

 Score =  223 bits (567), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 129/323 (39%), Positives = 193/323 (59%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG+D L  VI    VTT+YT  GG + S +TDNIQG         
Sbjct: 10  MVAELSALQQIVTALTGLDGLPAVIVECAVTTIYTSLGGFKVSFVTDNIQGVMVLGLIII 69

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     I++S+ID+S  L+S+ LGWQL+YI+PVA+     F  GFW R F+S+ DR
Sbjct: 70  GVITVGVETHIDRSLIDSSGYLESSLLGWQLIYILPVAILTNDFFISGFWLRTFASRTDR 129

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +LR+     ++++  +L  +G TG++A W+G+WPG+   E  +AFFTL   LP WV GI 
Sbjct: 130 DLRIGTTIATVVVTIILTLVGCTGLLAAWSGVWPGDPPQEGSIAFFTLLATLPAWVVGIV 189

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ V++S AA+D+  SA  +  SND+F N LPL   R   + A VP V   L+   VL+
Sbjct: 190 LVMVVALSTAAFDSFQSAMVSTGSNDLFRNALPLWCIRAAVVAAIVPVVVVALRSPSVLQ 249

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           V+LI+DL++AS +P +++GL D+ ++ +  +                +++Y NA+DG  L
Sbjct: 250 VYLISDLVSASLVPVLVVGLCDACWWWSGAEVVVGGLGGIFTVFLFGTVYYCNARDGGRL 309

Query: 378 IGLPLGLYITDYSVLGAFIVAPL 400
           I L  GLY  D+S  GAF+ AP+
Sbjct: 310 ILLENGLYGDDWSAFGAFVAAPV 332



>gi|322696792|gb|EFY88579.1| urea transporter [Metarhizium acridum CQMa 102]
          Length = 463

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 161/470 (34%), Positives = 244/470 (51%), Gaps = 60/470 (12%)

Query: 8   SNVLIYVVLAIFL--GIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYS 65
           SN +IY+    FL  G GI A   + ++K D+LSS GTQ+A           +G+ IL+S
Sbjct: 9   SNAIIYLTYGAFLVLGTGI-AWTMRNQSKQDFLSSNGTQSA-----------LGAGILFS 56

Query: 66  FPEVGTIAGLLGVIIE----------LSAVGNI--------------------------- 88
           +PE+ TI G+ GVII             A+G I                           
Sbjct: 57  YPELATITGVQGVIIYALASALPMLIFGALGPIIRRKCPEGFVLTEWTRQRYGTVAMFYL 116

Query: 89  ----LVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXAT 144
               LVTL  +  +A +  +  V TL    GG + S +TD IQG                
Sbjct: 117 SFMTLVTLF-LYMVAELSALGQVVTL----GGFKISFLTDVIQGGMVVGLIIIATITVGA 171

Query: 145 SIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAV 204
              I++ +ID+S LL+ + LGWQLLYI+PVAV     F   FW R FSSK+D++L +   
Sbjct: 172 KTEIKRELIDSSHLLEPSLLGWQLLYILPVAVLTNDFFLSNFWLRTFSSKSDKDLWVGVS 231

Query: 205 YGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSM 264
              +++  +L  +G TG+IA W+G WPGE   E  LAFF L + LP WV GI +V+ VS+
Sbjct: 232 VAMVVILCILTLVGCTGLIAAWSGAWPGEPEQEGSLAFFLLLQQLPSWVVGIILVMVVSL 291

Query: 265 SCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADL 324
           S AA+D+L SA  ++ SND+F NRL +   R + ++  +P V   L+   +L+++LI+DL
Sbjct: 292 STAAFDSLQSAMVSSASNDLFRNRLNIWYIRGMVVLIIIPVVVVALRASSILQIYLISDL 351

Query: 325 LAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGL 384
           L+A+T+P + LGL D LY+    +                +++Y +A+ G +L+ +  GL
Sbjct: 352 LSAATIPVLCLGLSDRLYWWRGFEVVVGGLGGILTVFIFGAVYYKDAEQGAQLLLIQNGL 411

Query: 385 YITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 434
           Y  D+S  GAF+ AP+  I + F +  +RL   ++  ++R E F    +P
Sbjct: 412 YANDWSTFGAFVAAPVGGIVWGFGALALRLSFQYIKARLRRERFDALDRP 461



>gi|336264692|ref|XP_003347122.1| hypothetical protein SMAC_05421 [Sordaria macrospora k-hell]
 gi|380093817|emb|CCC08781.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 495

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 135/393 (34%), Positives = 217/393 (55%), Gaps = 8/393 (2%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELS++G ++  LTG+  L  +I   ++TT+YT  GG R S ITDNIQG         
Sbjct: 98  MVAELSSIGQVVEVLTGLHGLPVIIVECVITTIYTSLGGFRISFITDNIQGAMVVGLIVV 157

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                    +I+ S+I+ S LLK N LGWQLLYI+PVA+     F   FW R F+SK D+
Sbjct: 158 AAIAIGVETKIDTSLIEPSGLLKDNLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDK 217

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVS 254
           +L +     ++++  ++  +G TG+IA W+G+WPG   E  L   +AFF L + LP WV 
Sbjct: 218 DLWIGISLAALIILIIITMVGCTGLIAAWSGIWPGSDPENPLPGSVAFFGLLENLPAWVV 277

Query: 255 GITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD 314
           G  +V++V++S AA+D+L SA  +  SND+F N+L +   R   ++  +P V   +K   
Sbjct: 278 GFVLVMSVTLSTAAFDSLQSAMVSTASNDLFRNKLNVWWIRGAVVLVIIPIVVIAIKAPS 337

Query: 315 VLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDG 374
           +L+++LI+DL++A+T+P +++GL D  Y+    +                +I+Y +A  G
Sbjct: 338 ILQIYLISDLVSAATIPVLVIGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYKDAHRG 397

Query: 375 IELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 434
            +L+ L  GLY   ++  GAF+ AP+  + + F +  +RL   WV  K +G  F    +P
Sbjct: 398 AQLMLLEEGLYQEGWAAFGAFVAAPVGGLLWGFGALALRLSVQWVQAKRKGVRFDALDRP 457

Query: 435 EVV----DTKKY-AGNKFKDDTEIIQSSDPDEI 462
            +V    +T +Y AG   +      Q S   +I
Sbjct: 458 VMVEGDGETVQYIAGGDLETILSTGQESGAGKI 490



>gi|310794094|gb|EFQ29555.1| hypothetical protein GLRG_04699 [Glomerella graminicola M1.001]
          Length = 454

 Score =  222 bits (565), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 209/393 (53%), Gaps = 4/393 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+G ++  LT +D L  +I   +VTT+YT  GG R S +TDN+QG         
Sbjct: 59  MVAELSAIGQVVNALTSLDGLPVMIVQCVVTTIYTSLGGFRISFVTDNLQGAMVVCLIVI 118

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     I+ S+I++S LLK   LGWQLLYI+PV +     F  GFW R F+SK DR
Sbjct: 119 VGIAMGVKTDIDTSLIESSGLLKPTLLGWQLLYILPVCILTNDFFLSGFWLRTFASKTDR 178

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGI 256
           +LR+       ++  +L  +G+TG++A W+G  P ++  E+  +AFF L + +P WV G+
Sbjct: 179 DLRVGVSIAVAVILCILTLVGVTGLVAAWSGALPLDQVAENGSVAFFLLLERMPAWVVGL 238

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 316
            +V+  ++S AA+D+L SA  ++ SND+F NRL +   R   ++   P +   LK   VL
Sbjct: 239 VLVMVCTLSTAAFDSLQSAMVSSASNDLFRNRLNIWWIRAAVVLVIAPTIVIALKAPSVL 298

Query: 317 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGI 375
           +++LI+DL++AS +P ++LGL D  Y+    +                 ++Y  +A    
Sbjct: 299 QIYLISDLVSASVIPVLVLGLSDRFYWWRGFEVVAGGLGGILTVFLFGLVYYDGDASRAG 358

Query: 376 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
            L+ L  GLY  D+S  GAF+ AP+ S  + F + G RL   +V  +  G  F     P 
Sbjct: 359 NLLILSEGLYADDWSAFGAFVAAPVGSFLWGFAALGCRLAFQYVAARRSGRRFDALDDPA 418

Query: 436 VVDTKKYA--GNKFKDDTEIIQSSDPDEIEIRG 466
           V      A    +F +  E   +SD + ++  G
Sbjct: 419 VAPDAASADGAPRFVERDEYEATSDVEVVKPAG 451



>gi|344301867|gb|EGW32172.1| hypothetical protein SPAPADRAFT_61262 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 392

 Score =  221 bits (563), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 130/352 (36%), Positives = 200/352 (56%), Gaps = 6/352 (1%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+   L TLTGV+ LA VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 8   ELSAISGALETLTGVNALAAVIVECVVTTIYTFFGGFRISFITDNFQGACVLILLIICAA 67

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + I I+ S +  S LLKSN LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 68  GMGSYIEIDPSKVGPSGLLKSNKLGWQLVYILFVAIVTNDCFLSGFWLRTFASKTDKDLW 127

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 259
           +     + + F +   +G+ G +AVW+G L  G++  E Y AFF L   +P W+    ++
Sbjct: 128 IGTSLAAFVTFVITTLVGVPGFLAVWSGDLTVGDD--EGYNAFFILLAKMPRWLVAFVII 185

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 318
             V +S   +D+L SA  +  SND+F N+L L+ TR + ++  VP V   +K  D +L++
Sbjct: 186 FCVVLSTCTFDSLQSAMVSTISNDVFRNKLQLHWTRCIVILVMVPIVVLAVKVADNILQI 245

Query: 319 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +LIADL++A+ +P + LGL DS  +FL   D                +++Y +A++G +L
Sbjct: 246 YLIADLVSAAIIPALFLGLSDSWFWFLRGFDIMCGGLGALLGVFIFGTVYYGSAREGGKL 305

Query: 378 IGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 428
           + +  G+Y + D+   GAF++AP   I  T ++ GVR+   + ++K  G+ F
Sbjct: 306 LLIWNGIYSSEDWGAFGAFVIAPFGGILITLVAAGVRIAGAYCYSKATGKPF 357



>gi|477525718|gb|ENH77590.1| urea transporter [Colletotrichum orbiculare MAFF 240422]
          Length = 527

 Score =  220 bits (561), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 140/417 (33%), Positives = 218/417 (52%), Gaps = 6/417 (1%)

Query: 51  SNWFASSIGSSILYSFPEVGTIAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTL 110
           + W     G+  ++    +  +   L ++ ELSA+G ++ TLT +D L  +I   I+TT+
Sbjct: 106 TAWTRQRYGTVAMFYLSFMTLVTLFLYMVAELSAIGQVVNTLTSLDGLPVMIVQCIITTI 165

Query: 111 YTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLY 170
           YT  GG R S ITDN+QG                   I+ S+I+ S  LK   LGWQLLY
Sbjct: 166 YTSLGGFRISFITDNLQGAMVVCLIVIVAVTMGVKAEIDTSLIETSGYLKPTLLGWQLLY 225

Query: 171 IMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW 230
           I+P+ +     F  GFW R F+SK D++LR+      +++  +L  +G+TG +AVW+G  
Sbjct: 226 ILPICILTNDFFLSGFWLRTFASKTDKDLRIGVSVAVVIILCILTMVGVTGCVAVWSGAL 285

Query: 231 PGEENLES-YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL 289
           P +   ES  +AFF L   LP WV GI +V+  ++S AA+DTL SA  ++ SND+F NRL
Sbjct: 286 PLDGVAESGSVAFFLLLNQLPAWVVGIVLVMVCTLSTAAFDTLQSAMVSSASNDLFRNRL 345

Query: 290 PLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDX 349
            +   R   ++  +P V   LK   +L+++LI+DL++AS +P ++ GL D  Y+    + 
Sbjct: 346 NIWWIRAGVVVIIIPTVIIALKAPSILQIYLISDLVSASVIPVLVFGLTDRFYWWRGFEV 405

Query: 350 XXXXXXXXXXXXXXXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFL 408
                           I+Y  + +    L+ +  GLY  D+SV GAF+ AP+ S  + F 
Sbjct: 406 VVGGLGGLLTVFIFGIIYYDGDTQKAGNLLIISEGLYANDWSVFGAFVAAPVGSFLWGFA 465

Query: 409 SFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSSD-PDEIEI 464
             G RL   +   K  G  F    +P  VDT  YA +      ++ + +D   ++EI
Sbjct: 466 GLGCRLAFQYAMAKKNGRRFDALDRP--VDT-PYAPDGVPRQVDVDEYADVTSDVEI 519



>gi|342878048|gb|EGU79459.1| hypothetical protein FOXB_10044 [Fusarium oxysporum Fo5176]
          Length = 581

 Score =  219 bits (559), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 170/530 (32%), Positives = 257/530 (48%), Gaps = 76/530 (14%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNA--------VALGSNW 53
           ML G     L ++  A    +    GY     +   L  LG ++A        V+ GSN 
Sbjct: 56  MLVGAFPLALNFIASAQLRSLSAELGYSNYLLQRGNLGRLGGEDAAHYGRRVDVSSGSN- 114

Query: 54  FASSIGSSILYSFPEVGTIA-------------------GLLGVII-------------- 80
             +S+GS IL+S+PE+ TI+                   G LG II              
Sbjct: 115 LGASLGSGILFSYPELATISGVQGMIVYALASSLPMLIFGYLGPIIRRRCPEGFVLTEWT 174

Query: 81  --------------------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGY 114
                                     ELSA+G ++  +TG+  L  +I    VTT+YT  
Sbjct: 175 RQRYGVITMLYLSFMSLVTLFLYMVGELSAIGQVVNAMTGLKPLPVMIVQCAVTTIYTSL 234

Query: 115 GGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPV 174
           GG R S ITD  QG                   I++ +I+ S L KSN LGWQLLYI+PV
Sbjct: 235 GGFRISFITDVAQGTMVIGLVIIAAITIGAKTEIQRPLIEESGLTKSNLLGWQLLYILPV 294

Query: 175 AVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEE 234
           AV     F   FW R F+SK D++LR+     +I++  +L  +G TG+IAVW+G    E+
Sbjct: 295 AVLTNDFFLSSFWLRTFASKTDKDLRIGTTIATIVILCILTLVGSTGLIAVWSGALSLED 354

Query: 235 NLES-YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV 293
              S  +AFF L + LP WV GI +V+ V+MS AA+D+L SA  ++ SND+F N+L +  
Sbjct: 355 AAGSGSVAFFVLLETLPSWVVGIVLVMVVTMSTAAFDSLQSAMVSSGSNDLFRNKLNIWY 414

Query: 294 TRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXX 353
            R   ++  +P +   LK   VL+++LI DL++A+T+P +++GL+D  Y+    +     
Sbjct: 415 IRAFVVLIIIPVIVIALKAPSVLQIWLITDLISAATIPVLVIGLVDKFYWWRGFEVVVGG 474

Query: 354 XXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVR 413
                       I+Y NA++  EL+ +  GLY  D+S  GAF+ AP+ S+ +   +  +R
Sbjct: 475 LGGILTVFIFGCIYYGNAQEAGELLLVQKGLYGNDWSAFGAFVAAPVGSLLWGCGALALR 534

Query: 414 LISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDD--TEIIQSSDPDE 461
           L   ++  KIRG  F    +P  VD +    +  ++D  TE + SS P +
Sbjct: 535 LSYQYMSAKIRGHRFDALDRP--VDLRP---SSTEEDVPTENLVSSTPGK 579



>gi|354547251|emb|CCE43985.1| hypothetical protein CPAR2_502100 [Candida parapsilosis]
          Length = 467

 Score =  218 bits (554), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 133/383 (34%), Positives = 212/383 (55%), Gaps = 10/383 (2%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+ + +  LTG++ L  VI    VTT+YT +GG R S ITDN QG            
Sbjct: 83  ELSAIRSAIEALTGLNALGAVIVECAVTTIYTFFGGFRVSFITDNFQGACVLILIIICAC 142

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK D++L 
Sbjct: 143 GMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASKTDKDLW 202

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWA-GLWPGEENLESYLAFFTLFKVLPDWVSGITVV 259
           +     + + F +   +G TG +AVW+  L  G++  E Y AFF L   +P W+    ++
Sbjct: 203 IGCSIAAFVAFVITSLVGTTGFLAVWSEDLQVGDD--EGYNAFFVLLSHMPRWLVAFVLI 260

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 318
             + +S   +D+L SA  +  SND+F N+L  N  R L +I   P V   +K  D +L++
Sbjct: 261 FCIVLSTCTFDSLQSAFVSTISNDVFRNKLHTNWARLLVVIMIFPIVVLAVKVADNILQI 320

Query: 319 FLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +LIADL +A+ +P + LGL +   +++   D                +++YH+AK+G +L
Sbjct: 321 YLIADLASAAVIPAVFLGLSNRYFWWMRGFDVMCGGLGALLGVFVFGTVYYHSAKEGGKL 380

Query: 378 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 436
           + +  GLY   D+   GAF++AP+  I F++++  VR+ +++V++KI G  F   ++PE 
Sbjct: 381 LLIWNGLYNPEDWGPFGAFVIAPVGGIVFSWIAAAVRIGAVYVYSKISGTPFTVLERPE- 439

Query: 437 VDTKKYAGNK--FKDDTEIIQSS 457
            +   Y  N+  +  DT I Q+S
Sbjct: 440 -EEPIYVDNQTTYGSDTNIEQTS 461



>gi|361125484|gb|EHK97525.1| putative Eukaryotic translation initiation factor eIF-1 [Glarea
           lozoyensis 74030]
          Length = 517

 Score =  216 bits (551), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 136/361 (37%), Positives = 201/361 (55%), Gaps = 4/361 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG+D L  VI   +V T+YT  GG + S ITDNIQG         
Sbjct: 8   MVAELSALQQIMTALTGMDGLPMVIVQCVVATIYTSLGGFKISFITDNIQGAMVVCLIII 67

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     I+ S+ID+S L +++ LGWQLLYI+PVAV     F   FW RAF+SK D+
Sbjct: 68  ATITIGVKTDIDTSLIDSSGLTQASLLGWQLLYILPVAVLTNDFFLSNFWIRAFASKTDK 127

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGI 256
           +L +     ++++  +L  +G TG+IAVW+G L P +      +AFF L + LP WV GI
Sbjct: 128 DLWIGISIAAVVVLIILTLIGCTGLIAVWSGALGPDDIESSGSIAFFLLLERLPAWVVGI 187

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 316
            +V+ VS+S AA+D+  SA  +  SND+F N+L +   R   ++  VP +   LK   +L
Sbjct: 188 VLVMVVSLSTAAFDSFQSAMVSMGSNDLFRNKLNIWFIRAAVVLLIVPVIILALKAPSIL 247

Query: 317 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIE 376
           +++LI+DL +AS++P ++LGL D  Y+    +                +I+Y NA+ G +
Sbjct: 248 QIYLISDLFSASSIPVLILGLSDRFYWWRGFEVVVGGLGGIITVFIFGTIYYGNAQAGAD 307

Query: 377 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 436
           LI L  GLY  D+SV GAF+ AP+  + +    FG  + S   F+         P KPE 
Sbjct: 308 LILLEGGLYANDWSVFGAFVAAPVGGLLW---GFGAFVPSTHTFSYFSPSTISTPSKPET 364

Query: 437 V 437
           V
Sbjct: 365 V 365



>gi|50554165|ref|XP_504491.1| YALI0E27984p [Yarrowia lipolytica]
 gi|49650360|emb|CAG80094.1| YALI0E27984p [Yarrowia lipolytica CLIB122]
          Length = 495

 Score =  216 bits (551), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 139/397 (35%), Positives = 208/397 (52%), Gaps = 16/397 (4%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ EL+AV   + TLTG+D L  +I  A+ T++YT  GG   S  TDN QG         
Sbjct: 80  MVAELAAVQAAIETLTGIDALPVLIVEAVFTSIYTAVGGFHTSFFTDNFQGGMMLVLMVI 139

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     ++ S    S +L  N L  +L+YI+PVA++    F  GFW R F+SKN+ 
Sbjct: 140 VCVGLGVYFHVDPSEPAKSGMLGPNLLANKLIYILPVAIATNDCFLSGFWMRTFASKNNV 199

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-------GEENLESYLAFFTLFKVLP 250
           EL  +    S ++  VL  +GLTG++AVWA L         G+E   S LAFF + K +P
Sbjct: 200 ELFWACAIASSIVLIVLTVVGLTGLLAVWAKLEIDGQVFVYGDE--RSALAFFYVLKEMP 257

Query: 251 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGL 310
            WV G TV   +S+S A+YD+  SA  +  SND F N++P+   R + L  N P +   L
Sbjct: 258 GWVIGFTVAFVLSLSVASYDSSQSAMASTISNDFFRNKIPMVWVRLIVLCINAPVIVVAL 317

Query: 311 KDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHN 370
           K  +VL +FLIADL +A+ +P +  GL   +YF++  +                SI++ +
Sbjct: 318 KAPNVLNIFLIADLFSAAVIPIMFCGLSKRMYFISGWEVIGGGFGGMLTVFIFGSIYFKS 377

Query: 371 AKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVF 430
           A++GI+LI L  GLY  D+S  GAF+ AP+ S+ + F    VRL  + +++ I G+ F  
Sbjct: 378 AREGIKLIILLEGLYGDDWSAFGAFVAAPVGSLLWGFGILTVRLTVLKIYSLITGKPFTA 437

Query: 431 PKKPEVVDTK----KYAGNKFKDDTE---IIQSSDPD 460
             KP    T     +  G+   D+T    I+   DP+
Sbjct: 438 LDKPSDDKTGIAVIREIGHVEDDNTSESIILDRKDPN 474



>gi|396469553|ref|XP_003838434.1| hypothetical protein LEMA_P113700.1 [Leptosphaeria maculans JN3]
 gi|312215002|emb|CBX94955.1| hypothetical protein LEMA_P113700.1 [Leptosphaeria maculans JN3]
          Length = 871

 Score =  216 bits (550), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 128/364 (35%), Positives = 195/364 (53%), Gaps = 1/364 (0%)

Query: 72  IAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAX 131
           I   L ++ ELSA+  I+  LTG++ L  VI    +TT+YT +GG + S +TDNIQG   
Sbjct: 131 ITMFLYMVAELSALQQIVTLLTGLNGLPVVIVECTITTIYTSFGGFKVSFLTDNIQGVMV 190

Query: 132 XXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAF 191
                           I++S+ID S  L  + LGWQL+YI+PVA+     F  GFW R F
Sbjct: 191 LGLIIMGVIAVGVETNIDRSLIDQSGYLNPSLLGWQLIYILPVAILTNDFFLSGFWMRTF 250

Query: 192 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPD 251
           ++K D++L +     S  +  +L  LG+ G+++ W+G +   +     LAFF L + LP 
Sbjct: 251 AAKTDKDLWIGVSLASGGVLIILTLLGVAGLLSAWSGAYTIGDQENGSLAFFLLLEKLPA 310

Query: 252 WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLK 311
           WV GIT+V+ VS+S AA+D+  SA  +  SND F N+L + V R   +    P V   L+
Sbjct: 311 WVIGITLVMTVSLSTAAFDSFQSAMISTGSNDFFRNKLNIWVIRACVVALIFPVVVVALR 370

Query: 312 DLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-N 370
             D+LR+FLI+DL++A+ +P ++LGL +  Y+    D                 +FY  +
Sbjct: 371 SPDILRIFLISDLVSAAVVPCLVLGLSERFYWYRGFDFVIGGLGGIFTIFLFGLVFYDGD 430

Query: 371 AKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVF 430
                 L+ L  GLY  D+SV GAF+ AP   + +   + G+R+  +W+  K RG  F  
Sbjct: 431 VTMAGNLLLLESGLYADDWSVFGAFVAAPFGGLLWAMGACGLRISFLWIMAKARGRRFDA 490

Query: 431 PKKP 434
             +P
Sbjct: 491 LDRP 494



>gi|459369699|gb|EMG48026.1| Urea transporter, putative (Urea/polyamine transporter, putative)
           [Candida maltosa Xu316]
          Length = 522

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 131/385 (34%), Positives = 217/385 (56%), Gaps = 8/385 (2%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           +I ELSA+   + TLTG++ L  VI    VTT+YT +GG R S ITDN QG         
Sbjct: 137 MIGELSAIRGAIETLTGLNALGAVIVEVGVTTIYTFFGGFRVSFITDNFQGACVLILIII 196

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+S++D+
Sbjct: 197 CAAGMGSYIEIDTSKVGPSGLLKANKLGWQLVYILFVAILTNDCFMSGFWLRTFASRSDK 256

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGI 256
           +L +     ++++F V   +G  G +AVW+G L  G+EN   Y AFF L + +P W+   
Sbjct: 257 DLWIGTSIAAVVVFVVCTLVGTPGFLAVWSGDLTVGDEN--GYNAFFILLEKMPRWLVAF 314

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DV 315
            ++  + +S   +D+L SA  +  SNDIF N+L  N  R + ++  VP V   +K   ++
Sbjct: 315 VIIFCIVLSTCTFDSLQSAMVSTISNDIFRNKLHTNYVRGMLVLLMVPIVVLAVKVANNI 374

