BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10295_c0_seq1-m.110 5prime_partial 897-1547(-) 217 (-)
         (216 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|117422550|gb|ABK34898.1| cob(I)alamin adenosyltransferase [Bl...   246   3e-63   Blastocladiella emersonii
gi|196014876|ref|XP_002117296.1| hypothetical protein TRIADDRAFT...   218   7e-55   Trichoplax adhaerens
gi|109497496|ref|XP_001080395.1| PREDICTED: cob(I)yrinic acid a,...   215   5e-54   Rattus norvegicus [brown rat]
gi|126631839|gb|AAI33926.1| Si:dkey-189p24.5 protein [Danio rerio]    215   6e-54   Danio rerio [leopard danio]
gi|130492033|ref|NP_001076278.1| cob(I)yrinic acid a,c-diamide a...   214   9e-54   Danio rerio [leopard danio]
gi|432874052|ref|XP_004072448.1| PREDICTED: cob(I)yrinic acid a,...   211   7e-53   Oryzias latipes [Japanese rice fish]
gi|348584470|ref|XP_003477995.1| PREDICTED: cob(I)yrinic acid a,...   211   7e-53   Cavia porcellus [guinea pig]
gi|470387293|ref|XP_004334273.1| ATP:cob(I)alamin adenosyltransf...   211   8e-53   Acanthamoeba castellanii str. Neff
gi|363739991|ref|XP_423950.3| PREDICTED: cob(I)yrinic acid a,c-d...   211   1e-52   
gi|363745270|ref|XP_003643248.1| PREDICTED: cob(I)yrinic acid a,...   211   1e-52   Gallus gallus [bantam]
gi|344295320|ref|XP_003419360.1| PREDICTED: cob(I)yrinic acid a,...   210   2e-52   Loxodonta africana [African bush elephant]
gi|291413952|ref|XP_002723229.1| PREDICTED: cob(I)alamin adenosy...   210   2e-52   
gi|505844142|ref|XP_004615563.1| PREDICTED: cob(I)yrinic acid a,...   209   3e-52   Sorex araneus [Eurasian shrew]
gi|512868243|ref|XP_004891655.1| PREDICTED: cob(I)yrinic acid a,...   209   3e-52   
gi|504162771|ref|XP_004591980.1| PREDICTED: cob(I)yrinic acid a,...   209   4e-52   Ochotona princeps [southern American pika]
gi|449674218|ref|XP_002168576.2| PREDICTED: cob(I)yrinic acid a,...   209   4e-52   Hydra vulgaris
gi|395834064|ref|XP_003790036.1| PREDICTED: LOW QUALITY PROTEIN:...   209   4e-52   
gi|354482770|ref|XP_003503569.1| PREDICTED: cob(I)yrinic acid a,...   209   5e-52   Cricetulus griseus [Chinese hamsters]
gi|260785034|ref|XP_002587568.1| hypothetical protein BRAFLDRAFT...   209   5e-52   Branchiostoma floridae
gi|471387347|ref|XP_004379161.1| PREDICTED: cob(I)yrinic acid a,...   209   5e-52   Trichechus manatus latirostris
gi|326929764|ref|XP_003211026.1| PREDICTED: cob(I)yrinic acid a,...   208   6e-52   
gi|18381148|gb|AAH22159.1| Mmab protein, partial [Mus musculus] ...   208   6e-52   Mus musculus [mouse]
gi|21313396|ref|NP_084232.1| cob(I)yrinic acid a,c-diamide adeno...   208   7e-52   Mus musculus [mouse]
gi|470297392|ref|XP_004345611.1| conserved hypothetical protein ...   208   7e-52   Capsaspora owczarzaki ATCC 30864
gi|432092873|gb|ELK25239.1| Cob(I)yrinic acid a,c-diamide adenos...   207   1e-51   Myotis davidii
gi|507560727|ref|XP_004664066.1| PREDICTED: cob(I)yrinic acid a,...   207   1e-51   
gi|507676139|ref|XP_004709704.1| PREDICTED: cob(I)yrinic acid a,...   206   2e-51   Echinops telfairi [lesser hedgehog tenrec]
gi|410923130|ref|XP_003975035.1| PREDICTED: cob(I)yrinic acid a,...   206   3e-51   
gi|149720492|ref|XP_001496901.1| PREDICTED: cob(I)yrinic acid a,...   206   3e-51   Equus caballus [domestic horse]
gi|194043105|ref|XP_001929229.1| PREDICTED: cob(I)yrinic acid a,...   205   6e-51   Sus scrofa [pigs]
gi|55639327|ref|XP_509512.1| PREDICTED: cob(I)yrinic acid a,c-di...   205   7e-51   Pan troglodytes
gi|403281707|ref|XP_003932319.1| PREDICTED: cob(I)yrinic acid a,...   205   7e-51   Saimiri boliviensis boliviensis
gi|397525175|ref|XP_003832552.1| PREDICTED: cob(I)yrinic acid a,...   205   7e-51   Pan paniscus [bonobo]
gi|332261278|ref|XP_003279701.1| PREDICTED: cob(I)yrinic acid a,...   205   7e-51   Nomascus leucogenys [White-cheeked Gibbon]
gi|390468185|ref|XP_003733896.1| PREDICTED: LOW QUALITY PROTEIN:...   205   8e-51   Callithrix jacchus [common marmoset]
gi|355564662|gb|EHH21162.1| hypothetical protein EGK_04165, part...   204   9e-51   Macaca mulatta [rhesus macaque]
gi|507665016|ref|XP_004636409.1| PREDICTED: cob(I)yrinic acid a,...   204   1e-50   Octodon degus
gi|470597858|ref|XP_004311558.1| PREDICTED: cob(I)yrinic acid a,...   204   1e-50   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|301771734|ref|XP_002921281.1| PREDICTED: cob(I)yrinic acid a,...   204   1e-50   Ailuropoda melanoleuca
gi|350539880|ref|NP_001232298.1| cob(I)yrinic acid a,c-diamide a...   204   1e-50   Taeniopygia guttata
gi|410977138|ref|XP_003994967.1| PREDICTED: cob(I)yrinic acid a,...   204   2e-50   Felis catus [cat]
gi|488586334|ref|XP_004478504.1| PREDICTED: cob(I)yrinic acid a,...   203   2e-50   Dasypus novemcinctus
gi|118601860|ref|NP_001073100.1| cob(I)yrinic acid a,c-diamide a...   203   2e-50   Bos taurus [bovine]
gi|340378569|ref|XP_003387800.1| PREDICTED: cob(I)yrinic acid a,...   203   2e-50   
gi|57105918|ref|XP_543436.1| PREDICTED: cob(I)yrinic acid a,c-di...   203   2e-50   Canis lupus familiaris [dogs]
gi|340376903|ref|XP_003386970.1| PREDICTED: cob(I)yrinic acid a,...   203   3e-50   Amphimedon queenslandica
gi|511919890|ref|XP_004779177.1| PREDICTED: cob(I)yrinic acid a,...   203   3e-50   Mustela putorius furo [black ferret]
gi|225703716|gb|ACO07704.1| CobIyrinic acid a,c-diamide adenosyl...   203   3e-50   Oncorhynchus mykiss
gi|472393941|ref|XP_004416232.1| PREDICTED: cob(I)yrinic acid a,...   202   5e-50   Odobenus rosmarus divergens
gi|402887604|ref|XP_003907179.1| PREDICTED: cob(I)yrinic acid a,...   202   5e-50   Papio anubis [Doguera baboon]
gi|225715754|gb|ACO13723.1| CobIyrinic acid a,c-diamide adenosyl...   202   6e-50   Esox lucius
gi|84708849|gb|AAI11195.1| Methylmalonic aciduria (cobalamin def...   201   8e-50   Bos taurus [bovine]
gi|300122503|emb|CBK23073.2| Cobalamin adenosyltransferase [Blas...   201   8e-50   Blastocystis hominis
gi|126324807|ref|XP_001378495.1| PREDICTED: cob(I)yrinic acid a,...   201   8e-50   Monodelphis domestica
gi|478511817|ref|XP_004430175.1| PREDICTED: cob(I)yrinic acid a,...   201   1e-49   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|127802458|gb|AAH05054.2| Methylmalonic aciduria (cobalamin de...   201   1e-49   Homo sapiens [man]
gi|119618275|gb|EAW97869.1| methylmalonic aciduria (cobalamin de...   201   1e-49   Homo sapiens [man]
gi|281209783|gb|EFA83951.1| hypothetical protein PPL_03021 [Poly...   200   2e-49   Polysphondylium pallidum PN500
gi|16418349|ref|NP_443077.1| cob(I)yrinic acid a,c-diamide adeno...   200   2e-49   Homo sapiens [man]
gi|109098680|ref|XP_001097465.1| PREDICTED: cob(I)yrinic acid a,...   200   2e-49   Macaca mulatta [rhesus macaque]
gi|431894096|gb|ELK03897.1| Cob(I)yrinic acid a,c-diamide adenos...   200   2e-49   Pteropus alecto
gi|281212393|gb|EFA86553.1| hypothetical protein PPL_00354 [Poly...   199   3e-49   Polysphondylium pallidum PN500
gi|466066211|ref|XP_004281435.1| PREDICTED: cob(I)yrinic acid a,...   199   3e-49   Orcinus orca [Orca]
gi|426247796|ref|XP_004017662.1| PREDICTED: cob(I)yrinic acid a,...   199   4e-49   Ovis aries [domestic sheep]
gi|126030727|pdb|2IDX|A Chain A, Structure Of Human Atp:cobalami...   198   6e-49   Homo sapiens [man]
gi|443719133|gb|ELU09408.1| hypothetical protein CAPTEDRAFT_1753...   197   1e-48   Capitella teleta
gi|348528397|ref|XP_003451704.1| PREDICTED: cob(I)yrinic acid a,...   197   2e-48   Oreochromis niloticus
gi|307111325|gb|EFN59559.1| hypothetical protein CHLNCDRAFT_4930...   197   2e-48   Chlorella variabilis
gi|498956365|ref|XP_004544597.1| PREDICTED: cob(I)yrinic acid a,...   197   2e-48   Maylandia zebra
gi|47226512|emb|CAG08528.1| unnamed protein product [Tetraodon n...   196   3e-48   Tetraodon nigroviridis
gi|145356590|ref|XP_001422511.1| predicted protein [Ostreococcus...   195   7e-48   Ostreococcus lucimarinus CCE9901
gi|225709746|gb|ACO10719.1| CobIyrinic acid a,c-diamide adenosyl...   193   3e-47   Caligus rogercresseyi
gi|159488232|ref|XP_001702121.1| flagellar associated protein, c...   192   6e-47   Chlamydomonas reinhardtii
gi|225709676|gb|ACO10684.1| CobIyrinic acid a,c-diamide adenosyl...   192   6e-47   Caligus rogercresseyi
gi|147904736|ref|NP_001089764.1| methylmalonic aciduria (cobalam...   191   8e-47   Xenopus laevis [clawed frog]
gi|512811818|ref|XP_002932128.2| PREDICTED: cob(I)yrinic acid a,...   191   8e-47   Xenopus tropicalis [western clawed frog]
gi|390353303|ref|XP_784498.3| PREDICTED: cob(I)yrinic acid a,c-d...   189   3e-46   Strongylocentrotus purpuratus [purple urchin]
gi|470288691|ref|XP_004342649.1| cobalamin adenosyltransferase [...   187   1e-45   
gi|348676973|gb|EGZ16790.1| hypothetical protein PHYSODRAFT_2858...   186   3e-45   Phytophthora sojae
gi|296478543|tpg|DAA20658.1| TPA: cob(I)yrinic acid a,c-diamide ...   186   3e-45   Bos taurus [bovine]
gi|281344189|gb|EFB19773.1| hypothetical protein PANDA_010179 [A...   186   4e-45   Ailuropoda melanoleuca
gi|428172775|gb|EKX41682.1| hypothetical protein GUITHDRAFT_1598...   185   5e-45   Guillardia theta CCMP2712
gi|485631532|gb|EOD26652.1| Cob(I)alamin adenosyltransferase [Em...   185   8e-45   Emiliania huxleyi CCMP1516
gi|513210414|ref|XP_004945682.1| PREDICTED: cob(I)yrinic acid a,...   184   1e-44   
gi|513234665|ref|XP_004949973.1| PREDICTED: cob(I)yrinic acid a,...   184   1e-44   
gi|512868251|ref|XP_004891657.1| PREDICTED: cob(I)yrinic acid a,...   184   1e-44   
gi|340376901|ref|XP_003386969.1| PREDICTED: cob(I)yrinic acid a,...   184   1e-44   Amphimedon queenslandica
gi|255087730|ref|XP_002505788.1| predicted protein [Micromonas s...   183   2e-44   Micromonas commoda
gi|512868240|ref|XP_004891654.1| PREDICTED: cob(I)yrinic acid a,...   182   4e-44   
gi|321463410|gb|EFX74426.1| hypothetical protein DAPPUDRAFT_2996...   181   7e-44   Daphnia pulex
gi|26329841|dbj|BAC28659.1| unnamed protein product [Mus musculu...   181   8e-44   Mus musculus [mouse]
gi|512868247|ref|XP_004891656.1| PREDICTED: cob(I)yrinic acid a,...   181   1e-43   
gi|330790297|ref|XP_003283234.1| hypothetical protein DICPUDRAFT...   181   1e-43   Dictyostelium purpureum
gi|291239026|ref|XP_002739429.1| PREDICTED: methylmalonic acidur...   180   2e-43   
gi|297621077|ref|YP_003709214.1| Cob(I)alamin adenosyltransferas...   176   3e-42   
gi|488586336|ref|XP_004478505.1| PREDICTED: cob(I)yrinic acid a,...   176   3e-42   Dasypus novemcinctus
gi|449279231|gb|EMC86866.1| Cob(I)yrinic acid a,c-diamide adenos...   176   3e-42   Columba livia [carrier pigeon]
gi|301092320|ref|XP_002997018.1| cobalamin adenosyltransferase, ...   176   3e-42   Phytophthora infestans T30-4
gi|308811216|ref|XP_003082916.1| P0627E03.18 gene product (ISS) ...   175   8e-42   Ostreococcus tauri
gi|507971521|ref|XP_004690738.1| PREDICTED: cob(I)yrinic acid a,...   175   8e-42   Condylura cristata
gi|337292301|emb|CCB90338.1| Cob(I)yrinic acid a,c-diamide adeno...   175   9e-42   Waddlia chondrophila 2032/99
gi|313220697|emb|CBY31541.1| unnamed protein product [Oikopleura...   174   2e-41   Oikopleura dioica
gi|302844588|ref|XP_002953834.1| hypothetical protein VOLCADRAFT...   172   4e-41   Volvox carteri f. nagariensis
gi|470426319|ref|XP_004337884.1| ATP:cob(I)alamin adenosyltransf...   172   7e-41   Acanthamoeba castellanii str. Neff
gi|444510224|gb|ELV09549.1| Cob(I)yrinic acid a,c-diamide adenos...   171   8e-41   Tupaia chinensis
gi|485607785|gb|EOD07229.1| Cob(I)alamin adenosyltransferase, pa...   171   9e-41   Emiliania huxleyi CCMP1516
gi|299115666|emb|CBN75866.1| flagellar associated protein, cobal...   170   3e-40   Ectocarpus siliculosus
gi|303289078|ref|XP_003063827.1| predicted protein [Micromonas p...   169   4e-40   Micromonas pusilla CCMP1545
gi|46446375|ref|YP_007740.1| hypothetical protein pc0741 [Candid...   169   6e-40   
gi|513210422|ref|XP_004945684.1| PREDICTED: cob(I)yrinic acid a,...   166   3e-39   
gi|148687965|gb|EDL19912.1| methylmalonic aciduria (cobalamin de...   165   8e-39   Mus musculus [mouse]
gi|513210428|ref|XP_004945686.1| PREDICTED: cob(I)yrinic acid a,...   164   2e-38   
gi|330791517|ref|XP_003283839.1| hypothetical protein DICPUDRAFT...   164   2e-38   Dictyostelium purpureum
gi|358332211|dbj|GAA50903.1| cob(I)alamin adenosyltransferase [C...   162   4e-38   Clonorchis sinensis [oriental liver fluke]
gi|290996460|ref|XP_002680800.1| predicted protein [Naegleria gr...   161   1e-37   Naegleria gruberi strain NEG-M
gi|224005112|ref|XP_002296207.1| predicted protein [Thalassiosir...   160   2e-37   Thalassiosira pseudonana CCMP1335
gi|355786511|gb|EHH66694.1| hypothetical protein EGM_03737 [Maca...   159   3e-37   Macaca fascicularis [crab eating macaque]
gi|326435499|gb|EGD81069.1| hypothetical protein PTSG_11014 [Sal...   158   8e-37   Salpingoeca rosetta
gi|452824573|gb|EME31575.1| cob(I)alamin adenosyltransferase [Ga...   157   1e-36   Galdieria sulphuraria
gi|412985482|emb|CCO18928.1| ATP:cob(I)alamin adenosyltransferas...   154   1e-35   Bathycoccus prasinos
gi|219119145|ref|XP_002180339.1| predicted protein [Phaeodactylu...   154   1e-35   Phaeodactylum tricornutum CCAP 1055/1
gi|496378061|ref|WP_009087051.1| cobalamin adenosyltransferase [...   154   2e-35   Elizabethkingia anophelis
gi|66814610|ref|XP_641484.1| hypothetical protein DDB_G0279905 [...   152   4e-35   Dictyostelium discoideum AX4
gi|268574480|ref|XP_002642217.1| C. briggsae CBR-MMAB-1 protein ...   152   5e-35   Caenorhabditis briggsae
gi|510826779|ref|WP_016199917.1| Cob(I)alamin adenosyltransferas...   151   1e-34   Elizabethkingia meningoseptica
gi|385809377|ref|YP_005845773.1| Cob(I)alamin adenosyltransferas...   150   2e-34   
gi|507110252|emb|CDF34025.1| unnamed protein product [Chondrus c...   149   5e-34   Chondrus crispus [Irish moss]
gi|300176889|emb|CBK25458.2| unnamed protein product [Blastocyst...   149   7e-34   Blastocystis hominis
gi|341896250|gb|EGT52185.1| hypothetical protein CAEBREN_17860 [...   149   7e-34   Caenorhabditis brenneri
gi|167533449|ref|XP_001748404.1| hypothetical protein [Monosiga ...   148   8e-34   Monosiga brevicollis MX1
gi|308487772|ref|XP_003106081.1| CRE-MMAB-1 protein [Caenorhabdi...   147   1e-33   Caenorhabditis remanei
gi|426374099|ref|XP_004053920.1| PREDICTED: cob(I)yrinic acid a,...   147   1e-33   Gorilla gorilla gorilla [lowland gorilla]
gi|495978022|ref|WP_008702601.1| ATP/cobalamin adenosyltransfera...   147   2e-33   
gi|511000697|gb|EPB82218.1| ATP:cob(I)alamin adenosyltransferase...   145   5e-33   Mucor circinelloides f. circinelloides 1006PhL
gi|397689251|ref|YP_006526505.1| ATP:cob(I)alamin adenosyltransf...   144   1e-32   
gi|156402373|ref|XP_001639565.1| predicted protein [Nematostella...   144   1e-32   Nematostella vectensis
gi|407450947|ref|YP_006722671.1| hypothetical protein B739_0163 ...   144   1e-32   
gi|115534154|ref|NP_498038.2| Protein MMAB-1 [Caenorhabditis ele...   144   1e-32   Caenorhabditis elegans [roundworm]
gi|495116168|ref|WP_007840985.1| cobalamin adenosyltransferase [...   144   1e-32   Chryseobacterium
gi|495863953|ref|WP_008588532.1| ATP:cob(I)alamin adenosyltransf...   144   2e-32   Salimicrobium jeotgali
gi|326429486|gb|EGD75056.1| hypothetical protein PTSG_12477 [Sal...   143   2e-32   Salpingoeca rosetta
gi|148656112|ref|YP_001276317.1| ATP--cobalamin adenosyltransfer...   143   3e-32   
gi|297692908|ref|XP_002823771.1| PREDICTED: cob(I)yrinic acid a,...   143   4e-32   
gi|495576011|ref|WP_008300590.1| Cob(I)yrinic acid a,c-diamide a...   142   4e-32   Bhargavaea cecembensis
gi|483505444|gb|EOA97021.1| Cob(I)yrinic acid a,c-diamide adenos...   142   4e-32   Anas platyrhynchos [duck]
gi|255536391|ref|YP_003096762.1| Cob(I)alamin adenosyltransferas...   142   4e-32   
gi|490461657|ref|WP_004332220.1| cobalamin adenosyltransferase [...   142   7e-32   Porphyromonas endodontalis
gi|311270785|ref|XP_003132971.1| PREDICTED: cob(I)yrinic acid a,...   142   7e-32   