Query: 316 LRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDG 374
           L+++LIADL++A+ +P + LGL D+  +FL   D                +++Y +A++G
Sbjct: 375 LQIYLIADLVSAAVIPSVFLGLADAWFWFLTGFDVMVGGFGALLGVFVFGTVYYGSAREG 434

Query: 375 IELIGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 433
            +L+ +  G+Y + D+   GAF++AP+    FT +   +RL ++++++K+ G EF    +
Sbjct: 435 GKLLLIWNGIYDSEDWGAFGAFVIAPVGGTIFTLICAALRLGALYLYSKVSGSEFTALDR 494

Query: 434 PE--VVDTKKYAGNKFKDDTEIIQS 456
           PE  +V+ +   G    DD + ++ 
Sbjct: 495 PETVIVEHEPSKGLSQTDDDDSLKK 519



>gi|448515648|ref|XP_003867382.1| Dur3 urea transporter [Candida orthopsilosis Co 90-125]
 gi|380351721|emb|CCG21944.1| Dur3 urea transporter [Candida orthopsilosis]
          Length = 524

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/389 (33%), Positives = 219/389 (56%), Gaps = 10/389 (2%)

Query: 75  LLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXX 134
            L +I ELSA+ + +  LTG++ L  VI    VTT+YT +GG R S ITDN QG      
Sbjct: 134 FLFMIGELSAIRSAIEALTGLNALGAVIVECAVTTIYTFFGGFRVSFITDNFQGACVLIL 193

Query: 135 XXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSK 194
                    + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+SK
Sbjct: 194 VIICACGMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFMSGFWLRTFASK 253

Query: 195 NDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWV 253
            D++L +     +++ F +   +G TG +AVW+G L  G++  E Y AFF L   +P W+
Sbjct: 254 TDKDLWIGCSIAAVVTFVITSLVGTTGFLAVWSGDLQVGDD--EGYNAFFILLSHMPRWL 311

Query: 254 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 313
               ++  + +S   +D+L SA  +  SND+F N+L  N +R L +I   P V   +K  
Sbjct: 312 VAFVLIFCIILSTCTFDSLQSAFVSTISNDVFRNKLHTNWSRLLVVIMIFPIVVLAVKVA 371

Query: 314 D-VLRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNA 371
           D +L+++LIADL++A+ +P   LGL ++  +++   D                +++Y++A
Sbjct: 372 DNILQIYLIADLVSAAVIPAAFLGLSNTYFWWMRGFDVMCGGLGALLGVFVFGTVYYNSA 431

Query: 372 KDGIELIGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVF 430
           K+G +L+ +  GLY + D+   GAF++AP+  + F++++  VR+ +++V++KIRG  F  
Sbjct: 432 KEGGKLLLIWNGLYDSEDWGPFGAFVIAPVGGVVFSWVAAAVRISAVYVYSKIRGTPFTE 491

Query: 431 PKKPEVVDTKKYAGNK--FKDDTEIIQSS 457
             +P+  +   Y  N+  +  D  + Q+S
Sbjct: 492 LDRPD--EEPIYVDNQATYGADENVEQTS 518



>gi|380471757|emb|CCF47122.1| hypothetical protein CH063_15636 [Colletotrichum higginsianum]
          Length = 454

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/395 (33%), Positives = 210/395 (53%), Gaps = 18/395 (4%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+G ++  LT +D L  +I   ++TT+YT  GG R S +TDN+QG         
Sbjct: 59  MVAELSAIGQVVNALTSLDGLPVMIVQCVITTIYTSLGGFRISFLTDNLQGAMVVCLIII 118

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     I+ S+I+ S LLK   LGWQLLYI+P+ +     F  GFW R F+SK D+
Sbjct: 119 VAITMGVKTDIDTSLIETSGLLKPTLLGWQLLYILPICILTNDFFLSGFWLRTFASKTDK 178

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLFKVLPDWVSGI 256
           +LR+      +++  +L  +G+TG++A W+G  P ++  ES  +AFF L + +P WV GI
Sbjct: 179 DLRVGVSIAVVVILCILTMVGVTGLVAAWSGALPLDQISESGSVAFFLLLQRMPAWVVGI 238

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 316
            +V+  ++S AA+DTL SA  ++ SND+F NRL +   R   ++  +P V   LK   VL
Sbjct: 239 VLVMVCTLSTAAFDTLQSAMVSSASNDLFRNRLNIWWIRAGVVVIIIPTVVIALKAPSVL 298

Query: 317 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGI 375
           +++LI+DL++AS +P ++ GL D  Y+    +                 ++Y  +A+   
Sbjct: 299 QIYLISDLVSASVIPVLVFGLTDRFYWWRGFEVVAGGLGGILTVFLFGLVYYDGDAQKAG 358

Query: 376 ELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF------V 429
            L+ +  GLY  D+SV GAF+ AP+ S  + F + G RL   +   K  G  F      +
Sbjct: 359 NLLIISEGLYANDWSVFGAFVAAPVGSFLWGFAALGCRLGFQYAMAKKSGRRFDALDRPI 418

Query: 430 FP-------KKPEVVDTKKYAGNKFKDDTEIIQSS 457
            P         P  V+  +YA      D E+++ +
Sbjct: 419 GPGFTPEADGAPRYVERDEYAATS---DVEVVKPA 450



>gi|448084999|ref|XP_004195745.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
 gi|359377167|emb|CCE85550.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
          Length = 524

 Score =  213 bits (542), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 132/362 (36%), Positives = 206/362 (56%), Gaps = 6/362 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           +I EL+A+   + T+TG++ LA VI   +VT++YT  GG   S ITDN QG         
Sbjct: 137 MISELAAIRTAIETMTGLNALAAVIVECVVTSIYTSIGGFHVSFITDNFQGVLVLLLVVI 196

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+S++D+
Sbjct: 197 CAAGMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFMAGFWLRTFASRSDK 256

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGI 256
           +L +       + F +   +G+TG +AVW+G L  G+EN ++  AFF L   +P WV   
Sbjct: 257 DLIIGCSIAGFVTFVICSLVGVTGFLAVWSGDLEVGDENGQN--AFFILLSKMPAWVLAF 314

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DV 315
            ++  V++S   +D+L SA  +  SND+F N+L +N TR + +I  VP +   +K   D+
Sbjct: 315 VLIFCVALSTCTFDSLQSAMVSTISNDVFRNKLHINYTRIIVVIIIVPIIVLAIKVANDI 374

Query: 316 LRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDG 374
           L ++LIADL+++S +P ILLGL DS  +FL   D                 I+Y +A++G
Sbjct: 375 LTIYLIADLVSSSIIPIILLGLSDSYFWFLRGFDVMFGGLGAILAVFVFGCIYYQSAEEG 434

Query: 375 IELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 433
            +L+ L  GLY   D+   GAF++AP+ SI    +S  VR+ + +++ K +G+ F    +
Sbjct: 435 GKLLLLWNGLYDPEDWGPFGAFVIAPVGSILLALISASVRISATYLYCKWKGKSFHALDR 494

Query: 434 PE 435
           PE
Sbjct: 495 PE 496



>gi|406605512|emb|CCH43156.1| Sodium/glucose cotransporter 1 [Wickerhamomyces ciferrii]
          Length = 530

 Score =  213 bits (541), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 161/498 (32%), Positives = 247/498 (49%), Gaps = 61/498 (12%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS   +N ++YV   + L  G+  G+    +K  +L+  GTQ  + L  N+ AS +G  I
Sbjct: 4   LSHPAANAILYVTYGLLLISGVSIGWI-FHDKKTFLNVNGTQKGIPLAFNFVASGLGVGI 62

Query: 63  LYSFPEV------------------------------------------------GTIAG 74
           L ++P+V                                                G +AG
Sbjct: 63  LSTYPQVANTAGLQGLLVYALCGGLPMLLFSFLGPKIRKQCPDGFVLTEWVFHRFGPVAG 122

Query: 75  L-----------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 123
           L           L ++ +++++   + TLTG++ L  VI   +VT++YT  GG + S IT
Sbjct: 123 LYLSACTILTLFLFMVSDVASLQYAINTLTGLNALPVVIVECVVTSIYTAIGGFKVSFIT 182

Query: 124 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 183
           DNIQ                T I I+ S I  S LLK N LGWQL+YI+ +A+    LF 
Sbjct: 183 DNIQIATVFILIIIISCAMGTYIDIDTSKIPESGLLKGNKLGWQLIYILVIAIFTNDLFM 242

Query: 184 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 243
            GFW R F+SK D++L +     + ++  + V +G+ G+IAVWAGL    ++  S  +FF
Sbjct: 243 SGFWLRTFASKTDKDLWIGCSIAAFLMTCIAVIVGIPGIIAVWAGLVDVGDDGASGASFF 302

Query: 244 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 303
            +   LP WV G T+V   ++S     +L SA T+  SNDIF N++P+   R + ++  V
Sbjct: 303 IILTQLPSWVMGFTLVFIAALSTCTIGSLQSALTSTISNDIFRNKIPIMYIRVIVVLIIV 362

Query: 304 PAVYWGLKDL-DVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXX 362
           P +  GLK   DVL+++ IADLL+A+ +P ILLGL    YFL   +              
Sbjct: 363 PVIVVGLKVADDVLQIYFIADLLSAAVIPVILLGLSSYFYFLTVFEVIAGGLGGLLTVFI 422

Query: 363 XXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 422
             +I+Y NAKDG  L+ +  G+Y  D+S  GAF+ AP+ S+    +  G+RL+ + + +K
Sbjct: 423 FGTIYYGNAKDGGLLLIVNNGIYGNDWSAFGAFVAAPVGSLLAASIMLGLRLLVLKLISK 482

Query: 423 IRGEEFVFPKKPEVVDTK 440
             G+ F    KP+  DTK
Sbjct: 483 SSGKPFTALDKPKPKDTK 500



>gi|255732433|ref|XP_002551140.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240131426|gb|EER30986.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 530

 Score =  211 bits (538), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 127/355 (35%), Positives = 203/355 (57%), Gaps = 6/355 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           +I ELSA+   + TLTG++ L  VI    VTT+YT +GG R S ITDN QG         
Sbjct: 135 MIGELSAIRGAIETLTGLNALGAVIVEVGVTTIYTFFGGFRVSFITDNFQGVCVLILLII 194

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 + I I+K +I  S LLK N LGWQL+YI+ VA+     F  GFW R F+S++D+
Sbjct: 195 CACGMGSYIHIDKDLIGPSGLLKGNKLGWQLVYILFVAILTNDCFMSGFWLRTFASRSDK 254

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGI 256
           +L +     ++ +F +   +G+ G +AVW+G L  G++N   Y AFF L   +P+W+   
Sbjct: 255 DLWIGTSIAAVAVFVICTLVGVPGFLAVWSGDLTVGDDN--GYNAFFILLAKMPNWLLAF 312

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-V 315
            ++  + +S   +D+L SA  +  SND+F N+L  N  R + ++  VP V   +K  D +
Sbjct: 313 VLIFCIVLSTCTFDSLQSAMVSTISNDVFRNKLNTNWVRGMLVLLMVPIVVLAVKVADNI 372

Query: 316 LRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDG 374
           L+++LIADL++A+ +P I LGL DS  ++L   D                +++Y +AK+G
Sbjct: 373 LQIYLIADLVSAAIIPSIFLGLADSWFWYLRGFDIMVGGFGALLGVFVFGTVYYDSAKEG 432

Query: 375 IELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 428
            +L+ +  G+Y   D+   GAF++AP+  + F  L+   R+ S++V++KI G +F
Sbjct: 433 GKLLLIWNGIYDPEDWGAFGAFVIAPVGGVVFALLAAAARIGSLYVYSKITGNQF 487



>gi|189202288|ref|XP_001937480.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187984579|gb|EDU50067.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 440

 Score =  210 bits (534), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 122/377 (32%), Positives = 205/377 (54%), Gaps = 1/377 (0%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQG         
Sbjct: 55  MVAELSALQQIVNLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFVTDNIQGVMVIGLIIM 114

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                    +I++S+ID S  L+S+ LGWQL+YI+PVA+     F  GFW R F+++ D+
Sbjct: 115 GIIAVGVETKIDRSLIDKSGYLESSLLGWQLIYILPVAILTNDFFLSGFWMRTFAARTDK 174

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +L +     S+ +  +L  LG+ GM+A W+G +   +     LAFF L + LP WV G+ 
Sbjct: 175 DLWIGVSLASVGVLIILTLLGVGGMLAAWSGAYTIGDEANGSLAFFLLLETLPAWVVGVI 234

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ +S+S AA+D+  SA  +  SND F N+L + + R   +    P V   L+  D+L+
Sbjct: 235 LVMTISLSTAAFDSFQSAMISTGSNDFFRNKLNIWIIRACVVALIFPVVVVALRSPDILQ 294

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIE 376
           +FLI+DL++A+ +P +++GL D  Y+    D                 ++Y  +A    +
Sbjct: 295 IFLISDLVSAAVVPCLVIGLSDRFYWYRGFDFVVGGLGGVFTIFLFGLVYYDGDATKAGK 354

Query: 377 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 436
           L+ L  GLY  D+S  GAF+ AP   + + F +  +R+  +W+  +++G  F    +P  
Sbjct: 355 LLLLEGGLYGNDWSAFGAFVAAPFGGLLWAFGACALRISFLWIRARVQGTRFDAFDRPIP 414

Query: 437 VDTKKYAGNKFKDDTEI 453
           ++   + G+   + + +
Sbjct: 415 LNNDDHDGDAVLEHSSV 431



>gi|448080486|ref|XP_004194649.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
 gi|359376071|emb|CCE86653.1| Piso0_005156 [Millerozyma farinosa CBS 7064]
          Length = 524

 Score =  209 bits (532), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 131/362 (36%), Positives = 204/362 (56%), Gaps = 6/362 (1%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           +I EL+A+   + T+TG++ LA +I   +VT++YT  GG   S ITDN QG         
Sbjct: 137 MISELAAIRTAIETMTGLNALAAIIVECVVTSIYTSIGGFHVSFITDNFQGALVLLLVVI 196

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+S++DR
Sbjct: 197 CAAGMGSYIDIDTSKVAPSGLLKANKLGWQLVYILFVAILTNDCFMAGFWLRTFASRSDR 256

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGI 256
           +L +     + + F +   +G+TG +AVW+G L  G+ N  S  AFF L   +P W+   
Sbjct: 257 DLIIGCSLAAFVTFVICSLVGVTGFLAVWSGDLKVGDSNGSS--AFFILLSKMPAWLMAF 314

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL-DV 315
            ++  VS+S   +D+L SA  +  SND+F N+L +N TR + +I  VP +   +K   ++
Sbjct: 315 VLIFCVSLSTCTFDSLQSAMVSTISNDLFRNKLHINYTRIIVVIIIVPIIVLAIKVANNI 374

Query: 316 LRVFLIADLLAASTMPPILLGLIDS-LYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDG 374
           L ++LIADL+++S +P ILLGL D   +FL   D                 I+Y +AK+G
Sbjct: 375 LTIYLIADLVSSSIIPIILLGLSDRYFWFLRGFDVMFGGLGAILAVFVFGCIYYQSAKEG 434

Query: 375 IELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 433
            +L+ L  GLY   D+   GAF++AP+ SI    +S  VR+ + +++ K +G+ F    +
Sbjct: 435 GKLLLLWNGLYNPEDWGPFGAFVIAPVGSILLALISASVRISASYLYCKWKGKSFHALDR 494

Query: 434 PE 435
           PE
Sbjct: 495 PE 496



>gi|38567077|emb|CAE76374.1| hypothetical protein [Neurospora crassa]
          Length = 461

 Score =  209 bits (531), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 210/389 (53%), Gaps = 24/389 (6%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELS +G ++  LTG++ L  +I   ++TT+YT            NIQG         
Sbjct: 75  MVAELSGIGQVVEVLTGLNGLPVLIVECVITTIYT-----------YNIQGAMVIGLLVV 123

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                    +I+ S+I+ S LLK + LGWQLLYI+PVA+     F   FW R F+SK DR
Sbjct: 124 ASIAIGVETKIDTSLIEPSGLLKDSLLGWQLLYILPVAILTNDFFLSSFWLRTFASKTDR 183

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPG---EENLESYLAFFTLFKVLPDWVS 254
           +L +     ++ +  ++  +G TG+IA W+G+WPG   E  L   +AFF L + LP WV 
Sbjct: 184 DLWIGITLAALFILIIITMIGCTGLIAAWSGVWPGSDPENPLPGSVAFFGLLENLPAWVV 243

Query: 255 GITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD 314
           G  +V++V++S AA+D+L SA  ++ SND+F N+L +   R   ++  +P V   +K   
Sbjct: 244 GFVLVMSVTLSTAAFDSLQSAMVSSASNDLFRNKLSVWWIRVAVVLIIIPIVVLAIKAPS 303

Query: 315 VLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDG 374
           +L+++LI+DL++A+T+P +++GL D  Y+    +                +I+Y++A  G
Sbjct: 304 ILQIYLISDLVSAATIPVLIVGLSDRCYWWRGFEVVVGGLGGIFTVFIFGAIYYNDAYKG 363

Query: 375 IELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 434
            +LI L  G+Y   ++  GAF+ AP+  + + F +  +RL   WV  K +G  F    +P
Sbjct: 364 AQLILLEDGIYQEGWAAFGAFVAAPVGGLLWGFGALALRLAVQWVQAKRKGVRFDALDRP 423

Query: 435 EVVDTKKYAGNKFKDDTEIIQSSDPDEIE 463
            VV++          D+E IQ     ++E
Sbjct: 424 VVVES----------DSEAIQYVAGGDLE 442



>gi|363755328|ref|XP_003647879.1| hypothetical protein Ecym_7216 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356891915|gb|AET41062.1| hypothetical protein Ecym_7216 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 517

 Score =  207 bits (526), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 161/520 (30%), Positives = 243/520 (46%), Gaps = 73/520 (14%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS V SN +I+    + L       Y K  +K+ +LS+ G+Q AV L  N+ AS +G S+
Sbjct: 4   LSSVASNAIIWPTYIVMLVSASAIAYWKHDSKT-FLSANGSQRAVPLALNFIASGVGCSV 62

Query: 63  LYSFPEV------------------------------------------------GTIAG 74
           L ++PE+                                                GT+AG
Sbjct: 63  LVAYPEMANVAGLQGLLVYALTSALPMYVFAVFGPQIKKKCPNGFMLTEWVFQRYGTVAG 122

Query: 75  L-----------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 123
           L           L ++ E++++   + TLT    LA VI   +VTT+YT  GG   S IT
Sbjct: 123 LYLSACTILTLFLFMVSEIASLKQAVETLTKGGGLAVVIVECVVTTIYTTIGGFNISFIT 182

Query: 124 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 183
           D++Q                  +++++S+I+ S LLK   LGWQL+YI+ VA+     F 
Sbjct: 183 DSLQTLVFLFIWIISAIAFGCYVKVDRSLIEPSGLLKPTRLGWQLIYILTVAIFTNDFFL 242

Query: 184 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP-GEENLESYLAF 242
            GFW R F++K+D++L +     + +L    V +G TG++AVW G  P G E+  S  AF
Sbjct: 243 SGFWLRTFAAKSDKDLLIGCSLAAGILVFFFVVVGFTGILAVWGGYVPIGSEDPGS--AF 300

Query: 243 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 302
           F L   LP W+ G+ +   + +S    D+L SA  +  SND+F N+LPL  TR +  I  
Sbjct: 301 FVLLSELPSWIMGLVLTFVLVLSTCTLDSLQSALVSTISNDLFKNKLPLMYTRAIVGIVM 360

Query: 303 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXX 362
           +P V  GL   DVL +FLI DLL+++ +P ++LGL   + FL   +              
Sbjct: 361 IPVVIVGLIATDVLTIFLIVDLLSSAVVPVLMLGLWSKMDFLTAWEIIGGGLGGLFCVFL 420

Query: 363 XXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 422
             + +Y N +DG  L+ +  GLY  D+   GA + AP  S+   F    +R  S  ++ +
Sbjct: 421 FGTAYYGNTRDGGRLLLISDGLYKNDWGAFGAMVAAPFGSLLVGFSILAIR--SAVIYLR 478

Query: 423 IRGEEFVFPKKPEVVDTKK--YAGNKF-KDDTEIIQSSDP 459
            R       KKP  V T+K  Y    + K D   I S  P
Sbjct: 479 CRTT-----KKPFTVFTRKIVYHDQIYSKQDDVSITSKSP 513



>gi|366999438|ref|XP_003684455.1| hypothetical protein TPHA_0B03510 [Tetrapisispora phaffii CBS 4417]
 gi|357522751|emb|CCE62021.1| hypothetical protein TPHA_0B03510 [Tetrapisispora phaffii CBS 4417]
          Length = 565

 Score =  206 bits (524), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 145/455 (31%), Positives = 236/455 (51%), Gaps = 35/455 (7%)

Query: 30  KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIIELSAVGNIL 89
           + K    ++ S    +   + + W+ S+     +Y F           ++ EL+++   +
Sbjct: 100 RKKTPHGFILSEWVFHRFGIAAGWYLSACTILTMYLF-----------MVSELASLKYAV 148

Query: 90  VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIE 149
            TLTG+  L  VI   +VT++YT  GG + S +TD +Q                + I I+
Sbjct: 149 ETLTGIKALPVVIIECVVTSIYTTVGGFKISFLTDTLQVSIVFILLIIVSCAMGSYISID 208

Query: 150 KSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIM 209
           KS I+ S LLK+N LGWQL+YI+ +A+    LF  GFW R F+S++D++L +     + +
Sbjct: 209 KSKIEPSGLLKANRLGWQLIYILTIAIFTNDLFLNGFWLRTFASRSDKDLLIGCSIAAFL 268

Query: 210 LFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAY 269
           L  ++  +G+TG IAVWAG     +   S  AFF L   LP WV G T+V  + +S    
Sbjct: 269 LTAIVTVVGVTGFIAVWAGFVEVADEENSGAAFFILLAQLPSWVMGFTLVFVLILSTCTL 328

Query: 270 DTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAAST 329
           D+L SA  +  SND+F N++P+  TR + ++  VP V  GL   DVL ++LI DLL++S 
Sbjct: 329 DSLQSALVSTISNDVFRNKIPILYTRIIVVVIMVPVVVVGLIAEDVLSIYLIVDLLSSSV 388

Query: 330 MPPILLGL---IDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYI 386
           +P ++LGL    DS ++  W +                +I+YH+A++G +L+ +  GLYI
Sbjct: 389 VPVLVLGLWSKFDS-FWTAW-EVIGGGLAGIFGVWVYGTIYYHSAREGGKLLLIWNGLYI 446

Query: 387 TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVD-------- 438
            D+   GAF+VAP++S+  +F+   +RL S+ ++   + +  V  +  +V D        
Sbjct: 447 QDWGAFGAFVVAPVASMVISFIILAIRLYSIKLY---QADTTVGHRFRDVCDSLGKITGI 503

Query: 439 -----TKKYAGNKF---KDDTEIIQSSDPDEIEIR 465
                T KY  NK     D +E I  S    +EI+
Sbjct: 504 TWLYRTTKYWDNKLIKELDYSEAISDSSEGIVEIQ 538



>gi|255718783|ref|XP_002555672.1| KLTH0G14718p [Lachancea thermotolerans]
 gi|238937056|emb|CAR25235.1| KLTH0G14718p [Lachancea thermotolerans CBS 6340]
          Length = 535

 Score =  206 bits (524), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 146/500 (29%), Positives = 230/500 (46%), Gaps = 67/500 (13%)

Query: 32  KNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEV---------------------- 69
           K+   +LS+ GTQ  V L  N+ AS++G  +  ++P++                      
Sbjct: 32  KDAKTFLSANGTQKGVPLAFNFVASALGVGVFTTYPQIANISGLHGLLVYALAGGLPMFL 91

Query: 70  --------------------------GTIAGL-----------LGVIIELSAVGNILVTL 92
                                     G + GL           L ++ EL+++   + +L
Sbjct: 92  FAFFGPVIRRKVPNGFVLTEWVFQRYGKVCGLYLSACTILTLYLFMVSELASLKFCIQSL 151

Query: 93  TGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSV 152
           T V  L  VI   +VTT+YT  GG   S ITD++Q                + I I+ S 
Sbjct: 152 TTVRALPVVIVECVVTTIYTTVGGFHISFITDSMQVSVVFALLVVVACAMGSYIHIDTSK 211

Query: 153 IDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFP 212
           I  S LLK N LGWQL+YI+ VA+     F  GFW R F++++DR+L +      ++L  
Sbjct: 212 IGPSGLLKQNKLGWQLVYILVVAIFTNDFFMSGFWLRTFAARSDRDLLIGCSLAFVVLVI 271

Query: 213 VLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTL 272
           ++  +G+TG IAVWAGL    +      +FF L   +PDWV G  +  AV +S    D+L
Sbjct: 272 MVSLIGVTGFIAVWAGLVDVADQDLGGSSFFVLLTAMPDWVMGFVLAFAVVLSTCTLDSL 331

Query: 273 ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPP 332
            SA  +  SND+F N+LPL   R L  +  VP V  GL   DVL +FLI DLL+++ +P 
Sbjct: 332 QSALVSTISNDVFRNKLPLVYARGLVALIMVPVVVVGLIAEDVLSIFLIVDLLSSAVVPV 391

Query: 333 ILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI----GL----PLGL 384
           ++LGL    +FL+  +                +++Y + ++G  L+    GL      G+
Sbjct: 392 LMLGLSSRFFFLSAWEVVGGGLGGIFAVWIFGTVYYDSPREGGRLLLVSNGLYGQDSKGV 451

Query: 385 YITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEVVDTKKYAG 444
           Y  D+S  GAF+VAP   I   FL   +R    +   ++   +F   KK  +V+  ++  
Sbjct: 452 YGNDWSAFGAFVVAPFGGILVGFLILAIRTAVNYTRCRMHNLKFNMYKKTALVEEPEHNE 511

Query: 445 NKFKDDTEIIQSSDPDEIEI 464
              ++D  I ++      E+
Sbjct: 512 PVLEEDATIKKTFTSRTSEV 531



>gi|471566473|gb|EMR66770.1| putative urea transporter protein [Eutypa lata UCREL1]
          Length = 522

 Score =  206 bits (523), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 130/389 (33%), Positives = 218/389 (56%), Gaps = 10/389 (2%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+G ++  LTG+  L  +I   ++TT+YT  GG   S +TDN+QG         
Sbjct: 134 MVAELSAIGQVINALTGLYGLPVIIVECVITTIYTSLGGFTISFLTDNVQGAMVCCLIII 193

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                   + I+  ++  S LL ++ +GWQ++YI+P+A+     F   FW RAF+S+ D+
Sbjct: 194 AAVTVGVKVDIQPDLVKGSPLLDASLIGWQIIYILPIAILTNQFFLANFWLRAFASRTDK 253

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE-SYLAFFTLFKVLPDWVSGI 256
           +L +     S ++F VL+ +G TG+IAVW+G +PG+   E   +AFF L + LP+WV GI
Sbjct: 254 DLWVGLGIASFVIFCVLLLVGFTGLIAVWSGAFPGDPPAEDGSIAFFLLLEQLPNWVVGI 313

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 316
            +V+ V++S AA+D+L SA  ++ SND+F NRL +   R   ++  +P V   ++   +L
Sbjct: 314 VIVMVVTLSTAAFDSLQSAMVSSASNDVFRNRLNIWWIRAGVVLIIIPVVVIAIQAPGIL 373

Query: 317 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIE 376
           +++LI+DLL+A+ +P +++GL +  YF    +                +I+Y +AK G E
Sbjct: 374 QIYLISDLLSAAVIPVLVIGLSERFYFWRGFEVVVGGLGGILTVFIFGTIYYDSAKQGGE 433

Query: 377 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF-VFPKKPE 435
           LI L  GLY  D+   GAF+ AP+  + +  ++   RL    + +KI G  F  F +  E
Sbjct: 434 LILLQQGLYTGDWGAFGAFVAAPVGGVVWGCIALAFRLTIQLLQSKIAGRRFDAFDRPIE 493

Query: 436 VVDTKKYAGNKFKDDTEIIQSSDPDEIEI 464
           V   ++Y  +   +D  I    + DE+ +
Sbjct: 494 V--QRQY--DSLPEDAAI----NGDEVPM 514



>gi|126137249|ref|XP_001385148.1| urea transport protein [Scheffersomyces stipitis CBS 6054]
 gi|126092370|gb|ABN67119.1| urea transport protein [Scheffersomyces stipitis CBS 6054]
          Length = 520

 Score =  204 bits (519), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 125/362 (34%), Positives = 199/362 (54%), Gaps = 6/362 (1%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+   + TLTG+D L  VI   IVTT+YT  GG + S ITDN QG            
Sbjct: 140 ELSAIRGAIETLTGLDALGAVIVECIVTTIYTSIGGFKISFITDNFQGALVIILIIICGA 199

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + I I+ S +  S LLK+N LGWQL+YI+ VA+     F  GFW R F+S+ D++L 
Sbjct: 200 GMGSYIDIDTSKVGPSGLLKANKLGWQLVYILFVAIVTNDCFLSGFWLRTFASRTDKDLW 259

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVV 259
           +     +   F +   +G TG +AVW+G L   ++N   Y AFF L   +P W+    ++
Sbjct: 260 IGTSIAAFATFAICTLVGTTGFLAVWSGDLEVSDDN--GYNAFFILLAKMPRWIVAFVLI 317

Query: 260 LAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRV 318
             + +S   +D+L S   +  SND+F N+L +N TR L ++  VP V   +K  D +L++
Sbjct: 318 FCICLSTCTFDSLQSGMVSTISNDVFRNKLHINYTRGLVVLVMVPIVVLAVKVADNILQI 377

Query: 319 FLIADLLAASTMPPILLGLIDSLY-FLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +LIADL++A+ +P + LGL D+ + ++   D                +++Y  A++G +L
Sbjct: 378 YLIADLVSAAIIPAVFLGLSDTCFWYIRGFDVMCGGLGALIGVFIFGTVYYGTAREGAKL 437

Query: 378 IGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 436
           + +  G+Y   D+   GAF++AP   +  TF +  +R+ + +V+ K+ G  F    KPE+
Sbjct: 438 LLIWNGIYDPEDWGAFGAFVIAPFGGLVITFAAAALRIGAAYVYAKVSGNTFSALDKPEI 497

Query: 437 VD 438
           V+
Sbjct: 498 VE 499



>gi|156847319|ref|XP_001646544.1| hypothetical protein Kpol_1055p41 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117222|gb|EDO18686.1| hypothetical protein Kpol_1055p41 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 573

 Score =  203 bits (516), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 191/340 (56%), Gaps = 5/340 (1%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           E++++   + TLTG++ L  +I   +VT++YT  GG   S +TD IQ             
Sbjct: 140 EVASLKYAIETLTGINALPVIIIECVVTSIYTSIGGFNISFLTDTIQVSIVFILLIIVAC 199

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + + I+KS+I  S LLK+N LGWQL+YI+PVAV    LF  GFW R F+++++++L 
Sbjct: 200 AMGSYVDIDKSLIGPSGLLKANKLGWQLVYILPVAVFTNDLFMSGFWLRTFAARSNKDLL 259

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
           +       +L   +  +G+TG IAVWAG     +   S  AFF L   LP WV G T+V 
Sbjct: 260 IGCSIACFILVAFVTVVGVTGFIAVWAGFVSVADQENSGAAFFILLAQLPSWVMGFTLVF 319

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
            + +S    D+L SA  +  SNDIF N+LP+ + R + +   VP V  GL   DVL ++L
Sbjct: 320 ILVLSTCTLDSLQSALVSTVSNDIFRNKLPILIVRGIVIAIMVPVVVVGLIAQDVLTIYL 379

Query: 321 IADLLAASTMPPILLGL---IDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           I DLL++S +P +++GL   +D+++   W +                SI+YH+AK+G +L
Sbjct: 380 IVDLLSSSVVPVLVIGLWSKMDNIW-TAW-EVISGGVGGILGVFIFGSIYYHSAKEGGKL 437

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISM 417
           + +  GLY+ D+S  GAF+VAP + I  +      RL S+
Sbjct: 438 LIISNGLYVDDWSTFGAFVVAPGAGIVTSLGVLAFRLSSI 477



>gi|429848401|gb|ELA23890.1| urea transporter [Colletotrichum gloeosporioides Nara gc5]
          Length = 458

 Score =  203 bits (516), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 143/466 (30%), Positives = 218/466 (46%), Gaps = 97/466 (20%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN +IYV   +FL  G    +K + ++K ++LS   TQ A  L  N+ AS++GS IL+S+
Sbjct: 9   SNAIIYVTYGLFLITGTAIAWKFRNQSKGEFLSGNRTQTAFPLALNFIASALGSGILFSY 68

Query: 67  PEV------------------------------------------------GTIAGL--- 75
           PE+                                                GTIA L   
Sbjct: 69  PELATITGVQGVVVYALSSSLPLLIFAVLGPIIRRKTPEGFVLTAWTRQRYGTIAMLYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSA+G ++  LT +D L  +I   ++TT+YT  GG + S ITDN+Q
Sbjct: 129 FMTLVTLFLYMVAELSAIGQVVNALTSLDGLPVMIVQCVITTIYTSLGGFKISFITDNLQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                   I+ S+ID S LLK   LGWQLLYI+P+ +     F  GFW
Sbjct: 189 GAMVVCLIIIVAITMGVKTEIDTSLIDTSGLLKPTLLGWQLLYILPICILTNDFFLSGFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLES-YLAFFTLF 246
            R F+SK DR+LR+       ++  VL  +G+TG++A W+G  P ++  +S  +AFF L 
Sbjct: 249 LRTFASKTDRDLRIGVSIAVAVILCVLTMVGVTGLVAAWSGALPLDQIADSGSVAFFLLL 308

Query: 247 KVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV 306
           + LP WV GI +V+  ++S AA+D+L SA   +                           
Sbjct: 309 QQLPAWVVGIVLVMVCTLSTAAFDSLQSAMAPS--------------------------- 341

Query: 307 YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSI 366
                   VL+++LI+DL++AS +P ++ GL+D  Y+    +                 +
Sbjct: 342 --------VLQIYLISDLVSASVIPVLVFGLVDRFYWWRGFEVVVGGLGGILTVFLFGLV 393

Query: 367 FYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFG 411
           FY  +A+    L+ +  GLY  D+SV GAF+ AP+ S  + F + G
Sbjct: 394 FYEGDAQKAANLLIISEGLYADDWSVFGAFVAAPVGSFLWGFGALG 439



>gi|50551147|ref|XP_503047.1| YALI0D19866p [Yarrowia lipolytica]
 gi|49648915|emb|CAG81239.1| YALI0D19866p [Yarrowia lipolytica CLIB122]
          Length = 504

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 132/369 (35%), Positives = 198/369 (53%), Gaps = 5/369 (1%)

Query: 76  LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXX 135
           L ++ ELSAV   + TL GVD L  +I  AI T++YT  GG   S  TDNIQG       
Sbjct: 57  LYMVAELSAVQAAIETLAGVDALPVLIVEAIFTSIYTAVGGFHTSFFTDNIQGGMVLILL 116

Query: 136 XXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 195
                       ++ S    S +L+ N L  +L+YI+PVA++    F  GFW R F+SKN
Sbjct: 117 IIVCVGLGVYFHVDPSEPKKSGMLEPNLLANKLIYILPVAIATNDCFLSGFWMRTFASKN 176

Query: 196 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW-PGEE----NLESYLAFFTLFKVLP 250
           +REL  +    +++   +L  LGLTG++AVWA +   GE+    +  S  AFF +   +P
Sbjct: 177 NRELFWACAIATVLTLVILTVLGLTGLLAVWAKMVVDGEQFVYGDERSANAFFYVLLEMP 236

Query: 251 DWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGL 310
            WV G T+   +S+S AAYD+ +SA  +  SND F N++P+   R + L  N P +   +
Sbjct: 237 GWVIGFTIAFTLSLSVAAYDSNVSAMASTISNDFFRNKVPMVWVRLIVLCINAPVIVVAI 296

Query: 311 KDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHN 370
           K  +VL +FLIADL +A+ +P +  GL   +YF+   +                SI++ N
Sbjct: 297 KAPNVLNIFLIADLFSAAVIPIMFCGLSRKMYFITGWEVIGGGFGGMITVFIFGSIYFKN 356

Query: 371 AKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVF 430
           A +GI+L+ L  GLY  D+S  GAF+ AP+ SI + F    +RL  + +++ I  + F  
Sbjct: 357 AHEGIKLLILLQGLYGDDWSAFGAFVAAPVGSILWGFGILIIRLTVLKIYSMISKKPFTA 416

Query: 431 PKKPEVVDT 439
             KP+   T
Sbjct: 417 LDKPDPTQT 425



>gi|50305545|ref|XP_452732.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641865|emb|CAH01583.1| KLLA0C11913p [Kluyveromyces lactis]
          Length = 529

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 127/390 (32%), Positives = 206/390 (52%), Gaps = 9/390 (2%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+++   + +LT +  L  +I   +VTT+YT  GG   S ITD IQ             
Sbjct: 142 ELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHISFITDTIQVSIVFILLIIVSC 201

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + + I+KS+I  S LLK+++LGWQL+YI+ VA+     F  GFW R F+++ D++L 
Sbjct: 202 AMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTNDFFMSGFWLRTFAARTDKDLM 261

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
           +     +++L   +  +G+TGMIAVWAG  P  +   S  AFF +   +P WV G  +  
Sbjct: 262 IGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSGAAFFIVLTQMPGWVIGFVLAF 321

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
            V +S    D+L SA  +  SNDIF N+LP+   R + ++  VP V  GL   DVL ++L
Sbjct: 322 VVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRGIVVLIMVPVVVVGLIADDVLTIYL 381

Query: 321 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGL 380
           I DLL++S +P ++LGL     FL   +                +++Y + ++G +L+ +
Sbjct: 382 IVDLLSSSVVPILMLGLSSKFDFLTAWEIIGGGFGGLLSVWIFGTVYYDSPREGGKLLLI 441

Query: 381 PLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK-------IRGEEFVFPKK 433
             GLY  D++  GAF+VAP   + F F    VR I +++  K       +  ++F++  +
Sbjct: 442 WNGLYADDWAAFGAFVVAPFGGLIFGFFVLFVRTIIVYIDCKKNNKPFDLYSKKFIYRHE 501

Query: 434 PEVVDTKKYAGNKFKDDTEIIQSSDPDEIE 463
            EV  T    G+K K  T + +  + + +E
Sbjct: 502 GEVQSTTT-DGDK-KSFTSVERELETESVE 529



>gi|169594868|ref|XP_001790858.1| hypothetical protein SNOG_00164 [Phaeosphaeria nodorum SN15]
 gi|160700958|gb|EAT91659.2| hypothetical protein SNOG_00164 [Phaeosphaeria nodorum SN15]
          Length = 395

 Score =  198 bits (504), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 203/380 (53%), Gaps = 1/380 (0%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  I+  LTG++ L  VI    VTT+YT  GG + S +TDNIQG         
Sbjct: 5   MVAELSALQQIVTLLTGLNGLPVVIVECAVTTIYTSLGGFKVSFLTDNIQGVMVLGLIIM 64

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                     I++S+ID S  LK + LGWQL+YI+PVA+     F  GFW R F+++ D+
Sbjct: 65  GVIAVGVETNIDRSLIDQSGYLKPSLLGWQLIYILPVAILTNDFFLSGFWLRTFAARTDK 124

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +L +     S  +  +L  +G+ G++A W+G     +    Y++ F L + LP WV G+ 
Sbjct: 125 DLWIGVSLASFGVLVILTLVGVAGLLAAWSGALQLGDAEGGYISLFLLLQQLPSWVVGVV 184

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ +S+S AA+D+  SA  +  SND+F N+L + V R   ++  +P V   L+  D+L+
Sbjct: 185 LVMVMSLSTAAFDSFQSAMVSTGSNDLFRNKLNIWVIRGCVVLIIIPVVVVALRSPDILQ 244

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKDGIE 376
           +FLI+DL++A+ +P +++GL +  Y+    D                 ++Y  +     +
Sbjct: 245 IFLISDLVSAAVVPCLVIGLSEKFYWYRGFDFVIGGLGGIFTIFLFGLVYYDGDVTQAGK 304

Query: 377 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPEV 436
           L+ L  GLY  D+S  GAF+ AP   + + F +  +R+  +W+  +++G  F    KP  
Sbjct: 305 LLLLENGLYANDWSAFGAFVAAPFGGLLWAFGACALRIGFLWIMARVKGHRFDAFDKPVP 364

Query: 437 VDTKKYAGNKFKDDTEIIQS 456
             T +      +++  +++ 
Sbjct: 365 RHTARLGAFDEQENDAVLEH 384



>gi|366987111|ref|XP_003673322.1| hypothetical protein NCAS_0A03750 [Naumovozyma castellii CBS 4309]
 gi|342299185|emb|CCC66933.1| hypothetical protein NCAS_0A03750 [Naumovozyma castellii CBS 4309]
          Length = 579

 Score =  192 bits (488), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 149/493 (30%), Positives = 231/493 (46%), Gaps = 68/493 (13%)

Query: 2   MLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSS 61
           +LS V +N +I+    + L       Y K  +KS +LSS GTQ A+ L  N+ AS +G  
Sbjct: 3   ILSAVTANAIIWPTYMVLLISASAIAYWKRDSKS-FLSSNGTQKALPLAFNFVASGLGCG 61

Query: 62  IL------------------------------------------------YSFPEVGTIA 73
           +L                                                + F   G I 
Sbjct: 62  VLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVFHRFGLIC 121

Query: 74  G-----------LLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 122
           G            L ++ E++++   + T+T +  L  +I   +VTT+YT  GG   S I
Sbjct: 122 GWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIGGFNISFI 181

Query: 123 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLF 182
           TD +Q                + I I++S+I  S LLK N LGWQL+YI+  A+     F
Sbjct: 182 TDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFAIFTNDFF 241

Query: 183 HEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAF 242
             GFW R F+S++D++L +      ++L      +G+TG IAVWAGL    +   S  AF
Sbjct: 242 MSGFWLRTFASRSDKDLMIGCSVACVILVVFCTVVGVTGFIAVWAGLVQVADEENSGAAF 301

Query: 243 FTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIAN 302
           F L   LP WV G T+V    +S    D+L SA  +  SND+F NRL +   R + ++  
Sbjct: 302 FILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWVRGIVVLIM 361

Query: 303 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL---IDSLYFLNWIDXXXXXXXXXXX 359
           VP V  GL   +VL ++LI DLL++S +P ++LG     D L+   W +           
Sbjct: 362 VPVVVVGLIAENVLNIYLIVDLLSSSVVPVLVLGFWSKFDDLW-TAW-EVIGGGLGGILS 419

Query: 360 XXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWV 419
                +++YH+A++G  L+ +  GLY+ D+S  GAF+VAP   + F+     +RLI + +
Sbjct: 420 VWIFGTVYYHSAREGGRLLLISNGLYVDDWSTFGAFVVAPGGGLVFSGFILVIRLICVRL 479

Query: 420 FTKIRGEEFVFPK 432
           +   + EE +F +
Sbjct: 480 Y---KDEEGLFHR 489



>gi|344233479|gb|EGV65351.1| hypothetical protein CANTEDRAFT_119625 [Candida tenuis ATCC 10573]
          Length = 518

 Score =  191 bits (486), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 131/383 (34%), Positives = 204/383 (53%), Gaps = 12/383 (3%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELS+V   + TLTG+D L  VI   +VTT+YT  GG + S ITDN QG         
Sbjct: 137 MVAELSSVSLAIETLTGLDALGAVIVECVVTTIYTSVGGFKVSFITDNFQGALVLLLIII 196

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                 + I I+ S I  S LL++N LGW+L+Y+  VAV     F   FW R F+SK+DR
Sbjct: 197 CAAGMGSYIDIDTSKIGPSHLLQANKLGWELIYVFFVAVGTNAFFLNSFWLRTFASKSDR 256

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGI 256
            L +     ++++  +   +G+ G +AVW+G L  G+EN    +AFF L   +P W+   
Sbjct: 257 GLAIGTSVSAVIVMVICTLVGVPGFLAVWSGDLTVGDEN--GSMAFFILLAKMPGWIIAF 314

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-V 315
            ++  +++S   +D+L SA  +  SNDIF NRL     R + +I  VP V   +K  D +
Sbjct: 315 VLIFTITISTCTFDSLQSAFVSTISNDIFRNRLKTIWVRAMVVIMIVPIVVLAVKVADNI 374

Query: 316 LRVFLIADLLAASTMPPILLGLIDSLY-FLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDG 374
           L+++LIADL+++S +P I LGL D  + FL  +D                +++Y  AK+G
Sbjct: 375 LQIYLIADLISSSIIPIIFLGLSDRFFWFLTGVDVMVGGLGALVAIFIFGTVYYGTAKEG 434

Query: 375 IELIGLPLGLY-ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKK 433
            +L+ +  GLY   D+   GAF++AP   I    +    R+ ++WV+ KI  + F   ++
Sbjct: 435 GKLLLIWNGLYDAEDWGAFGAFVIAPFGGILIALVCVVARVGAIWVYCKITKKPFTALQR 494

Query: 434 P---EVVDTK---KYAGNKFKDD 450
           P   E+V+ +    Y     K D
Sbjct: 495 PVPVEIVEEEFDSAYGSTNAKSD 517



>gi|465795812|emb|CCV00245.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 545

 Score =  191 bits (486), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 130/374 (34%), Positives = 200/374 (53%), Gaps = 10/374 (2%)

Query: 78  VIIELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXX 136
           +I+EL+  G I+ T+   + K+ P + IAI TT+YT YGG +ASL TDN           
Sbjct: 82  MIVELNTYGLIVQTIVPSMSKIIPPLIIAITTTIYTMYGGFKASLWTDNFNAVVVVVFII 141

Query: 137 XXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 196
                 +  + ++   + +  LL +++ G +L YI+ V++ FA +F++GFWQRAF+SK +
Sbjct: 142 IGAVMFSVKLDLDSERVHDPRLLGAHAFGGELWYILTVSIVFAQMFNQGFWQRAFASKTN 201

Query: 197 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW--PGEENLESYLAFFTLFKVLPDWVS 254
             L +S    SI LF +   +G+ G +A WA +   P +E+ +   A F     +P WV 
Sbjct: 202 MGLYVSVALASIPLFAICFLVGMAGPLAYWAHVQELPNDED-DGSNALFNALLYMPKWVH 260

Query: 255 GITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD 314
           G+ +VL   +S +AYDT  SA  +   +D+F  RL +   R L L+ NVP V   L  +D
Sbjct: 261 GLVLVLTGVLSSSAYDTFQSAQISVIQSDLFLGRLNIWWCRVLLLLLNVPCVVLALIQID 320

Query: 315 VLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-NAKD 373
           +L+VFLIADL   + +P + +GLI      N  D                +I+YH +A  
Sbjct: 321 ILQVFLIADLAGLAVIPAVFMGLIPGFDVFNGFDVVVGGCGGFLTVFVFGTIYYHGDAIR 380

Query: 374 GIELIGLPLGLY-----ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEF 428
           G +LIGLP GLY      +DYSV+GAF+ AP+  + F   S G+R++  W + +   + F
Sbjct: 381 GGQLIGLPDGLYGVDADASDYSVIGAFLAAPVGDLCFALASCGLRILVGWAYARYTNQPF 440

Query: 429 VFPKKPEVVDTKKY 442
              +K E     KY
Sbjct: 441 TMLQKREEYRMDKY 454



>gi|453084248|gb|EMF12293.1| hypothetical protein SEPMUDRAFT_46200, partial [Mycosphaerella
           populorum SO2202]
          Length = 475

 Score =  191 bits (486), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 204/371 (54%), Gaps = 6/371 (1%)

Query: 60  SSILYSFPEVGTIAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRA 119
           +S+  SF    TI   L ++ ELSA+  ++  LTG++ L  +I  A +TT YT  GG R 
Sbjct: 64  TSLYLSFFSCATI--WLYMVAELSALQQVVNLLTGLNGLPALIVQAAITTTYTALGGFRV 121

Query: 120 SLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFA 179
           S +TDNIQG                ++ I++S+I  S+ L+ + LGWQLLYI+PVA+   
Sbjct: 122 SFVTDNIQGAMVLLFLIVGTIAIGVTVDIDRSLIPVSNYLEPSLLGWQLLYILPVAILTN 181

Query: 180 TLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY 239
             F   FW RAF++K D++L +     ++ +  +   +G++G+IA W+G+  G     S 
Sbjct: 182 DFFLSNFWLRAFAAKTDKDLYIGVSIAAVAVTIITTLVGVSGLIAGWSGVL-GNPPEASG 240

Query: 240 LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 299
           +  FTL + LP WV GI +V+ V++S +A+D+L SA  +  SND F N+L +   RF  +
Sbjct: 241 IELFTLLETLPTWVVGIVLVMVVTLSISAFDSLQSALISTGSNDFFRNKLNIWWVRFFVV 300

Query: 300 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXX 359
           +  +P V   LK   VL+++LI+D+++A+ +P +++GL    YF    +           
Sbjct: 301 LLIIPTVVVALKSPSVLQIYLISDIISAAMIPCLVIGLSSKFYFWRGFEVVVGGLGGILS 360

Query: 360 XXXXXSIFYHN--AKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISM 417
                 ++Y    ++ G  LI L  GLY +D+SV G F+ AP+  + +   +F  R+  +
Sbjct: 361 VFLFGLVYYDGDVSRAGSLLI-LSDGLYASDWSVFGVFVAAPVGGLLWALAAFVARISVL 419

Query: 418 WVFTKIRGEEF 428
           W   K++G  F
Sbjct: 420 WTVAKVKGHRF 430



>gi|365985345|ref|XP_003669505.1| hypothetical protein NDAI_0C06030 [Naumovozyma dairenensis CBS 421]
 gi|343768273|emb|CCD24262.1| hypothetical protein NDAI_0C06030 [Naumovozyma dairenensis CBS 421]
          Length = 573