gi|283781894|ref|YP_003372649.1| ATP/cobalamin adenosyltransfera...   141   1e-31   
gi|497268367|ref|WP_009582584.1| Cob(I)alamin adenosyltransferas...   141   1e-31   Fulvivirga imtechensis
gi|313207182|ref|YP_004046359.1| ATP/cobalamin adenosyltransfera...   140   2e-31   
gi|401423110|ref|XP_003876042.1| conserved hypothetical protein ...   140   2e-31   Leishmania mexicana MHOM/GT/2001/U1103
gi|188580955|ref|YP_001924400.1| ATP--cobalamin adenosyltransfer...   140   2e-31   
gi|194379708|dbj|BAG58206.1| unnamed protein product [Homo sapiens]   140   2e-31   Homo sapiens [man]
gi|156743715|ref|YP_001433844.1| ATP--cobalamin adenosyltransfer...   140   2e-31   
gi|495907966|ref|WP_008632545.1| cob(I)yrinic acid a,c-diamide a...   139   4e-31   Bacillaceae
gi|495803093|ref|WP_008527672.1| cob(I)yrinic acid a,c-diamide a...   139   6e-31   Rhizobium sp. Pop5
gi|374328618|ref|YP_005078802.1| ATP--cobalamin adenosyltransfer...   138   9e-31   
gi|398016265|ref|XP_003861321.1| hypothetical protein, conserved...   138   1e-30   Leishmania donovani
gi|494229487|ref|WP_007138073.1| cobalamin adenosyltransferase [...   137   1e-30   Flavobacterium frigoris
gi|146088233|ref|XP_001466024.1| conserved hypothetical protein ...   137   1e-30   Leishmania infantum JPCM5
gi|163848992|ref|YP_001637036.1| ATP--cobalamin adenosyltransfer...   137   2e-30   Chloroflexus aurantiacus J-10-fl
gi|328541738|ref|YP_004301847.1| cobalamin adenosyltransferase, ...   137   2e-30   
gi|489662727|ref|WP_003567036.1| cob(I)yrinic acid a,c-diamide a...   137   2e-30   Rhizobium leguminosarum
gi|493728123|ref|WP_006677461.1| ATP:cob(I)alamin adenosyltransf...   137   2e-30   Paenibacillus dendritiformis
gi|149631725|ref|XP_001516376.1| PREDICTED: cob(I)yrinic acid a,...   137   2e-30   
gi|489707217|ref|WP_003611354.1| cob(I)yrinic acid a,c-diamide a...   137   2e-30   Methylosinus
gi|390943976|ref|YP_006407737.1| ATP:cob(I)alamin adenosyltransf...   137   2e-30   
gi|498294039|ref|WP_010608195.1| ATP:cob(I)alamin adenosyltransf...   137   3e-30   
gi|345303062|ref|YP_004824964.1| ATP/cobalamin adenosyltransfera...   136   3e-30   
gi|219847175|ref|YP_002461608.1| ATP/cobalamin adenosyltransfera...   136   3e-30   
gi|492906624|ref|WP_006037030.1| ATP:cob(I)alamin adenosyltransf...   136   3e-30   Paenibacillus curdlanolyticus
gi|489616389|ref|WP_003520829.1| hypothetical protein [Agrobacte...   136   4e-30   Agrobacterium tumefaciens
gi|302037975|ref|YP_003798297.1| cob(I)yrinic acid a,c-diamide a...   136   4e-30   
gi|493748726|ref|WP_006697713.1| cob(I)yrinic acid a,c-diamide a...   136   4e-30   
gi|490580604|ref|WP_004445624.1| cob(I)yrinic acid a,c-diamide a...   136   4e-30   
gi|255037058|ref|YP_003087679.1| ATP/cobalamin adenosyltransfera...   136   5e-30   
gi|497276082|ref|WP_009590299.1| ATP:cob(I)alamin adenosyltransf...   135   5e-30   
gi|325280600|ref|YP_004253142.1| ATP/cobalamin adenosyltransfera...   135   5e-30   
gi|268317147|ref|YP_003290866.1| ATP/cobalamin adenosyltransfera...   135   5e-30   
gi|495825820|ref|WP_008550399.1| cob(I)yrinic acid a,c-diamide a...   135   6e-30   Pseudovibrio sp. JE062
gi|513235717|ref|XP_004950159.1| PREDICTED: cob(I)yrinic acid a,...   135   7e-30   
gi|511023063|ref|WP_016277372.1| ATP:cob(I)alamin adenosyltransf...   135   7e-30   Bacteroides
gi|332373480|gb|AEE61881.1| unknown [Dendroctonus ponderosae]         135   8e-30   Dendroctonus ponderosae
gi|488764771|ref|WP_002687971.1| cobalamin adenosyltransferase [...   135   8e-30   Bergeyella zoohelcum
gi|495931413|ref|WP_008655992.1| ATP/cobalamin adenosyltransfera...   135   8e-30   Rhodopirellula europaea
gi|478251577|gb|ENN72039.1| hypothetical protein YQE_11327, part...   135   9e-30   Dendroctonus ponderosae
gi|493328963|ref|WP_006286182.1| uncharacterized conserved prote...   135   9e-30   Paenibacillus popilliae
gi|494906686|ref|WP_007632728.1| cob(I)yrinic acid a,c-diamide a...   135   9e-30   Rhizobium sp. CCGE 510
gi|489605148|ref|WP_003509589.1| cob(I)yrinic acid a,c-diamide a...   135   9e-30   Agrobacterium tumefaciens
gi|497679173|ref|WP_009993357.1| putative cobalamin adenosultran...   135   9e-30   
gi|495476759|ref|WP_008201446.1| cobalamin adenosyltransferase [...   135   1e-29   Algoriphagus machipongonensis
gi|338174726|ref|YP_004651536.1| cob(I)yrinic acid a,c-diamide a...   134   1e-29   
gi|261408891|ref|YP_003245132.1| ATP/cobalamin adenosyltransfera...   134   1e-29   
gi|157870383|ref|XP_001683742.1| conserved hypothetical protein ...   134   1e-29   Leishmania major strain Friedlin
gi|295132949|ref|YP_003583625.1| cobalamin adenosyltransferase [...   134   2e-29   
gi|498350435|ref|WP_010664591.1| cobalamin adenosyltransferase [...   134   2e-29   Marinilabilia salmonicolor
gi|488739837|ref|WP_002663214.1| cobalamin adenosyltransferase [...   134   2e-29   Bergeyella zoohelcum
gi|493240180|ref|WP_006212216.1| ATP:cob(I)alamin adenosyltransf...   134   2e-29   Paenibacillus
gi|494842309|ref|WP_007568409.1| cobalamin adenosyltransferase [...   134   2e-29   Bacteroides coprocola
gi|374855250|dbj|BAL58112.1| ATP--cobalamin adenosyltransferase ...   134   2e-29   uncultured prokaryote
gi|489678375|ref|WP_003582607.1| cob(I)yrinic acid a,c-diamide a...   134   2e-29   
gi|66812588|ref|XP_640473.1| hypothetical protein DDB_G0281875 [...   134   2e-29   Dictyostelium discoideum AX4
gi|170749366|ref|YP_001755626.1| ATP--cobalamin adenosyltransfer...   134   2e-29   
gi|495860963|ref|WP_008585542.1| cobalamin adenosyltransferase [...   133   3e-29   Niabella soli
gi|493359084|ref|WP_006315577.1| cob(I)yrinic acid a,c-diamide a...   133   3e-29   Agrobacterium sp. ATCC 31749
gi|153006427|ref|YP_001380752.1| ATP--cobalamin adenosyltransfer...   133   3e-29   
gi|159185812|ref|NP_357019.2| hypothetical protein Atu3593 [Agro...   133   3e-29   Agrobacterium fabrum str. C58
gi|150004033|ref|YP_001298777.1| hypothetical protein BVU_1468 [...   133   4e-29   
gi|86359373|ref|YP_471265.1| hypothetical protein RHE_CH03790 [R...   133   4e-29   
gi|375013212|ref|YP_004990200.1| ATP:cob(I)alamin adenosyltransf...   133   4e-29   
gi|497863181|ref|WP_010177337.1| cobalamin adenosyltransferase [...   133   4e-29   Aquimarina agarilytica
gi|332668284|ref|YP_004451072.1| ATP/cobalamin adenosyltransfera...   132   4e-29   
gi|493386115|ref|WP_006342321.1| hypothetical protein [Parachlam...   132   4e-29   Parachlamydia acanthamoebae
gi|226226010|ref|YP_002760116.1| hypothetical protein GAU_0604 [...   132   4e-29   
gi|489638850|ref|WP_003543290.1| cob(I)yrinic acid a,c-diamide a...   132   4e-29   Rhizobium leguminosarum
gi|297624454|ref|YP_003705888.1| ATP/cobalamin adenosyltransfera...   132   5e-29   
gi|91090932|ref|XP_974318.1| PREDICTED: similar to Si:dkey-189p2...   132   5e-29   Tribolium castaneum [rust-red flour beetle]
gi|116254052|ref|YP_769890.1| cobalamin adenosultransferase [Rhi...   132   5e-29   
gi|490809622|ref|WP_004671743.1| cob(I)yrinic acid a,c-diamide a...   132   5e-29   Rhizobium
gi|226310651|ref|YP_002770545.1| hypothetical protein BBR47_1064...   132   5e-29   
gi|498195258|ref|WP_010509414.1| ATP:cob(I)alamin adenosyltransf...   132   6e-29   
gi|190893626|ref|YP_001980168.1| cobalamin adenosultransferase [...   132   6e-29   
gi|489067175|ref|WP_002977170.1| cobalamin adenosyltransferase [...   132   6e-29   
gi|383767635|ref|YP_005446617.1| cob(I)alamin adenosyltransferas...   132   6e-29   
gi|491851675|ref|WP_005633341.1| cobalamin adenosyltransferase [...   132   6e-29   Parabacteroides merdae
gi|495501822|ref|WP_008226476.1| cob(I)yrinic acid a,c-diamide a...   132   6e-29   Roseobacter sp. GAI101
gi|495421722|ref|WP_008146419.1| cobalamin adenosyltransferase [...   132   6e-29   Parabacteroides johnsonii
gi|325955435|ref|YP_004239095.1| ATP/cobalamin adenosyltransfera...   132   7e-29   
gi|495939404|ref|WP_008663983.1| ATP/cobalamin adenosyltransfera...   132   7e-29   Rhodopirellula europaea
gi|493839309|ref|WP_006786464.1| ATP--cobalamin adenosyltransfer...   132   7e-29   Thiorhodospira sibirica
gi|154338541|ref|XP_001565495.1| conserved hypothetical protein ...   132   7e-29   Leishmania braziliensis MHOM/BR/75/M2904
gi|430749381|ref|YP_007212289.1| ATP:cob(I)alamin adenosyltransf...   132   8e-29   
gi|495555372|ref|WP_008279951.1| cob(I)yrinic acid a,c-diamide a...   132   8e-29   Roseovarius sp. TM1035
gi|494153883|ref|WP_007093626.1| cobalamin adenosyltransferase [...   131   9e-29   Kordia algicida
gi|83644749|ref|YP_433184.1| hypothetical protein HCH_01926 [Hah...   131   9e-29   
gi|496255169|ref|WP_008968554.1| cob(I)yrinic acid a,c-diamide a...   131   9e-29   Bradyrhizobium sp. STM 3843
gi|494126467|ref|WP_007066242.1| cob(I)yrinic acid a,c-diamide a...   131   1e-28   Fulvimarina pelagi
gi|383458451|ref|YP_005372440.1| putative ATP:cob(I)alamin adeno...   131   1e-28   
gi|493884679|ref|WP_006830855.1| ATP:cob(I)alamin adenosyltransf...   131   1e-28   Planococcus antarcticus
gi|498337279|ref|WP_010651435.1| ATP:cob(I)alamin adenosyltransf...   131   1e-28   Oceanobacillus massiliensis
gi|496841559|ref|WP_009382027.1| ATP--cobalamin adenosyltransfer...   131   1e-28   
gi|490430235|ref|WP_004302366.1| cobalamin adenosyltransferase [...   131   1e-28   Bacteroides
gi|32472259|ref|NP_865253.1| hypothetical protein RB2976 [Rhodop...   131   1e-28   Rhodopirellula baltica SH 1
gi|406959441|gb|EKD86781.1| hypothetical protein ACD_37C00146G00...   131   1e-28   uncultured bacterium
gi|490424193|ref|WP_004296388.1| cobalamin adenosyltransferase [...   131   1e-28   Bacteroides
gi|491925120|ref|WP_005675351.1| cobalamin adenosyltransferase [...   131   1e-28   Bacteroides caccae
gi|383450586|ref|YP_005357307.1| hypothetical protein KQS_06450 ...   131   1e-28   
gi|496285765|ref|WP_008997803.1| cobalamin adenosyltransferase [...   131   1e-28   Bacteroides sp. D2
gi|495041679|ref|WP_007766529.1| cob(I)yrinic acid a,c-diamide a...   131   1e-28   Rhizobium sp. CF080
gi|497782966|ref|WP_010097150.1| ATP:cob(I)alamin adenosyltransf...   131   1e-28   Ornithinibacillus scapharcae
gi|491938787|ref|WP_005681742.1| cobalamin adenosyltransferase [...   130   2e-28   Bacteroides caccae
gi|497482848|ref|WP_009797046.1| cob(I)yrinic acid a,c-diamide a...   130   2e-28   Nitrobacter sp. Nb-311A
gi|326800904|ref|YP_004318723.1| ATP/cobalamin adenosyltransfera...   130   2e-28   
gi|209883900|ref|YP_002287757.1| ATP:cob(I)alamin adenosyltransf...   130   2e-28   
gi|514395552|ref|WP_016556412.1| cobalamin adenosultransferase [...   130   2e-28   Rhizobium grahamii
gi|496413361|ref|WP_009122225.1| cobalamin adenosyltransferase [...   130   2e-28   
gi|498289348|ref|WP_010603504.1| cobalamin adenosyltransferase [...   130   2e-28   Pedobacter agri
gi|495110072|ref|WP_007834893.1| cobalamin adenosyltransferase [...   130   2e-28   Bacteroides
gi|495084605|ref|WP_007809429.1| ATP--cobalamin adenosyltransfer...   130   2e-28   Rhodanobacter spathiphylli
gi|493795739|ref|WP_006743768.1| cobalamin adenosyltransferase [...   130   2e-28   Bacteroides coprosuis
gi|469819470|ref|YP_007591554.1| ATP:cob(I)alamin adenosyltransf...   130   2e-28   
gi|489685753|ref|WP_003589975.1| cob(I)yrinic acid a,c-diamide a...   130   2e-28   Rhizobium leguminosarum
gi|494773886|ref|WP_007509294.1| ATP--cobalamin adenosyltransfer...   130   2e-28   Rhodanobacter denitrificans
gi|150009910|ref|YP_001304653.1| ATP:cob(I)alamin adenosyltransf...   130   2e-28   
gi|209551135|ref|YP_002283052.1| ATP/cobalamin adenosyltransfera...   130   2e-28   
gi|494889270|ref|WP_007615316.1| cob(I)yrinic acid a,c-diamide a...   130   2e-28   Bradyrhizobium sp. WSM471
gi|493994143|ref|WP_006936826.1| cob(I)yrinic acid a,c-diamide a...   130   2e-28   Labrenzia aggregata
gi|495513722|ref|WP_008238367.1| cobalamin adenosyltransferase [...   130   2e-28   Imtechella halotolerans
gi|365961457|ref|YP_004943024.1| hypothetical protein FCOL_12150...   130   2e-28   
gi|494842626|ref|WP_007568726.1| cob(I)yrinic acid a,c-diamide a...   130   2e-28   Methylobacterium
gi|494792590|ref|WP_007527998.1| cob(I)yrinic acid a,c-diamide a...   130   2e-28   Rhizobium mesoamericanum
gi|75674948|ref|YP_317369.1| cobalamin adenosyltransferase [Nitr...   130   3e-28   
gi|494205800|ref|WP_007127269.1| ATP:cob(I)alamin adenosyltransf...   130   3e-28   Paenibacillus lactis
gi|495898642|ref|WP_008623221.1| cobalamin adenosyltransferase [...   130   3e-28   Paraprevotella clara
gi|339256044|ref|XP_003370765.1| putative ATP:cob(I)alamin adeno...   130   3e-28   Trichinella spiralis
gi|497501462|ref|WP_009815660.1| cob(I)yrinic acid a,c-diamide a...   130   3e-28   Roseovarius sp. 217
gi|491152019|ref|WP_005010413.1| Cob(I)yrinic acid a,c-diamide a...   130   3e-28   Nitrospina gracilis
gi|496251458|ref|WP_008964843.1| cob(I)yrinic acid a,c-diamide a...   130   3e-28   Bradyrhizobium sp. STM 3809
gi|386713381|ref|YP_006179704.1| cob(I)yrinic acid a,c-diamide a...   130   3e-28   
gi|408402875|ref|YP_006860858.1| ATP--cobalamin adenosyltransfer...   130   3e-28   
gi|383774643|ref|YP_005453712.1| hypothetical protein S23_64180 ...   130   3e-28   
gi|492737815|ref|WP_005941981.1| ATP:cob(I)alamin adenosyltransf...   130   3e-28   
gi|156331081|ref|XP_001619135.1| hypothetical protein NEMVEDRAFT...   129   3e-28   
gi|511014452|ref|WP_016268845.1| ATP:cob(I)alamin adenosyltransf...   129   3e-28   
gi|495526895|ref|WP_008251540.1| ATP--cobalamin adenosyltransfer...   129   4e-28   
gi|492405007|ref|WP_005833621.1| cobalamin adenosyltransferase [...   129   4e-28   
gi|495464321|ref|WP_008189013.1| cob(I)yrinic acid a,c-diamide a...   129   4e-28   
gi|163850968|ref|YP_001639011.1| ATP--cobalamin adenosyltransfer...   129   4e-28   
gi|406947736|gb|EKD78613.1| ATP/cobalamin adenosyltransferase [u...   129   4e-28   
gi|488802132|ref|WP_002714538.1| ATP:cob(I)alamin adenosyltransf...   129   4e-28   
gi|495912867|ref|WP_008637446.1| cobalamin adenosyltransferase [...   129   4e-28   
gi|340383245|ref|XP_003390128.1| PREDICTED: cob(I)yrinic acid a,...   129   4e-28   
gi|511017677|ref|WP_016272019.1| ATP:cob(I)alamin adenosyltransf...   129   4e-28   
gi|495482883|ref|WP_008207570.1| cob(I)yrinic acid a,c-diamide a...   129   4e-28   
gi|490707726|ref|WP_004571062.1| cobalamin adenosyltransferase [...   129   4e-28   
gi|495960119|ref|WP_008684698.1| ATP--cobalamin adenosyltransfer...   129   4e-28   
gi|495937373|ref|WP_008661952.1| cobalamin adenosyltransferase [...   129   5e-28   
gi|240138100|ref|YP_002962572.1| cobalamin adenosyltransferase, ...   129   5e-28   
gi|218529796|ref|YP_002420612.1| ATP/cobalamin adenosyltransfera...   129   5e-28   
gi|262193830|ref|YP_003265039.1| ATP/cobalamin adenosyltransfera...   129   5e-28   
gi|490500561|ref|WP_004366681.1| cobalamin adenosyltransferase [...   129   5e-28   
gi|295695180|ref|YP_003588418.1| ATP/cobalamin adenosyltransfera...   129   5e-28   
gi|498221426|ref|WP_010535582.1| cobalamin adenosyltransferase [...   129   5e-28   
gi|222149949|ref|YP_002550906.1| hypothetical protein Avi_4008 [...   129   5e-28   
gi|91975409|ref|YP_568068.1| ATP [Rhodopseudomonas palustris Bis...   129   5e-28   
gi|497209153|ref|WP_009523415.1| ATP--cobalamin adenosyltransfer...   129   5e-28   
gi|332025014|gb|EGI65201.1| Cob(I)yrinic acid a,c-diamide adenos...   129   5e-28   
gi|114319580|ref|YP_741263.1| ATP:cob(I)alamin adenosyltransfera...   129   5e-28   
gi|34498366|ref|NP_902581.1| hypothetical protein CV_2911 [Chrom...   129   5e-28   
gi|495065912|ref|WP_007790737.1| cob(I)yrinic acid a,c-diamide a...   129   5e-28   
gi|197106610|ref|YP_002131987.1| hypothetical protein PHZ_c3149 ...   129   6e-28   
gi|29348169|ref|NP_811672.1| hypothetical protein BT_2760 [Bacte...   129   6e-28   
gi|492386107|ref|WP_005827736.1| ATP:cob(I)alamin adenosyltransf...   129   6e-28   