 Score =  187 bits (474), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 149/458 (32%), Positives = 220/458 (48%), Gaps = 63/458 (13%)

Query: 3   LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSI 62
           LS + SN +I+    I L       Y K  +K+ +LS+ GTQ A+ L  N+ AS +G  +
Sbjct: 4   LSQLTSNAIIWPTYMILLITASIVAYWKRDSKA-FLSANGTQKALPLAFNFVASGLGVGV 62

Query: 63  LYSFPEVG-----------TIAG--------LLGVII----------------------- 80
           L ++P++            TIAG         LG +I                       
Sbjct: 63  LSAYPQIANISGLHGLLVYTIAGGLPMFVFAFLGPLIRKKTPNGFVLTEWVFHRFGLICG 122

Query: 81  -----------------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLIT 123
                            E++++   + T+T +  L  +I   IVTT+YT  GG   S IT
Sbjct: 123 WYLSACTILTVYLFLVSEVASLKYAIETMTQIKALPVIIIECIVTTIYTTIGGFNISFIT 182

Query: 124 DNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFH 183
           D++Q  A             + I I++S I  S LLKSN LGWQL+YI+  A+     F 
Sbjct: 183 DSLQVSAVFVLLIIVACAMGSYIDIDRSKIGPSGLLKSNKLGWQLIYILVFAIFTNDFFM 242

Query: 184 EGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFF 243
            GFW R F+S++D++L +       +L      +G+TG IAVWAGL    +   S  AFF
Sbjct: 243 SGFWLRTFASRSDKDLIIGCSIACFILVIFCTVIGVTGFIAVWAGLISVNDEENSGAAFF 302

Query: 244 TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANV 303
            L   LP WV G T+V +V +S    D+L SA  +  SNDIF N+LP+   R + ++   
Sbjct: 303 ILLSELPSWVMGFTIVFSVILSTCTLDSLQSALVSTISNDIFRNKLPIMYVRGIVVLIMF 362

Query: 304 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXX 361
           P V  GL   DVL ++LI DLL++S +P +++GL   L   +  W +             
Sbjct: 363 PVVVVGLIAEDVLNIYLIVDLLSSSVVPVLVVGLWSKLDNIWSAW-EVVGGGLSGIFSVW 421

Query: 362 XXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAP 399
              +I+Y +A++G  L+ +  GLYI D+S  GAF VAP
Sbjct: 422 VFGTIYYGSAREGGRLLLISNGLYINDWSTFGAFCVAP 459



>gi|398408051|ref|XP_003855491.1| hypothetical protein MYCGRDRAFT_36927, partial [Zymoseptoria
           tritici IPO323]
 gi|339475375|gb|EGP90467.1| hypothetical protein MYCGRDRAFT_36927 [Zymoseptoria tritici IPO323]
          Length = 474

 Score =  187 bits (474), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 132/391 (33%), Positives = 208/391 (53%), Gaps = 6/391 (1%)

Query: 51  SNWFASSIGS--SILYSFPEVGTIAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVT 108
           + W     GS  S+  SF  + T+   L ++ ELSA+  ++  LTG++ L  VI    VT
Sbjct: 53  TEWTRQRYGSVTSLYLSFFTLATM--WLYMVAELSALQQVVNLLTGLNGLPAVIVQCAVT 110

Query: 109 TLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQL 168
           T+YT  GG R S +TDNIQG              AT++ I++S I  S  L +N LGWQL
Sbjct: 111 TIYTAAGGFRVSFVTDNIQGAMVLLFIIIGTISIATTVDIDRSSIPASGYLNANLLGWQL 170

Query: 169 LYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG 228
           LYI+PVA+     F   FW RAF++K D++L +     ++ +  +   +G++G++A W+G
Sbjct: 171 LYILPVAILTNDFFLSQFWMRAFAAKTDKDLWIGVSIAAVAVTCITTLIGVSGLVAGWSG 230

Query: 229 LWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNR 288
           +  G   + S +  FTL   LP WV G+ +V+ V++S +A+D+  SA  +  SND+F N+
Sbjct: 231 VL-GTPPVPSGIELFTLLNTLPAWVVGVILVMVVTLSTSAFDSFQSAIISTGSNDLFRNK 289

Query: 289 LPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWID 348
           L   + R + +I  VP +   LK   VL+++LI+DLL+AS  P +++GL    Y     +
Sbjct: 290 LNTWIVRAIVVIIIVPTMIVALKSPSVLQIYLISDLLSASITPCLVIGLSSKAYCWRGFE 349

Query: 349 XXXXXXXXXXXXXXXXSIFYH-NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTF 407
                            ++Y  +A    EL+ L  GLY  D+S  GAF+ AP+  + F  
Sbjct: 350 VVIGGLGGILSVFFFGLVYYDGDAHKAGELLILSGGLYGDDWSAFGAFVAAPVGGLLFAI 409

Query: 408 LSFGVRLISMWVFTKIRGEEFVFPKKPEVVD 438
            +F +R+  +W+  K  G  F    +P   D
Sbjct: 410 SAFLLRIGVLWLKAKASGTRFTALDRPTAPD 440



>gi|320581949|gb|EFW96168.1| urea transporter, putative urea/polyamine transporter, putative
           [Ogataea parapolymorpha DL-1]
          Length = 463

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 121/361 (33%), Positives = 194/361 (53%), Gaps = 11/361 (3%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+   +  LTG+D    ++   +VTT+YT  GG   S ITD  Q             
Sbjct: 83  ELTAIEYAIEALTGLDATPAMVVECVVTTIYTFLGGFHVSFITDAFQAAFVLVLLVIGVV 142

Query: 141 XXATSIRIEKSVIDNSD--LLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRE 198
             ATSI I+  +   ++  LL +N LGW LLYI+PVA+     F  GFW R F++K D++
Sbjct: 143 GYATSIHIDMDLKHATEDQLLHANKLGWMLLYILPVAIITNDCFLSGFWLRTFAAKTDKD 202

Query: 199 LRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           L + A   +++   V   +GL G++AVW G +   +EN  +  AFF L   + +WV G+ 
Sbjct: 203 LYIGASIAAVVAGIVCTLVGLPGILAVWTGDMKVYDENGSN--AFFILVSKMDNWVIGVI 260

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAV-YWGLKDLDVL 316
           ++ ++ +S A +D+L SATT++ SND F N++ +   RF+ ++  VP++        +VL
Sbjct: 261 LIFSIGISTATFDSLQSATTSSISNDFFRNKVNIMWVRFIVILVMVPSIVVAVKAAANVL 320

Query: 317 RVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIE 376
           +++LIADL++AS +P I LGL     FL  +D                +I+Y NAK+G  
Sbjct: 321 QIYLIADLVSASVIPIIFLGLSKRFDFLRGLDVMVGGLGALVAVFIYGTIYYGNAKEGAR 380

Query: 377 LIGLPLGLYI-TDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
           L+ +  G+Y   D+   GAF++AP+      F    +R+  + +  KI G +    + PE
Sbjct: 381 LLLIWNGIYSDKDWGAFGAFVIAPIGGCLIGFACAAIRISVLKIKDKITGID----RLPE 436

Query: 436 V 436
           V
Sbjct: 437 V 437



>gi|116193701|ref|XP_001222663.1| hypothetical protein CHGG_06568 [Chaetomium globosum CBS 148.51]
 gi|88182481|gb|EAQ89949.1| hypothetical protein CHGG_06568 [Chaetomium globosum CBS 148.51]
          Length = 372

 Score =  181 bits (458), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 121/344 (35%), Positives = 179/344 (52%), Gaps = 62/344 (18%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN L+YV   +FL +G    +K + ++K ++L+   TQ A+ L  N+ AS++GS IL+++
Sbjct: 9   SNALVYVTYGVFLIMGTGVAWKFRNQSKGEFLAGNRTQTALPLALNFIASALGSGILFAY 68

Query: 67  PEV------------------------------------------------GTIAGL--- 75
           P++                                                GT+A L   
Sbjct: 69  PQLATLAGVQGVVVYALSSALPLLIFAALGPIIRRKCPQGFVLTEWTRQRYGTVAALYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L +I ELSA+G ++  LTG+D L  +I   IVTT+YT  GG + S  TDNIQ
Sbjct: 129 FMSLVTLFLYMISELSAIGQVVNLLTGIDGLPVLIVECIVTTIYTSVGGFKVSFFTDNIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G                  +I+ S+I++S L K + LGWQLLYI+PVA+     F   FW
Sbjct: 189 GAMVMGLILIATITIGVETKIDTSLIESSGLTKPSLLGWQLLYILPVAILTNDFFLSHFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEEN--LESYLAFFTL 245
            R F+SK DR+L L      + +  ++  +G TG+IA WAGLWPG E+  ++  +AFF L
Sbjct: 249 LRTFASKTDRDLWLGISGAVVGVLVIVTLVGSTGLIAAWAGLWPGPEDAPVDGSVAFFAL 308

Query: 246 FKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRL 289
              LP+WV G+ VV+AV++S AA+D+  SA   + SND+F N+L
Sbjct: 309 LMQLPNWVVGVVVVMAVTLSTAAFDSFQSAMVTSASNDLFRNKL 352



>gi|367008374|ref|XP_003678687.1| hypothetical protein TDEL_0A01440 [Torulaspora delbrueckii]
 gi|359746344|emb|CCE89476.1| hypothetical protein TDEL_0A01440 [Torulaspora delbrueckii]
          Length = 554

 Score =  180 bits (457), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 116/336 (34%), Positives = 179/336 (53%), Gaps = 3/336 (0%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           E++++   + T+ G+  L  +I   +VTT+YT  GG   S ITD +Q             
Sbjct: 140 EVASLKYAIETIAGIKALPVIIIECVVTTIYTTIGGFHISFITDTLQVSVVFVLLIIVAC 199

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
                + I+ S+I+ S LLK+N LGWQL+YI+  A+     F  GFW R F+S+++++L 
Sbjct: 200 AMGKYVHIDSSMIEPSGLLKANKLGWQLVYILTFAIFTNDFFMSGFWLRTFASRSNKDLM 259

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
           +      ++L   +  +G+TG IAVWAGL    +   S  AFF L   LP WV G T+V 
Sbjct: 260 IGCSIACVILVVFVTVIGVTGFIAVWAGLISVADEENSGAAFFILLAQLPSWVMGFTLVF 319

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
            V +S    D+L SA  ++ SND+F N++P+   R L L+  VP V  GL   DVL ++L
Sbjct: 320 VVVLSTCTLDSLQSALVSSVSNDVFRNKIPIMYVRGLVLLVMVPVVVVGLIAEDVLSIYL 379

Query: 321 IADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 378
           I DLL++S +P ++ GL      Y+  W +                +++Y + ++G +L+
Sbjct: 380 IVDLLSSSVVPVLVFGLSKRFEKYWTGW-EVVGGGLGGILATWIFGTVYYDSPEEGGKLL 438

Query: 379 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRL 414
            +  GLY  D+   GAF+VAP   I F F    +RL
Sbjct: 439 LITNGLYADDWGTFGAFVVAPFGGIAFGFFIMLIRL 474



>gi|164656775|ref|XP_001729515.1| hypothetical protein MGL_3550 [Malassezia globosa CBS 7966]
 gi|159103406|gb|EDP42301.1| hypothetical protein MGL_3550 [Malassezia globosa CBS 7966]
          Length = 589

 Score =  180 bits (456), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 124/368 (33%), Positives = 200/368 (54%), Gaps = 12/368 (3%)

Query: 78  VIIELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXX 136
           +I+EL+    I+ ++   + K+ P + IA+ TT+YT YGG +ASL TDN           
Sbjct: 71  MIVELNTYSVIVRSIQPDISKVIPPLIIALTTTIYTTYGGFKASLWTDNFNAIVVIVFII 130

Query: 137 XXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 196
                    + I+K ++ +S +L ++ LG +L YI+ +++ F+ +F++GFWQRAF+SK +
Sbjct: 131 IGAVMFGKRLDIDKDLMHDSGMLGAHRLGGELWYILTISIIFSQMFNQGFWQRAFASKTN 190

Query: 197 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWP----GEENLESY----LAFFTLFKV 248
             L LS    +I LF +   +G+ G +A W+ + P      E+   Y     A F     
Sbjct: 191 TGLYLSVAMATIPLFAICFLVGMAGPLAYWSHVQPPLNTSTEDTSLYDDGSNALFRALLY 250

Query: 249 LPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYW 308
           +P WV G+ +VL   +S +AYDT  SA  +   +D+  +R+ +   R + ++ NVP V  
Sbjct: 251 MPKWVHGLVLVLTGVLSSSAYDTFQSAMISVIESDLLLSRVNIWWCRLILIMFNVPCVAL 310

Query: 309 GLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFY 368
            + D+D+L+VFL+ADL   + +P + LGL   L  LN  D                +I+Y
Sbjct: 311 AVIDIDILQVFLVADLAGLAVIPSVFLGLAPRLDVLNGFDLVVGGCGGFLTVFVFGTIYY 370

Query: 369 H-NAKDGIELIGLPLGLY--ITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRG 425
           + +A +G +LIGLP GLY    DYSV+GAF+ APL  + FT  S G R++  W++ +I  
Sbjct: 371 NGDAIEGGQLIGLPNGLYGDPDDYSVIGAFLAAPLGGMGFTLASCGTRILLGWLYARITN 430

Query: 426 EEFVFPKK 433
             F   +K
Sbjct: 431 TPFTMLRK 438



>gi|254567718|ref|XP_002490969.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238030766|emb|CAY68689.1| Hypothetical protein PAS_chr2-1_0088 [Komagataella pastoris GS115]
 gi|328352498|emb|CCA38897.1| Sodium-coupled monocarboxylate transporter 2 [Komagataella pastoris
           CBS 7435]
          Length = 539

 Score =  179 bits (454), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 143/523 (27%), Positives = 243/523 (46%), Gaps = 71/523 (13%)

Query: 1   IMLSGVVSNVLIYVV--LAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSI 58
           + LS   SN +IYV   L +   +G+ A Y    +KS +LSS  T+  + L  N+ AS++
Sbjct: 1   MTLSSQASNAIIYVTYGLTLIFCVGL-AWYHN--DKSKFLSSNQTKTGIPLALNFIASAM 57

Query: 59  GSSIL------------------------------------------------YSFPEVG 70
           G  IL                                                ++F   G
Sbjct: 58  GCGILTTYTQVANLAGIHGLMTYTIVGALPIFFFSFWGPLIRRKCPEGFVLTEWTFQRFG 117

Query: 71  TIAG-----------LLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRA 119
           ++ G            L ++ ELSA+   +  LTG+D L  VI   IVTT+YT  GG + 
Sbjct: 118 SVTGYYLSLATILTMFLFMVAELSAIKFAVEALTGLDGLPVVIVECIVTTIYTSIGGFQV 177

Query: 120 SLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSD--LLKSNSLGWQLLYIMPVAVS 177
           S  TDN Q               A ++ I+  +   ++  LL +N LGWQLLYI+ +A++
Sbjct: 178 SFSTDNYQACVVLVLAVIGVIGFALNVNIDPELKRETESYLLGANKLGWQLLYILFIAIA 237

Query: 178 FATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAG-LWPGEENL 236
               F  GFW R F++K +++L +     SI+   +   +GL G+  VW G +  G    
Sbjct: 238 TCDCFISGFWLRTFAAKTNKDLMIGTGIASIVAMTICTLVGLPGIFGVWTGDVVIGSP-- 295

Query: 237 ESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRF 296
           E YL+FF +   + +W+ G+ ++ ++ +S   +D+L S  T+   ND    R+PL   R 
Sbjct: 296 EGYLSFFIMVSTMGNWMIGLILIFSIVLSTCTFDSLQSGLTSTIVNDFGRGRMPLWAARV 355

Query: 297 LSLIANVPAV-YWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXX 355
           ++++  VP++        DVL+++ IADL+++S +P + +GL    YF +  +       
Sbjct: 356 ITILVMVPSIVVAVKVADDVLKIYFIADLISSSVIPSLFIGLSTRFYFWSGWEVVGGGFA 415

Query: 356 XXXXXXXXXSIFYHNAKDGIELIGLPLGLYIT-DYSVLGAFIVAPLSSIFFTFLSFGVRL 414
                    +++Y +A +G +L+ +  G+Y + D+   GAF+VAP  S+    +  GVRL
Sbjct: 416 GLFFVWVFGTVYYGDAAEGGKLLLIWNGIYDSEDWGPFGAFVVAPGVSLVGGLIICGVRL 475

Query: 415 ISMWVFTKIRGEEFVFPKKPEVVDTKKYAGNKFKDDTEIIQSS 457
             + V++ I+G  F    +PE +     A     D  E+ + +
Sbjct: 476 AVLKVYSNIKGTPFTALDRPEKLGFGGVAIGDSSDIEEVYEET 518



>gi|452984112|gb|EME83869.1| hypothetical protein MYCFIDRAFT_162760, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 364

 Score =  168 bits (426), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 113/357 (31%), Positives = 179/357 (50%), Gaps = 61/357 (17%)

Query: 8   SNVLIYVVLAIFLGIGIYAGYK-KTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSF 66
           SN LIY     FL  G++  ++ + ++  ++LS+  TQ A  L  N+ AS++GS IL+++
Sbjct: 9   SNALIYCSYVAFLVFGLFIAWRLRGQSAGEWLSANRTQKAFPLALNFIASALGSGILFTY 68

Query: 67  PEV------------------------------------------------GTIAGL--- 75
           P +                                                GTI  L   
Sbjct: 69  PNIAALAGLHGLLVYALSSGLPLLIFAALGPIIRRKCPDGFVLTQWTRQRYGTITSLYLS 128

Query: 76  --------LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQ 127
                   L ++ ELSA+  ++  LTG++ L  VI    VTT+YT  GG R S +TDNIQ
Sbjct: 129 FFSCATIWLYMVAELSALQQVIKLLTGMNGLPAVIVQCAVTTIYTAAGGFRVSFVTDNIQ 188

Query: 128 GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFW 187
           G              A ++ I+ S+I  S  L++N LGWQLLYI+PVA+     F  GFW
Sbjct: 189 GAMVLLFLIVGVITIAVTVDIDTSLIPVSGYLEANLLGWQLLYILPVAILTNDFFLSGFW 248

Query: 188 QRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK 247
            RAF++K D++L +     ++ +  +   +G++G+IA W+G+  G   + + +  FTL K
Sbjct: 249 LRAFAAKTDKDLYIGVSIAAVAVALITTLVGVSGLIAGWSGVL-GVPPVATGIELFTLLK 307

Query: 248 VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVP 304
            LP WV GI +V+ V++S +A+D+L SA  +  SND F N+L +   R + ++  +P
Sbjct: 308 TLPAWVVGIILVMVVTLSISAFDSLQSALISTGSNDFFRNKLNIWWIRLIVVVLIIP 364



>gi|513034046|gb|AGO14012.1| AaceriAGR155Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 502

 Score =  166 bits (419), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/322 (32%), Positives = 171/322 (53%), Gaps = 2/322 (0%)

Query: 92  LTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKS 151
           L+ +  +  VI   +VTT+YT  GG   S +TD++Q                TS++++ +
Sbjct: 151 LSNIKPIPVVIVQCVVTTIYTAIGGFHISFVTDSLQATVVLLLLIVCAAAVGTSVKVDPA 210

Query: 152 VIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLF 211
            I  S LL+ + LGWQL+YI+ +A+     F  GFW R F+++++R+L +     + +L 
Sbjct: 211 RIGPSGLLRPSRLGWQLVYILTIAIFTNDFFMSGFWLRTFAARSNRDLLIGCSLAAALLA 270

Query: 212 PVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDT 271
            VL+ +G+TG++AVWAG  P  +   +  +FF L   LP WV+G+ +   V +S    D+
Sbjct: 271 IVLLLIGVTGLLAVWAGYAPVADAESA--SFFLLIAELPAWVNGVVLAFVVVLSTCTLDS 328

Query: 272 LISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMP 331
             SA  +  SND+F NRL     R    +  VP V  GL   D+L ++LI DLL+A+ +P
Sbjct: 329 FQSALVSTVSNDLFRNRLRPIYARAAVAVVMVPVVVVGLLATDILAIYLIVDLLSAAVVP 388

Query: 332 PILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSV 391
            +LLG       ++  +                +I+YH+A++G  L+ +  GLY  D+  
Sbjct: 389 VMLLGFWPRFARMSAYEVIGGGLGGLLCVFIFGAIYYHSAREGGRLLIIANGLYADDWGT 448

Query: 392 LGAFIVAPLSSIFFTFLSFGVR 413
            GA + AP+ S+ F  + F VR
Sbjct: 449 FGAMVAAPVGSLLFAGIIFLVR 470



>gi|403216744|emb|CCK71240.1| hypothetical protein KNAG_0G01820 [Kazachstania naganishii CBS
           8797]
          Length = 565

 Score =  165 bits (417), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 107/342 (31%), Positives = 182/342 (53%), Gaps = 4/342 (1%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           + S++   +V LTG+D L  +I  A++TT YT  GG   S +TD+ Q +           
Sbjct: 143 DFSSLKICVVALTGMDPLPVIIAEAVITTCYTTIGGFGISFLTDSFQVYIGISLMLILGY 202

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
                  I+   + +  LL +N LGWQL+YI+ +A+    LF  GFW R F+S++DR+L+
Sbjct: 203 GIRGYTTIDMEKVASVGLLSTNKLGWQLVYILTIAIFTNDLFLNGFWLRTFASRSDRDLK 262

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
           ++     I+L    +F+G  G +AV AGL    +   S  AFF L   LP++   + ++ 
Sbjct: 263 IACTVSCIVLTIFCIFVGSAGFLAVGAGLLDSNDP-NSGSAFFLLLNALPEFFLQVALIS 321

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
            V++S  + D+  S   +  SND+F N+L +   R + +I  +P V   L   ++L +++
Sbjct: 322 FVTLSVCSLDSQQSCLVSTISNDLFRNKLKIKWARLMVIIIIIPIVLLSLFAENILSIYM 381

Query: 321 IADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 378
             DLL++S +P +++G I  L  Y+ +W +                + +Y + K+G++L+
Sbjct: 382 FVDLLSSSVIPTLVVGFIPDLEAYWTSW-EVIGGGFGGLFCTFLFGTFYYSDFKEGVKLL 440

Query: 379 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVF 420
            +  GLY  D+S  GAF+ APL  I  + L  GVRL ++ +F
Sbjct: 441 LIWNGLYAEDWSTFGAFVTAPLGGIIVSLLIMGVRLYAIELF 482



>gi|50290383|ref|XP_447623.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526933|emb|CAG60560.1| unnamed protein product [Candida glabrata]
          Length = 559

 Score =  164 bits (415), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 185/344 (53%), Gaps = 3/344 (0%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           E++++   + TLT ++ L  +I   +VTT+YT  GG   S +TD++Q             
Sbjct: 140 EVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISFMTDSLQVSIVFILLVIVAA 199

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + I I++ +I  S LLK N LGWQL+YI+ VA+     F  GFW R F+S+++++L 
Sbjct: 200 AMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDFFMSGFWLRTFASRSNKDLL 259

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
           +       +L   +  +G+TG IAVWAGL P  +   S  AF+ L   LP W+ G T+V 
Sbjct: 260 IGCSLACFILVTFVTVVGVTGFIAVWAGLLPARDQENSGAAFYLLLAQLPSWIIGFTLVF 319

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
              +S    D+L SA  +  SND+F N+L + + R + +   VP V  GL   DVL ++L
Sbjct: 320 VAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLVRGIVVAIMVPVVVVGLIAQDVLSIYL 379

Query: 321 IADLLAASTMPPILLGLIDSL--YFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELI 378
           I DLL++S +P +++GL   L   +  W +                +++YH+AK+G  L+
Sbjct: 380 IVDLLSSSVVPVLVVGLWGKLDEIWSAW-EVIGGGCAGILGVWIFGTVYYHSAKEGGRLL 438

Query: 379 GLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTK 422
            +  GLY  D+   GAF+VAP + +  + +   +RL  M ++ K
Sbjct: 439 LISNGLYADDWGAFGAFVVAPGAGLVCSVIILAIRLSLMKLYKK 482



>gi|302419953|ref|XP_003007807.1| urea transport protein [Verticillium albo-atrum VaMs.102]
 gi|261353458|gb|EEY15886.1| urea transport protein [Verticillium albo-atrum VaMs.102]
          Length = 512

 Score =  164 bits (415), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 116/358 (32%), Positives = 180/358 (50%), Gaps = 30/358 (8%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+G ++ TLTGV++L  ++    VTT+YT  GG + S +TDNIQG            
Sbjct: 138 ELSAIGQVVTTLTGVNQLPVMLVQVAVTTIYTSLGGFKISFVTDNIQGGMVICLIVIAAA 197

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
                  I+ S+I  S+ LK   LGWQLLYI+PV +     F   +W RAF+SK D++L 
Sbjct: 198 TIGALTDIDTSLIRESEFLKPTLLGWQLLYILPVCILTNNFFLSNYWLRAFASKTDKDLW 257

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
           +     + +   +L +  L  ++       PG                 P WV G+ +V+
Sbjct: 258 IGVSLATTV---ILGYFRLGCLLHS-----PGSS---------------PSWVIGVVLVM 294

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
            V+MSC+A+DTL SA  ++ SND+F NRL +   R   L+  +PA+   L+   VL+++L
Sbjct: 295 VVTMSCSAFDTLQSAMVSSASNDLFRNRLNIWWIRAGILLIIIPAIVIALEAPSVLQIYL 354

Query: 321 IADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFY----HNAKDGIE 376
           I+DL++A  +P + +GL +  Y+    +                 I+Y    H A +   
Sbjct: 355 ISDLVSACIVPVLCIGLSNKCYWWRGFEVIVGGLGGILTSFLFGVIYYDGDVHRAGN--- 411

Query: 377 LIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP 434
           L+ +  GLY  D+SV G F+ AP+ SI + F +   RL   ++  K  G  F    +P
Sbjct: 412 LLLISEGLYADDWSVFGVFVAAPVGSIVWGFAALACRLSFQYIQAKRSGCRFDALDRP 469



>gi|260943103|ref|XP_002615850.1| hypothetical protein CLUG_04732 [Clavispora lusitaniae ATCC 42720]
 gi|238851140|gb|EEQ40604.1| hypothetical protein CLUG_04732 [Clavispora lusitaniae ATCC 42720]
          Length = 311

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 120/215 (55%), Gaps = 1/215 (0%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           E+SAV + + TLTG++ L  VI   +VTT+YT +GG R S ITDN QG            
Sbjct: 83  EVSAVKSAIETLTGLNGLGAVIVECVVTTIYTAFGGFRVSFITDNFQGVLVVLLVVICAA 142

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
              + I I+ S I  S LL +N LGWQLLYI+PVA+     F  GFW R F+SK DR+L 
Sbjct: 143 GMGSYIDIDTSKIGPSHLLDANKLGWQLLYILPVAIITNDCFMAGFWLRTFASKTDRDLW 202

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
           + A   S + F +   +G TG +AVWAG +    + +   AFF +   +P W+    ++ 
Sbjct: 203 IGAGIASFVTFAICTLVGTTGFLAVWAG-YIDVNDEDGGNAFFIMLSHMPRWLIAFVLIF 261

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTR 295
            + +S   +D+L SA  +  SND+F N+L +   R
Sbjct: 262 VICLSTCTFDSLQSAMVSTISNDVFRNKLDMIYVR 296



>gi|302309420|ref|NP_986821.2| AGR155Cp [Ashbya gossypii ATCC 10895]
 gi|299788351|gb|AAS54645.2| AGR155Cp [Ashbya gossypii ATCC 10895]
 gi|374110070|gb|AEY98975.1| FAGR155Cp [Ashbya gossypii FDAG1]
          Length = 563

 Score =  134 bits (337), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 108 TTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQ 167
           TT+YT  GG   S +TD++Q                TS++I+ + I  S LL+ + LGWQ
Sbjct: 228 TTIYTAIGGFHISFVTDSLQATVVLLLVVVGAVAVGTSVKIDPARIGPSGLLRPSRLGWQ 287

Query: 168 LLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWA 227
           L+YI+ VA+     F  GFW R F+++++R+L L     +++L  VL+ +G+TG++AVWA
Sbjct: 288 LVYILTVAIFTNDFFMSGFWLRTFAARSNRDLLLGCSLAAVLLAVVLLLVGVTGLLAVWA 347

Query: 228 GLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNN 287
           G  P   +L+S  +FF L   LP W +G+ + L V +S    D+  SA  +  SND+F N
Sbjct: 348 GYAP-VADLDS-ASFFLLLAALPAWANGVVLALVVVLSTCTLDSFQSALVSTISNDLFRN 405

Query: 288 RLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWI 347
           RLP    R    +  VP V  GL   D+L ++LI DLL+A+ +P +LLG       L+  
Sbjct: 406 RLPPLYARAAVAVVMVPVVVVGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARLSAW 465

Query: 348 DXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTF 407
           +                +I+Y +A++G  L+ +  GLY+ D+   GA +VAPL S+ F  
Sbjct: 466 ELIGGGLGGLLCVFVFGAIYYRSAREGGRLLIIANGLYVDDWGTFGAMVVAPLGSLLFAA 525

Query: 408 LSFGVR 413
           + F +R
Sbjct: 526 IIFALR 531



>gi|507524472|ref|YP_008046085.1| solute symporter-like protein [Spiribacter salinus M19-40]
 gi|511292660|ref|WP_016352927.1| solute symporter-like protein [Spiribacter salinus]
 gi|507224482|gb|AGM40620.1| solute symporter-like protein [Spiribacter salinus M19-40]
          Length = 461

 Score =  124 bits (312), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 141/265 (53%), Gaps = 16/265 (6%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+G I   L+G+D    ++ +A+ T +YT  GGLRASL+TD  Q W           
Sbjct: 135 ELTAIGAITTLLSGLDGRYVIVGVALATLIYTAIGGLRASLLTDRWQAWLLVGLVGLVAF 194

Query: 141 XXATSIRIEK------SVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSK 194
                           S + N+ L  + SLG  L  I  +AV+ A LFH+G+WQR ++++
Sbjct: 195 AALALAPARPGEAAPTSTLPNTGL--AASLGVALTLI--IAVTAANLFHQGYWQRVWAAR 250

Query: 195 NDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVS 254
           +DR L+ +A+ G      V+  LG  G++A   GL  G   +     FF L    P W++
Sbjct: 251 DDRALKTAALVGGASTVGVVAVLGGAGILAGLRGLPLGSPPIP----FFALLSEAPQWLA 306

Query: 255 GITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD 314
              +VLA+++  ++ DTL +A  +    +  +  + L   R+LS +  +P V   L+++ 
Sbjct: 307 LPALVLAITLVASSVDTLQNALVSLGVTE--SQAMGLTGARWLSALLMLPVVGLALQEIS 364

Query: 315 VLRVFLIADLLAASTMPPILLGLID 339
           VLR+FLIADLL A+ + P+L GL +
Sbjct: 365 VLRLFLIADLLCATAVVPLLSGLSE 389



>gi|384254250|gb|EIE27724.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
          Length = 878

 Score =  119 bits (298), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 144/264 (54%), Gaps = 9/264 (3%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           E +AVG++   + G +++  V+ I +V+ +YT YGGL  S+ITD  Q             
Sbjct: 146 EYTAVGDLFELVIGTERVPIVVIIGVVSMIYTAYGGLYISIITDQWQAALGLTLAAILVI 205

Query: 141 XXATSIR--IEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRE 198
             A + R  + + + DN   L  N+ G   + +MP+++  A++F E  WQR ++S +D +
Sbjct: 206 WTAVTFRGPLPRPLPDN---LAINNEGLSSIAVMPISLFSASVFSEAIWQRCWASASDAK 262

Query: 199 LRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLW-PGEENLESYLAFFTLF--KVLPDWVSG 255
           LR+ A++G++ +  V+   G  G +AVW+GLW P   +       F L   K    W++ 
Sbjct: 263 LRVGAIWGALQVTVVVFIFGFGGFLAVWSGLWQPSGPDDPGNTILFALLNAKGQQVWITV 322

Query: 256 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 315
           I  VLA +MS +A D+L +A   N S   F   LPL   R L +I +VP +   L+   +
Sbjct: 323 IVAVLAATMSESAIDSLQNAIVDNISGS-FLKGLPLIWIRVLVIILSVPVIIVSLQGYGI 381

Query: 316 LRVFLIADLLAASTMPPILLGLID 339
           + +FL+A+L+  ++  P+LLGL++
Sbjct: 382 INLFLLANLITTTSTLPVLLGLLE 405



>gi|496243989|ref|WP_008957374.1| sodium:solute symporter [Halomonas sp. HAL1]
 gi|350600213|gb|EHA16283.1| hypothetical protein HAL1_07285 [Halomonas sp. HAL1]
          Length = 459

 Score =  118 bits (296), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/257 (31%), Positives = 134/257 (52%), Gaps = 6/257 (2%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+G I   L+ V     +I +A+ T +YT  GGLRASL TD  Q W           
Sbjct: 136 ELTAIGAITALLSDVPPALVIIGVALTTLVYTAVGGLRASLATDRWQAWLLLALLLAVGS 195

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
                +    S      +  +++L   L  +  +AV+ A LFH+G+WQR +++++D+ L 
Sbjct: 196 VTLWRLPTMPSEATLPSIPVTSALSVALTLV--IAVTAANLFHQGYWQRVWAARDDQSLG 253

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
             A  G  M   V++ +G  GM+A  +G+  GE  +     FF L    P W++   +VL
Sbjct: 254 RGAWLGGGMTVVVVMLIGGLGMLATMSGVPLGEPPMP----FFALLTEAPAWLTLPALVL 309

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
           AV++  ++ DTL +   +   +      + +   R++++   +P V   L+ L VLR+FL
Sbjct: 310 AVTLVASSVDTLQNGIASLVVSRSEQRGVSIAAARWVTIALMMPVVVIALQGLSVLRLFL 369

Query: 321 IADLLAASTMPPILLGL 337
           IADLL A+ + P+LLGL
Sbjct: 370 IADLLCAAIVVPVLLGL 386



>gi|328771326|gb|EGF81366.1| hypothetical protein BATDEDRAFT_34916 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 523

 Score =  118 bits (296), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 110/393 (27%), Positives = 176/393 (44%), Gaps = 28/393 (7%)

Query: 76  LGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXX 135
           + ++ E SA+G I     GV    P++ + IVT  YT  GGL  S++TD  Q        
Sbjct: 147 IALLAEYSAIGGIFQDFFGVPSWVPILVVGIVTMSYTATGGLYVSIVTDQWQAIMALVLF 206

Query: 136 XXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 195
                    S     S+    D L + ++GWQ    + +++  AT F E  WQR +++++
Sbjct: 207 AITIIYMGVSFH-GTSLPKLPDYLGATTVGWQSFITLGISLISATFFSEAMWQRVWAAES 265

Query: 196 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSG 255
           +R LR+ A+ GS M   V+   GL  M+A W+G    ++N  S   +F  F+ L  + S 
Sbjct: 266 ERSLRIGAIIGSSMSTVVVAVFGLGSMLAYWSGRATADDN--SNFGYFLAFRDLNGYTSA 323

Query: 256 ----ITVVLAVSMSCAAYDTLISATTANFSNDI--FNNRLPLNVTRFLSLIANVPAVYWG 309
               + +++AV M+ +A D+  +A T    +    F  + P    R L ++ NVP +Y G
Sbjct: 324 AILVVVILIAVIMNESAVDSFQNAITDAVVSVFGSFGVKFPTMGARLLVILFNVPIMYIG 383

Query: 310 LKDLDVLRVFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH 369
              L VL VFLI +++      P++ GLI +   LN I                  + Y 
Sbjct: 384 TLGLSVLGVFLIGNMITTCMFFPLVAGLIPA---LNRIISSFSVCLACLFSFFSVMV-YG 439

Query: 370 NAKDGIELIGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEE-- 427
               G    GL L  + T Y V  AF+ A +SSI +  +  G+ L     F K+ G E  
Sbjct: 440 KIMTGDISTGL-LTYFYTVYDV-NAFLTASVSSIVWLVVFTGIDL----AFRKLTGREMP 493

Query: 428 -FVFPKKPEVVDTKKYAGNKFKDDTEIIQSSDP 459
              FP K  +  + +      K   E+ ++  P
Sbjct: 494 NLPFPSKAALAFSTR------KSIVEVPEAQGP 520



>gi|501087544|ref|WP_012137811.1| solute symporter-like protein [Marinobacter lipolyticus]
 gi|499161817|gb|EON92887.1| solute symporter-like protein [Marinobacter lipolyticus SM19]
          Length = 454

 Score =  116 bits (290), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 139/261 (53%), Gaps = 11/261 (4%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           V  EL+A+G I   L+ V+    V+ +A  T +YT +GGLRASL+TD    W        
Sbjct: 133 VTAELTAIGAITSLLSNVNGNLAVVAVASATLIYTAWGGLRASLVTDQ---WQAFLLIAL 189

Query: 138 XXXXXATSI-RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 196
                  +I R+ +  +D+S  +   S    +   + +AV+ A LFH+G+WQR +S+++ 
Sbjct: 190 LIIVGVVAINRLPEISLDHSPSVPVGS-ALSVALTLVIAVTAANLFHQGYWQRLWSARDT 248

Query: 197 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGI 256
             L+  A +G I+   V+  +G  G+ A  +G   G   +     FF +    P W++  
Sbjct: 249 SSLQRGAFFGGIITIAVVALVGSMGIAAAMSGTDLGNPPIP----FFAMLSGAPAWLTIP 304

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 316
            +VLA+++  ++ DTL +A  +    +     L L   R+++++  +P V   L+ + VL
Sbjct: 305 ALVLALTLVASSVDTLQNALASLAVTE--KKGLSLTAARWITVLLMIPVVLVALQGISVL 362

Query: 317 RVFLIADLLAASTMPPILLGL 337
           R+FLIADLL A+ + P+L+GL
Sbjct: 363 RLFLIADLLCATAVIPVLMGL 383



>gi|428175810|gb|EKX44698.1| hypothetical protein GUITHDRAFT_87377 [Guillardia theta CCMP2712]
          Length = 646

 Score =  115 bits (289), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 145/300 (48%), Gaps = 20/300 (6%)

Query: 55  ASSIGSSILYSFPEVGTIAGLLGVII--------ELSAVGNILVTLTGVDKLAPVICIAI 106
           A+S+G  IL  F     +A ++  +I        E + VG +     G      +I +A+
Sbjct: 116 ANSLGDFILLRFGPTAKLATIIVTLINMSIFMLAEFTTVGGLFSDFVGSVSYPIIIIVAV 175

Query: 107 VTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIR--IEKSVIDNSDLLKSNSL 164
           +TT+YT YGGL  S++TD +QG              A + R  +  +      +L  N  
Sbjct: 176 LTTIYTVYGGLLVSIVTDQVQGIISVLLTIILTIYVAATFRRDLPANFGPYEPMLGPNLS 235

Query: 165 GWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIA 224
           G+  ++ MP++++ AT+F+EG WQR +++++   L+   +     +  V+   G  G++A
Sbjct: 236 GYSSIFTMPISLAAATVFNEGMWQRVWAAEDHTALKRGGIIACFAIVFVVFIFGFGGLLA 295

Query: 225 VWAGLWPGEENLESYLAFFTLFKVLP--------DWVSGITVVLAVSMSCAAYDTLISAT 276
           VW GL    EN    L  F LFK  P        +++  + +VLA  M+ +A D+L +  
Sbjct: 296 VWGGL-VDYENTNPNLYIFQLFKSDPSAPNAHVENFIEVLVLVLAAVMNESAIDSLQNGL 354

Query: 277 TANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLG 336
            A  S+     + PL   R   L+ N+  V + L +  VL +FL+ ++L     PP+++G
Sbjct: 355 AATISSHFLRGK-PLLWARICVLLINIIIVPFALANYSVLSIFLLGNMLGVCWFPPVIMG 413



>gi|494264168|ref|WP_007153677.1| sodium:solute symporter [Marinobacter algicola]
 gi|149359352|gb|EDM47813.1| Na+/solute symporter [Marinobacter algicola DG893]
          Length = 456

 Score =  112 bits (279), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 138/257 (53%), Gaps = 9/257 (3%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+G I   L+GV+    V+ +A+ T +YT +GGLRAS++TD  Q +           
Sbjct: 136 ELTAIGAITSLLSGVNGNLAVLGVAVATLIYTTWGGLRASIVTDQWQAF-LLIGLLAIVG 194

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
             A     E  + D       ++LG  L  +  +AV+ A LFH+G+WQR +S+++   LR
Sbjct: 195 FVAMDRLPELQMADAPSAPVGSALGVALTLV--IAVTAANLFHQGYWQRLWSARDISALR 252

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
             A+ G ++   V+  +G  G+ A  +G   G   +     FF L    P W++   +VL
Sbjct: 253 SGALLGGLVTIIVVAVVGGLGIAAAMSGADLGSPPIP----FFALLSGAPAWLTIPALVL 308

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
           A+++  ++ DTL +A  +    +     L +   R+++++  +P V   L+ + VLR+FL
Sbjct: 309 ALTLVASSVDTLQNALASLAVTE--KQGLSITSARWVTVLLMIPVVIVALQGVSVLRLFL 366

Query: 321 IADLLAASTMPPILLGL 337
           IADLL A+ + P+L+GL
Sbjct: 367 IADLLCATAVIPVLMGL 383



>gi|219129440|ref|XP_002184897.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403682|gb|EEC43633.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 578

 Score =  110 bits (274), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 143/269 (53%), Gaps = 12/269 (4%)

Query: 78  VIIELSAVGNILVTLTGVDK----LAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXX 133
           ++ EL+A+ NI   LTG +     +   I I + T +YT   GL AS++TD  QG     
Sbjct: 159 IVAELTAISNIFALLTGNNSKIYGIGITIAIGVFTIIYTTLAGLPASIVTDRFQG--GIV 216

Query: 134 XXXXXXXXXATSIRIEKSVIDNSDLLKSNSL--GWQLLYIMPVAVSFATLFHEGFWQRAF 191
                    A +I  E  +  +   L SN    G +    + +A+  A LF++G WQR +
Sbjct: 217 ALLIIMLTLAVTISDENRITRDEFALASNFTIQGLKAAVTLVIAILCAELFNQGTWQRVW 276

Query: 192 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE--SYLAFFTLFKVL 249
           ++++   +R     GS M+F +++F G+ GMIA +A      +N E  ++LAFF L   L
Sbjct: 277 AAESIPVMRRGFAIGSAMVFLIMMFFGVMGMIA-YAKDPESYDNFEKFAFLAFFDLLLPL 335

Query: 250 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFN-NRLPLNVTRFLSLIANVPAVYW 308
            +    + ++L  +++ ++ D+L +  T+ F++D+      P+   R L +  NVPA++ 
Sbjct: 336 GNGWHVLVLILVTALAASSIDSLQNGLTSVFAHDLLKVGWNPIWAARALMVAVNVPAIWL 395

Query: 309 GLKDLDVLRVFLIADLLAASTMPPILLGL 337
             +  DV+ +FL+ADL+ A+++ P+ LGL
Sbjct: 396 ASRKWDVIALFLVADLVCATSVFPVFLGL 424



>gi|223993879|ref|XP_002286623.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220977938|gb|EED96264.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 614

 Score =  108 bits (269), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/291 (28%), Positives = 151/291 (51%), Gaps = 21/291 (7%)

Query: 63  LYSFPEVGTIAGLLGVIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLI 122
           +Y   E+ +I+ + G+I+ L    +  V  T     +  I +A+ T  YT   GL AS++
Sbjct: 166 IYLVSEMTSISNVYGLIVGLDTFSDDTVKYT----TSIAISLAVFTWFYTSVAGLPASIV 221

Query: 123 TDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQL-----LYIMPVAVS 177
           TD  Q +              ++   E  V      + SN   W L        + +A++
Sbjct: 222 TDKFQAYLMFGLVFILLIVACSNS--ENQVSKEEFAVASN---WTLDGLAAAVTLFIAIA 276

Query: 178 FATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLE 237
            A +F++G WQR +++K+  ++R    +GS+++F +++F G+ GM+A +A      +N E
Sbjct: 277 CAEMFNQGNWQRVWAAKSVPDMRKGFAWGSLLVFLLMMFFGIMGMLA-YANDPDAYDNWE 335

Query: 238 --SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLN--- 292
             +YLAFF L   L  +   + +++  +++ ++ DTL +A  + FS+D+    L  N   
Sbjct: 336 KFAYLAFFDLLAPLNTFFHVLVLIIVTALAASSVDTLQTAIASMFSSDLIRFGLSDNASR 395

Query: 293 -VTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 342
            VTRF+ ++ N+PAV    K  DV+ +FL+ADL+  + + P+ LGL+   Y
Sbjct: 396 FVTRFILVLINIPAVILSSKRFDVIGLFLVADLVCGTAVLPVFLGLMTEDY 446



>gi|496591109|ref|WP_009288217.1| Sodium/solute symporter [Halomonas titanicae]
 gi|445564478|gb|ELY20598.1| Sodium/solute symporter [Halomonas titanicae BH1]
          Length = 470

 Score =  105 bits (261), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/257 (31%), Positives = 134/257 (52%), Gaps = 6/257 (2%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+G I   L+ V     +I +A+ T +YT  GGLRASL TD  Q W           
Sbjct: 136 ELTAIGAITALLSDVPPALVIIGVALTTLIYTAAGGLRASLATDRWQAWLLLVLLCVVGG 195

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
                +    +      +  +++L   L  +  +AV+ A LFH+G+WQR +++++D+ L 
Sbjct: 196 MALWRLPTIPNEAALPAIPITSALSVALTLV--IAVTAANLFHQGYWQRVWAAQDDQSLG 253

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
             A  G  M   V++ +G  G++A  +G+  GE  +     FF L    P W++   +VL
Sbjct: 254 RGAWLGGAMTVVVVMVIGGLGVLAAMSGVPLGEPPMP----FFALLSDAPVWLTLPALVL 309

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
           AV++  ++ DTL +   +          + L   R+++++  VP V   L+ L VLR+FL
Sbjct: 310 AVTLVASSVDTLQNGIASLVVARSEQQGVSLVAARWVTVVVMVPVVLIALQGLSVLRLFL 369

Query: 321 IADLLAASTMPPILLGL 337
           IADLL A+ + P+LLGL
Sbjct: 370 IADLLCAAIVVPVLLGL 386



>gi|323455936|gb|EGB11803.1| hypothetical protein AURANDRAFT_61010 [Aureococcus anophagefferens]
          Length = 1097

 Score =  104 bits (260), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 143/280 (51%), Gaps = 30/280 (10%)

Query: 78  VIIELSAVGNILVTLTG-----------VDKLAPVICIAIVTTLYTGYGGLRASLITDNI 126
           ++ EL+++GN+  TL G             K+A  IC+A+ T  YT   GL AS++TD  
Sbjct: 673 MVAELTSIGNVYATLVGKSVAGDDSEHFTTKIA--ICVALFTWAYTALAGLPASILTDKF 730

Query: 127 QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 186
           QG               T    E S  +  D     S G++ L  + +A+  A LF++G 
Sbjct: 731 QGVVITCVVIMLLVATTTLKSNEVSKQEYDDATGWFSKGFEALVTLWIAICSAELFNQGN 790

Query: 187 WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIA---------VWAGLWPGEENLE 237
           WQR +++++D+++++  + G++++  V++F G+ G IA          W  L        
Sbjct: 791 WQRVWAARSDKDMKIGFLAGAVLVTLVMLFFGVMGTIAYARDRESYDTWQKL-------- 842

Query: 238 SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFL 297
           +YL+FF L + LP +   +T+ L  +++ ++ DTL +   +  S D+   +L  N +R +
Sbjct: 843 AYLSFFDLLRNLPRFWHYVTLALLTTLAASSLDTLQNGIASVLSRDLLKQKLNTNWSRLV 902

Query: 298 SLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 337
            +  N+ A+       +V+ +FL+ADL+ A+ + P+ LGL
Sbjct: 903 VVGFNIAAIIQASDRFEVVPLFLVADLVCATAVFPLFLGL 942



>gi|323456367|gb|EGB12234.1| hypothetical protein AURANDRAFT_61365 [Aureococcus anophagefferens]
          Length = 1212

 Score =  104 bits (260), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 143/280 (51%), Gaps = 30/280 (10%)

Query: 78   VIIELSAVGNILVTLTG-----------VDKLAPVICIAIVTTLYTGYGGLRASLITDNI 126
            ++ EL+++GN+  TL G             K+A  IC+A+ T  YT   GL AS++TD  
Sbjct: 788  MVAELTSIGNVYATLVGKSVAGDDSENFTTKIA--ICVALFTWAYTALAGLPASILTDKF 845

Query: 127  QGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGF 186
            QG               T    E S  +  D     S G++ L  + +A+  A LF++G 
Sbjct: 846  QGVVITCVVIMLLVATTTLKSNEVSKQEYDDATGWFSKGFEALVTLWIAICSAELFNQGN 905

Query: 187  WQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIA---------VWAGLWPGEENLE 237
            WQR +++++D+++++  + G++++  V++F G+ G IA          W  L        
Sbjct: 906  WQRVWAARSDKDMKIGFLAGAVLVTLVMLFFGVMGTIAYARDRESYDTWQKL-------- 957

Query: 238  SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFL 297
            +YL+FF L + LP +   +T+ L  +++ ++ DTL +   +  S D+   +L  N +R +
Sbjct: 958  AYLSFFDLLRNLPRFWHYVTLALLTTLAASSLDTLQNGIASVLSRDLLKQKLNTNWSRLV 1017

Query: 298  SLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 337
             +  N+ A+       +V+ +FL+ADL+ A+ + P+ LGL
Sbjct: 1018 VVGFNIAAIIQASDRFEVVPLFLVADLVCATAVFPLFLGL 1057



>gi|158321712|ref|YP_001514219.1| Na+/solute symporter [Alkaliphilus oremlandii OhILAs]
 gi|501110941|ref|WP_012160530.1| Na+/solute symporter [Alkaliphilus oremlandii]
 gi|158141911|gb|ABW20223.1| Na+/solute symporter [Alkaliphilus oremlandii OhILAs]
          Length = 466