gi|490442309|ref|WP_004313274.1| cobalamin adenosyltransferase [...   129   6e-28   
gi|492374955|ref|WP_005824436.1| cobalamin adenosyltransferase [...   129   6e-28   
gi|51891750|ref|YP_074441.1| cobalamin adenosyltransferase [Symb...   129   6e-28   
gi|494871251|ref|WP_007597347.1| cob(I)yrinic acid a,c-diamide a...   129   6e-28   
gi|495707567|ref|WP_008432146.1| ATP:cob(I)alamin adenosyltransf...   129   6e-28   
gi|493780348|ref|WP_006728765.1| cob(I)yrinic acid a,c-diamide a...   129   6e-28   
gi|430005332|emb|CCF21133.1| putative ATP:cob(I)alamin adenosylt...   129   7e-28   
gi|494647580|ref|WP_007405524.1| cob(I)yrinic acid a,c-diamide a...   129   7e-28   
gi|497361893|ref|WP_009676106.1| ATP:cob(I)alamin adenosyltransf...   129   7e-28   
gi|146343273|ref|YP_001208321.1| ATP:cob(I)alamin adenosyltransf...   129   7e-28   
gi|492918850|ref|WP_006045634.1| cobalamin adenosyltransferase [...   129   7e-28   
gi|241206538|ref|YP_002977634.1| ATP/cobalamin adenosyltransfera...   129   7e-28   
gi|498369425|ref|WP_010683581.1| Cobalamin adenosyltransferase [...   129   7e-28   
gi|495298326|ref|WP_008023078.1| cobalamin adenosyltransferase [...   129   7e-28   
gi|496328168|ref|WP_009037346.1| cobalamin adenosyltransferase [...   129   7e-28   
gi|494140457|ref|WP_007080209.1| ATP--cobalamin adenosyltransfer...   129   7e-28   
gi|148252709|ref|YP_001237294.1| ATP:cob(I)alamin adenosyltransf...   129   7e-28   
gi|490422338|ref|WP_004294576.1| cobalamin adenosyltransferase [...   128   8e-28   
gi|304310466|ref|YP_003810064.1| ATP:cob(I)alamin adenosyltransf...   128   8e-28   
gi|495709210|ref|WP_008433789.1| ATP--cobalamin adenosyltransfer...   128   8e-28   
gi|334146885|ref|YP_004509814.1| putative ATP:corrinoid adenosyl...   128   8e-28   
gi|495772544|ref|WP_008497123.1| Cob [Planococcus halocryophilus...   128   9e-28   
gi|492619851|ref|WP_005905105.1| adenosylcobalamin-dependent DIO...   128   9e-28   
gi|493850278|ref|WP_006797225.1| cobalamin adenosyltransferase [...   128   9e-28   
gi|496316408|ref|WP_009025586.1| cob(I)yrinic acid a,c-diamide a...   128   9e-28   
gi|490418998|ref|WP_004291312.1| cobalamin adenosyltransferase [...   128   1e-27   
gi|491694474|ref|WP_005548499.1| ATP:cob(I)alamin adenosyltransf...   128   1e-27   
gi|496280607|ref|WP_008992645.1| cobalamin adenosyltransferase [...   128   1e-27   
gi|387132795|ref|YP_006298767.1| ATP:cob(I)alamin adenosyltransf...   128   1e-27   
gi|494183807|ref|WP_007118027.1| cob(I)yrinic acid a,c-diamide a...   128   1e-27   
gi|284036019|ref|YP_003385949.1| ATP/cobalamin adenosyltransfera...   128   1e-27   
gi|497188779|ref|WP_009503041.1| cob(I)yrinic acid a,c-diamide a...   128   1e-27   
gi|479163849|ref|YP_007792583.1| ATP:cob(I)alamin adenosyltransf...   127   1e-27   
gi|493303060|ref|WP_006260637.1| cobalamin adenosyltransferase [...   127   1e-27   
gi|150024678|ref|YP_001295504.1| Protein of unknown function [Fl...   127   1e-27   
gi|495528859|ref|WP_008253500.1| cobalamin adenosyltransferase [...   127   1e-27   
gi|491145104|ref|WP_005003504.1| cob(I)yrinic acid a,c-diamide a...   127   1e-27   
gi|514356214|ref|WP_016547928.1| ATP:cob(I)alamin adenosyltransf...   127   1e-27   
gi|492644274|ref|WP_005909526.1| ATP--cobalamin adenosyltransfer...   127   1e-27   
gi|493314254|ref|WP_006271678.1| cob(I)yrinic acid a,c-diamide a...   127   2e-27   
gi|492827450|ref|WP_005981404.1| cob(I)yrinic acid a,c-diamide a...   127   2e-27   
gi|497224562|ref|WP_009538824.1| Cob(I)alamin adenosyltransferas...   127   2e-27   
gi|489592986|ref|WP_003497430.1| cob(I)yrinic acid a,c-diamide a...   127   2e-27   
gi|497420996|ref|WP_009735194.1| cob(I)yrinic acid a,c-diamide a...   127   2e-27   
gi|495785704|ref|WP_008510283.1| cobalamin adenosyltransferase [...   127   2e-27   
gi|495088098|ref|WP_007812921.1| cob(I)yrinic acid a,c-diamide a...   127   2e-27   
gi|53804097|ref|YP_114252.1| ATP:cob(I)alamin adenosyltransferas...   127   2e-27   
gi|507380957|ref|YP_008019076.1| ATP:cob(I)alamin adenosyltransf...   127   2e-27   
gi|494927690|ref|WP_007653725.1| cobalamin adenosyltransferase [...   127   2e-27   
gi|489429792|ref|WP_003335396.1| ATP:cob(I)alamin adenosyltransf...   127   2e-27   
gi|497939721|ref|WP_010253877.1| cobalamin adenosyltransferase [...   127   2e-27   
gi|332299604|ref|YP_004441525.1| ATP/cobalamin adenosyltransfera...   127   2e-27   
gi|459287559|ref|YP_007510716.1| putative putative ATP/cob(I)ala...   127   2e-27   
gi|496138672|ref|WP_008863179.1| cobalamin adenosyltransferase [...   127   2e-27   
gi|312795177|ref|YP_004028099.1| cobalamin adenosyltransferase [...   127   2e-27   
gi|86159894|ref|YP_466679.1| ATP:cob(I)alamin adenosyltransferas...   127   2e-27   
gi|496048428|ref|WP_008772935.1| cobalamin adenosyltransferase [...   127   2e-27   
gi|495153078|ref|WP_007877884.1| ATP--cobalamin adenosyltransfer...   127   2e-27   
gi|497777245|ref|WP_010091429.1| ATP--cobalamin adenosyltransfer...   127   2e-27   
gi|496069023|ref|WP_008793530.1| ATP--cobalamin adenosyltransfer...   127   2e-27   
gi|494606273|ref|WP_007364521.1| cobalamin adenosyltransferase [...   127   2e-27   
gi|188995085|ref|YP_001929337.1| ATP:corrinoid adenosyltransfera...   127   2e-27   
gi|501089223|ref|WP_012139467.1| ATP-cobalamin adenosyltransfera...   127   2e-27   
gi|494080323|ref|WP_007022363.1| ATP--cobalamin adenosyltransfer...   127   2e-27   
gi|493299495|ref|WP_006257112.1| cobalamin adenosyltransferase [...   127   2e-27   
gi|490461321|ref|WP_004331889.1| cobalamin adenosyltransferase [...   127   2e-27   
gi|495491458|ref|WP_008216138.1| ATP--cobalamin adenosyltransfer...   127   2e-27   
gi|403366705|gb|EJY83154.1| hypothetical protein OXYTRI_19225 [O...   127   2e-27   
gi|310823833|ref|YP_003956191.1| ATP:cob(i)alamin adenosyltransf...   127   2e-27   
gi|494372508|ref|WP_007199111.1| cob(I)yrinic acid a,c-diamide a...   127   2e-27   
gi|497481026|ref|WP_009795224.1| ATP:cob(I)alamin adenosyltransf...   127   2e-27   
gi|495835446|ref|WP_008560025.1| cob(I)yrinic acid a,c-diamide a...   127   2e-27   
gi|493659194|ref|WP_006610577.1| cob(I)yrinic acid a,c-diamide a...   127   2e-27   
gi|307170874|gb|EFN62985.1| Cob(I)yrinic acid a,c-diamide adenos...   127   3e-27   
gi|298208386|ref|YP_003716565.1| hypothetical protein CA2559_090...   127   3e-27   
gi|496203598|ref|WP_008923435.1| ATP--cobalamin adenosyltransfer...   127   3e-27   
gi|494388873|ref|WP_007206580.1| cob(I)yrinic acid a,c-diamide a...   127   3e-27   
gi|488806023|ref|WP_002718429.1| ATP:cob(I)alamin adenosyltransf...   127   3e-27   
gi|313675054|ref|YP_004053050.1| ATP/cobalamin adenosyltransfera...   127   3e-27   
gi|490396657|ref|WP_004273393.1| cob(I)yrinic acid a,c-diamide a...   127   3e-27   
gi|470245449|ref|XP_004356864.1| hypothetical protein DFA_06638 ...   126   3e-27   
gi|490219697|ref|WP_004118074.1| putative cobalamin adenosultran...   126   3e-27   
gi|498110911|ref|WP_010425067.1| cobalamin adenosyltransferase [...   126   3e-27   
gi|496095916|ref|WP_008820423.1| ATP--cobalamin adenosyltransfer...   126   3e-27   
gi|494922570|ref|WP_007648606.1| Cob(I)alamin adenosyltransferas...   126   3e-27   
gi|496518404|ref|WP_009226687.1| ATP:cob(I)alamin adenosyltransf...   126   3e-27   
gi|108760949|ref|YP_634078.1| ATP:cob(I)alamin adenosyltransfera...   126   3e-27   
gi|496530816|ref|WP_009237507.1| cobalamin adenosyltransferase [...   126   3e-27   
gi|492662358|ref|WP_005914746.1| adenosylcobalamin-dependent dio...   126   3e-27   
gi|495313095|ref|WP_008037843.1| cob(I)yrinic acid a,c-diamide a...   126   3e-27   
gi|490496464|ref|WP_004362634.1| ATP:cob(I)alamin adenosyltransf...   126   3e-27   
gi|497545953|ref|WP_009860151.1| cobalamin adenosyltransferase [...   126   3e-27   
gi|496695978|ref|WP_009337521.1| cob(I)yrinic acid a,c-diamide a...   126   3e-27   
gi|510820930|ref|WP_016194400.1| Cob(I)alamin adenosyltransferas...   126   4e-27   
gi|497498119|ref|WP_009812317.1| cob(I)yrinic acid a,c-diamide a...   126   4e-27   
gi|498123576|ref|WP_010437732.1| cob(I)yrinic acid a,c-diamide a...   126   4e-27   
gi|322787048|gb|EFZ13272.1| hypothetical protein SINV_12211 [Sol...   126   4e-27   
gi|488686552|ref|WP_002610771.1| ATP:cob(I)alamin adenosyltransf...   126   4e-27   
gi|489448426|ref|WP_003353817.1| ATP:cob(I)alamin adenosyltransf...   126   4e-27   
gi|492704606|ref|WP_005928910.1| cobalamin adenosyltransferase [...   126   4e-27   
gi|497496607|ref|WP_009810805.1| cob(I)yrinic acid a,c-diamide a...   126   4e-27   
gi|379724057|ref|YP_005316188.1| hypothetical protein PM3016_640...   126   4e-27   
gi|91774978|ref|YP_544734.1| ATP:cob(I)alamin adenosyltransferas...   126   4e-27   
gi|492488978|ref|WP_005862843.1| cob(I)yrinic acid a,c-diamide a...   126   4e-27   
gi|376316737|emb|CCG00120.1| ATP/cobalamin adenosyltransferase [...   126   4e-27   
gi|337751016|ref|YP_004645178.1| hypothetical protein KNP414_067...   126   4e-27   
gi|496078403|ref|WP_008802910.1| ATP--cobalamin adenosyltransfer...   126   4e-27   
gi|85816597|gb|EAQ37784.1| ATP:corrinoid adenosyltransferase fam...   126   4e-27   
gi|494873631|ref|WP_007599726.1| cob(I)yrinic acid a,c-diamide a...   126   5e-27   
gi|498212089|ref|WP_010526245.1| cobalamin adenosyltransferase [...   126   5e-27   
gi|307205667|gb|EFN83929.1| Cob(I)yrinic acid a,c-diamide adenos...   126   5e-27   
gi|488900744|ref|WP_002811835.1| hypothetical protein [Xanthomon...   125   5e-27   
gi|497466932|ref|WP_009781130.1| cobalamin adenosyltransferase [...   125   5e-27   
gi|491892433|ref|WP_005656603.1| cobalamin adenosyltransferase [...   125   5e-27   
gi|496072530|ref|WP_008797037.1| ATP--cobalamin adenosyltransfer...   125   5e-27   
gi|115526838|ref|YP_783749.1| ATP--cobalamin adenosyltransferase...   125   5e-27   
gi|89053040|ref|YP_508491.1| ATP:cob(I)alamin adenosyltransferas...   125   5e-27   
gi|514226804|gb|EPH21992.1| ATP:cob(I)alamin adenosyltransferase...   125   5e-27   
gi|491611992|ref|WP_005469549.1| ATP:cob(I)alamin adenosyltransf...   125   5e-27   
gi|492759639|ref|WP_005953790.1| ATP--cobalamin adenosyltransfer...   125   6e-27   
gi|507514922|ref|YP_008036539.1| ATP--cobalamin adenosyltransfer...   125   6e-27   
gi|34540854|ref|NP_905333.1| ATP:cob(I)alamin adenosyltransferas...   125   6e-27   
gi|492548919|ref|WP_005882241.1| conserved hypothetical protein ...   125   6e-27   
gi|387791262|ref|YP_006256327.1| ATP:cob(I)alamin adenosyltransf...   125   6e-27   
gi|308068171|ref|YP_003869776.1| hypothetical protein PPE_01398 ...   125   6e-27   
gi|492672050|ref|WP_005917951.1| ATP--cobalamin adenosyltransfer...   125   6e-27   
gi|86747944|ref|YP_484440.1| cobalamin adenosyltransferase [Rhod...   125   6e-27   
gi|23098359|ref|NP_691825.1| hypothetical protein OB0904 [Oceano...   125   6e-27   
gi|492801527|ref|WP_005967882.1| ATP--cobalamin adenosyltransfer...   125   6e-27   
gi|498182832|ref|WP_010496988.1| ATP:cob(I)alamin adenosyltransf...   125   6e-27   
gi|197123951|ref|YP_002135902.1| ATP/cobalamin adenosyltransfera...   125   6e-27   
gi|492875251|ref|WP_006018792.1| ATP:cob(I)alamin adenosyltransf...   125   7e-27   
gi|489536854|ref|WP_003441579.1| cob(I)alamin adenosyltransferas...   125   7e-27   
gi|56695625|ref|YP_165976.1| ATP:cob(I)alamin adenosyltransferas...   125   7e-27   
gi|220918720|ref|YP_002494024.1| ATP/cobalamin adenosyltransfera...   125   7e-27   
gi|495311285|ref|WP_008036033.1| cob(I)yrinic acid a,c-diamide a...   125   7e-27   
gi|27376487|ref|NP_768016.1| hypothetical protein blr1376 [Brady...   125   7e-27   
gi|495457413|ref|WP_008182105.1| cob(I)yrinic acid a,c-diamide a...   125   7e-27   
gi|512485281|ref|WP_016429221.1| ATP:cob(I)alamin adenosyltransf...   125   8e-27   
gi|492539422|ref|WP_005878471.1| conserved hypothetical protein ...   125   8e-27   
gi|494592614|ref|WP_007351207.1| ATP--cobalamin adenosyltransfer...   125   8e-27   
gi|491819743|ref|WP_005616938.1| ATP:cob(I)alamin adenosyltransf...   125   9e-27   
gi|492588014|ref|WP_005896162.1| ATP--cobalamin adenosyltransfer...   125   9e-27   
gi|495626905|ref|WP_008351484.1| ATP--cobalamin adenosyltransfer...   125   9e-27   
gi|90426352|ref|YP_534722.1| ATP [Rhodopseudomonas palustris Bis...   125   9e-27   
gi|497822247|ref|WP_010136403.1| cobalamin adenosyltransferase [...   125   1e-26   
gi|495832501|ref|WP_008557080.1| cob(I)yrinic acid a,c-diamide a...   125   1e-26   
gi|399991351|ref|YP_006571591.1| cobalamin adenosyltransferase [...   125   1e-26   
gi|192293591|ref|YP_001994196.1| ATP/cobalamin adenosyltransfera...   125   1e-26   
gi|495743480|ref|WP_008468059.1| cobalamin adenosyltransferase [...   125   1e-26   
gi|159900211|ref|YP_001546458.1| ATP--cobalamin adenosyltransfer...   125   1e-26   
gi|167645014|ref|YP_001682677.1| ATP--cobalamin adenosyltransfer...   125   1e-26   
gi|497291293|ref|WP_009605510.1| cob(I)yrinic acid a,c-diamide a...   124   1e-26   
gi|295675579|ref|YP_003604103.1| ATP/cobalamin adenosyltransfera...   124   1e-26   
gi|408672750|ref|YP_006872498.1| ATP/cobalamin adenosyltransfera...   124   1e-26   
gi|496162478|ref|WP_008886985.1| cob(I)yrinic acid a,c-diamide a...   124   1e-26   
gi|99082268|ref|YP_614422.1| ATP:cob(I)alamin adenosyltransferas...   124   1e-26   
gi|496467373|ref|WP_009176218.1| cob(I)yrinic acid a,c-diamide a...   124   1e-26   
gi|494321649|ref|WP_007179213.1| ATP--cobalamin adenosyltransfer...   124   1e-26   
gi|488734408|ref|WP_002657809.1| cobalamin adenosyltransferase [...   124   1e-26   
gi|488786218|ref|WP_002698625.1| cobalamin adenosyltransferase [...   124   1e-26   
gi|497838093|ref|WP_010152249.1| ATP:cob(I)alamin adenosyltransf...   124   1e-26   
gi|120434897|ref|YP_860583.1| cobalamin adenosyltransferase [Gra...   124   1e-26   
gi|494005558|ref|WP_006948054.1| cobalamin adenosyltransferase [...   124   1e-26   
gi|495888304|ref|WP_008612883.1| cobalamin adenosyltransferase [...   124   1e-26   
gi|495381947|ref|WP_008106658.1| ATP--cobalamin adenosyltransfer...   124   1e-26   
gi|492582375|ref|WP_005894069.1| Hypothetical Cytosolic Protein,...   124   1e-26   
gi|496973592|ref|WP_009424461.1| ATP--cobalamin adenosyltransfer...   124   1e-26   
gi|496143167|ref|WP_008867674.1| cobalamin adenosyltransferase [...   124   1e-26   
gi|497537832|ref|WP_009852030.1| ATP--cobalamin adenosyltransfer...   124   1e-26   
gi|497516127|ref|WP_009830325.1| cob(I)yrinic acid a,c-diamide a...   124   1e-26   
gi|495903660|ref|WP_008628239.1| cobalamin adenosyltransferase [...   124   1e-26   
gi|78065298|ref|YP_368067.1| ATP:cob(I)alamin adenosyltransferas...   124   1e-26   
gi|496324307|ref|WP_009033485.1| cobalamin adenosyltransferase [...   124   1e-26   
gi|489486661|ref|WP_003391629.1| hypothetical protein [Brevibaci...   124   1e-26   
gi|92118942|ref|YP_578671.1| ATP--cobalamin adenosyltransferase ...   124   2e-26   
gi|495306337|ref|WP_008031086.1| cob(I)yrinic acid a,c-diamide a...   124   2e-26   
gi|328958042|ref|YP_004375428.1| ATP:cob(I)alamin adenosyltransf...   124   2e-26   
gi|495899197|ref|WP_008623776.1| Cob(I)alamin adenosyltransferas...   124   2e-26   
gi|408490843|ref|YP_006867212.1| cob(I)alamin adenosyltransferas...   124   2e-26   
gi|494771003|ref|WP_007506411.1| ATP:cob(I)alamin adenosyltransf...   124   2e-26   
gi|496388507|ref|WP_009097497.1| ATP/cobalamin adenosyltransfera...   124   2e-26   
gi|316936220|ref|YP_004111202.1| ATP/cobalamin adenosyltransfera...   124   2e-26   
gi|39937809|ref|NP_950085.1| hypothetical protein RPA4751 [Rhodo...   124   2e-26   
gi|87198577|ref|YP_495834.1| ATP:cob(I)alamin adenosyltransferas...   124   2e-26   
gi|406987054|gb|EKE07502.1| Cob(I)alamin adenosyltransferase, pa...   124   2e-26   