 Score =  104 bits (259), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 136/278 (48%), Gaps = 22/278 (7%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           +I EL+A+G +   L GV  L   + + I T +YT YGGLRA++ TD IQ          
Sbjct: 136 LIAELTAIGLVAYELAGVPLLYTALFVGIGTLIYTAYGGLRAAMFTDMIQMILIVFLLIM 195

Query: 138 XXXXX-----ATSIRIEKSVIDNSDLLK-SNSLGWQLLYIMPVAVSFATLFHEGFWQRAF 191
                          I  +  +  DL    N  G +    + +AV  A LF++G+WQR +
Sbjct: 196 VTVGIVHYGGGVGTIISSAKTNAPDLFSFRNWGGIEYGLTLCIAVFAANLFNQGYWQRVY 255

Query: 192 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTL-FKVLP 250
           +SK+++ LR S +   I+  PV++  G  G++++  G+          +A F+L +K LP
Sbjct: 256 ASKDNKTLRKSLIVCIIIALPVMLITGFLGIVSMGLGIGSSPS-----VALFSLIYKFLP 310

Query: 251 DWVSGITVVLAVSMSCAAYDTLISATTANF---SNDIFN-----NRLPLNVTRFLSLIAN 302
             +     +LA+ +  +  DTL++A  A F   S  IF      + LP    R + ++  
Sbjct: 311 SQLIVAVFILALVLVMSTVDTLLNAIVATFALDSQQIFKKVKSESLLPF--ARMMMVVLM 368

Query: 303 VPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDS 340
           +PA++   +   VL +F +ADL+ A  + PI  GL ++
Sbjct: 369 IPAIFIAARGYSVLYLFFVADLVCAGVVFPIFFGLFNT 406



>gi|385331874|ref|YP_005885825.1| solute symporter-like protein [Marinobacter adhaerens HP15]
 gi|495449986|ref|WP_008174680.1| sodium:solute symporter [Marinobacter manganoxydans]
 gi|311695024|gb|ADP97897.1| solute symporter-like protein [Marinobacter adhaerens HP15]
 gi|357225226|gb|EHJ03733.1| hypothetical protein KYE_14777 [Marinobacter manganoxydans MnI7-9]
          Length = 454

 Score =  104 bits (259), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 135/257 (52%), Gaps = 9/257 (3%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+G I   L+G+D    VI +AI T +YT  GGLRAS++TD  Q             
Sbjct: 136 ELTAIGAITSLLSGIDGGIVVIGVAITTLVYTAVGGLRASIVTDQWQA-LLLIGLLAIVS 194

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
             A     + +     D+  S +L   L  +  +AV+ A LFH+G+WQR +S+++   L 
Sbjct: 195 FVAVGKLPDAAPAALPDIPASAALSVALTLV--IAVTAANLFHQGYWQRLWSARDTDALS 252

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
             A+ G ++   V+  +G  G++A  +G   G   +     FF L    P W++   ++L
Sbjct: 253 RGALLGGVVTIAVVAVVGGLGILAAMSGADLGSPPIP----FFALLADAPAWLALPALIL 308

Query: 261 AVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFL 320
           A+++  ++ DTL +A  +    +     L +   R+ +++  +P V   L+ + VLR+FL
Sbjct: 309 AITLVASSVDTLQNALASLAVTE--KQGLSIVSARWFTVLLMIPVVLVALQGISVLRLFL 366

Query: 321 IADLLAASTMPPILLGL 337
           IADLL A+ + P+L+GL
Sbjct: 367 IADLLCATAVLPVLMGL 383



>gi|512441197|ref|WP_016416980.1| sodium:solute symporter [Halomonas anticariensis]
 gi|511273970|gb|EPC02107.1| sodium:solute symporter [Halomonas anticariensis FP35 = DSM 16096]
          Length = 459

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 136/259 (52%), Gaps = 8/259 (3%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+  I   L+ +     VI +A+ T +YT  GGLRASL TD  Q W           
Sbjct: 136 ELTAINGITTLLSDMSGSVVVIGVALSTLVYTALGGLRASLATDRWQAWLLIALLGVVGW 195

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELR 200
                +    S  +   +   ++L   L  +  +AV+ A LFH+G+WQR ++++N   L 
Sbjct: 196 VGWQRLPALPSDANLPSVPAGSALSVALTLV--IAVTAANLFHQGYWQRVWAARNGHALG 253

Query: 201 LSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVL 260
             A+ G ++   V+  +G  G++A  +G   GE  +     FF L    P W+  + +VL
Sbjct: 254 RGAILGGLITVAVVAVVGGLGILAAMSGTPLGEPPMP----FFALLTEAPQWLMLLALVL 309

Query: 261 AVSMSCAAYDTLIS--ATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRV 318
           AV++  ++ DTL +  A+ A    +  + R+ L   R++++   VP V   L++L VLR+
Sbjct: 310 AVTLVASSVDTLQNGIASLAVSEGEGGSRRVSLATARWITVALMVPVVIVALQNLSVLRL 369

Query: 319 FLIADLLAASTMPPILLGL 337
           FLIADLL A+ + P+LLGL
Sbjct: 370 FLIADLLCATAVVPVLLGL 388



>gi|490716886|ref|WP_004579451.1| solute symporter-like protein [Marinobacter nanhaiticus]
 gi|478770607|gb|ENO15155.1| solute symporter-like protein [Marinobacter nanhaiticus D15-8W]
          Length = 455

 Score =  103 bits (256), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 140/260 (53%), Gaps = 14/260 (5%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+AVG I   LT ++    ++ +A  T +YT +GGLRASL+TD    W           
Sbjct: 135 ELTAVGAITGLLTDLNGNVAILGVAGATLIYTAWGGLRASLVTDR---WQALLLVGLILV 191

Query: 141 XXATSIRIEKSVIDNSDLLKS---NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
               ++    S +D + +  +   ++LG  L  ++  AV+ A LFH+G+WQR +++++  
Sbjct: 192 VGFVALPGLPSPVDRTPMPSAPIGSALGVALTLVL--AVTAANLFHQGYWQRVWAARDGA 249

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
            L   A+ G ++   V+  +G  G+ A  +G+  G   +     FF L    PDW++ + 
Sbjct: 250 ALGQGAILGGVITIAVVALVGGLGVTAAMSGVDLGSPPIP----FFALLSQAPDWLALVA 305

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           ++LA+++  ++ DTL +   +    +   + L L+  R++++   VP V   L+   VLR
Sbjct: 306 LILALTLVASSVDTLQNGLASLAVTE--KSGLSLSAARWITVGLMVPVVLIALQGYSVLR 363

Query: 318 VFLIADLLAASTMPPILLGL 337
           +FLIADLL A+ + P+L+GL
Sbjct: 364 LFLIADLLCATAVIPVLMGL 383



>gi|428171596|gb|EKX40511.1| hypothetical protein GUITHDRAFT_75395, partial [Guillardia theta
           CCMP2712]
          Length = 447

 Score =  102 bits (255), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 130/271 (47%), Gaps = 22/271 (8%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           E + +G +     G +    ++ +A VTT+YT YGGL  S++TD +QG            
Sbjct: 151 EFTTIGGLFRDFVGTEGFPIILIVATVTTVYTMYGGLLVSIVTDQVQGITSVVLITTISI 210

Query: 141 XXATSIRIEKSVIDNSDLLKS----NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 196
             A + + E  +  N   LK     N  G+  + +MP ++  + +F+EG WQR +++K+ 
Sbjct: 211 YVAATFKRE--LPPNFGSLKQSLGPNQSGYSSILVMPASLMSSVMFNEGMWQRVWAAKDP 268

Query: 197 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGL---WPGEENLESYLAFFTLFKVLPD-- 251
           + L+   V   + +  V+   GL G +A W GL     G  NL  YL  F +FK  P+  
Sbjct: 269 QSLKRGGVLACLAVVSVVFLFGLGGFLAAWGGLIDFQTGNPNL--YL--FQVFKSSPNQN 324

Query: 252 ------WVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPA 305
                 ++  + +VLA  M+ +A D++ +   A  S      + PL   R   L+  V  
Sbjct: 325 NVHVNQFIEVLVLVLAAVMNESAIDSVQNGLAATISTQFLRGK-PLIWARGCVLVITVII 383

Query: 306 VYWGLKDLDVLRVFLIADLLAASTMPPILLG 336
           V + L +  VL +FL+  +LA   + P++LG
Sbjct: 384 VPFALANYAVLSIFLLPSILAVCWLFPVMLG 414



>gi|494173757|ref|WP_007113484.1| sodium:solute symporter [Halomonas boliviensis]
 gi|357970128|gb|EHJ92575.1| hypothetical protein KUC_2532 [Halomonas boliviensis LC1]
          Length = 463

 Score =  102 bits (255), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 134/261 (51%), Gaps = 14/261 (5%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+G I   L+ V     +I +A+ T +YT  GGLRASL TD  Q W           
Sbjct: 136 ELTAIGAITALLSDVPPALVIIGVALTTLIYTAAGGLRASLATDRWQAWLLLILLCVVGG 195

Query: 141 XXATSIRIEKSVIDNSDLLKS----NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKND 196
                +      I N   L S    ++L   L  +  +AV+ A LFH+G+WQR +++++D
Sbjct: 196 MALWRL----PTIPNETALPSIPVTSALSVALTLV--IAVTAANLFHQGYWQRVWAAQDD 249

Query: 197 RELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGI 256
           + L   A  G  M   V++ +G  G++A  + +  GE  +     FF L    P W++  
Sbjct: 250 QSLGRGAWLGGAMTVVVVMVIGGLGVLAAMSDVSLGEPPMP----FFALLSDAPIWLTLP 305

Query: 257 TVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVL 316
            +VLAV++  ++ DTL +   +          + L   R+++++  +P V   L+ L VL
Sbjct: 306 ALVLAVTLVASSVDTLQNGIASLVVARSEQRGVSLVAARWVTVVVMIPVVLIALQGLSVL 365

Query: 317 RVFLIADLLAASTMPPILLGL 337
           R+FLIADLL A+ + P+LLGL
Sbjct: 366 RLFLIADLLCAAIVVPVLLGL 386



>gi|497407386|ref|WP_009721584.1| sodium:solute symporter [Halomonas sp. TD01]
 gi|338766491|gb|EGP21410.1| hypothetical protein GME_01569 [Halomonas sp. TD01]
          Length = 462

 Score =  101 bits (252), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 87/263 (33%), Positives = 137/263 (52%), Gaps = 17/263 (6%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+G I   L+ V     +I +A+ T +YT  GGLRASL TD  Q W           
Sbjct: 136 ELTAIGAITALLSDVPPALVIIGVALTTLVYTVIGGLRASLATDRWQAWLLLALLLAVG- 194

Query: 141 XXATSIRIEK-SVIDNSDLLKSNSLGWQL--LYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
               S+ I +   + N  ++ S  +   L     + +AV+ A LFH+G+WQR +++++D+
Sbjct: 195 ----SVAIWRLPTMPNDAVMPSIPIASALSVALTLVIAVTAANLFHQGYWQRVWAAQDDQ 250

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
            L   A  G  M   V++ +G  GM+A  +G   G+  +     FF L    P WV+   
Sbjct: 251 SLGRGAWLGGGMTVMVVMVIGGVGMMAAMSGASLGDPPIP----FFALLTDAPAWVALPA 306

Query: 258 VVLAVSMSCAAYDTL---ISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD 314
           +VLAV++  ++ DTL   I++       +   +   L   R++++   VP V   L+ L 
Sbjct: 307 LVLAVTLVTSSVDTLQNGIASLIVGRGGE--RHTASLTTARWITVAMMVPVVLIALQGLS 364

Query: 315 VLRVFLIADLLAASTMPPILLGL 337
           VLR+FLIADLL A+ + P+LLGL
Sbjct: 365 VLRLFLIADLLCAAIVVPVLLGL 387



>gi|307544110|ref|YP_003896589.1| hypothetical protein HELO_1521 [Halomonas elongata DSM 2581]
 gi|503096465|ref|WP_013331276.1| sodium:solute symporter [Halomonas elongata]
 gi|307216134|emb|CBV41404.1| hypothetical protein HELO_1521 [Halomonas elongata DSM 2581]
          Length = 468

 Score =  100 bits (249), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/260 (32%), Positives = 138/260 (53%), Gaps = 12/260 (4%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+G I   L+ V     V+ +A+VT +YT  GGLRASL TD    W           
Sbjct: 136 ELTAIGAIASLLSEVPAGLVVMGVAVVTLVYTAVGGLRASLATDR---WQGWLLLALLVL 192

Query: 141 XXATSIRIEKSVIDNSDLLKS---NSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                + +   + +N+ +  +   N+L   L  I  +AV+ A LFH+G+WQR ++++ + 
Sbjct: 193 VAGVVVWVLPPLPENASMPTTPSVNALSVALTLI--IAVTAAELFHQGYWQRVWAAETNG 250

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
            L   A+ G + +  V++ +G  G++A   GL  GE  +     FF L    P W++   
Sbjct: 251 ALGRGALLGGVGVLLVVMVIGGLGILAAMHGLPLGEPPIP----FFALLAEAPGWLAVPA 306

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +VLAV++  ++ DTL +A  +          L +   R  +++  VP V   L++L VLR
Sbjct: 307 LVLAVTLVASSVDTLQNAIASLVVAGSGRRGLSIGSARLATVVLMVPVVVVALQELSVLR 366

Query: 318 VFLIADLLAASTMPPILLGL 337
           +FLIADLL A+T+ P+LLG+
Sbjct: 367 LFLIADLLCAATVVPVLLGV 386



>gi|348678595|gb|EGZ18412.1| hypothetical protein PHYSODRAFT_332209 [Phytophthora sojae]
          Length = 481

 Score =  100 bits (248), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 100/403 (24%), Positives = 175/403 (43%), Gaps = 82/403 (20%)

Query: 1   IMLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           ++ SGV   V+I  ++A+     I +   +  +  +++S+  +  ++ L   +F++ +GS
Sbjct: 1   MLASGVTYGVMIATLVAVAAYAIIVSRRMEVNSVKNFISAKNSTTSLRLAWCFFSAGMGS 60

Query: 61  SILYSFPEVG-----------TIAGLLGVIIELSAVG---------NILVT--------- 91
             L+SFP++G           T++G+ G+++ L+ VG         N+ +T         
Sbjct: 61  WTLFSFPQIGVDAGSWGVIGYTLSGVCGMLV-LAVVGPYTRSALGENVTMTDVVAQRFGY 119

Query: 92  ---------------------LTGVDKLA-----------PVICIAIVTTLYTGYGGLRA 119
                                LT V +L            P++ +  +T LY   GGLRA
Sbjct: 120 VMQVYIGLISVFYQFISLASELTCVAQLTTMFSPNAHSLIPILVVVFLTNLYLIIGGLRA 179

Query: 120 SLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFA 179
           SL TD  QG                 + I +     +++      G++ L  + +AV+ +
Sbjct: 180 SLATDVWQGIGVIALLAVVCIAMCFHVAIPEGAWSRTNVAAFTVEGFETLVTLVIAVTAS 239

Query: 180 TLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY 239
            LF  GFWQR +++ +D  LR +A     ++ P  V L L GM+              SY
Sbjct: 240 NLFFTGFWQRVYAAYDDHTLRKAAFMACGIIIPFTVALALAGMV--------------SY 285

Query: 240 LAF---FTLFKVLPDWVSG--ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVT 294
           LA+      F +L D   G  + +V+ ++M  +     I    A      F  +L L   
Sbjct: 286 LAYPDGVLFFAILMDMGRGWEVLIVIVIAMLASGVSDSIQIGIAAELTTCF-PKLSLLHA 344

Query: 295 RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 337
           R +  + NVPA+  G +  D+L +FLIADLL  + + P+LLG+
Sbjct: 345 RIIVALLNVPAIVIGYQQYDILNLFLIADLLCTAAVGPMLLGV 387



>gi|145345452|ref|XP_001417224.1| SSS family transporter: sodium ion/solute [Ostreococcus lucimarinus
           CCE9901]
 gi|144577451|gb|ABO95517.1| SSS family transporter: sodium ion/solute [Ostreococcus lucimarinus
           CCE9901]
          Length = 577

 Score = 99.0 bits (245), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 119/237 (50%), Gaps = 5/237 (2%)

Query: 104 IAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNS 163
           + ++T  YT   GL AS+ITD +QG                  + E +      + KS +
Sbjct: 192 VCVITLSYTMIAGLPASVITDRVQG--VMITGFMLLFSCVVLAKNEVTATQMRAVSKSTT 249

Query: 164 LGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMI 223
            G+ ++  + +A   A LF+ G WQR +++++ ++LR     G+ M+F V+ F G+ G+ 
Sbjct: 250 NGFVVMITLIIATLGAELFNAGQWQRVYAARSTQDLRKGLALGAGMIFVVMWFFGILGVT 309

Query: 224 AVWAGLWPGEENLE--SYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFS 281
           AV A      ++     YLAFF L + L      I ++ A S+  ++ D++ +  T+   
Sbjct: 310 AV-AKYRADFDDFSRLHYLAFFELAEGLAKGWHVIILIFATSLCVSSVDSIQNGLTSVLY 368

Query: 282 NDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLI 338
            DI N  LP N  R +    NV A++  +  +DVL +FL+ DL+ A   P + LGLI
Sbjct: 369 RDILNYDLPANSVRVICAALNVGAIFVAVDKIDVLSLFLMVDLVCALAAPALYLGLI 425



>gi|294900101|ref|XP_002776900.1| Osmoregulated proline transporter, putative [Perkinsus marinus ATCC
           50983]
 gi|239884101|gb|EER08716.1| Osmoregulated proline transporter, putative [Perkinsus marinus ATCC
           50983]
          Length = 515

 Score = 98.2 bits (243), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 86/322 (26%), Positives = 153/322 (47%), Gaps = 21/322 (6%)

Query: 27  GYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVIIELSAVG 86
           G +     + Y+S+ G++   A  ++W  +  G  +      V      + +  E +AVG
Sbjct: 107 GVRIRAKLNSYMSAGGSEGYAA--TDWILARFGRLVQVYAVLVSIFIMWISMTAEYTAVG 164

Query: 87  NILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI 146
            ++   +G+      + +A++T  YT   GL  S++TD  QG A            ATS 
Sbjct: 165 QVIEIFSGIPVWLSTLSVAVITLSYTLVAGLPVSILTDMAQGLAAVGLIVFAVV--ATST 222

Query: 147 RIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYG 206
            +  +  + + +    +LG + L  + +A+    L     WQR +++KND  LR+  + G
Sbjct: 223 NVTVTTANWNAVANFTTLGLESLITLVLAILGFQLLDMVVWQRVWAAKNDFNLRMGLLLG 282

Query: 207 SIMLFPVLVFLGLTGMIAVWAGLWPGEEN--------LESY---LAFFTLFKVLPDWVSG 255
             ++F  ++  G+ GM+A        ++         L  Y   LAFF L  VLP+   G
Sbjct: 283 GSLVFLTMLAFGILGMLA------EAQDRARPVPHLTLHPYTKALAFFDLLGVLPNAAVG 336

Query: 256 ITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDV 315
             VVLA+ +S ++ D+L SA  + F+ +       LN  R L ++ N+PA+   ++ + V
Sbjct: 337 AVVVLAICLSTSSVDSLQSALLSVFAAEFVKRGWSLNWGRLLLVLMNIPAIALAMRGISV 396

Query: 316 LRVFLIADLLAASTMPPILLGL 337
           + +FL+ADL+AA+   P   GL
Sbjct: 397 INLFLVADLVAATICMPAYCGL 418



>gi|346977478|gb|EGY20930.1| urea transport protein [Verticillium dahliae VdLs.17]
          Length = 345

 Score = 97.8 bits (242), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 69/119 (57%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           ELSA+G ++ TLTGV++L  ++    VTT+YT  GG + S +TDNIQG            
Sbjct: 128 ELSAIGQVVTTLTGVNQLPVMLVQVAVTTIYTSLGGFKISFVTDNIQGGMVICLIVIAAA 187

Query: 141 XXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 199
                  I+ S+I  S+ LK   LGWQLLYI+PV +     F   +W RAF+SK D++L
Sbjct: 188 TIGALTDIDTSLIRESEFLKPTLLGWQLLYILPVCILTNNFFLSNYWLRAFASKTDKDL 246



>gi|308802840|ref|XP_003078733.1| unnamed protein product [Ostreococcus tauri]
 gi|116057186|emb|CAL51613.1| unnamed protein product [Ostreococcus tauri]
          Length = 630

 Score = 97.1 bits (240), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 125/241 (51%), Gaps = 6/241 (2%)

Query: 101 VICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLK 160
           ++ + ++T  YT   GL AS+ITD +QG                  R+ K+  + +   K
Sbjct: 246 LVTVCVITLTYTMLAGLPASVITDRLQGVMITGFMLLFTVILLADNRVTKAQYERAS--K 303

Query: 161 SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLT 220
           S   G+ ++  + +AV  A LF+ G WQR +++K+  +LR     G+ ++F V+ F G+ 
Sbjct: 304 STDEGFVVMITLIIAVLSAELFNAGQWQRVYAAKSTADLRKGLALGAGLIFFVMWFFGVL 363

Query: 221 GMIAVWAGLWPGEE---NLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATT 277
           G++++ A  +   E      +YL FF L + L      + ++ A S+  ++ D++ +  T
Sbjct: 364 GVVSL-AKYYDDYEVSYTKYAYLGFFYLAESLNKGWHVLILIFATSLCVSSVDSIQNGLT 422

Query: 278 ANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 337
           +    D+ N  +P+NV R +    NV A++  +  +DVL +FL+ DL+ A   P + LGL
Sbjct: 423 SVLYRDVLNFGVPVNVIRVVCAALNVGAIFVAIDKIDVLSLFLMVDLVCALGAPALYLGL 482

Query: 338 I 338
           +
Sbjct: 483 M 483



>gi|348689995|gb|EGZ29809.1| hypothetical protein PHYSODRAFT_309973 [Phytophthora sojae]
          Length = 442

 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 95/369 (25%), Positives = 160/369 (43%), Gaps = 70/369 (18%)

Query: 28  YKKTKNKSDYLSSLGTQNAVALGSNWFASSIGSSILYSFPEVGTIAGLLGVI-------- 79
           + +  +  +++S+  + +A+ L   +FA+ IG+  L++FPE+G  AG  GVI        
Sbjct: 28  HIEVNSVKNFVSAKNSTSALRLAWCFFAAGIGAGSLFTFPEIGVDAGSWGVIGYTLSCIS 87

Query: 80  --IELSAVG---------NILVT--------------LTGVDKLAPVIC----------- 103
             + L  VG         NI +T              + G+      IC           
Sbjct: 88  GMVVLGVVGPYIRSAVGDNITMTDVVSNRFGYVMRIYIGGISLFYQFICLASEYTCIAQL 147

Query: 104 ----------------IAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIR 147
                           +A +T LY   GGLRASL TD  QG                 + 
Sbjct: 148 TTMMSPDAHPIITILLVAFLTNLYLTIGGLRASLATDVWQGIDVVALVGLVCIAMFVHVS 207

Query: 148 IEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGS 207
           I +     +++    + G+++L  + +AV+ + LF  GFWQR +++ +DR L  +A   S
Sbjct: 208 IPEGAWKKTNVAAFTTSGFEVLVTLVIAVTASNLFITGFWQRVYTAVDDRTLYKAAFMAS 267

Query: 208 IMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCA 267
           I+L    V L + GM++  A  +P     E  L F  L  +   W   I +V+A+ ++  
Sbjct: 268 IILTVFTVALAMAGMVSYLA--YP-----EGDLFFAILIDMGRGWQVLIIIVIAM-LASG 319

Query: 268 AYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAA 327
             D+L     A  +      +L L   R + ++ N PA+  G +  D++ ++LIADLL  
Sbjct: 320 VSDSLQVGIAAELTTCF--PKLTLLQARIICVLLNAPAIAIGYQQYDIMTLYLIADLLCT 377

Query: 328 STMPPILLG 336
             + P+LLG
Sbjct: 378 IAVGPMLLG 386



>gi|303282763|ref|XP_003060673.1| Na+/solute symporter [Micromonas pusilla CCMP1545]
 gi|226458144|gb|EEH55442.1| Na+/solute symporter [Micromonas pusilla CCMP1545]
          Length = 588

 Score = 95.1 bits (235), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 124/242 (51%), Gaps = 8/242 (3%)

Query: 101 VICI-AIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLL 159
           V+C+ A+VT  YT   G  AS+ITD IQG                   +  S +D+  + 
Sbjct: 184 VLCVVALVTMSYTMAAGFPASVITDRIQGVMIISFMLFFAIFLMAENPVTPSEMDS--VS 241

Query: 160 KSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGL 219
            S + G+ ++  + +A+  A LF+ G WQR +++K+  +LR     G+ ++F V+ F G+
Sbjct: 242 HSRTSGFVVMVTLIIAIISAELFNAGQWQRVYAAKSTVDLRKGLALGAGLIFIVMWFFGV 301