>gi|117422550|gb|ABK34898.1| cob(I)alamin adenosyltransferase [Blastocladiella emersonii]
          Length = 217

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 149/208 (71%), Gaps = 8/208 (3%)

Query: 11  KPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLE 70
           K     +YT+TGDKG SSL+NGERRSK D VF ALG+VDELSSSIGVA  YC +AGNGL 
Sbjct: 16  KSSTMKIYTKTGDKGTSSLYNGERRSKTDAVFEALGSVDELSSSIGVAAEYCGQAGNGLA 75

Query: 71  DKLVEIQCKLIEVGSNIATPRNSSNTS--KLSFTSFDEENVNILESWIDNLDNQLPPLKN 128
           ++L EIQC LIE+GSNIATPR SS  +  KL+ T+FDE +V  LE+WID LD  LP L N
Sbjct: 76  EQLQEIQCVLIEMGSNIATPRQSSADAPYKLAKTAFDEAHVAQLEAWIDALDATLPALTN 135

Query: 129 FILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAM 188
           FILPSGG +A  LHQCRSV RRAER  VPL  A+  +  V +Y NRLSD+FFVAAR+AA 
Sbjct: 136 FILPSGGLAAAHLHQCRSVARRAERSLVPLAAADEVDAGVTQYANRLSDYFFVAARHAAK 195

Query: 189 FEKHIENYYEQRRDDRESNLVKRELSKE 216
            E  +E  +  +R      +V+R LS E
Sbjct: 196 HEGQVERVFVAKR------VVERSLSCE 217



>gi|196014876|ref|XP_002117296.1| hypothetical protein TRIADDRAFT_32318 [Trichoplax adhaerens]
 gi|190580049|gb|EDV20135.1| hypothetical protein TRIADDRAFT_32318 [Trichoplax adhaerens]
          Length = 188

 Score =  218 bits (555), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 111/183 (60%), Positives = 130/183 (71%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKGKSSLF GERR KDD +F ALGT DELSS+IG+A  +C +AG    DKL +I
Sbjct: 3   IYTKTGDKGKSSLFTGERRLKDDTIFEALGTNDELSSAIGLAREFCLQAGQNFVDKLEQI 62

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           QC+L ++GSNIATPR  ++  KL  T F   NV  LE WID +D QLPPLKNFILPSGG 
Sbjct: 63  QCRLQDIGSNIATPRIQADEDKLVRTEFSSSNVQQLELWIDEMDEQLPPLKNFILPSGGL 122

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           S+  LH  RS+CRRAER  VPLV     +  V KYLNRLSDF F AARY+AM E   E  
Sbjct: 123 SSSSLHVARSICRRAERRVVPLVRENAVDPDVAKYLNRLSDFLFTAARYSAMKEGRSEVI 182

Query: 197 YEQ 199
           Y +
Sbjct: 183 YRK 185



>gi|109497496|ref|XP_001080395.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Rattus norvegicus]
 gi|392352576|ref|XP_003751249.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Rattus norvegicus]
          Length = 237

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 107/200 (53%), Positives = 135/200 (67%), Gaps = 5/200 (2%)

Query: 6   DDNNPKP-----KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANH 60
           D + P+P     K   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG A  
Sbjct: 36  DGDRPQPSSKAAKVLKIYTKTGDKGLSSTFTGERRPKDDQVFEALGTTDELSSAIGFAME 95

Query: 61  YCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLD 120
              + G+   ++L +IQC L +VGS +ATPR+S+  + L  T+F EE +  LE WID   
Sbjct: 96  LITEKGHTFAEELRKIQCTLQDVGSALATPRSSAREAHLKHTAFQEEPILELEQWIDKYS 155

Query: 121 NQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFF 180
           +QLPPL  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F
Sbjct: 156 SQLPPLTAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLF 215

Query: 181 VAARYAAMFEKHIENYYEQR 200
             ARYAAM E   E  Y++R
Sbjct: 216 TVARYAAMKEGSQEKIYKKR 235



>gi|126631839|gb|AAI33926.1| Si:dkey-189p24.5 protein [Danio rerio]
          Length = 233

 Score =  215 bits (548), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 140/196 (71%), Gaps = 3/196 (1%)

Query: 5   TDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK 64
           +++N   PK   +YT+TGDKG SS F GERR K+D +F+ALGT DELSS+IG+A  +C  
Sbjct: 40  SEENRRIPK---IYTKTGDKGFSSTFTGERRPKEDHIFDALGTTDELSSAIGLAREFCID 96

Query: 65  AGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLP 124
           +G+   D+L +IQC L +VGSNIATPR+S+  S ++ T F  ++V+ LE WID+   +LP
Sbjct: 97  SGHSFTDQLEKIQCVLQDVGSNIATPRSSARESHITKTKFSSQSVSELEKWIDSFTEELP 156

Query: 125 PLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           PL +FILPSGG+S+  LH  R+VCRRAER   P+V +  T+  V KYLNRLSD+ F  AR
Sbjct: 157 PLTSFILPSGGKSSAALHVARAVCRRAERCVAPVVRSGETDPEVAKYLNRLSDYLFTVAR 216

Query: 185 YAAMFEKHIENYYEQR 200
           YAAM + + E  Y+++
Sbjct: 217 YAAMKDGNAETIYKRQ 232



>gi|130492033|ref|NP_001076278.1| cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           [Danio rerio]
          Length = 233

 Score =  214 bits (546), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 101/196 (51%), Positives = 140/196 (71%), Gaps = 3/196 (1%)

Query: 5   TDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK 64
           +++N   PK   +YT+TGDKG SS F GERR K+D +F+ALGT DELSS+IG+A  +C  
Sbjct: 40  SEENRRIPK---IYTKTGDKGFSSTFTGERRPKEDHIFDALGTTDELSSAIGLAREFCID 96

Query: 65  AGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLP 124
           +G+   D+L ++QC L +VGSNIATPR+S+  S ++ T F  ++V+ LE WID+   +LP
Sbjct: 97  SGHSFTDQLEKVQCVLQDVGSNIATPRSSARESHITKTKFSSQSVSELEKWIDSFTEELP 156

Query: 125 PLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           PL +FILPSGG+S+  LH  R+VCRRAER   P+V +  T+  V KYLNRLSD+ F  AR
Sbjct: 157 PLTSFILPSGGKSSAALHVARAVCRRAERCVAPVVRSGETDPEVAKYLNRLSDYLFTVAR 216

Query: 185 YAAMFEKHIENYYEQR 200
           YAAM + + E  Y+++
Sbjct: 217 YAAMKDGNAETIYKRQ 232



>gi|432874052|ref|XP_004072448.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Oryzias latipes]
          Length = 236

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 103/195 (52%), Positives = 135/195 (69%), Gaps = 3/195 (1%)

Query: 5   TDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK 64
           T ++N  PK   +YT+TGDKG SS F GERR K+D +F ALG  DELSS+IG+A  +C +
Sbjct: 43  TAEDNKGPK---IYTKTGDKGFSSTFTGERRPKEDHIFEALGNTDELSSAIGLAREFCLE 99

Query: 65  AGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLP 124
            G+    +L +IQC L +VGSNIATPR+S+  S +  T F  + +  LE+WIDN  N+LP
Sbjct: 100 KGHTFIHQLDKIQCILQDVGSNIATPRSSARDSHIKKTKFTSQPIADLETWIDNFTNELP 159

Query: 125 PLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           PL NFILPSGG+S+  LH  R+VCRRAER   P+V +   +Q V K+LNRLSD+ F  AR
Sbjct: 160 PLTNFILPSGGKSSAALHLARTVCRRAERSVAPIVRSGEADQDVAKFLNRLSDYLFTVAR 219

Query: 185 YAAMFEKHIENYYEQ 199
           YAAM E + E  Y++
Sbjct: 220 YAAMKEGNEEKIYKR 234



>gi|348584470|ref|XP_003477995.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Cavia porcellus]
          Length = 241

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 103/188 (54%), Positives = 130/188 (69%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YTRTGDKG SS F GERR KDD VF ALGT DELSS+IG A     + G+   +
Sbjct: 47  PKIPKIYTRTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELITEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L  T+F+  ++  LE WID    QLPPL  FIL
Sbjct: 107 ELQKIQCTLQDVGSALATPRSSAREAHLKRTAFEAGSILELEQWIDKYSRQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKSSAALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKIYKK 234



>gi|470387293|ref|XP_004334273.1| ATP:cob(I)alamin adenosyltransferase [Acanthamoeba castellanii str.
           Neff]
 gi|440791005|gb|ELR12260.1| ATP:cob(I)alamin adenosyltransferase [Acanthamoeba castellanii str.
           Neff]
          Length = 213

 Score =  211 bits (538), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 128/187 (68%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS +YTRTGDKG+SSL+ GERR+KDD +F ALGT+DEL+S +GVA+ YCK A NGL   
Sbjct: 14  KKSALYTRTGDKGESSLYTGERRAKDDAIFEALGTIDELNSHLGVASEYCKLADNGLHVY 73

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           + EIQ +L++VGS +ATP  S+   + +  +F  E    LE WID LD QLP L  FILP
Sbjct: 74  IEEIQARLMDVGSAVATPETSATEPQKAKMAFGMEYTEALEEWIDLLDGQLPKLTRFILP 133

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG S+  LH  RSVCR AER  V LV    T+ SV  YLNRLSDF F AAR AAM +  
Sbjct: 134 SGGMSSAHLHVARSVCRSAERRVVTLVHLRTTDSSVACYLNRLSDFLFAAARCAAMKDGR 193

Query: 193 IENYYEQ 199
            E  Y++
Sbjct: 194 EETTYKK 200



>gi|363739991|ref|XP_423950.3| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X6 [Gallus gallus]
          Length = 232

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/192 (53%), Positives = 130/192 (67%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           +   P  +   +YTRTGD+G SS F GERR K D +F ALGT DELSS+IG+A+    + 
Sbjct: 36  EGGPPSARSPRIYTRTGDEGFSSTFTGERRPKGDRIFEALGTTDELSSAIGLASELSSEK 95

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L ++QC L +VGSNIATP +S+  + L  TSF EE +  LE WID    QLPP
Sbjct: 96  GHAFVEQLHKVQCMLQDVGSNIATPLSSAREAHLKRTSFSEEPILELEKWIDRYSEQLPP 155

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           L+ FILPSGG+S+  LH  R+VCRRAER  VPLV+A   + +V KYLNRLSD+ FV ARY
Sbjct: 156 LRAFILPSGGKSSAALHFSRAVCRRAERCVVPLVQAGEADTNVAKYLNRLSDYLFVLARY 215

Query: 186 AAMFEKHIENYY 197
           AAM E   E  Y
Sbjct: 216 AAMKEGKEEKIY 227



>gi|363745270|ref|XP_003643248.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X1 [Gallus gallus]
 gi|363745666|ref|XP_003643370.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X1 [Gallus gallus]
          Length = 232

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/192 (53%), Positives = 130/192 (67%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           +   P  +   +YTRTGD+G SS F GERR K D +F ALGT DELSS+IG+A+    + 
Sbjct: 36  EGGPPSARSPRIYTRTGDEGFSSTFTGERRPKGDRIFEALGTTDELSSAIGLASELSSEK 95

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L ++QC L +VGSNIATP +S+  + L  TSF EE +  LE WID    QLPP
Sbjct: 96  GHAFVEQLHKVQCMLQDVGSNIATPLSSAREAHLKRTSFSEEPILELEKWIDRYSEQLPP 155

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           L+ FILPSGG+S+  LH  R+VCRRAER  VPLV+A   + +V KYLNRLSD+ FV ARY
Sbjct: 156 LRAFILPSGGKSSAALHFSRAVCRRAERCVVPLVQAGEADPNVAKYLNRLSDYLFVLARY 215

Query: 186 AAMFEKHIENYY 197
           AAM E   E  Y
Sbjct: 216 AAMKEGKEEKIY 227



>gi|344295320|ref|XP_003419360.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Loxodonta africana]
          Length = 235

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 130/188 (69%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELITERGHTFVE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L  T+F E  +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCTLQDVGSTLATPRSSAREAHLKHTTFMEGPILELEQWIDKYTSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+A  T+ +V K+LNRLSD+ F  ARY AM E 
Sbjct: 167 PSGGKSSSMLHLCRAVCRRAERCVVPLVQAGETDANVAKFLNRLSDYLFTLARYTAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKIYKK 234



>gi|291413952|ref|XP_002723229.1| PREDICTED: cob(I)alamin adenosyltransferase-like [Oryctolagus
           cuniculus]
          Length = 274

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 104/194 (53%), Positives = 133/194 (68%), Gaps = 1/194 (0%)

Query: 7   DNNPK-PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           + +PK PK   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG A  +  + 
Sbjct: 41  EPSPKTPKIPRIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMEFITEK 100

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L +IQC L ++GS +ATPR+S+  + L   +F E  V  LE WID    QLPP
Sbjct: 101 GHPFAEELQKIQCTLQDIGSTLATPRSSAREAHLKHAAFGEGPVLELERWIDEYTRQLPP 160

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           L  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY
Sbjct: 161 LTAFILPSGGKSSSALHLCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARY 220

Query: 186 AAMFEKHIENYYEQ 199
           AAM E + E  Y++
Sbjct: 221 AAMKEGNQEKIYKR 234



>gi|505844142|ref|XP_004615563.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Sorex araneus]
          Length = 241

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 103/192 (53%), Positives = 129/192 (67%), Gaps = 2/192 (1%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IGVA     + G+   D
Sbjct: 47  PKAPKIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGVAMEIVTERGHPFAD 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L  ++F+   +  LE WID    QLP L  FIL
Sbjct: 107 ELQKIQCSLQDVGSALATPRSSAREAHLKHSTFEAGRIQELEQWIDTYTRQLPALTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG S+  LH CR+VCRRAER  VPLV++  T+ +V  +LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGPSSATLHFCRAVCRRAERRVVPLVQSGETDANVAVFLNRLSDYLFTVARYAAMREG 226

Query: 192 HIENYYEQRRDD 203
             E  Y  ++DD
Sbjct: 227 KQEKIY--KKDD 236



>gi|512868243|ref|XP_004891655.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X2 [Heterocephalus glaber]
 gi|512962830|ref|XP_004843668.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X2 [Heterocephalus glaber]
          Length = 239

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 130/188 (69%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG A     + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELITEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L ++QC L +VGS +ATPR+S+  + L  T+F+   +  LE WIDN   QLPPL  FIL
Sbjct: 107 ELQKVQCTLQDVGSALATPRSSAREAHLKRTAFEAGPILQLEQWIDNYSRQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKIYKK 234



>gi|504162771|ref|XP_004591980.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Ochotona princeps]
          Length = 241

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 105/199 (52%), Positives = 135/199 (67%), Gaps = 5/199 (2%)

Query: 6   DDNNPKP-----KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANH 60
           D + P P     K   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG+A  
Sbjct: 36  DGDRPHPSSKTAKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGLALE 95

Query: 61  YCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLD 120
           +  + G+   ++L +IQC L +VGS +ATPR+S+  + L  T+F+E  +  LE WID   
Sbjct: 96  FITEKGHPFTEELQKIQCHLQDVGSALATPRSSAREAHLKQTAFEEGPILELERWIDQYS 155

Query: 121 NQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFF 180
            QLPPL  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F
Sbjct: 156 CQLPPLTAFILPSGGKSSSTLHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLF 215

Query: 181 VAARYAAMFEKHIENYYEQ 199
             ARYAAM E + E  Y++
Sbjct: 216 TLARYAAMKEGNQEKIYKK 234



>gi|449674218|ref|XP_002168576.2| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Hydra magnipapillata]
          Length = 221

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 135/190 (71%), Gaps = 5/190 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLE-- 70
           K   +YTRTGDKG SSLF GERR+KDD VF A+G  DEL+SSIG+A  +C + G+ LE  
Sbjct: 28  KSFKIYTRTGDKGTSSLFGGERRTKDDQVFEAMGCTDELTSSIGIAKEFCLEFGH-LEVV 86

Query: 71  DKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFI 130
            KL EIQC+L ++ SNIATP   S    +   SFD  N++ LESWID  D  LPPLKNFI
Sbjct: 87  QKLEEIQCRLQDINSNIATPAQVSINGDV--LSFDATNIDQLESWIDEYDKHLPPLKNFI 144

Query: 131 LPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFE 190
           LPSGG+S+V LH  R++CRRAER  VPL+   + ++SV KY+NRLSDF F+AAR+AA  +
Sbjct: 145 LPSGGKSSVSLHLARTICRRAERRLVPLLHKNMIDESVYKYMNRLSDFLFIAARFAAHKD 204

Query: 191 KHIENYYEQR 200
              E  Y++R
Sbjct: 205 GKNELVYKRR 214



>gi|395834064|ref|XP_003790036.1| PREDICTED: LOW QUALITY PROTEIN: cob(I)yrinic acid a,c-diamide
           adenosyltransferase, mitochondrial [Otolemur garnettii]
          Length = 246

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 101/188 (53%), Positives = 131/188 (69%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A    ++ G+    
Sbjct: 47  PKSPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELIEEKGHTFAK 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L ++QC L +VGS +ATPR+S+  + L  T+F+E  +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKVQCMLQDVGSALATPRSSAREAHLKHTAFEEGPILELEQWIDKYTSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKIYKK 234



>gi|354482770|ref|XP_003503569.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Cricetulus griseus]
 gi|344254512|gb|EGW10616.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           [Cricetulus griseus]
          Length = 237

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 105/199 (52%), Positives = 132/199 (66%), Gaps = 5/199 (2%)

Query: 6   DDNNPKP-----KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANH 60
           D N PK      K   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A  
Sbjct: 36  DGNRPKSSSKAHKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAME 95

Query: 61  YCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLD 120
              + G+    +L +IQC L +VGS +ATPR+S+  + L +T+F E  +  LE WID   
Sbjct: 96  LITEKGHTFAKELQKIQCTLQDVGSALATPRSSAREAHLKYTTFKEGPIVELEQWIDKYS 155

Query: 121 NQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFF 180
           +QLPPL  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F
Sbjct: 156 SQLPPLTAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLF 215

Query: 181 VAARYAAMFEKHIENYYEQ 199
             ARYAAM E   E  Y++
Sbjct: 216 TIARYAAMKEGSQEKIYKK 234



>gi|260785034|ref|XP_002587568.1| hypothetical protein BRAFLDRAFT_282758 [Branchiostoma floridae]
 gi|229272717|gb|EEN43579.1| hypothetical protein BRAFLDRAFT_282758 [Branchiostoma floridae]
          Length = 236

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 100/183 (54%), Positives = 124/183 (67%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGDKGKSSLF GERR KDD +F ALGT DELS ++G+A  +   AG+   D+L +I
Sbjct: 48  IYTRTGDKGKSSLFTGERRKKDDTIFEALGTTDELSCAVGLAGEFGNDAGHQFMDRLEKI 107

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L +VGSNIATPR  +   KL+ T F   +V  LE WID    QLPPL NFILPSGG+
Sbjct: 108 QSLLQDVGSNIATPRTKAQDGKLARTEFPSGSVEELEGWIDEYTEQLPPLTNFILPSGGK 167

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           ++  LH  R++CRR ER  VPLV +   +  VG+Y+NRLSDF F  AR+AAM E   E  
Sbjct: 168 TSASLHMARAICRRTERRLVPLVSSGDVDAEVGRYINRLSDFLFTLARFAAMTENKEEKI 227

Query: 197 YEQ 199
           Y +
Sbjct: 228 YRR 230



>gi|471387347|ref|XP_004379161.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Trichechus manatus latirostris]
          Length = 235

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 101/188 (53%), Positives = 129/188 (68%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELITEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L  T+F E  +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCTLQDVGSALATPRSSAREAHLKHTAFSEGPILELEQWIDKYSSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY AM E 
Sbjct: 167 PSGGKSSSMLHLCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYTAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKMYKK 234



>gi|326929764|ref|XP_003211026.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Meleagris gallopavo]
          Length = 243

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 107/196 (54%), Positives = 133/196 (67%), Gaps = 1/196 (0%)

Query: 3   LMTDDNNPKPKKS-NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHY 61
           L + +  P+  +S  +YTRTGD+G SS F GERR K D VF ALGT DELSS+IG+A   
Sbjct: 43  LYSPERGPRSSRSPRIYTRTGDEGFSSTFTGERRPKGDRVFEALGTTDELSSAIGLACEL 102

Query: 62  CKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDN 121
             + G+   ++L ++QC L +VGSNIATP +S+  + L  TSF EE V  LE WID    
Sbjct: 103 SSEKGHVFVEQLHKVQCMLQDVGSNIATPLSSAREAHLKRTSFSEEPVLELEKWIDRYSE 162

Query: 122 QLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFV 181
           QLPPL+ FILPSGG+S+  LH  R+VCRRAER  VPLV+A   + +V KYLNRLSD+ FV
Sbjct: 163 QLPPLRAFILPSGGKSSAALHFSRAVCRRAERCVVPLVQAGEADPNVAKYLNRLSDYLFV 222

Query: 182 AARYAAMFEKHIENYY 197
            ARYAAM E   E  Y
Sbjct: 223 LARYAAMKEGKEEKIY 238



>gi|18381148|gb|AAH22159.1| Mmab protein, partial [Mus musculus]
 gi|148687963|gb|EDL19910.1| methylmalonic aciduria (cobalamin deficiency) type B homolog
           (human), isoform CRA_b [Mus musculus]
          Length = 233

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 129/187 (68%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   ++
Sbjct: 44  KIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELVTEKGHMFAEE 103

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L +IQC L +VGS +ATPR+S+  + L  T+F E  V  LE WID   +QLPPLK FILP
Sbjct: 104 LQKIQCMLQDVGSALATPRSSAREAHLKHTAFQEGPVLELERWIDKYSSQLPPLKAFILP 163

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E  
Sbjct: 164 SGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEGS 223

Query: 193 IENYYEQ 199
            E  Y++
Sbjct: 224 QEKIYKK 230



>gi|21313396|ref|NP_084232.1| cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           precursor [Mus musculus]
 gi|38258240|sp|Q9D273.1|MMAB_MOUSE RecName: Full=Cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial; AltName: Full=Cob(I)alamin
           adenosyltransferase; AltName: Full=Methylmalonic
           aciduria type B homolog; Flags: Precursor
 gi|12860826|dbj|BAB32055.1| unnamed protein product [Mus musculus]
 gi|26353882|dbj|BAC40571.1| unnamed protein product [Mus musculus]
 gi|35505368|gb|AAH57558.1| Methylmalonic aciduria (cobalamin deficiency) type B homolog
           (human) [Mus musculus]
 gi|74203902|dbj|BAE28544.1| unnamed protein product [Mus musculus]
          Length = 237

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 129/187 (68%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   ++
Sbjct: 48  KIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELVTEKGHMFAEE 107

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L +IQC L +VGS +ATPR+S+  + L  T+F E  V  LE WID   +QLPPLK FILP
Sbjct: 108 LQKIQCMLQDVGSALATPRSSAREAHLKHTAFQEGPVLELERWIDKYSSQLPPLKAFILP 167

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E  
Sbjct: 168 SGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEGS 227

Query: 193 IENYYEQ 199
            E  Y++
Sbjct: 228 QEKIYKK 234



>gi|470297392|ref|XP_004345611.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
 gi|320163990|gb|EFW40889.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
          Length = 204

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 124/185 (67%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE 75
            +YT+TGDKG S LF GERR KDD VF ALG  DEL+S++ +A  +       L ++   
Sbjct: 3   KIYTKTGDKGTSGLFTGERRPKDDAVFEALGATDELTSALALAREFTLSVNENLAEQFET 62

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQC L ++GSN+ATPR + + ++  FT FD   V  LE WID +D QLPPL+NFILPSGG
Sbjct: 63  IQCVLQDIGSNVATPRTTEDKARKGFTEFDPTQVEELEQWIDAMDEQLPPLRNFILPSGG 122

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIEN 195
           +++  +H  RS+ RRAER  VPLV     +++ G+YLNRLSD+ F AARYAAM E   E 
Sbjct: 123 KASSAIHIARSISRRAERRVVPLVRDGEADEAAGRYLNRLSDYLFTAARYAAMLEHKPEI 182

Query: 196 YYEQR 200
            Y+ R
Sbjct: 183 VYKTR 187



>gi|432092873|gb|ELK25239.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           [Myotis davidii]
          Length = 239

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 128/188 (68%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG A     + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELIAEKGHPFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L  T+F+   V  LE WID    QLPPL  FIL
Sbjct: 107 ELEKIQCSLQDVGSALATPRSSARETHLRRTTFESGRVLELEQWIDKYSGQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER   PLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKSSAALHFCRAVCRRAERRVAPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKIYKK 234



>gi|507560727|ref|XP_004664066.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Jaculus jaculus]
          Length = 414

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 132/194 (68%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           D   P  K   +YT+TGDKG SS F GERR K+D VF A+GT DELSS+IG A  +  + 
Sbjct: 214 DRLQPSSKIPKIYTKTGDKGFSSTFTGERRPKNDQVFEAVGTTDELSSAIGFALAFITEK 273

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
            +   ++L +IQC L +VGS +ATPR+S+  + L +T+FD  ++  LE WID   +QLPP
Sbjct: 274 DHTFAEELQKIQCMLQDVGSALATPRSSAREAHLKYTAFDAGSILELEQWIDKYTSQLPP 333

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           L  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY
Sbjct: 334 LSAFILPSGGKSSAALHVCRTVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTIARY 393

Query: 186 AAMFEKHIENYYEQ 199
           AAM E + E  Y +
Sbjct: 394 AAMKEGNQEKIYRK 407



>gi|507676139|ref|XP_004709704.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Echinops telfairi]
          Length = 235

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 132/197 (67%), Gaps = 3/197 (1%)

Query: 6   DDNNPK---PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYC 62
           D + P    PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS IG+A    
Sbjct: 38  DGSKPPSKTPKVPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSLIGLAMELM 97

Query: 63  KKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQ 122
           ++ G    ++L ++QC L +VGS +ATPR+S+  + L  T+F E  V  LE WID   +Q
Sbjct: 98  EERGPLFAEELQKVQCMLQDVGSALATPRSSAREAHLKHTAFPEGAVLELEQWIDKYASQ 157

Query: 123 LPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVA 182
           LPPL  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  
Sbjct: 158 LPPLTAFILPSGGKSSAVLHLCRTVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTL 217

Query: 183 ARYAAMFEKHIENYYEQ 199
           ARYAA+ E   E  Y++
Sbjct: 218 ARYAALQEGIQEKIYQK 234



>gi|410923130|ref|XP_003975035.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Takifugu rubripes]
          Length = 206

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/199 (49%), Positives = 132/199 (66%), Gaps = 3/199 (1%)

Query: 1   FFLMTDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANH 60
           +  +T+  N  PK   +YT+TGDKG SS F GERR K+D +F ALG  DELSS+IG+A  
Sbjct: 10  YLYVTEGENRIPK---IYTKTGDKGVSSTFTGERRPKEDHIFEALGNTDELSSAIGLARE 66

Query: 61  YCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLD 120
           +C  +G+   D+L  IQC L+++GSNIATPR+S+  S +  T    +    LE+WID   
Sbjct: 67  FCLDSGHTFTDQLDRIQCILLDIGSNIATPRSSARESHMQRTRLTAQPTADLETWIDRFT 126

Query: 121 NQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFF 180
            +LPPL NFI+PSGG+S+  LH  R+VCRRAER  VP+V +   +  V K+LNRLSD+ F
Sbjct: 127 VELPPLTNFIIPSGGKSSAALHFARTVCRRAERSVVPIVRSGEADPEVAKFLNRLSDYLF 186

Query: 181 VAARYAAMFEKHIENYYEQ 199
             ARYAAM E   E  Y++
Sbjct: 187 TVARYAAMKEGREEKIYKK 205



>gi|149720492|ref|XP_001496901.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Equus caballus]
          Length = 241

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/188 (52%), Positives = 129/188 (68%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PKVPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L ++GS +ATPR+S+  + L  T+F+   +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCSLQDIGSALATPRSSAREAHLRHTAFEAGPILELEQWIDKYSSQLPPLTEFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY AM E 
Sbjct: 167 PSGGKSSSALHLCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYVAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKIYKK 234



>gi|194043105|ref|XP_001929229.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform 1 [Sus scrofa]
          Length = 241

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 99/188 (52%), Positives = 130/188 (69%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L ++G+ +ATPR+S+  + L  T+F+   +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCSLQDIGAALATPRSSAREAHLKHTTFEVGPILELEQWIDRYSSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDVNVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NPEKIYKK 234



>gi|55639327|ref|XP_509512.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform 2 [Pan troglodytes]
          Length = 244

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 101/195 (51%), Positives = 131/195 (67%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L +T+F    +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCTLQDVGSALATPRSSAREAHLKYTAFKAGPILELEQWIDKYTSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 227 NQEKIYKKNDPSAES 241



>gi|403281707|ref|XP_003932319.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Saimiri boliviensis boliviensis]
          Length = 244

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 101/195 (51%), Positives = 132/195 (67%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L +T+F+   +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCLLQDVGSALATPRSSAREAHLKYTTFEAGPILELEQWIDKYTSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 227 NQEKIYKKNDPSAES 241



>gi|397525175|ref|XP_003832552.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Pan paniscus]
          Length = 244

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 101/195 (51%), Positives = 131/195 (67%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L +T+F    +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCTLQDVGSALATPRSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 227 NQEKIYKKNDPSAES 241



>gi|332261278|ref|XP_003279701.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Nomascus leucogenys]
          Length = 244

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 129/188 (68%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+    
Sbjct: 47  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAK 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L +T+F+   V  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCTLQDVGSALATPRSSAREAHLKYTTFEAGPVLELEQWIDKYTSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKIYKK 234



>gi|390468185|ref|XP_003733896.1| PREDICTED: LOW QUALITY PROTEIN: cob(I)yrinic acid a,c-diamide
           adenosyltransferase, mitochondrial [Callithrix jacchus]
          Length = 244

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 101/195 (51%), Positives = 132/195 (67%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F G RR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PRIPKIYTKTGDKGFSSTFTGXRRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L +T+F+   +  LE WIDN  +QLPPL  FIL
Sbjct: 107 ELQKIQCLLQDVGSALATPRSSAREAHLKYTTFEAGPIVELEQWIDNYTSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 227 NQEKIYKKNDPSAES 241



>gi|355564662|gb|EHH21162.1| hypothetical protein EGK_04165, partial [Macaca mulatta]
          Length = 240

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 101/195 (51%), Positives = 131/195 (67%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 43  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAVELVTEKGHIFAE 102

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L +T+F+   +  LE WID    QLPPL  FIL
Sbjct: 103 ELQKIQCTLQDVGSALATPRSSAREAHLKYTTFESGPILELEQWIDKYTCQLPPLTAFIL 162

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 163 PSGGKISSALHFCRAVCRRAERCVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 222

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 223 NQEKIYKKNDPSAES 237



>gi|507665016|ref|XP_004636409.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Octodon degus]
          Length = 239

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/187 (52%), Positives = 130/187 (69%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG A     + G+   ++
Sbjct: 48  KIPKIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELVTEKGHAFAEE 107

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L +IQC L +VG+ +ATP++S+  + L  T+F+   +  LE WID+   QLPPL  FILP
Sbjct: 108 LQKIQCTLQDVGAALATPQSSAREAHLKHTAFEAGPILELEQWIDSYSRQLPPLTAFILP 167

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F+ ARYAAM E +
Sbjct: 168 SGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFMVARYAAMKEGN 227

Query: 193 IENYYEQ 199
            E  Y++
Sbjct: 228 QEKIYKK 234



>gi|470597858|ref|XP_004311558.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Tursiops truncatus]
          Length = 241

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/188 (52%), Positives = 129/188 (68%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PKLPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFVE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L   +F+   +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCSLQDVGSALATPRSSAREAHLKHATFEAGPILELEQWIDRYSSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV++  T+ +V K+LNRLSD+ F  ARY AM E 
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQSGETDANVAKFLNRLSDYLFTLARYTAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NPEKIYKK 234



>gi|301771734|ref|XP_002921281.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Ailuropoda melanoleuca]
          Length = 239

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 134/201 (66%), Gaps = 5/201 (2%)

Query: 4   MTDDNNPK-----PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVA 58
           + D + P+     PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A
Sbjct: 34  VKDGDGPQSSLKTPKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFA 93

Query: 59  NHYCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDN 118
             +  + G+   ++L +IQC L +VGS +ATPR+S+  + L   +F+   +  LE WID 
Sbjct: 94  LEFIAEKGHPFAEELRKIQCSLQDVGSALATPRSSAREAHLRHATFEAGPILELEQWIDK 153

Query: 119 LDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDF 178
             +QLPPL  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+
Sbjct: 154 YSSQLPPLTAFILPSGGKSSSVLHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDY 213

Query: 179 FFVAARYAAMFEKHIENYYEQ 199
            F  ARY AM E + E  Y++
Sbjct: 214 LFTLARYMAMKEGNQEKIYKK 234



>gi|350539880|ref|NP_001232298.1| cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           [Taeniopygia guttata]
 gi|197128056|gb|ACH44554.1| putative methylmalonic aciduria (cobalamin deficiency) type B
           variant 2 [Taeniopygia guttata]
          Length = 233

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 125/185 (67%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           +   +YTRTGD G SS F GERR K D +F ALG  DELSS+IG+A  +  + G+   D+
Sbjct: 44  RAPRIYTRTGDSGFSSTFTGERRPKGDRIFEALGATDELSSAIGLAGEFSSEKGHTFVDQ 103

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L ++QC L +VGSN+ATP +S+  +    TSF E+ V  LE WID+   QLPPL+ FILP
Sbjct: 104 LHKVQCMLQDVGSNLATPLSSAREAHRKRTSFSEKPVLELEQWIDSYSEQLPPLRAFILP 163

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG S+  LH  R+VCRRAER  VPLV+A   + +V KYLNRLSD+ FV ARYAAM E  
Sbjct: 164 SGGRSSAALHFSRAVCRRAERCVVPLVQAGEADPNVAKYLNRLSDYLFVLARYAAMKEGK 223

Query: 193 IENYY 197
            E  Y
Sbjct: 224 EEKIY 228



>gi|410977138|ref|XP_003994967.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Felis catus]
          Length = 241

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 101/199 (50%), Positives = 133/199 (66%), Gaps = 5/199 (2%)

Query: 6   DDNNPKP-----KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANH 60
           D + P+P     K   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A  
Sbjct: 36  DGDGPQPSLKTSKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAVE 95

Query: 61  YCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLD 120
              + G+   ++L +IQC L ++GS +ATPR+S+  + L   +F+   +  LE WID   
Sbjct: 96  LVAEKGHPFAEELQKIQCSLQDIGSALATPRSSAREAHLRCAAFEAGPILELEQWIDRYS 155

Query: 121 NQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFF 180
           +QLPPL  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F
Sbjct: 156 SQLPPLTAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLF 215

Query: 181 VAARYAAMFEKHIENYYEQ 199
             ARYAAM E + E  Y++
Sbjct: 216 TLARYAAMKEGNQEKIYKK 234



>gi|488586334|ref|XP_004478504.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform 1 [Dasypus novemcinctus]
          Length = 239

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 128/187 (68%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K   +YTRTGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   ++
Sbjct: 48  KIPKIYTRTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELTAEKGHAFAEE 107

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L +IQC L +VG+ +ATP +S+  + L  T+F+E     LE WID   +QLPPL  FILP
Sbjct: 108 LQKIQCALQDVGAALATPSSSAREAHLKRTAFEEGPTLELEQWIDKYSSQLPPLTAFILP 167

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E +
Sbjct: 168 SGGKSSSALHFCRAVCRRAERRVVPLVQMGETDVNVAKFLNRLSDYLFTVARYAAMREGN 227

Query: 193 IENYYEQ 199
            E  Y++
Sbjct: 228 QEKIYKK 234



>gi|118601860|ref|NP_001073100.1| cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           precursor [Bos taurus]
 gi|75057625|sp|Q58D49.1|MMAB_BOVIN RecName: Full=Cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial; AltName: Full=Cob(I)alamin
           adenosyltransferase; AltName: Full=Methylmalonic
           aciduria type B homolog; Flags: Precursor
 gi|61554665|gb|AAX46595.1| cob(I)alamin adenosyltransferase [Bos taurus]
          Length = 241

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 128/188 (68%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERRSKDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PKVPKIYTKTGDKGFSSTFTGERRSKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFVE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L   +F+   +  LE WID    QLPPL  FIL
Sbjct: 107 ELQKIQCSLQDVGSALATPRSSAREAHLKHATFEAGPILELEQWIDKYSRQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY AM E 
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDANVVKFLNRLSDYLFTLARYTAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NPEKIYKK 234



>gi|340378569|ref|XP_003387800.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Amphimedon queenslandica]
          Length = 208

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/184 (53%), Positives = 130/184 (70%), Gaps = 1/184 (0%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGDKG SS + G+R  KDD +F ALG+ DELSSS+G+A  +C      L DKL EI
Sbjct: 26  IYTRTGDKGTSSNYAGQRLPKDDALFEALGSNDELSSSLGLAREFCVPQST-LPDKLQEI 84

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           QC L ++GS++ATPR+S+  +KL+ T F   +V  LE WID LD+QLPPL NFILPSGG+
Sbjct: 85  QCLLQDIGSHLATPRSSATPTKLAHTEFSMSHVTKLEKWIDELDDQLPPLTNFILPSGGK 144

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           ++ FLH  R++CRR ER  VPL      +++V KYLNRLSDF F AAR+ A  E+  E  
Sbjct: 145 ASSFLHLSRTICRRTERRVVPLYRDGQVDEAVFKYLNRLSDFLFNAARFEAQLEEKEEVI 204