Query: 220 TGMIAVWAGLWPGEENLES---YLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISAT 276
            G++A  A  +  + N  +   YLA+F L + L      I ++ A S+  ++ D++ +  
Sbjct: 302 LGVVA--AAKYNDDFNAYTKFHYLAYFYLVENLAKGWHFIVLIFATSLCVSSVDSIQNGL 359

Query: 277 TANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLG 336
           T+    DI    LP+N  R + L  N+ A+      +DVL +FL+ DL+ A   P + LG
Sbjct: 360 TSVMYRDIKKFGLPVNSVRVVCLALNIGAIVVAADKIDVLSLFLMVDLVCAVAAPALYLG 419

Query: 337 LI 338
           +I
Sbjct: 420 MI 421



>gi|344233258|gb|EGV65131.1| hypothetical protein CANTEDRAFT_113558 [Candida tenuis ATCC 10573]
          Length = 249

 Score = 94.7 bits (234), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 127/248 (51%), Gaps = 12/248 (4%)

Query: 213 VLVFLGLTGMIAVWAG-LWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDT 271
           +   +G+ G +AVW+G L  G+EN    +AFF L   +P W+    ++  +++    +D+
Sbjct: 3   ICTLVGVPGFLAVWSGDLTVGDEN--GSMAFFILLAKMPGWIIAFVLIFTITICTCTFDS 60

Query: 272 LISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLD-VLRVFLIADLLAASTM 330
           L SA  +  SNDIF NR      R + +I  VP V   +K  D +L+++LIADL+++S +
Sbjct: 61  LQSAFVSTISNDIFRNRFKTIWARAMVVIMIVPIVVLAVKVADNILQIYLIADLISSSII 120

Query: 331 PPILLGLIDSLY-FLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIELIGLPLGLY-ITD 388
           P I LGL D  + FL  +D                +++Y  AK+G +L+ +  GLY   D
Sbjct: 121 PIIFLGLSDRFFWFLTGVDVMVGGLGALVAIFIFGTVYYGTAKEGGKLLLIWNGLYDPED 180

Query: 389 YSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKP---EVVDTK---KY 442
           +   GAF +AP   I    +    R+ ++WV+ KI  + F   ++P   E+V+ +    Y
Sbjct: 181 WGAFGAFEIAPFGGILIALVCVVARVGAIWVYCKITKKPFRALQRPVPVEIVEEEFDSAY 240

Query: 443 AGNKFKDD 450
                K D
Sbjct: 241 GSTNAKSD 248



>gi|332283893|ref|YP_004415804.1| sodium transporter family protein [Pusillimonas sp. T7-7]
 gi|503507058|ref|WP_013741719.1| sodium:solute symporter [Pusillimonas sp. T7-7]
 gi|330427846|gb|AEC19180.1| sodium transporter family protein [Pusillimonas sp. T7-7]
          Length = 479

 Score = 92.0 bits (227), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 131/289 (45%), Gaps = 46/289 (15%)

Query: 81  ELSAVGNILVTLTGVDKLAPV---ICIAIV---TTLYTGYGGLRASLITDNIQ------- 127
           E++A+  +      V  LAPV   +  AIV   T LYT YGGLRAS+ TD +Q       
Sbjct: 139 EITAIAKL------VQLLAPVPLWVTAAIVMGSTLLYTSYGGLRASIFTDKVQMAVIVPL 192

Query: 128 -------GWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLK-SNSLGWQLLYIMPVAVSFA 179
                  GW               +  IE   I    LL  ++ +G +  +   VA+   
Sbjct: 193 LLVLLVLGWQATG---------GLAPAIEGLQIKAPQLLSLTDPVGVKAGFTFFVAILLT 243

Query: 180 TLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY 239
            LFH+G WQR +S+K+ R +R   + G +   P +  +GL G+   + GL  G     S 
Sbjct: 244 GLFHQGNWQRVYSAKDTRSMRRGFLLGGLFAGPFIFVMGLFGL--AFVGL--GHTGDSSV 299

Query: 240 LAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDI------FNNRLPLNV 293
             F  L   +P W +   + L +++  +  DT ISA ++  + D+       N R  + +
Sbjct: 300 ALFSVLLGHIPGWFAIALIPLGLALVMSTADTTISAVSSLIAVDVRRLTPAINKRALMAL 359

Query: 294 TRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSLY 342
           +R+L  +  +P +    +   VL +FL+ADL  ++   P+  GL +  Y
Sbjct: 360 SRWLIFLLAIPVMIVAAQGYSVLYLFLLADLFCSAAAFPVFFGLFNRRY 408



>gi|401395637|ref|XP_003879646.1| hypothetical protein NCLIV_001050 [Neospora caninum Liverpool]
 gi|325114053|emb|CBZ49611.1| hypothetical protein NCLIV_001050 [Neospora caninum Liverpool]
          Length = 2887

 Score = 89.7 bits (221), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 77/295 (26%), Positives = 140/295 (47%), Gaps = 17/295 (5%)

Query: 50  GSNWFASSIGSSILYSFPEVGTIAGLLGVIIELSAVGNILVTLTGVDK-----LAPVICI 104
           G+++  S  G ++      +  +     +  EL+ VG   +T+  V K      A V+ +
Sbjct: 123 GTDYLLSRYGRAVQVGATAISLLFMFFALSGELTTVG---ITMNAVTKGAFPVFAAVVPV 179

Query: 105 AIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSV----IDNSDLLK 160
           A+VT  YT YGGLRAS++TD  QG                + R    V    + +    +
Sbjct: 180 AVVTLAYTTYGGLRASILTDVYQGVLVVGLVVPLLVTVFVTARDATGVGFPALASPAAFR 239

Query: 161 SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLT 220
               G   +++  +  SF  LF +G WQR +++K+ R++R++     ++ F  + FLG+ 
Sbjct: 240 DYIAG--AVFLFSIWPSF--LFDQGIWQRVWAAKSLRDVRIAFGLAGVVAFACVFFLGMV 295

Query: 221 GMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVSGITVVLAVSMSCAAYDTLISATTAN 279
           G+      L   +E  E  ++ F  L + LP    G+  VLAV+   ++ DT  +A  + 
Sbjct: 296 GIACREQALSHAQERNEGNVSVFGYLAETLPAGWVGVLTVLAVTCVASSADTYQTALASV 355

Query: 280 FSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPIL 334
           F+ D+  ++   N  R L ++ N+PA+      LD+L + + A++L    + P+L
Sbjct: 356 FAQDLIRSKRSFNWARVLIVLLNIPAIIVAALQLDLLTLNMTANVLCVIAVGPML 410



>gi|348678575|gb|EGZ18392.1| hypothetical protein PHYSODRAFT_301074 [Phytophthora sojae]
          Length = 528

 Score = 86.7 bits (213), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 97/396 (24%), Positives = 178/396 (44%), Gaps = 70/396 (17%)

Query: 1   IMLSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALGSNWFASSIGS 60
           ++ SGV   V+   ++A+     I +   +  +  +++S+  +   + L   +F++ IG+
Sbjct: 45  MLASGVTYGVMAATLIAVAAYAIIVSRRMEVNSVKNFVSAKNSTTTLRLAWCFFSAGIGA 104

Query: 61  SILYSFPEVG-----------TIAGLLGVII-------ELSAVG-NILVT---------- 91
             L+S+PE+G            ++G++G+I+         SA+G N+ +T          
Sbjct: 105 GTLFSYPEIGVSAGSWGVIGYALSGVVGMIVLALVGPYTRSALGENVTMTDVVSHRFGYI 164

Query: 92  --------------------LTGVDKLA--------PVICIAIV---TTLYTGYGGLRAS 120
                                T + +L         P++ I IV   T LY   GGLRAS
Sbjct: 165 MQVYVGFISMFYQFICLASEYTCIAQLTTMMSPNAHPIVTILIVAFLTNLYLVIGGLRAS 224

Query: 121 LITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFAT 180
           L TD  QG                 + I +    ++++    + G++ L  + +AV+ + 
Sbjct: 225 LATDVWQGIGVVFLVAVVCVAMFFHVSIPEGAWSSTNVAAFTTAGFETLVTLVIAVTASN 284

Query: 181 LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYL 240
           LF  GFWQR +++ +D  LR +A+  S ++    V L + GM++  A  +P     +  L
Sbjct: 285 LFFTGFWQRVYAAYDDNTLRKAALIASAIIALFTVALAMAGMVSYLA--YP-----DGSL 337

Query: 241 AFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLI 300
            F  L  +   W   I VV+A+ +S    D++     A  +      +L L  +R + ++
Sbjct: 338 FFAVLIDMGRGWQVLIVVVIAM-LSSGVSDSIQMGLAAELTTCF--PKLSLMHSRVICVL 394

Query: 301 ANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLG 336
            N PA+  G +  D+L ++LIADLL  + + P+LLG
Sbjct: 395 LNAPAIAIGYQQYDILTLYLIADLLCTAAVGPMLLG 430



>gi|401410997|ref|XP_003884946.1| conserved hypothetical protein [Neospora caninum Liverpool]
 gi|325119365|emb|CBZ54918.1| conserved hypothetical protein [Neospora caninum Liverpool]
          Length = 598

 Score = 86.3 bits (212), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 84/325 (25%), Positives = 140/325 (43%), Gaps = 28/325 (8%)

Query: 97  KLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNS 156
           +LA ++ +A+VT  YT + G  ASL+TD  Q +                 ++ ++   ++
Sbjct: 270 RLAVILSVAVVTFAYTAFAGTNASLVTDKFQSFLLPLLLSIVLVAPCLHSQVSEATWKDA 329

Query: 157 DLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVF 216
                      +L ++    ++A     G WQR  S K  RE+R   + GS+++ P +  
Sbjct: 330 ATWTPEGAFSGVLMVLSCCPAYA--MDPGMWQRVLSGKGTREVRWGLLGGSLLVLPTIAL 387

Query: 217 LGLTGMIAVWA-------GLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAY 269
           LGLTG++A          G    E+NL S   FF +   L   +  +  +LAV ++  + 
Sbjct: 388 LGLTGILARATAVALEAQGYTVNEDNLVSAPFFFLVLPSLSRGLVAVVFILAVILTAGSV 447

Query: 270 DTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLK-DLDVLRVFLIADLLAAS 328
           DT  SA  +  + ++   RL       +SL+AN+PAV          +++ LI +LL A+
Sbjct: 448 DTFQSALPSLVAVELNAKRLSFGWGLLVSLVANIPAVLLAFSWTESFIQLMLIGNLLTAA 507

Query: 329 TMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYH-------NAKDGIELIGLP 381
             PPI LGL      L  +                 SIF+        +A      I LP
Sbjct: 508 IFPPIFLGLCKRTTALGSV---------VGSIAGAVSIFFSGLIFTRGDASMAARWIVLP 558

Query: 382 LGLYITDYSVLGAFIVAPLSSIFFT 406
           LG+   D S +  F++ P ++   T
Sbjct: 559 LGM--DDPSAVYTFLIVPATAALVT 581



>gi|385305452|gb|EIF49423.1| urea urea polyamine [Dekkera bruxellensis AWRI1499]
          Length = 272

 Score = 84.7 bits (208), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 88/167 (52%), Gaps = 3/167 (1%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+   +  LTG+D    V+   +VTT+YT  GG + S  TD++Q             
Sbjct: 83  ELTAIDEAINALTGLDATPCVVVECVVTTIYTFLGGFKVSFATDSLQAGFVMVLLVVGVI 142

Query: 141 XXATSIRIEKSVIDN--SDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDRE 198
             AT++ I++ +     S +L +N LGW LLYI+ VA+     F  GFW R F+++ DR+
Sbjct: 143 GYATNVHIDQKIKQETASQMLDANKLGWMLLYILFVAILTNDAFLSGFWLRTFAARTDRD 202

Query: 199 LRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTL 245
           L ++    + +   V    GL G+ AVW G+    ++ E Y AF+ L
Sbjct: 203 LLIACSIAAFVCALVCTLAGLPGIYAVWTGVLKVGDD-EGYNAFYIL 248



>gi|344212553|ref|YP_004796873.1| sodium-solute symporter putative [Haloarcula hispanica ATCC 33960]
 gi|503807004|ref|WP_014040998.1| sodium:proline symporter [Haloarcula hispanica]
 gi|343783908|gb|AEM57885.1| sodium-solute symporter putative [Haloarcula hispanica ATCC 33960]
          Length = 502

 Score = 83.6 bits (205), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 115/242 (47%), Gaps = 18/242 (7%)

Query: 110 LYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI----RIEKSVIDNSDLLKSNSLG 165
           +YT YGGL AS++TD +Q                 S+        +V+     L     G
Sbjct: 169 VYTAYGGLLASIVTDTVQTLVILPLLAVGFGGALLSLGGTSEFHATVVSADPTLLDPGFG 228

Query: 166 WQLLYIMPVAVSF--ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMI 223
             L + + VA +   A + ++G WQR +++  +R LR      ++++ P+L+  GL G+ 
Sbjct: 229 PGLEFGLYVAFALLGANMLNQGVWQRVYAADGERALRRGLGIAAVVVVPMLLLAGLFGIA 288

Query: 224 AVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSND 283
           A  AGL   E    S   F  + +  P WV+   VVLAV +  ++ DT+ +A  +  + D
Sbjct: 289 A--AGLGLTESGSASIAFFLVVAEAFPTWVTLAIVVLAVLLVMSSADTMFNAIASVVTAD 346

Query: 284 IFNNRL---PLNVT-----RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILL 335
           +   RL   P   T     R L++   + A++ G +   VL++FL ADLLAA    P L 
Sbjct: 347 L--ARLLDDPDQRTLWLGGRGLTVAVALAAMFIGAQGYSVLQLFLTADLLAAGVFVPFLA 404

Query: 336 GL 337
           GL
Sbjct: 405 GL 406



>gi|330813504|ref|YP_004357743.1| sodium:solute transporter family [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|503460508|ref|WP_013695169.1| sodium:solute symporter [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486599|gb|AEA81004.1| sodium:solute transporter family [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 492

 Score = 83.6 bits (205), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 132/272 (48%), Gaps = 23/272 (8%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           E++A+  I+  + GV+     + I I T +YT  GGL+ S+ITD +Q             
Sbjct: 137 EVTAIAKIVNLIAGVELWKTSLLILISTLIYTLRGGLKISIITDKLQFIIISIFLILIFY 196

Query: 141 XXATS--IRIEKSVIDNSDLLKSNSL-------GWQLLYIMPVAVSFATLFHEGFWQRAF 191
               S  + I   +I     LK+ +L       G+       +AV    LF +G WQR +
Sbjct: 197 YLFISGEVNISSELIS----LKAGNLIDPKYFSGYTAGITFFIAVFATNLFDQGIWQRVY 252

Query: 192 SSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPD 251
           ++K+D++L  S V    ++ PV++ LG  G++AV      G+    S + F  L K    
Sbjct: 253 AAKSDQDLHKSFVSSFFIVLPVILILGFCGIVAVSL----GQAKDPSIVIFSLLLKNGTV 308

Query: 252 WVSGITVVLAVSMSCAAYDTLISATTANF---SNDIFNNR---LPLNVTRFLSLIANVPA 305
           W+S   +VLA+++  ++ DTLI+A ++ F   S  I  ++     L++++   ++ +   
Sbjct: 309 WLSISILVLALTLVISSMDTLINAISSLFIIESKKIIRSKSSDFYLSISKIFLILISCLV 368

Query: 306 VYWGLKDLDVLRVFLIADLLAASTMPPILLGL 337
                + + VL +FL+ADLL  +   P+  G+
Sbjct: 369 FMIASQGMSVLYMFLLADLLCCAAAIPVFYGM 400



>gi|159478048|ref|XP_001697116.1| hypothetical protein CHLREDRAFT_175912 [Chlamydomonas reinhardtii]
 gi|158274590|gb|EDP00371.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 485

 Score = 83.2 bits (204), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 128/282 (45%), Gaps = 25/282 (8%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           E + +G +     G      VI + ++T  YT YGG+  S++TD  QG            
Sbjct: 149 EYTTIGILFKYFVGSVDYPIVIVVGVLTMFYTAYGGVYISIVTDQAQGIMTSLFIMILII 208

Query: 141 XXATSIRIEK--------SVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFS 192
             A + R E         +  +    L +N  G+  ++ MP ++  AT+F E  WQ+ ++
Sbjct: 209 YTAITYRPENLPKPLPNDTTYETGWPLGANKFGYSAIFSMPCSLMAATVFSEAMWQKVWA 268

Query: 193 SKNDRELRLSAVYG-SIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK---- 247
           S + + +      G ++ +F V +F G  G +A WAG     E+ +  L  F LF     
Sbjct: 269 STDRKSVVFGGFVGFALTMFAVFIF-GFGGWLAAWAGY--VTEDTDPNLYLFQLFADERD 325

Query: 248 --------VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSL 299
                    +  W+  ++++LA +M+ AA D+L +  T+  +   F  +  +   R + L
Sbjct: 326 SATPGASVTIQSWIGVVSLILATTMNEAAVDSLQNGITSVLAYHFFKGQHTV-FPRIIVL 384

Query: 300 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSL 341
           + N+P +   L+   VL +FLI ++L       I LGL+D L
Sbjct: 385 LINIPLIIISLQGFKVLALFLITNMLTTCMFLLIGLGLVDRL 426



>gi|221507030|gb|EEE32634.1| hypothetical protein TGVEG_093120 [Toxoplasma gondii VEG]
          Length = 2070

 Score = 83.2 bits (204), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 88/348 (25%), Positives = 151/348 (43%), Gaps = 27/348 (7%)

Query: 3    LSGVVSNVLIYVVLAIFLGIGIYAGYKKTKNKSDYLSSLGTQNAVALG-SNWFASSIGSS 61
            L GV   VL  V +A+ L I +YAG    +           Q  VA G +++     G S
Sbjct: 1642 LYGVWPVVLYAVAIALPLWILMYAGPIVREE---------MQRHVAFGLTDYVHRRFGRS 1692

Query: 62   ILYSFPEVGTIAGLLGVIIELSAVGNILVTLT-GVDKLAPVICIAIVTTLYTGYGGLRAS 120
            +      V   + ++ +  EL+ +     TL     +LA ++ +A+VT  YT + G  AS
Sbjct: 1693 MQIVTAVVSFFSTVMAMAGELAFLAAAAQTLAPSFPRLAVILSVAMVTFTYTAFLGTNAS 1752

Query: 121  LITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFAT 180
            L TDN+QG                  ++ +     +    +      +L ++    ++A 
Sbjct: 1753 LETDNLQGILLPLLLLIVPICAFMHSQVSQDAWKAAATWTAEGASSGVLMVLSCCPAYA- 1811

Query: 181  LFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWA-------GLWPGE 233
               +G WQR  +    RE+R     GS+++   +  LG+TG++A          G    E
Sbjct: 1812 -MDQGMWQRVMTGSGSREVRFGLFGGSLLVLMTVSLLGVTGIVARATAVTLETQGFTVDE 1870

Query: 234  ENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNV 293
            ++L +   FF +   L   +  +  VLAV ++  + DT  SA  +  + ++    +  + 
Sbjct: 1871 DSLVAAPFFFLILPSLSRGLVAVVFVLAVILTVGSVDTFQSALPSLVAGELNTKGVSFDW 1930

Query: 294  TRFLSLIANVPAV----YWGLKDLDVLRVFLIADLLAASTMPPILLGL 337
               +S IAN PAV    +W       +++ LI +LL A+  PPI LGL
Sbjct: 1931 ALLVSFIANFPAVLLAYHW---TESFIQLLLIGNLLTAAIFPPIFLGL 1975



>gi|495587964|ref|WP_008312543.1| sodium-solute symporter putative [Haloarcula amylolytica]
 gi|445765873|gb|EMA17010.1| sodium-solute symporter putative [Haloarcula amylolytica JCM 13557]
          Length = 502

 Score = 82.8 bits (203), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 115/242 (47%), Gaps = 18/242 (7%)

Query: 110 LYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI----RIEKSVIDNSDLLKSNSLG 165
           +YT YGGL AS++TD +Q                 S+        +V+     L     G
Sbjct: 169 VYTTYGGLLASIVTDTVQTLVILPLLAVGFGGALLSLGGTSEFHATVVSADPTLLDPGFG 228

Query: 166 WQLLYIMPVAVSF--ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMI 223
             L + + VA +   A + ++G WQR +++  +R LR      ++++ P+L+  GL G+ 
Sbjct: 229 PGLEFGLYVAFALLGANMLNQGVWQRVYAADGERALRRGLGIAAVVVVPMLLLAGLFGIA 288

Query: 224 AVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSND 283
           A  AGL   E    S   F  + +  P WV+   VVLAV +  ++ DT+ +A  +  + D
Sbjct: 289 A--AGLGLTESGSASIAFFLVVAEAFPTWVTLAIVVLAVLLVMSSADTMFNAIASVVTAD 346

Query: 284 IFNNRL---PLNVT-----RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILL 335
           +   RL   P   T     R L++   + A++ G +   VL++FL ADLLAA    P L 
Sbjct: 347 L--ARLLDDPDQRTLWLGGRGLTVAVALAAMFIGAQGYSVLQLFLTADLLAAGVFVPFLA 404

Query: 336 GL 337
           GL
Sbjct: 405 GL 406



>gi|325185496|emb|CCA19979.1| Solute:Sodium Symporter (SSS) Family putative [Albugo laibachii
           Nc14]
          Length = 462

 Score = 82.0 bits (201), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 127/261 (48%), Gaps = 16/261 (6%)

Query: 81  ELSAVGNILVTLTGVDK-LAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX 139
           E + VG +   L+   K +  ++ +A++T LYT  GG+ ASL TD  QG           
Sbjct: 142 EFTCVGQLTAILSPDAKPIVVILTVAVITNLYTLVGGMLASLATDVWQGVGVLSLVLLVC 201

Query: 140 XXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDREL 199
               +S     +V+  +     ++ G++ L  + +AV+ + LF  GFWQR +++ +D  L
Sbjct: 202 IVMISSTTTPANVLSVAVF---DTSGFETLVTLCIAVTSSNLFFSGFWQRVYAAADDATL 258

Query: 200 RLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPD-WVSGITV 258
           R + +Y      P  V L + GM++     +PGE      + FF+L   +   W   + +
Sbjct: 259 RKACLYACGFCIPFTVALAVAGMVSSLK--YPGE------IYFFSLLLNMGTVWQVFVMM 310

Query: 259 VLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRV 318
           V+    S A+    +  T    SN      L L   R + ++ NV A++  L++  VL +
Sbjct: 311 VIVSLASSASDSLQMGITAELVSN---FPSLSLFHARVICVMLNVSAIFVALQNYSVLTL 367

Query: 319 FLIADLLAASTMPPILLGLID 339
           FLI+DLL  +++ P+LL L D
Sbjct: 368 FLISDLLCTASVGPMLLALWD 388



>gi|491681725|ref|WP_005537864.1| sodium-solute symporter putative [Haloarcula argentinensis]
 gi|445767761|gb|EMA18854.1| sodium-solute symporter putative [Haloarcula argentinensis DSM
           12282]
          Length = 502

 Score = 80.1 bits (196), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 118/243 (48%), Gaps = 20/243 (8%)

Query: 110 LYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI----RIEKSVIDNSDLLKSNSLG 165
           +YT YGGL AS++TD +Q                 S+        +V+     L   + G
Sbjct: 169 VYTTYGGLLASIVTDTVQTLVILPLLAVGFGGALLSLGGTSEFHATVVSADPTLLDPTFG 228

Query: 166 WQLLYIMPVAVSF--ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMI 223
             L + + VA +   A + ++G WQR +++  +  LR      ++++ P+L+  GL G+ 
Sbjct: 229 PGLQFGLYVAFALLGANMLNQGVWQRVYAADGEGALRRGLGIAAVVVVPMLLLAGLFGIA 288

Query: 224 AVWAGLWPGEENLESYLAFF-TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSN 282
           A   GL    E+  + +AFF  + +  P WV+   VVLAV +  ++ DT+ +A  +  + 
Sbjct: 289 AAGLGL---TESGSASIAFFLVVAEAFPTWVTLAIVVLAVLLVMSSADTMFNAIASVVTA 345

Query: 283 DIFNNRL---PLNVT-----RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPIL 334
           D+   RL   P   T     R L++   + A++ G +   VL++FL ADLLAA    P L
Sbjct: 346 DL--ARLLDDPDQRTLWLGGRGLTVAVALAAMFIGAQGYSVLQLFLTADLLAAGVFVPFL 403

Query: 335 LGL 337
            GL
Sbjct: 404 AGL 406



>gi|490652117|ref|WP_004517111.1| sodium-solute symporter putative [Haloarcula vallismortis]
 gi|445755364|gb|EMA06754.1| sodium-solute symporter putative [Haloarcula vallismortis ATCC
           29715]
          Length = 502

 Score = 79.7 bits (195), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 114/242 (47%), Gaps = 18/242 (7%)

Query: 110 LYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI----RIEKSVIDNSDLLKSNSLG 165
           +YT YGGL AS++TD +Q                 S+        +V+     L     G
Sbjct: 169 VYTTYGGLLASIVTDTVQTLVILPLLAIGFGGALLSLGGTSEFHATVVSADPTLLDPGFG 228