Query: 197 YEQR 200
           Y+++
Sbjct: 205 YQRK 208



>gi|57105918|ref|XP_543436.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Canis lupus familiaris]
          Length = 239

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 128/188 (68%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A  +  + G+   +
Sbjct: 47  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALEFITEKGHPFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATP +S+  + L   +F+   +  LE WID   NQLPPL  FIL
Sbjct: 107 ELQKIQCSLQDVGSALATPHSSAREAHLRHATFEAGPILELEQWIDKYSNQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY AM E 
Sbjct: 167 PSGGKSSCALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYVAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKIYKK 234



>gi|340376903|ref|XP_003386970.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Amphimedon queenslandica]
          Length = 213

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/184 (53%), Positives = 129/184 (70%), Gaps = 1/184 (0%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGDKG SS + G+R  KDD +F ALG+ DELSSS+G+A  +C      L DKL EI
Sbjct: 31  IYTRTGDKGTSSNYAGQRLPKDDALFEALGSNDELSSSLGLAREFCGPQST-LPDKLQEI 89

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           QC L ++GS++ATPR+S+  +KL+ T F   +V  LE WID LD+QLPPL NFILPSGG+
Sbjct: 90  QCLLQDIGSHLATPRSSATPTKLAHTDFSMSHVTKLEKWIDELDDQLPPLTNFILPSGGK 149

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           ++ FLH  R++CRR ER  VPL      +++V KYLNRLSDF F AAR+ A  E   E  
Sbjct: 150 ASSFLHLSRTICRRTERRVVPLYRDGQVDEAVFKYLNRLSDFLFNAARFEAQLEGKEEVI 209

Query: 197 YEQR 200
           Y+++
Sbjct: 210 YQRK 213



>gi|511919890|ref|XP_004779177.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X3 [Mustela putorius furo]
 gi|512015443|ref|XP_004825042.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X3 [Mustela putorius furo]
          Length = 241

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 99/188 (52%), Positives = 129/188 (68%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERRSKDD VF A+G  DELSS+IG A  +  + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRSKDDQVFEAVGATDELSSAIGFALEFITEKGHPFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATP +S+  + L   +F+   +  LE WID   +QLPPL  FIL
Sbjct: 107 ELQKIQCLLQDVGSALATPHSSAREAHLRHATFEAGCILELEQWIDKYSSQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKSSSVLHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NQEKIYKK 234



>gi|225703716|gb|ACO07704.1| CobIyrinic acid a,c-diamide adenosyltransferase, mitochondrial
           precursor [Oncorhynchus mykiss]
          Length = 234

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 101/195 (51%), Positives = 129/195 (66%), Gaps = 3/195 (1%)

Query: 5   TDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK 64
           TD  +  PK   +YT+TGDKG SS + GERR K+D VF ALGT DELSS+IG+A  +C  
Sbjct: 41  TDGESRIPK---IYTKTGDKGFSSTYTGERRPKEDHVFEALGTTDELSSAIGLAREFCID 97

Query: 65  AGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLP 124
            G+   D+L +IQC L +VGSNIATP++S+    +  T F  + V  LE WID    +LP
Sbjct: 98  KGHTFTDQLDKIQCVLQDVGSNIATPQSSAREIHIKTTKFSSQPVADLEGWIDEFTEKLP 157

Query: 125 PLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           PL NFILPSGG+S+  LH  R+VCRRAER   P+V +   +  V KYLNRLSD+ F  AR
Sbjct: 158 PLTNFILPSGGKSSAALHIARTVCRRAERSVSPIVRSGEADPDVAKYLNRLSDYLFTVAR 217

Query: 185 YAAMFEKHIENYYEQ 199
           Y AM E + E  Y++
Sbjct: 218 YTAMKEGNEETIYKR 232



>gi|472393941|ref|XP_004416232.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Odobenus rosmarus divergens]
          Length = 241

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 98/201 (48%), Positives = 133/201 (66%), Gaps = 5/201 (2%)

Query: 4   MTDDNNPK-----PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVA 58
           + D + P+     PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A
Sbjct: 34  VQDGDGPQSSLKTPKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAMGTTDELSSAIGFA 93

Query: 59  NHYCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDN 118
             +  + G+   ++L ++QC L +VGS +ATPR+S+  + L   +F+   +  LE WID 
Sbjct: 94  LEFITEEGHPFAEELRKVQCSLQDVGSALATPRSSAREAHLRHAAFEAGPILELEQWIDK 153

Query: 119 LDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDF 178
             +QLPPL  FILPSGG+ +  LH CR+VCRRAER  +PLV+   T+ +V K+LNRLSD+
Sbjct: 154 YSSQLPPLTAFILPSGGKGSSALHVCRAVCRRAERRVLPLVQMGETDANVAKFLNRLSDY 213

Query: 179 FFVAARYAAMFEKHIENYYEQ 199
            F  ARY AM E + E  Y++
Sbjct: 214 LFTLARYTAMREGNQEKIYKK 234



>gi|402887604|ref|XP_003907179.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Papio anubis]
          Length = 244

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 131/195 (67%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAVELVTEKGHIFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L +++F+   +  LE WID    QLPPL  FIL
Sbjct: 107 ELQKIQCTLQDVGSALATPRSSAREAHLKYSTFEAGPILELEQWIDKYTCQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 227 NQEKIYKKNDPSAES 241



>gi|225715754|gb|ACO13723.1| CobIyrinic acid a,c-diamide adenosyltransferase, mitochondrial
           precursor [Esox lucius]
          Length = 233

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 98/183 (53%), Positives = 125/183 (68%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG SS F GERR K+D VF ALGT DELSS+IG+A  +C   G+   D+L +I
Sbjct: 49  IYTKTGDKGFSSTFTGERRPKEDHVFEALGTTDELSSAIGLAREFCIDKGHTFTDQLDKI 108

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           QC L +VGSNIATPR+S+  S +  T F  + V  LESWID    +LPPL NFILPSGG+
Sbjct: 109 QCVLQDVGSNIATPRSSARESHIKKTKFSPQPVADLESWIDAFTEELPPLTNFILPSGGK 168

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           S+  LH  R+VCRRAER   P+V +   +  V  +LNRLSD+ F  ARY A+ E + E  
Sbjct: 169 SSAALHIARTVCRRAERSVSPIVRSGEADPDVATFLNRLSDYLFTVARYTALKEGNEEKI 228

Query: 197 YEQ 199
           Y++
Sbjct: 229 YKR 231



>gi|84708849|gb|AAI11195.1| Methylmalonic aciduria (cobalamin deficiency) cblB type [Bos
           taurus]
          Length = 241

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 99/188 (52%), Positives = 126/188 (67%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERRSKDD VF A+GT DELSS+IG       + G    +
Sbjct: 47  PKVPKIYTKTGDKGFSSTFTGERRSKDDQVFEAVGTTDELSSAIGFVMELIAEKGQPFVE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L   +F+   +  LE WID    QLPPL  FIL
Sbjct: 107 ELQKIQCSLQDVGSALATPRSSAREAHLKHATFEAGPILELEQWIDKYSRQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY AM E 
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDANVVKFLNRLSDYLFTLARYTAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NPEKIYKK 234



>gi|300122503|emb|CBK23073.2| Cobalamin adenosyltransferase [Blastocystis hominis]
          Length = 248

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 128/190 (67%), Gaps = 11/190 (5%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           +KS +YT+TGDKG SSL+NGERR K DDVF ALG  DEL+S  G A  Y + + NGL  K
Sbjct: 23  RKSGIYTKTGDKGSSSLYNGERRKKYDDVFQALGNTDELNSFTGFARGYAEASNNGLAPK 82

Query: 73  LVE-----------IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDN 121
           L+E           IQ +L ++G+ IATP   S+++K+  T F E+N+  LE WID LD+
Sbjct: 83  LIEVFFLKFLHYQQIQSRLFDLGAAIATPPKRSSSNKVEKTKFPEDNITTLEKWIDELDS 142

Query: 122 QLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFV 181
           QLPPLK F +P+       L  CRS+CRRAER  VPLVE +  + +V +YLNRLSDFF+V
Sbjct: 143 QLPPLKTFTIPTSAPGGASLQMCRSICRRAERSVVPLVERDEVDSAVQRYLNRLSDFFYV 202

Query: 182 AARYAAMFEK 191
           A+R++  F+K
Sbjct: 203 ASRWSVEFDK 212



>gi|126324807|ref|XP_001378495.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Monodelphis domestica]
          Length = 247

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 101/188 (53%), Positives = 126/188 (67%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K   +YT+TGDKG SS F GERR K+D VF ALGT DELSS+IG A     + G+   D+
Sbjct: 52  KIPKIYTKTGDKGFSSTFTGERRLKNDQVFEALGTTDELSSAIGFAIEVITEKGHTFVDE 111

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L ++QC+L + G+ IATP  S+  + L  T+F E+ V  LE  ID    QLPPL  FILP
Sbjct: 112 LEQVQCRLQDAGAAIATPLPSAREAHLKRTAFSEDAVLDLERRIDVYTGQLPPLTAFILP 171

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG+S+  LH CR+VCRRAER  VPLV+A  T+ SV ++LNRLSD+ F  ARYAAM E  
Sbjct: 172 SGGQSSAVLHLCRAVCRRAERSVVPLVQAGQTDASVARFLNRLSDYLFTLARYAAMKEGK 231

Query: 193 IENYYEQR 200
            E  Y +R
Sbjct: 232 EEKIYRRR 239



>gi|478511817|ref|XP_004430175.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Ceratotherium simum simum]
          Length = 240

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/199 (49%), Positives = 130/199 (65%), Gaps = 5/199 (2%)

Query: 6   DDNNPKPKKSN-----VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANH 60
           D + P+P         +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A  
Sbjct: 35  DGDRPQPSSKTPNLPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAIE 94

Query: 61  YCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLD 120
              + G+   ++L ++QC L ++GS +ATP +S+  + L   +F    V  LE WID   
Sbjct: 95  LIAEKGHPFAEELQKVQCSLQDIGSALATPHSSAREAHLKHAAFGAGPVLELEQWIDKYS 154

Query: 121 NQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFF 180
           +QLPPL  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F
Sbjct: 155 SQLPPLTAFILPSGGKSSSALHLCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLF 214

Query: 181 VAARYAAMFEKHIENYYEQ 199
             ARYAAM E + E  Y++
Sbjct: 215 TVARYAAMKEGNQEKIYKK 233



>gi|127802458|gb|AAH05054.2| Methylmalonic aciduria (cobalamin deficiency) cblB type [Homo
           sapiens]
 gi|189069152|dbj|BAG35490.1| unnamed protein product [Homo sapiens]
          Length = 250

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 130/195 (66%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 53  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAE 112

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATP +S+  + L +T+F    +  LE WID   +QLPPL  FIL
Sbjct: 113 ELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFIL 172

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 173 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 232

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 233 NQEKIYKKNDPSAES 247



>gi|119618275|gb|EAW97869.1| methylmalonic aciduria (cobalamin deficiency) cblB type [Homo
           sapiens]
          Length = 250

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 130/195 (66%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 53  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAE 112

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATP +S+  + L +T+F    +  LE WID   +QLPPL  FIL
Sbjct: 113 ELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFIL 172

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 173 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 232

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 233 NQEKIYKKNDPSAES 247



>gi|281209783|gb|EFA83951.1| hypothetical protein PPL_03021 [Polysphondylium pallidum PN500]
          Length = 215

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 136/196 (69%), Gaps = 1/196 (0%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           +DN    K+S +YT+TGDKG SSLFNGER+ KDDD FNALG +DEL++S+GVA  YC   
Sbjct: 17  EDNGEDLKRSRLYTKTGDKGYSSLFNGERKPKDDDFFNALGNIDELNASLGVALEYCMID 76

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
            NGL+D + +IQ  +++VG+  ATP ++S  S +  T F +++V +LE WID LD++LPP
Sbjct: 77  NNGLQDYIEKIQSLMLDVGACCATPLDTSKDSHIQKTKFSDQHVIVLERWIDLLDSKLPP 136

Query: 126 LKNFILPSG-GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           LKNFI+P G G ++  LH  R++CRRAER    L   +V  ++V  ++NRLSDF F A R
Sbjct: 137 LKNFIVPCGVGLASSHLHLSRAICRRAERSICSLSRHQVIPENVSVFMNRLSDFLFAACR 196

Query: 185 YAAMFEKHIENYYEQR 200
           YAAM     E  +++R
Sbjct: 197 YAAMKSGKNETLWKKR 212



>gi|16418349|ref|NP_443077.1| cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           precursor [Homo sapiens]
 gi|38258221|sp|Q96EY8.1|MMAB_HUMAN RecName: Full=Cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial; AltName: Full=Cob(I)alamin
           adenosyltransferase; AltName: Full=Methylmalonic
           aciduria type B protein; Flags: Precursor
 gi|15080110|gb|AAH11831.1| Methylmalonic aciduria (cobalamin deficiency) cblB type [Homo
           sapiens]
 gi|26284726|gb|AAN85091.1| cob(I)alamin adenosyltransferase [Homo sapiens]
 gi|239740430|gb|ACS13749.1| cob [Homo sapiens]
 gi|325464215|gb|ADZ15878.1| methylmalonic aciduria (cobalamin deficiency) cblB type [synthetic
           construct]
          Length = 250

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 129/195 (66%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 53  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAE 112

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATP +S+  + L +T+F    +  LE WID   +QLPPL  FIL
Sbjct: 113 ELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFIL 172

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 173 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 232

Query: 192 HIENYYEQRRDDRES 206
           + E  Y +     ES
Sbjct: 233 NQEKIYMKNDPSAES 247



>gi|109098680|ref|XP_001097465.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Macaca mulatta]
          Length = 244

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 130/195 (66%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAVELVTEKGHIFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L +T+F+   +  LE WID    QL PL  FIL
Sbjct: 107 ELQKIQCTLQDVGSALATPRSSAREAHLKYTTFESGPILELEQWIDKYTCQLAPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 167 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEG 226

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 227 NQEKIYKKNDPSAES 241



>gi|431894096|gb|ELK03897.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           [Pteropus alecto]
          Length = 248

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 130/197 (65%), Gaps = 9/197 (4%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG A     + G+   +
Sbjct: 45  PKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELAMEKGHSFAE 104

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L ++QC L +VGS +ATPR+S+  + L  T+F+   +  LE WID   +QLPPL  FIL
Sbjct: 105 ELEKVQCLLQDVGSALATPRSSAREAHLRHTAFEARPIQELEQWIDKYSSQLPPLTAFIL 164

Query: 132 P---------SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVA 182
           P         SGG+S+  LH CR+VCRRAER  VPL++   T+ +V K+LNRLSD+ F  
Sbjct: 165 PVATLSFSFQSGGKSSSALHFCRAVCRRAERRVVPLIQMGETDANVAKFLNRLSDYLFTL 224

Query: 183 ARYAAMFEKHIENYYEQ 199
           ARYAA+ E + E  Y++
Sbjct: 225 ARYAALKEGNQEKIYKK 241



>gi|281212393|gb|EFA86553.1| hypothetical protein PPL_00354 [Polysphondylium pallidum PN500]
          Length = 288

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 131/204 (64%), Gaps = 11/204 (5%)

Query: 5   TDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK 64
           T    P+PKK  +YT+TGDKG SSLFNGERR KDD +FN LG +DELS+ IG++  + K 
Sbjct: 43  TTSTKPEPKKIKIYTKTGDKGTSSLFNGERRPKDDQIFNVLGDLDELSAHIGLSIDFIKM 102

Query: 65  A--------GNGLEDK---LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILE 113
                     N L +K   L EIQC L+++GS++ATPR SS  + L  T F E+N+  LE
Sbjct: 103 NTLSSKEVDSNQLVEKIKELEEIQCLLLDLGSHVATPRESSPDAHLRRTEFSEDNITRLE 162

Query: 114 SWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLN 173
           + ID +D  LPPL+NFILP G   +  LH CRSVCRR ER  VPL+  E  + +  KY+N
Sbjct: 163 AQIDQIDQSLPPLRNFILPGGNVVSSQLHVCRSVCRRCERHLVPLLIGEYIDAAANKYIN 222

Query: 174 RLSDFFFVAARYAAMFEKHIENYY 197
           RLSD+FF  ARYA+      E+ Y
Sbjct: 223 RLSDYFFTLARYASFVNNSPESIY 246



>gi|466066211|ref|XP_004281435.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Orcinus orca]
          Length = 241

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 128/188 (68%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PKLPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFVE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L   +F+   +  LE WID   +QLP L  FIL
Sbjct: 107 ELQKIQCSLQDVGSALATPRSSAREAHLKHATFEAGPILELEQWIDRYSSQLPLLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV++  T+ +V K+LNRLSD+ F  ARY AM E 
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQSGETDANVAKFLNRLSDYLFTLARYTAMKEG 226

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 227 NPEKIYKK 234



>gi|426247796|ref|XP_004017662.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Ovis aries]
          Length = 232

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 126/188 (67%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 38  PKVPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFVE 97

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATP +S+  + L   +F+   +  LE WID    QLPPL  FIL
Sbjct: 98  ELQKIQCSLQDVGSALATPSSSAREAHLKHATFEAGPILELERWIDRYSRQLPPLTAFIL 157

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY AM E 
Sbjct: 158 PSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDANVVKFLNRLSDYLFTLARYTAMKEG 217

Query: 192 HIENYYEQ 199
           + E  Y++
Sbjct: 218 NPEKIYKK 225



>gi|126030727|pdb|2IDX|A Chain A, Structure Of Human Atp:cobalamin Adenosyltransferase Bound
           To Atp.
 gi|126030728|pdb|2IDX|B Chain B, Structure Of Human Atp:cobalamin Adenosyltransferase Bound
           To Atp.
 gi|126030729|pdb|2IDX|C Chain C, Structure Of Human Atp:cobalamin Adenosyltransferase Bound
           To Atp.
          Length = 196

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/191 (51%), Positives = 127/191 (66%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE 75
            +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   ++L +
Sbjct: 3   KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQK 62

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQC L +VGS +ATP +S+  + L +T+F    +  LE WID   +QLPPL  FILPSGG
Sbjct: 63  IQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGG 122

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIEN 195
           + +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E + E 
Sbjct: 123 KISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEK 182

Query: 196 YYEQRRDDRES 206
            Y +     ES
Sbjct: 183 IYMKNDPSAES 193



>gi|443719133|gb|ELU09408.1| hypothetical protein CAPTEDRAFT_175326 [Capitella teleta]
          Length = 204

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 122/193 (63%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K   +YTR+GDKG SS F GERR KDD +F ALG  DEL+SSIG+A  +C++A +   +K
Sbjct: 6   KPPRIYTRSGDKGTSSTFTGERRPKDDRLFEALGATDELNSSIGLAREFCEEANHPFTEK 65

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L ++QC L ++GS IATPR ++    L  T F +E++  LE WID     LPPL NFILP
Sbjct: 66  LEQVQCILQDIGSTIATPRPTARDVHLRKTEFSKEHIADLEKWIDEYTESLPPLTNFILP 125

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG ++  LH  RS+CRR ER  +PLV     +    KYLNRLSDF F  AR AA+ +  
Sbjct: 126 SGGRASASLHMARSICRRTERRVIPLVREGQVDSMPAKYLNRLSDFLFTVARIAAVKDAK 185

Query: 193 IENYYEQRRDDRE 205
            E  Y +   D E
Sbjct: 186 GEKIYRRPNKDSE 198



>gi|348528397|ref|XP_003451704.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Oreochromis niloticus]
          Length = 234

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/195 (49%), Positives = 128/195 (65%), Gaps = 3/195 (1%)

Query: 5   TDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK 64
           T ++N  PK   +YT+TGDKG SS F GERR K+D +F ALG  DELSS+IG+A  +C  
Sbjct: 41  TGEDNRVPK---IYTKTGDKGFSSTFTGERRPKEDHIFEALGNTDELSSAIGLAREFCLD 97