Query: 166 WQLLYIMPVAVSF--ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMI 223
             L + + VA +   A + ++G WQR +++  +  LR      ++++ P+L+  GL G+ 
Sbjct: 229 PGLEFGLYVAFALLGANMLNQGVWQRVYAADGEDTLRRGMGIAAVVVVPMLLLSGLFGIA 288

Query: 224 AVWAGLWPGEENLESYLAFFTLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSND 283
           A  AGL   E    S   F  + +  P WV+   VVLAV +  ++ DT+ +A  +  + D
Sbjct: 289 A--AGLGLTESGSASIAFFLVVAEAFPTWVTLAIVVLAVLLVMSSADTMFNAIASVVTAD 346

Query: 284 IFNNRL---PLNVT-----RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILL 335
           +   RL   P   T     R L++   + A++ G +   VL++FL ADLLAA    P L 
Sbjct: 347 L--ARLLDDPDQQTLWLGGRGLTVAVALAAIFIGAQGYSVLQLFLTADLLAAGVFVPFLA 404

Query: 336 GL 337
           GL
Sbjct: 405 GL 406



>gi|495594848|ref|WP_008319427.1| sodium/proline symporter [Haloferax mucosum]
 gi|445744445|gb|ELZ95923.1| sodium/proline symporter [Haloferax mucosum ATCC BAA-1512]
          Length = 509

 Score = 78.6 bits (192), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 129/274 (47%), Gaps = 18/274 (6%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+ +   L  + GV +    + +     LYT YGGLRAS+ TD IQ             
Sbjct: 139 ELTGIAGALSLVAGVPQWQTALLVGGFVLLYTSYGGLRASITTDAIQAVVVFPLLLLAVG 198

Query: 141 XXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSK 194
               S+    + +D     N  LL   SL G Q    +  A+  A L ++ +WQR ++S 
Sbjct: 199 GALVSLGGPTAALDGITETNPALLDLGSLAGLQFGLALAFAILGAELINQTWWQRIYASD 258

Query: 195 N----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFK-VL 249
           +    +R  R +AV   +++F V  F G+  +            N  + +AFF L +   
Sbjct: 259 SEQTVERSFRSAAVANGLVVF-VTAFFGIVAVGNADVVTNVTSSNYNADVAFFVLLQDAF 317

Query: 250 PDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF------NNRLPLNVTRFLSLIANV 303
           P+W+    V+LA+ +  ++ DTL +A ++  + DI       ++R     +R L+++  +
Sbjct: 318 PEWLVLAAVLLALLLVMSSIDTLFNALSSLVTADIARVLSSPSDRQLAVGSRALTVVVAL 377

Query: 304 PAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 337
            A+Y  L+   VLR+F  ADLL A+   P++ GL
Sbjct: 378 AAIYVSLRAQSVLRLFFFADLLGAAVAFPLVYGL 411



>gi|493564321|ref|WP_006517691.1| Na+/proline symporter [Leptolyngbya sp. PCC 7375]
 gi|425762470|gb|EKV03323.1| Na+/proline symporter [Leptolyngbya sp. PCC 7375]
          Length = 502

 Score = 78.6 bits (192), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 131/271 (48%), Gaps = 17/271 (6%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+   L  +  V      + +     +YT  GGL  +++TD +Q             
Sbjct: 141 ELTAIAKALQLVADVPLGVTALVVITAVFIYTTVGGLGTTILTDVVQFVVIVPLLLICAG 200

Query: 141 XXATSIRIEKS----VIDNSDLLK-SNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 195
               ++    +    V    +LL   N  G +    + +A+  A +F++G WQR ++ ++
Sbjct: 201 VIVVALGGSDAFGAVVAQQPELLSLGNIGGIRFGATLMIAIVAAEVFNQGNWQRVYACRD 260

Query: 196 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVL--PDWV 253
            + +R + +  ++++ P++   GL G++AV   L   + ++    A F L   L  P WV
Sbjct: 261 SQTVRRAFLGSAVIILPLIFIAGLLGVLAV--PLAEVQPDIIGETALFGLLNQLAMPGWV 318

Query: 254 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLP-------LNVTRFLSLIANVPAV 306
               +VLA+++  ++ DT+++   + F+ D+    LP       L V+R L+++  VPA+
Sbjct: 319 VVSVIVLALALVMSSLDTMLNGIASVFTLDLMR-MLPDPSANNVLRVSRILTVLVGVPAI 377

Query: 307 YWGLKDLDVLRVFLIADLLAASTMPPILLGL 337
               +   VL +F +ADL+ A+ + P+L GL
Sbjct: 378 AIAAQGYSVLYLFFVADLICAAVLFPMLYGL 408



>gi|452837940|gb|EME39881.1| hypothetical protein DOTSEDRAFT_65790 [Dothistroma septosporum
           NZE10]
          Length = 410

 Score = 77.8 bits (190), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 86/358 (24%), Positives = 146/358 (40%), Gaps = 76/358 (21%)

Query: 78  VIIELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXX 137
           ++ ELSA+  ++  LTG+  L  VI     TT++T  GG R S +T+N+QG         
Sbjct: 93  MVAELSALQQVVNLLTGLSGLPAVIIQCFTTTVHTTAGGFRISFVTENVQG--------- 143

Query: 138 XXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAVSFATLFHEGFWQRAFSSKNDR 197
                                               VA+     F  GFW RAF+ K D+
Sbjct: 144 -----------------------------------DVAILANDFFLCGFWMRAFALKTDK 168

Query: 198 ELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLPDWVSGIT 257
           +L +     ++++  V V + +TG+IA W+G+                F V P  +    
Sbjct: 169 DLSIGVSISAVVVIVVTVLVDVTGVIAGWSGV----------------FGVSPMPI---- 208

Query: 258 VVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLR 317
           +V+ +++S +A+D   SA  +  S+  F N L + V R + +I  V  V   LK    L+
Sbjct: 209 LVMVMTISTSAFDFPRSALISTGSDAFFRNTLDICVVRLIVVILIVATVVVALKSPSTLQ 268

Query: 318 VFLIADLLAASTMPPILLGLIDSLYFLNWIDXXXXXXXXXXXXXXXXSIFYHNAKDGIEL 377
           +FLI+D+++ S +P +++GL    YF    +                S  +      + L
Sbjct: 269 IFLISDVISTSIIPRLVIGLTSRAYFWRGFEVVVGRLGRILAVASWESFEFDRGDVCLRL 328

Query: 378 IGLPLGLYITDYSVLGAFIVAPLSSIFFTFLSFGVRLISMWVFTKIRGEEFVFPKKPE 435
           + L    Y T + +L            F+ + +  ++   W   KI G  FV   + E
Sbjct: 329 VCLWGLRYCTGWRLL------------FSIIEYAGKIGFEWAMAKIHGTRFVALDRDE 374



>gi|494345167|ref|WP_007188843.1| sodium-solute symporter putative [Haloarcula californiae]
 gi|445769530|gb|EMA20604.1| sodium-solute symporter putative [Haloarcula californiae ATCC
           33799]
          Length = 502

 Score = 76.6 bits (187), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 118/243 (48%), Gaps = 20/243 (8%)

Query: 110 LYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI----RIEKSVIDNSDLLKSNSLG 165
           +YT YGGL AS++TD +Q                 S+        +V+     L   + G
Sbjct: 169 VYTTYGGLLASIVTDTVQTLVILPLLAVGFGGALLSLGGTSEFHATVVSADPTLLDPTFG 228

Query: 166 WQLLYIMPVAVSF--ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMI 223
             L + + VA +   A + ++G WQR +++  +R LR       +++ P+L+  GL G+ 
Sbjct: 229 PGLQFGLYVAFALLGANMLNQGVWQRVYAADGERALRRGMGIAGLVVVPMLLLSGLFGIA 288

Query: 224 AVWAGLWPGEENLESYLAFF-TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSN 282
           A   GL    E+  + +AFF  L +  P WV+   VVLAV +  ++ DT+ +A  +  + 
Sbjct: 289 AAGLGL---TESGSASIAFFLVLAEAFPTWVTLAVVVLAVLLVMSSADTMFNAIASVVTA 345

Query: 283 DIFNNRL---PLNVT-----RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPIL 334
           D+   RL   P   T     R L++   + A++ G +   VL++FL ADLLAA    P L
Sbjct: 346 DL--ARLLDDPDQRTLWLGGRGLTVAVALAAMFIGAQGYSVLQLFLTADLLAAGVFVPFL 403

Query: 335 LGL 337
            GL
Sbjct: 404 AGL 406



>gi|302828314|ref|XP_002945724.1| hypothetical protein VOLCADRAFT_115669 [Volvox carteri f.
           nagariensis]
 gi|300268539|gb|EFJ52719.1| hypothetical protein VOLCADRAFT_115669 [Volvox carteri f.
           nagariensis]
          Length = 528

 Score = 76.6 bits (187), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/357 (22%), Positives = 148/357 (41%), Gaps = 69/357 (19%)

Query: 29  KKTKNKSDYLSSLGTQNAVALGSNWFASSIGS-----------------SILYSF----P 67
            + +   +++++ GTQN   +  ++FAS++G+                  ++Y+F    P
Sbjct: 19  HRDQTAEEFITARGTQNKWRIAWSFFASAVGAWCITAPPSFAVSTGIVGCVMYAFASGIP 78

Query: 68  EVGTIAGLLGVII-----------ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGG 116
             G +A  L V+I           E + +G +     G      +I +  +T +YT YGG
Sbjct: 79  RFGPVARTLVVVISLYNMSIALLAEYTTIGLLFKYFVGSVDYPVIIVVGALTMIYTAYGG 138

Query: 117 LRASLITDNIQGWAXXXXXXXXXXXXATSIRIEKSVIDNSDLLKSNSLGWQLLYIMPVAV 176
           +  S+ITD  QG               T++ I   VI  +   + +SL   L        
Sbjct: 139 VYISIITDQAQG-------------IFTALFILILVIYTAVTFRPDSLPKPLP------- 178

Query: 177 SFATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENL 236
               L     WQ+ ++S++ R +      G +++   +   G  G +A W G      + 
Sbjct: 179 --ENLGPNAMWQKVWASESRRAVVFGGGVGFLLIMVAVFLFGFGGWLAAWGGYITDVTDY 236

Query: 237 ESYLAFFTLFKVLPD------------WVSGITVVLAVSMSCAAYDTLISATTANFSNDI 284
             YL  F +F    D            WV  +T++LA +M+ +A D++ +  TA  +   
Sbjct: 237 NLYL--FQVFSSERDAAATGASVQVSSWVGVVTLILAATMNESAIDSIQNGITAVLAQHF 294

Query: 285 FNNRLPLNVTRFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGLIDSL 341
           F  +  +   R +++  N+P +   L+   VL +FL  +LL+      + LGL + L
Sbjct: 295 FKGQHTV-FPRLVTVCVNIPLIIIALQGYKVLSLFLTTNLLSTCCFLLVGLGLSNRL 350



>gi|167042009|gb|ABZ06745.1| putative Sodium:solute symporter family protein [uncultured marine
           microorganism HF4000_141F21]
          Length = 484

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 112/204 (54%), Gaps = 11/204 (5%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX- 139
           E++AV  ++  ++G         + + T +YT YGGLRAS++TDNIQ +           
Sbjct: 144 EVTAVSMLVNYISGTPLWLTATLVIVTTLVYTLYGGLRASILTDNIQFFIVIILLLICAY 203

Query: 140 ---XXXATSIRIEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 195
                 + SI  +    ++  LL S  +  +       +AV+   LFH+G WQR F++KN
Sbjct: 204 YLFSLNSDSISFQVIQTNSQHLLSSKYIPNYTAGLTFFIAVAATNLFHQGNWQRVFAAKN 263

Query: 196 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVS 254
           ++ L+ S +   I++ P++ F+G++G+IA+       +  +   LAFF+ L K   +++S
Sbjct: 264 NKVLKKSLLISFIIIIPIVFFMGISGIIAI-----SLDSAVNPDLAFFSILLKNKTEFLS 318

Query: 255 GITVVLAVSMSCAAYDTLISATTA 278
            I ++LAVS++ +  DTL++A ++
Sbjct: 319 VIIIILAVSLAISTIDTLVNAISS 342



>gi|495289883|ref|WP_008014637.1| Na+/solute symporter [Haloterrigena limicola]
 gi|445664725|gb|ELZ17430.1| Na+/solute symporter [Haloterrigena limicola JCM 13563]
          Length = 505

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 130/278 (46%), Gaps = 26/278 (9%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+ +   L  + GV +    + +     LYT YGGLRAS+ TD+IQ             
Sbjct: 134 ELTGIAGALSLVAGVPQWQTAVLVGGFVLLYTSYGGLRASIFTDSIQALLVLPLLVVAFA 193

Query: 141 XXATSIRIEKSVID-----NSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSK 194
               S+     + D     N  LL    + G Q    +  A+  A L ++ +WQR ++++
Sbjct: 194 GAIVSLGGAGEIHDGIASTNPSLLDPGFIPGLQFGLALAFAILGAELINQLWWQRIYAAE 253

Query: 195 N----DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESY---LAFFTLFK 247
           +    +R  R + +   +++F      GL G++A        +    +Y   +AFF L +
Sbjct: 254 DGQTVERGFRNATIANGLIVF----LAGLFGLVAAGNADVVTDVTSSAYNADIAFFVLLQ 309

Query: 248 -VLPDWVSGITVVLAVSMSCAAYDTLISATTANFSNDIF-------NNRLPLNVTRFLSL 299
              P+W+    V+LA+ +  ++ DTL +A ++  + D+        +  L L   R L++
Sbjct: 310 TAFPEWIVLAVVLLALLLVMSSVDTLFNALSSIVTADLPRLLSDPDDRSLKLG-ARLLTI 368

Query: 300 IANVPAVYWGLKDLDVLRVFLIADLLAASTMPPILLGL 337
           +  V A+Y  L+   VLR+F +ADLL A+   P+L GL
Sbjct: 369 VVAVSAIYVSLRARSVLRLFFLADLLGAAVAFPLLYGL 406



>gi|221482350|gb|EEE20705.1| sodium/proline symporter, putative [Toxoplasma gondii GT1]
 gi|221502757|gb|EEE28471.1| hypothetical protein TGVEG_106540 [Toxoplasma gondii VEG]
          Length = 541

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 125/261 (47%), Gaps = 10/261 (3%)

Query: 81  ELSAVGNIL--VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXX 138
           EL+ VG  +  VT       A VI +A+VT  YT YGGLRAS++TD  QG          
Sbjct: 154 ELTTVGVTMNAVTNGAFPVFAGVIPVAVVTLAYTTYGGLRASILTDVYQGLLVVGLVVPL 213

Query: 139 XXXXATSIRIEKSVIDNSDLLKSNSLGWQLL----YIMPVAVSFATLFHEGFWQRAFSSK 194
                ++ R +   +DN+  + + S   Q +    ++  +  SF  L  +G WQR ++++
Sbjct: 214 LIIVFSTAR-DNMFVDNAATVAAPSGYSQYIAGGVFLFSIWPSF--LLDQGIWQRVWAAR 270

Query: 195 NDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWV 253
           +  ++R++    + + F  +   G+ G+      L    +  E  ++ F  L + LP   
Sbjct: 271 SLTDIRIAFAGAAFVAFSCVFLFGMVGIACRDQALSQAMQRQEENVSIFGYLAETLPAGW 330

Query: 254 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 313
            G+  VLA++   ++ DT  +A    F+ D+  ++   N  R L ++ N+PA+      L
Sbjct: 331 VGVLTVLAITCVASSADTYQTALAVVFAQDLLRSKRSFNWARVLIVLLNIPAILVASLQL 390

Query: 314 DVLRVFLIADLLAASTMPPIL 334
           D+L + + A++L      P+L
Sbjct: 391 DLLTLNMTANVLCVVAAGPLL 411



>gi|237842017|ref|XP_002370306.1| sodium:solute symporter family domain-containing protein
           [Toxoplasma gondii ME49]
 gi|211967970|gb|EEB03166.1| sodium:solute symporter family domain-containing protein
           [Toxoplasma gondii ME49]
          Length = 541

 Score = 75.9 bits (185), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 125/261 (47%), Gaps = 10/261 (3%)

Query: 81  ELSAVGNIL--VTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXX 138
           EL+ VG  +  VT       A VI +A+VT  YT YGGLRAS++TD  QG          
Sbjct: 154 ELTTVGVTMNAVTNGAFPVFAGVIPVAVVTLAYTTYGGLRASILTDVYQGLLVVGLVVPL 213

Query: 139 XXXXATSIRIEKSVIDNSDLLKSNSLGWQLL----YIMPVAVSFATLFHEGFWQRAFSSK 194
                ++ R +   +DN+  + + S   Q +    ++  +  SF  L  +G WQR ++++
Sbjct: 214 LIIVFSTAR-DNMFVDNAATVAAPSGYSQYIAGGVFLFSIWPSF--LLDQGIWQRVWAAR 270

Query: 195 NDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWV 253
           +  ++R++    + + F  +   G+ G+      L    +  E  ++ F  L + LP   
Sbjct: 271 SLTDIRIAFAGAAFVAFSCVFLFGMVGIACRDQALSQAMQRQEENVSIFGYLAETLPAGW 330

Query: 254 SGITVVLAVSMSCAAYDTLISATTANFSNDIFNNRLPLNVTRFLSLIANVPAVYWGLKDL 313
            G+  VLA++   ++ DT  +A    F+ D+  ++   N  R L ++ N+PA+      L
Sbjct: 331 VGVLTVLAITCVASSADTYQTALAVVFAQDLLRSKRSFNWARVLIVLLNIPAILVASLQL 390

Query: 314 DVLRVFLIADLLAASTMPPIL 334
           D+L + + A++L      P+L
Sbjct: 391 DLLTLNMTANVLCVVAAGPLL 411



>gi|493500829|ref|WP_006455347.1| transporter, SSS family, putative [Synechococcus sp. PCC 7335]
 gi|196190635|gb|EDX85599.1| transporter, SSS family, putative [Synechococcus sp. PCC 7335]
          Length = 538

 Score = 75.5 bits (184), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 134/271 (49%), Gaps = 19/271 (7%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXXX 140
           EL+A+  +L  +  V  L   + +     +YT YGGL+ +++TD  Q             
Sbjct: 190 ELTAIAQVLQLVANVPLLVTSLVVIAAVFIYTTYGGLKVTILTDAAQFILIVPLLLICFI 249

Query: 141 XXATSI-----RIEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSK 194
               S+            D    L   +L G +    + +A+  A LF++G WQR ++ K
Sbjct: 250 ATVASLGGWSGAFGPVAQDLPAFLSLGNLDGLRFGATLMIAIIAAELFNQGNWQRVYACK 309

Query: 195 NDRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFTLFKVLP--DW 252
           +D+ +R + +  ++++ P+L   GL G+IA  AG      +L    AFF L + L    W
Sbjct: 310 DDQTVRRAFLGSALVILPLLFLSGLLGIIA--AGF-----DLSGTTAFFDLLQALEISGW 362

Query: 253 VSGITVVLAVSMSCAAYDTLISATTANFSNDIFN-NRLP---LNVTRFLSLIANVPAVYW 308
           + G  V+LAV++  ++ DTL++  +A F+ D+   +R P   L ++R L++   + AV  
Sbjct: 363 LLGSIVLLAVALVMSSLDTLLNGISAVFTVDLLRLSRQPAQVLMISRILTVAVGLLAVPI 422

Query: 309 GLKDLDVLRVFLIADLLAASTMPPILLGLID 339
             +   VL +F +ADL+ A+ + PI+  L +
Sbjct: 423 AAQGYSVLYLFFVADLICAALLFPIVFSLYN 453



>gi|55378520|ref|YP_136370.1| sodium-solute symporter [Haloarcula marismortui ATCC 43049]
 gi|499543045|ref|WP_011223828.1| sodium:proline symporter [Haloarcula marismortui]
 gi|55231245|gb|AAV46664.1| sodium-solute symporter putative [Haloarcula marismortui ATCC
           43049]
          Length = 502

 Score = 75.1 bits (183), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 117/243 (48%), Gaps = 20/243 (8%)

Query: 110 LYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI----RIEKSVIDNSDLLKSNSLG 165
           +YT YGGL AS++TD +Q                 S+        +V+     L     G
Sbjct: 169 VYTAYGGLLASIVTDTVQTLVILPLLAVGFGGALLSLGGTSEFHATVVSADPTLLDPGFG 228

Query: 166 WQLLYIMPVAVSF--ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMI 223
             L + + VA +   A + ++G WQR +++  D  LR      ++++ P+L+  GL G+ 
Sbjct: 229 PGLEFGLYVAFALLGANMLNQGVWQRVYAADGDGALRRGMGIAAVVVVPMLLLSGLFGIA 288

Query: 224 AVWAGLWPGEENLESYLAFF-TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSN 282
           A   GL    E+  + +AFF  + +  P WV+   VVLAV +  ++ DT+ +A  +  + 
Sbjct: 289 AAGLGL---TESGSASIAFFLVVAEAFPTWVTLAVVVLAVLLVMSSADTMFNAIASVVTA 345

Query: 283 DIFNNRL---PLNVT-----RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPIL 334
           D+   RL   P   T     R L++   + A++ G +   VL++FL ADLLAA    P L
Sbjct: 346 DL--ARLLDDPDQRTLWLGGRGLTVAVALAAMFIGAQGYSVLQLFLTADLLAAGVFVPFL 403

Query: 335 LGL 337
            GL
Sbjct: 404 AGL 406



>gi|167042081|gb|ABZ06816.1| putative sodium:solute symporter family protein [uncultured marine
           microorganism HF4000_141I21]
          Length = 484

 Score = 75.1 bits (183), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 112/204 (54%), Gaps = 11/204 (5%)

Query: 81  ELSAVGNILVTLTGVDKLAPVICIAIVTTLYTGYGGLRASLITDNIQGWAXXXXXXXXX- 139
           E++AV  ++  ++G         + + T +YT YGGLRAS++TDNIQ +           
Sbjct: 144 EVTAVSMLVNYISGTPLWLTATLVIVTTLVYTLYGGLRASILTDNIQFFIVIILLLICAY 203

Query: 140 ---XXXATSIRIEKSVIDNSDLLKSNSL-GWQLLYIMPVAVSFATLFHEGFWQRAFSSKN 195
                 + SI  +    ++  LL S  +  +       +AV+   LFH+G WQR F++KN
Sbjct: 204 YLFSLNSDSISFQVIQTNSQYLLSSKYIPNYTAGLTFFIAVAATNLFHQGNWQRVFAAKN 263

Query: 196 DRELRLSAVYGSIMLFPVLVFLGLTGMIAVWAGLWPGEENLESYLAFFT-LFKVLPDWVS 254
           ++ L+ S +   I++ P++ F+G++G+IA+       +  +   LAFF+ L K   +++S
Sbjct: 264 NKVLKKSLLISFIIIIPIVFFMGISGIIAI-----SLDSAVNPDLAFFSILLKDKTEFLS 318

Query: 255 GITVVLAVSMSCAAYDTLISATTA 278
            I ++LAVS++ +  DTL++A ++
Sbjct: 319 VIIIILAVSLAISTIDTLVNAISS 342



>gi|491096221|ref|WP_004957825.1| sodium-solute symporter putative [Haloarcula sinaiiensis]
 gi|445764745|gb|EMA15889.1| sodium-solute symporter putative [Haloarcula sinaiiensis ATCC
           33800]
          Length = 502

 Score = 73.9 bits (180), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 118/243 (48%), Gaps = 20/243 (8%)

Query: 110 LYTGYGGLRASLITDNIQGWAXXXXXXXXXXXXATSI----RIEKSVIDNSDLLKSNSLG 165
           +YT YGGL AS++TD +Q                 S+        +V+     L   + G
Sbjct: 169 VYTTYGGLLASIVTDTVQTLVILPLLAVGFGGALLSLGGTSEFHATVVSADPTLLDPTFG 228

Query: 166 WQLLYIMPVAVSF--ATLFHEGFWQRAFSSKNDRELRLSAVYGSIMLFPVLVFLGLTGMI 223
             L + + VA +   A + ++G WQR +++  +  LR      ++++ P+L+  GL G+ 
Sbjct: 229 PGLQFGLYVAFALLGANMLNQGVWQRVYAADGEGALRRGMGIAALVVVPMLLLSGLFGIA 288

Query: 224 AVWAGLWPGEENLESYLAFF-TLFKVLPDWVSGITVVLAVSMSCAAYDTLISATTANFSN 282
           A   GL    E+  + +AFF  L +  P WV+   VVLAV +  ++ DT+ +A  +  + 
Sbjct: 289 AAGLGL---TESGSASIAFFLVLAEAFPTWVTLAVVVLAVLLVMSSADTMFNAIASVVTA 345

Query: 283 DIFNNRL---PLNVT-----RFLSLIANVPAVYWGLKDLDVLRVFLIADLLAASTMPPIL 334
           D+   RL   P   T     R L++   + A++ G +   VL++FL ADLLAA    P L
Sbjct: 346 DL--ARLLDDPDQRTLWLGGRGLTVAVALAAMFIGAQGYSVLQLFLTADLLAAGVFVPFL 403

Query: 335 LGL 337
            GL
Sbjct: 404 AGL 406