Query: 65  AGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLP 124
            G+    +L +IQC L +VGSNIATPR+S+  S +  T F  +    LE+WID    +LP
Sbjct: 98  KGHTFTHQLDKIQCVLQDVGSNIATPRSSARESHIKRTKFIAQPTADLETWIDEFTEELP 157

Query: 125 PLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           PL +FILPSGG+S+  LH  R+VCRRAER   P+V +   +  V K+LNRLSD+ F  AR
Sbjct: 158 PLTSFILPSGGKSSAALHLARTVCRRAERSVAPIVRSGEADPDVAKFLNRLSDYLFTVAR 217

Query: 185 YAAMFEKHIENYYEQ 199
           Y +M E   E  Y++
Sbjct: 218 YVSMKEGSEEKIYKR 232



>gi|307111325|gb|EFN59559.1| hypothetical protein CHLNCDRAFT_49309 [Chlorella variabilis]
          Length = 194

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 122/184 (66%), Gaps = 2/184 (1%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG--LEDKL 73
            +YT+TGD G SSL++GERR KDD VF ALG VDE++S++G+A  + ++      L  +L
Sbjct: 2   KIYTKTGDGGASSLYSGERRPKDDAVFAALGDVDEVNSTLGLAREHARQLAGAMRLAQQL 61

Query: 74  VEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPS 133
             IQ +L +VGS +ATPR +S+  KL   +F E +   LE WID +  +LPPL  FILPS
Sbjct: 62  EVIQSRLFDVGSAVATPRPTSSDHKLQRVAFSEAHAAQLERWIDEMMEELPPLTQFILPS 121

Query: 134 GGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHI 193
           GG +A  LH  RSVCRRAER  VPLV  + TE +V  YLNRLSD+ F AARYAA+     
Sbjct: 122 GGLAAAALHMSRSVCRRAERAVVPLVRDQATEAAVAIYLNRLSDYLFTAARYAALKAGEP 181

Query: 194 ENYY 197
           E  +
Sbjct: 182 ETVW 185



>gi|498956365|ref|XP_004544597.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Maylandia zebra]
          Length = 234

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/195 (49%), Positives = 130/195 (66%), Gaps = 3/195 (1%)

Query: 5   TDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK 64
           T ++N  PK   +YT+TGDKG SS F GERR K+D +F ALG  DELSS+IG+A  +C  
Sbjct: 41  TGEDNRVPK---IYTKTGDKGFSSTFTGERRPKEDHIFEALGNTDELSSAIGLAREFCLD 97

Query: 65  AGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLP 124
             +    +L +IQC L +VGSNIATPR+S+  S +  T F  + +  LE+WID    +LP
Sbjct: 98  KRHTFTHQLDKIQCVLQDVGSNIATPRSSARESHIKRTKFIAQPIVDLETWIDQFTEELP 157

Query: 125 PLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           PL +FILPSGG+S+  LH  R+VCRRAER   P+V++   +  V K+LNRLSD+ F  AR
Sbjct: 158 PLTSFILPSGGKSSAALHLARTVCRRAERSVAPIVQSGEADPDVAKFLNRLSDYLFTVAR 217

Query: 185 YAAMFEKHIENYYEQ 199
           YA+M E   E  Y++
Sbjct: 218 YASMKEGSEEKIYKR 232



>gi|47226512|emb|CAG08528.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 208

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 94/196 (47%), Positives = 132/196 (67%), Gaps = 3/196 (1%)

Query: 4   MTDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK 63
           +T+ +N  PK   +YT+TGDKG SS F GERR K+D +F ALG  DELSS++G+A  +C 
Sbjct: 15  VTEGDNRIPK---IYTKTGDKGFSSTFTGERRPKEDHIFEALGNTDELSSALGLAREFCL 71

Query: 64  KAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQL 123
            +G+    +L +IQC L+++GSNIATPR+S+  S +  T F  +  + LE W+D    +L
Sbjct: 72  DSGHTFTHQLDKIQCILLDIGSNIATPRSSARESHMQRTRFTAQPTSDLEIWMDEFTAEL 131

Query: 124 PPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAA 183
           PPL NFI+PSGG+S+  LH  R+VCRRAER  V +V +   +  V ++LNRLSD+ F  A
Sbjct: 132 PPLTNFIIPSGGKSSAALHFARTVCRRAERSVVSIVRSGEADPEVARFLNRLSDYLFTLA 191

Query: 184 RYAAMFEKHIENYYEQ 199
           R+AAM E   E  Y++
Sbjct: 192 RFAAMKEGRDEKIYKK 207



>gi|145356590|ref|XP_001422511.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144582754|gb|ABP00828.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 198

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 127/191 (66%)

Query: 9   NPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG 68
           +   ++  +YT+TGD G SSL+N ERR KDD  F+ALG VDE + + G+A  +C    NG
Sbjct: 4   DASTRRFKIYTKTGDAGTSSLYNCERRDKDDAAFDALGDVDECNVACGIAREFCVDENNG 63

Query: 69  LEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKN 128
           LE +L EIQ +L++VGS +ATP  +S+ +  +  +F E +V  LE WID +D +LP L +
Sbjct: 64  LEAQLAEIQSRLLDVGSAVATPLYASSDAMKARAAFSETHVETLEGWIDGMDAELPALSS 123

Query: 129 FILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAM 188
           F+L SGG+++VFLHQ R VCRRAER  VPLV +      V  YLNRLSD+ F AAR+AAM
Sbjct: 124 FLLVSGGKASVFLHQARVVCRRAERRCVPLVRSGAVPDVVRVYLNRLSDYMFTAARFAAM 183

Query: 189 FEKHIENYYEQ 199
                E  Y++
Sbjct: 184 KAGREEEAYKK 194



>gi|225709746|gb|ACO10719.1| CobIyrinic acid a,c-diamide adenosyltransferase, mitochondrial
           precursor [Caligus rogercresseyi]
          Length = 259

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 128/207 (61%), Gaps = 6/207 (2%)

Query: 7   DNNPK-PKKSN----VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHY 61
           D  PK P+K++    +YTRTGD G SSL+ GERR K D +F+ALGT DELSS IG+A  Y
Sbjct: 33  DEKPKSPRKASKYPRIYTRTGDGGNSSLYTGERRPKSDGIFDALGTTDELSSHIGLAYSY 92

Query: 62  CKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDN 121
             +  +   D L  IQC L ++GSNIATPR+S+    L    F+  +   LE WID    
Sbjct: 93  AAENRHPYLDHLERIQCLLQDIGSNIATPRSSAREVHLRKVEFNPRHTQELEEWIDEYSK 152

Query: 122 QLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFV 181
            L PLKNFILP GG+++  LH  RSVCRRAER   PLV  E  +    KYLNRLSDF F 
Sbjct: 153 SLLPLKNFILPGGGKTSASLHVARSVCRRAERTVAPLVAGEQVDPEALKYLNRLSDFLFT 212

Query: 182 AARYAAMFEKHIENYYEQRRDDRESNL 208
            +R+AA  +K  E  Y Q  ++ ESN 
Sbjct: 213 ISRFAARLDKMEETIYTQPGEE-ESNF 238



>gi|159488232|ref|XP_001702121.1| flagellar associated protein, cobalamin adenosyltransferase-like
           protein [Chlamydomonas reinhardtii]
 gi|158271390|gb|EDO97210.1| flagellar associated protein, cobalamin adenosyltransferase-like
           protein [Chlamydomonas reinhardtii]
          Length = 189

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 123/186 (66%), Gaps = 1/186 (0%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTR+GD G++SLFNGER  KDDDVF ALG VDEL+S++GVA++  +         L  I
Sbjct: 3   IYTRSGDAGQASLFNGERLYKDDDVFQALGDVDELNSALGVADYAAQFCAASWRSSLETI 62

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSF-DEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           Q +LI+VGS +ATP  +S+  KL  T F  +E+   LE+WID +D  LP L  FILPSGG
Sbjct: 63  QSRLIDVGSAVATPLPTSDEDKLQRTHFAGKEHTEQLEAWIDAMDEDLPKLTKFILPSGG 122

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIEN 195
           ++A  LH  RSVCRRAER  V L   +     V  Y+NRLSD+ F AAR+AAM +  +E 
Sbjct: 123 QAAACLHHARSVCRRAERSVVVLSRRQAVSSEVNMYVNRLSDYLFTAARHAAMTQGAVEK 182

Query: 196 YYEQRR 201
            Y++ R
Sbjct: 183 VYQKAR 188



>gi|225709676|gb|ACO10684.1| CobIyrinic acid a,c-diamide adenosyltransferase, mitochondrial
           precursor [Caligus rogercresseyi]
          Length = 259

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 127/207 (61%), Gaps = 6/207 (2%)

Query: 7   DNNPK-PKKSN----VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHY 61
           D  PK P+K++    +YTRTGD G SSL+ GERR K D +F+ALGT DELSS IG+A  Y
Sbjct: 33  DEKPKSPRKASKYPRIYTRTGDGGNSSLYTGERRPKSDGIFDALGTTDELSSHIGLAYSY 92

Query: 62  CKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDN 121
             +  +   D L  IQC L ++G NIATPR+S+    L    F+  +   LE WID    
Sbjct: 93  AAENQHPYLDHLERIQCLLQDIGPNIATPRSSAREVHLRKVEFNPRHTQELEEWIDEYSK 152

Query: 122 QLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFV 181
            L PLKNFILP GG+++  LH  RSVCRRAER   PLV  E  +    KYLNRLSDF F 
Sbjct: 153 SLLPLKNFILPGGGKTSASLHVARSVCRRAERTVAPLVAGEQVDPEALKYLNRLSDFLFT 212

Query: 182 AARYAAMFEKHIENYYEQRRDDRESNL 208
            +R+AA  +K  E  Y Q  ++ ESN 
Sbjct: 213 ISRFAARLDKMEETIYTQPGEE-ESNF 238



>gi|147904736|ref|NP_001089764.1| methylmalonic aciduria (cobalamin deficiency) cblB type [Xenopus
           laevis]
 gi|76779990|gb|AAI06514.1| MGC131263 protein [Xenopus laevis]
          Length = 227

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 99/191 (51%), Positives = 125/191 (65%), Gaps = 1/191 (0%)

Query: 8   NNPKPKK-SNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG 66
           + PK  K   +YT+TGDKG SS + GERR KDD +F ALG  DELSS+IG+A  +  +A 
Sbjct: 33  DGPKTTKVPKIYTKTGDKGFSSTYTGERRPKDDLLFKALGDTDELSSAIGLAREFSLEAN 92

Query: 67  NGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPL 126
           +    +L +IQC L +VGSNIATP +S+  S    TSF  E V  LE WID   +QLPPL
Sbjct: 93  HVFVSELEKIQCMLQDVGSNIATPLSSARESHKVRTSFSAEPVRELEEWIDKYSSQLPPL 152

Query: 127 KNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
            NFILPSGG+++  LH  R+VCRRAER    +++    +++VGKYLNRLSD  F  ARYA
Sbjct: 153 TNFILPSGGKTSAALHVARAVCRRAERKVFKIIQTGEADENVGKYLNRLSDCLFTLARYA 212

Query: 187 AMFEKHIENYY 197
           A  E   E  Y
Sbjct: 213 AQAEGRKETVY 223



>gi|512811818|ref|XP_002932128.2| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Xenopus (Silurana) tropicalis]
          Length = 230

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 125/191 (65%), Gaps = 1/191 (0%)

Query: 8   NNPKPKK-SNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG 66
           + PK  K   +YT+TGDKG SS + GERR KDD +F ALG  DEL+S+IG+A  +   A 
Sbjct: 36  DGPKTTKVPKIYTKTGDKGFSSTYTGERRPKDDLLFEALGDTDELNSAIGLAREFSLDAN 95

Query: 67  NGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPL 126
           +    +L +IQC L +VGSNIATP +S+  S    TSF  E V  LE WID   +QLPPL
Sbjct: 96  HIFVPELEKIQCMLQDVGSNIATPLSSARESHKVRTSFSAEPVQELEQWIDKYTSQLPPL 155

Query: 127 KNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
            NFILPSGG+++  LH  R+VCRRAER    +++A   +Q+VGKYLNRLSD  F  ARYA
Sbjct: 156 TNFILPSGGKTSAALHVARAVCRRAERKVFKVIQAGEADQNVGKYLNRLSDCLFTLARYA 215

Query: 187 AMFEKHIENYY 197
           A  E   E  Y
Sbjct: 216 AQAEGRKETVY 226



>gi|390353303|ref|XP_784498.3| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Strongylocentrotus purpuratus]
          Length = 286

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 126/194 (64%), Gaps = 1/194 (0%)

Query: 7   DNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG 66
           D  P  K   +YTRTGDKG S    G+RR K+D VF ALG  DELSS IG+A  + +++ 
Sbjct: 86  DKRPDRKLPKIYTRTGDKGTSVTIAGDRRPKNDIVFEALGATDELSSHIGLAREFVQESN 145

Query: 67  -NGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
            +    +L EIQC L + GSNIATP++ ++ ++L  T F+   V +LE+WID +   LPP
Sbjct: 146 LSATNLQLEEIQCILQDAGSNIATPKSLASKNQLDMTGFNGATVEMLETWIDEMTTMLPP 205

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           L+NFILPSGG+S+  +H  RSVCRRAER   PL  ++  + +V +++NRLSD+ F AARY
Sbjct: 206 LRNFILPSGGKSSSAIHVARSVCRRAERSIAPLATSDEIDPAVARFINRLSDYLFTAARY 265

Query: 186 AAMFEKHIENYYEQ 199
            A  E   E  Y +
Sbjct: 266 VAQEEGKKETVYRR 279



>gi|470288691|ref|XP_004342649.1| cobalamin adenosyltransferase [Capsaspora owczarzaki ATCC 30864]
 gi|320166017|gb|EFW42916.1| cobalamin adenosyltransferase [Capsaspora owczarzaki ATCC 30864]
          Length = 262

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 139/228 (60%), Gaps = 43/228 (18%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYC----KKAGNG 68
           KKSN+YT+TGD+G SSL+ GERR+K   +FNALG VDEL+S++G+A  YC       G+G
Sbjct: 6   KKSNIYTKTGDQGTSSLYTGERRTKAHAIFNALGDVDELNSALGLARAYCVVPSTVTGSG 65

Query: 69  LEDK------LVE-IQCKLIEVGSNIATPR------NSSNTSK----------------- 98
            E +      L+E IQC L+E+GS+I TPR      + S+T+                  
Sbjct: 66  AESRKGQLVPLIEDIQCALLEIGSSIGTPRTWKAPQDESDTTPADQGVAAAGDDEEDPEE 125

Query: 99  -------LSFTSFDEENVNI--LESWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCR 149
                  L+ T+FD E V +  LE  ID  D+ LP L NFILPSGG ++  LH  RS+CR
Sbjct: 126 AAKRARMLASTAFDAEGVRLAALEHAIDLYDSLLPRLTNFILPSGGLASSHLHLARSICR 185

Query: 150 RAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYY 197
           RAER  VPL+++   E+SVGKYLNRLSDF FVAAR+AA  +   E  +
Sbjct: 186 RAERAVVPLLQSGAGEKSVGKYLNRLSDFLFVAARFAAQQDGQTEVVF 233



>gi|348676973|gb|EGZ16790.1| hypothetical protein PHYSODRAFT_285842 [Phytophthora sojae]
          Length = 227

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 99/184 (53%), Positives = 125/184 (67%), Gaps = 3/184 (1%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG-LEDKLVE 75
           VYT+TGDKG S LF+GERR K+D VF ALG  DEL++ IGVA    + A N  L  KL +
Sbjct: 28  VYTKTGDKGTSQLFSGERRPKNDAVFQALGDTDELNAQIGVAVEQARVAANAFLPPKLEQ 87

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTS-FDEENVNILESWIDNLDNQLPPLKNFILPSG 134
           IQ +L ++G+ +ATP  S++ +K   T  FDE NV  LE WID +D +LPPLK FILPSG
Sbjct: 88  IQSRLFDLGACVATPLTSASETKQRRTGVFDEANVTQLELWIDEMDAELPPLKCFILPSG 147

Query: 135 GE-SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHI 193
           G  ++  LH  R+VCRRAER  VPLV A   +  V +YLNRLSDF FV+AR+AA+ E   
Sbjct: 148 GGLASTHLHVARAVCRRAERSVVPLVAAGDVDGVVQRYLNRLSDFLFVSARFAALKEGKE 207

Query: 194 ENYY 197
           E  +
Sbjct: 208 ETKW 211



>gi|296478543|tpg|DAA20658.1| TPA: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial precursor [Bos taurus]
          Length = 213

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 116/167 (69%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERRSKDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PKVPKIYTKTGDKGFSSTFTGERRSKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFVE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L   +F+   +  LE WID    QLPPL  FIL
Sbjct: 107 ELQKIQCSLQDVGSALATPRSSAREAHLKHATFEAGPILELEQWIDKYSRQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDF 178
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDANVVKFLNRLSDY 213



>gi|281344189|gb|EFB19773.1| hypothetical protein PANDA_010179 [Ailuropoda melanoleuca]
          Length = 179

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 119/175 (68%)

Query: 25  GKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEIQCKLIEVG 84
           G SS F GERR KDD VF A+GT DELSS+IG A  +  + G+   ++L +IQC L +VG
Sbjct: 1   GFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALEFIAEKGHPFAEELRKIQCSLQDVG 60

Query: 85  SNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGESAVFLHQC 144
           S +ATPR+S+  + L   +F+   +  LE WID   +QLPPL  FILPSGG+S+  LH C
Sbjct: 61  SALATPRSSAREAHLRHATFEAGPILELEQWIDKYSSQLPPLTAFILPSGGKSSSVLHFC 120

Query: 145 RSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYYEQ 199
           R+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY AM E + E  Y++
Sbjct: 121 RAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYMAMKEGNQEKIYKK 175



>gi|428172775|gb|EKX41682.1| hypothetical protein GUITHDRAFT_159882 [Guillardia theta CCMP2712]
          Length = 224

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 94/193 (48%), Positives = 129/193 (66%), Gaps = 9/193 (4%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED- 71
           ++ +VYTRTGDKGKSSL+NGERR KDD +F+ALG +DEL+S++G+      K    +ED 
Sbjct: 24  RQVSVYTRTGDKGKSSLYNGERRRKDDKIFHALGDIDELNSAVGIGKEMIIK--EKVEDD 81

Query: 72  ----KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLK 127
               +L +IQC+L+++G++IATP +     K+     ++  V+ LE WID +D +LPPLK
Sbjct: 82  ILLARLEDIQCRLLDLGAHIATPTSEKTAEKVKRMKVEDVWVDDLELWIDEMDKELPPLK 141

Query: 128 NFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAE--VTEQSVGKYLNRLSDFFFVAARY 185
           NFILPSGG ++  LH  R+VCRRAER  V L + E  V + S  +YLNRLSDF FV+AR 
Sbjct: 142 NFILPSGGLASATLHNARTVCRRAERNVVALQQDEQAVIDASAVRYLNRLSDFLFVSARR 201

Query: 186 AAMFEKHIENYYE 198
            A      E  Y+
Sbjct: 202 CAKLAGKPEALYQ 214



>gi|485631532|gb|EOD26652.1| Cob(I)alamin adenosyltransferase [Emiliania huxleyi CCMP1516]
          Length = 247

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 109/219 (49%), Positives = 130/219 (59%), Gaps = 26/219 (11%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG------- 68
            VYTRTGDKGKSSLFNGERR KDD VF+ALG VDELS++IG+A  +C++   G       
Sbjct: 31  TVYTRTGDKGKSSLFNGERRRKDDVVFDALGAVDELSAAIGLARAHCEEGAAGCTKEEAV 90

Query: 69  ---------------LEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD-EENVNIL 112
                          L  +L   Q  L++VGS IATP+ SS+   L     D     ++L
Sbjct: 91  EASVAPAPGPAGLRWLLPQLEGAQRLLLDVGSAIATPQTSSSEKHLQRVGIDGAAEASVL 150

Query: 113 ESWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYL 172
           E+ ID +D QLPPL  FILP GG  A  LH  R+VCRR+ER  VPLVEA      VG YL
Sbjct: 151 EARIDTMDAQLPPLTVFILPGGGAPAAALHMSRAVCRRSERCVVPLVEAGDCPAEVGVYL 210

Query: 173 NRLSDFFFVAARYAAMFEKHIENYYEQRRDDRESNLVKR 211
           NRLSD+FFVAARYAA    H E   E+R DD+      R
Sbjct: 211 NRLSDYFFVAARYAAASAGHAE---ERRGDDKAGPATGR 246



>gi|513210414|ref|XP_004945682.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X7 [Gallus gallus]
 gi|513210417|ref|XP_004945683.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X8 [Gallus gallus]
          Length = 240

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 115/169 (68%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           +   P  +   +YTRTGD+G SS F GERR K D +F ALGT DELSS+IG+A+    + 
Sbjct: 36  EGGPPSARSPRIYTRTGDEGFSSTFTGERRPKGDRIFEALGTTDELSSAIGLASELSSEK 95

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L ++QC L +VGSNIATP +S+  + L  TSF EE +  LE WID    QLPP
Sbjct: 96  GHAFVEQLHKVQCMLQDVGSNIATPLSSAREAHLKRTSFSEEPILELEKWIDRYSEQLPP 155

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNR 174
           L+ FILPSGG+S+  LH  R+VCRRAER  VPLV+A   + +V KYLNR
Sbjct: 156 LRAFILPSGGKSSAALHFSRAVCRRAERCVVPLVQAGEADTNVAKYLNR 204



>gi|513234665|ref|XP_004949973.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X2 [Gallus gallus]
 gi|513234668|ref|XP_004949974.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X3 [Gallus gallus]
 gi|513235698|ref|XP_004950154.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X2 [Gallus gallus]
 gi|513235702|ref|XP_004950155.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X3 [Gallus gallus]
          Length = 240

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 115/169 (68%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           +   P  +   +YTRTGD+G SS F GERR K D +F ALGT DELSS+IG+A+    + 
Sbjct: 36  EGGPPSARSPRIYTRTGDEGFSSTFTGERRPKGDRIFEALGTTDELSSAIGLASELSSEK 95

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L ++QC L +VGSNIATP +S+  + L  TSF EE +  LE WID    QLPP
Sbjct: 96  GHAFVEQLHKVQCMLQDVGSNIATPLSSAREAHLKRTSFSEEPILELEKWIDRYSEQLPP 155

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNR 174
           L+ FILPSGG+S+  LH  R+VCRRAER  VPLV+A   + +V KYLNR
Sbjct: 156 LRAFILPSGGKSSAALHFSRAVCRRAERCVVPLVQAGEADPNVAKYLNR 204



>gi|512868251|ref|XP_004891657.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X4 [Heterocephalus glaber]
 gi|512962834|ref|XP_004843670.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X4 [Heterocephalus glaber]
          Length = 210

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 114/164 (69%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG A     + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELITEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L ++QC L +VGS +ATPR+S+  + L  T+F+   +  LE WIDN   QLPPL  FIL
Sbjct: 107 ELQKVQCTLQDVGSALATPRSSAREAHLKRTAFEAGPILQLEQWIDNYSRQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRL 175
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNR+
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRV 210



>gi|340376901|ref|XP_003386969.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like [Amphimedon queenslandica]
          Length = 202

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 123/180 (68%), Gaps = 2/180 (1%)

Query: 22  GDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEIQCKLI 81
           GDKG SS + G+R  KDD +F ALG+ DELSSS+G+A  +C      L DKL EIQC L 
Sbjct: 24  GDKGASSNYAGQRLPKDDALFEALGSNDELSSSLGLAREFCGPQST-LPDKLQEIQCLLQ 82

Query: 82  EVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGESAVFL 141
           ++GS++AT R+S+  +KL+ T F   +V  LE WID LD+QLPPL NFILPSGG+++ FL
Sbjct: 83  DIGSHLATLRSSATPTKLAHTEFSMSHVTKLEKWIDELDDQLPPLTNFILPSGGKASSFL 142

Query: 142 HQCRSVCRRAERVTVPLV-EAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYYEQR 200
           H  R++CRR ER  VPL  + ++  ++V KYL RLSDF F AA + A  E   E  Y+++
Sbjct: 143 HLSRTICRRTERRVVPLYRDGQIDAEAVFKYLKRLSDFLFNAAHFEAQLEGKEEVIYQRK 202



>gi|255087730|ref|XP_002505788.1| predicted protein [Micromonas sp. RCC299]
 gi|226521058|gb|ACO67046.1| predicted protein [Micromonas sp. RCC299]
          Length = 221

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 129/191 (67%), Gaps = 5/191 (2%)

Query: 14  KSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK---AGNGLE 70
           K  +YT+TGD G S LFN ERR KDDDVF ALG VDEL   +G+A  + ++       + 
Sbjct: 29  KFKLYTKTGDLGSSCLFNMERRDKDDDVFEALGDVDELGVCVGIARTFAEEHVTPDGEML 88

Query: 71  DKLVEIQCKLIEVGSNIATPRNSSNTS--KLSFTSFDEENVNILESWIDNLDNQLPPLKN 128
            +L+EIQ +L++VGS +ATP  SS+T+  K     F EE++  LE WID  D  LPPL  
Sbjct: 89  ARLLEIQSRLLDVGSAVATPLQSSSTAEWKARRVEFAEEHITRLEGWIDEYDESLPPLTT 148

Query: 129 FILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAM 188
           FILPSGG++AV LHQ R+VCRRAER  VPLV     +Q+VG+YLNRLSDF + AARYAA 
Sbjct: 149 FILPSGGKTAVHLHQARTVCRRAERRVVPLVRDGDCDQAVGRYLNRLSDFLYAAARYAAH 208

Query: 189 FEKHIENYYEQ 199
            E H E  Y++
Sbjct: 209 REGHEELPYKK 219



>gi|512868240|ref|XP_004891654.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X1 [Heterocephalus glaber]
 gi|512962828|ref|XP_004843667.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X1 [Heterocephalus glaber]
          Length = 263

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 89/163 (54%), Positives = 113/163 (69%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG A     + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELITEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L ++QC L +VGS +ATPR+S+  + L  T+F+   +  LE WIDN   QLPPL  FIL
Sbjct: 107 ELQKVQCTLQDVGSALATPRSSAREAHLKRTAFEAGPILQLEQWIDNYSRQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNR 174
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNR
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNR 209



>gi|321463410|gb|EFX74426.1| hypothetical protein DAPPUDRAFT_299621 [Daphnia pulex]
          Length = 240

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 117/181 (64%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD G +S F GERR+KDD++F ALG VDEL+S IG+A  +  + G+   D L  I
Sbjct: 54  IYTKTGDGGMTSTFTGERRAKDDNIFQALGAVDELASCIGLAREFGLENGHPYTDHLQRI 113

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           QC L +V + IATP +S+  + L  T FD  +V  +E WID+  + LPPL+NFILP GG+
Sbjct: 114 QCILQDVNACIATPYSSAREAHLKKTEFDSGHVEEVEEWIDSYTDHLPPLENFILPGGGK 173

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           ++  LH  R+VCRRAER  VP+V  +       KY+NRLSD  F  ARYAA  +   E  
Sbjct: 174 ASSSLHVARTVCRRAERAIVPIVREQQINPETLKYVNRLSDLLFTLARYAAKLDGRKETV 233

Query: 197 Y 197
           Y
Sbjct: 234 Y 234



>gi|26329841|dbj|BAC28659.1| unnamed protein product [Mus musculus]
 gi|148687964|gb|EDL19911.1| methylmalonic aciduria (cobalamin deficiency) type B homolog
           (human), isoform CRA_c [Mus musculus]
          Length = 257

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 90/162 (55%), Positives = 113/162 (69%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   ++
Sbjct: 48  KIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELVTEKGHMFAEE 107

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L +IQC L +VGS +ATPR+S+  + L  T+F E  V  LE WID   +QLPPLK FILP
Sbjct: 108 LQKIQCMLQDVGSALATPRSSAREAHLKHTAFQEGPVLELERWIDKYSSQLPPLKAFILP 167

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNR 174
           SGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNR
Sbjct: 168 SGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNR 209



>gi|512868247|ref|XP_004891656.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X3 [Heterocephalus glaber]
 gi|512962832|ref|XP_004843669.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X3 [Heterocephalus glaber]
          Length = 227

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 112/162 (69%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF ALGT DELSS+IG A     + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRPKDDQVFEALGTTDELSSAIGFAMELITEKGHTFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L ++QC L +VGS +ATPR+S+  + L  T+F+   +  LE WIDN   QLPPL  FIL
Sbjct: 107 ELQKVQCTLQDVGSALATPRSSAREAHLKRTAFEAGPILQLEQWIDNYSRQLPPLTAFIL 166

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLN 173
           PSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LN
Sbjct: 167 PSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLN 208



>gi|330790297|ref|XP_003283234.1| hypothetical protein DICPUDRAFT_146841 [Dictyostelium purpureum]
 gi|325086915|gb|EGC40298.1| hypothetical protein DICPUDRAFT_146841 [Dictyostelium purpureum]
          Length = 201

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 125/176 (71%), Gaps = 1/176 (0%)

Query: 14  KSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKL 73
           +S +YT+TGDKG S+LFNGERR K+D  F++LG +DELS+++G+A  +C    NGLE  L
Sbjct: 9   RSKLYTKTGDKGTSALFNGERRPKNDAFFHSLGAIDELSATLGIALEHCIIEKNGLESYL 68

Query: 74  VEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP- 132
            ++   ++++G+ +ATP ++S  S+++ T FD+  + ++ESWID +D++LPPLK FI+P 
Sbjct: 69  EKLIVVMLDIGACVATPLDNSKDSQINKTKFDDNRIKVIESWIDKVDSELPPLKCFIIPY 128

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAM 188
             G ++  LH  R+VCRRAER  V L       +SV  ++NRLSDF F AARYAAM
Sbjct: 129 RVGLASAHLHLARTVCRRAEREMVGLSRHSFIPESVSIFINRLSDFLFAAARYAAM 184



>gi|291239026|ref|XP_002739429.1| PREDICTED: methylmalonic aciduria (cobalamin deficiency) type B
           homolog [Saccoglossus kowalevskii]
          Length = 207

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 116/164 (70%)

Query: 11  KPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLE 70
           KPK   +YTRTGDKG SS ++GERR KDD +F ALG+ DEL+ +IG+A  + + A +   
Sbjct: 44  KPKAIRIYTRTGDKGMSSTYSGERRPKDDVIFEALGSTDELTCTIGLAREFSEDAKHTFS 103

Query: 71  DKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFI 130
           DKL ++QC L +VGS+IATPR + + +KL  T F  +NV  LE+WID   +QLPPL+NFI
Sbjct: 104 DKLEQVQCLLQDVGSHIATPRTALSETKLKRTEFSIDNVVELENWIDMYTDQLPPLRNFI 163

Query: 131 LPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNR 174
           +PSGG+++  LH  RSVCRRAER  +PL      + +V +YLNR
Sbjct: 164 VPSGGKTSTALHLARSVCRRAERRVIPLARDGEVDNAVVQYLNR 207



>gi|297621077|ref|YP_003709214.1| Cob(I)alamin adenosyltransferase [Waddlia chondrophila WSU 86-1044]
 gi|502946946|ref|WP_013181922.1| Cob(I)alamin adenosyltransferase [Waddlia chondrophila]
 gi|297376378|gb|ADI38208.1| Cob(I)alamin adenosyltransferase [Waddlia chondrophila WSU 86-1044]
          Length = 193

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 116/173 (67%), Gaps = 2/173 (1%)

Query: 15  SNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK--KAGNGLEDK 72
           + +YTR+GDKG++SLF GER  K+D    ALGTVDE +S+IG+A  +    +  +GL+ +
Sbjct: 2   AKIYTRSGDKGETSLFTGERVLKNDPFIEALGTVDECNSTIGLAIAHMPDNEIYSGLKQQ 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           LV IQ  L ++G+ IATPR  +   K++ T FDEE + ILE WID +D QLP LK+FILP
Sbjct: 62  LVMIQHALFDLGAAIATPRTRAKEDKINKTRFDEEEIEILEKWIDEMDLQLPKLKHFILP 121

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
            G  +   LH  RSVCRRAER  +PL         + +YLNRLSD+ F+A+R+
Sbjct: 122 GGHPAGAMLHLARSVCRRAERQVIPLSRHSDVSDKITRYLNRLSDYLFMASRW 174



>gi|488586336|ref|XP_004478505.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform 2 [Dasypus novemcinctus]
          Length = 219

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 115/187 (61%), Gaps = 20/187 (10%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K   +YTRTGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   ++
Sbjct: 48  KIPKIYTRTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELTAEKGHAFAEE 107

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L +IQC L +VG+ +ATP +S+  + L  T+F+E     LE WID   +QLPPL  FILP
Sbjct: 108 LQKIQCALQDVGAALATPSSSAREAHLKRTAFEEGPTLELEQWIDKYSSQLPPLTAFILP 167

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG+S+  LH CR+VCRRAER                    RLSD+ F  ARYAAM E +
Sbjct: 168 SGGKSSSALHFCRAVCRRAER--------------------RLSDYLFTVARYAAMREGN 207

Query: 193 IENYYEQ 199
            E  Y++
Sbjct: 208 QEKIYKK 214



>gi|449279231|gb|EMC86866.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial,
           partial [Columba livia]
          Length = 168

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 112/166 (67%), Gaps = 3/166 (1%)

Query: 32  GERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEIQCKLIEVGSNIATPR 91
           GERR K D +F ALG  DELSS+IG  N   + A +   D  V++QC L +VGSNIATP 
Sbjct: 1   GERRPKGDRIFEALGATDELSSAIGPLN---ESASDFCPDCHVQVQCMLQDVGSNIATPL 57

Query: 92  NSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRA 151
           +S+  + L  TSF E+ V  LE WID+   QLPPL+ FILPSGG+S+  LH  R+VCRRA
Sbjct: 58  SSAREAHLKRTSFSEKPVLELEQWIDSYSEQLPPLRAFILPSGGKSSAALHFSRAVCRRA 117

Query: 152 ERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYY 197
           ER  VPLV+A   + +V KYLNRLSD+ FV ARYAAM E   E  Y
Sbjct: 118 ERCVVPLVQAGEADPNVAKYLNRLSDYLFVLARYAAMKEGKEEKIY 163



>gi|301092320|ref|XP_002997018.1| cobalamin adenosyltransferase, putative [Phytophthora infestans
           T30-4]
 gi|262112171|gb|EEY70223.1| cobalamin adenosyltransferase, putative [Phytophthora infestans
           T30-4]
          Length = 200

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 125/184 (67%), Gaps = 3/184 (1%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG-LEDKLVE 75
           VYT+TGD G S LF+GERR K+D VF ALG +DEL++ IGVA    + A N  L  KL +
Sbjct: 3   VYTKTGDNGTSQLFSGERRPKNDAVFQALGDMDELNAQIGVAVEQARVAANAFLPPKLEQ 62

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFT-SFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
           IQ +L ++G+ +ATP  S++ +K   T +F++ NV  LE WID +D +LP +K FILPSG
Sbjct: 63  IQSRLFDLGACVATPLTSASETKQRRTGAFNDANVTQLEHWIDEMDTKLPLIKCFILPSG 122

Query: 135 GE-SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHI 193
           G  ++  LH  R+VCRRAER  VPLV A   +  V +YLNRLSDF FV+AR+AA+ E   
Sbjct: 123 GGLASTHLHVARAVCRRAERSVVPLVGAGDVDGVVQRYLNRLSDFLFVSARFAAVKEGKE 182

Query: 194 ENYY 197
           E  +
Sbjct: 183 ETKW 186



>gi|308811216|ref|XP_003082916.1| P0627E03.18 gene product (ISS) [Ostreococcus tauri]
 gi|116054794|emb|CAL56871.1| P0627E03.18 gene product (ISS) [Ostreococcus tauri]
          Length = 585

 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 120/187 (64%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE 75
            +YT+TGD G S L+  ERR KDD  F+ALG VDE + ++G+A  +C +  NGL ++L E
Sbjct: 2   KIYTKTGDAGASDLYTMERREKDDATFDALGDVDECNVAVGIAREFCVEEKNGLAEELAE 61

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQ +L++VGS +ATP  +S     +  +F E +V +LE  ID +  +LP L +F+L SGG
Sbjct: 62  IQSRLLDVGSRVATPLTTSEARAAARAAFSEAHVEMLERRIDAMSEELPALTSFLLVSGG 121

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIEN 195
            ++VFLHQ R VCRRAER  VPLV        V  YLNRLSD+ F AARYAAM     E 
Sbjct: 122 RASVFLHQARVVCRRAERRCVPLVRRGECPDVVRVYLNRLSDYMFTAARYAAMKAGRAEE 181

Query: 196 YYEQRRD 202
            Y++  D
Sbjct: 182 PYKKAAD 188



>gi|507971521|ref|XP_004690738.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Condylura cristata]
          Length = 239

 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 120/189 (63%), Gaps = 4/189 (2%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR+KDD VF ALGT DELSS+IG+A  +  + G+   +
Sbjct: 47  PKIPKIYTKTGDKGFSSTFTGERRAKDDQVFEALGTTDELSSAIGLALEFITEKGHPFAE 106

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L ++GS +ATPR+S+  + L  T+F    V  LE WID    QLP L  FIL
Sbjct: 107 ELQKIQCSLQDIGSALATPRSSAREAHLKHTAFQAGPVLELEQWIDKYSRQLPALTAFIL 166

Query: 132 PSG-GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFE 190
           P G G   +F   C  +C  +    VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E
Sbjct: 167 PVGMGSPRMF---CGVMCVSSLSSVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKE 223

Query: 191 KHIENYYEQ 199
            + E  Y++
Sbjct: 224 GNQEKIYKK 232



>gi|337292301|emb|CCB90338.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           [Waddlia chondrophila 2032/99]
          Length = 193

 Score =  175 bits (443), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 84/173 (48%), Positives = 115/173 (66%), Gaps = 2/173 (1%)

Query: 15  SNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK--KAGNGLEDK 72
           + +YTR+GDKG++SLF GER  K+D    ALGTVDE +S+IG+A  +    +  +GL+ +
Sbjct: 2   AKIYTRSGDKGETSLFTGERVLKNDPFIEALGTVDECNSTIGLAIAHMPDNEIYSGLKQQ 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           LV IQ  L ++G+ IATPR  +   K+  T FDE+ + ILE WID +D QLP LK+FILP
Sbjct: 62  LVMIQHALFDLGAAIATPRTRAKEDKIDKTRFDEKEIEILEKWIDEMDLQLPKLKHFILP 121

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
            G  +   LH  RSVCRRAER  +PL         + +YLNRLSD+ F+A+R+
Sbjct: 122 GGHPAGAMLHLARSVCRRAERQVIPLSRHSDVSDKITRYLNRLSDYLFMASRW 174



>gi|313220697|emb|CBY31541.1| unnamed protein product [Oikopleura dioica]
 gi|313236649|emb|CBY11907.1| unnamed protein product [Oikopleura dioica]
          Length = 202

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/184 (47%), Positives = 119/184 (64%), Gaps = 5/184 (2%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLV- 74
            +YT+TGDKG +SL+ GERR K D VF+ALG  DELS+++GVA  Y       +E+ +  
Sbjct: 19  KIYTKTGDKGTTSLYTGERRPKTDLVFDALGATDELSAALGVAREYAYD--RQMENVIAI 76

Query: 75  --EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
             ++Q +L EVGS IATP +S++  KL   SFDE  V  LE  ID LD QLP L  FILP
Sbjct: 77  VGDLQSRLQEVGSAIATPTSSASEMKLKRVSFDESEVKKLEDLIDELDAQLPQLTTFILP 136

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG+ +  LH  R++CRRAER+++PL + E  +++V +YLNRLSD  F  AR A   E  
Sbjct: 137 GGGKCSAHLHMARTICRRAERMSLPLADCEDLDRNVCRYLNRLSDLLFQLARSAQQQEGK 196

Query: 193 IENY 196
            + +
Sbjct: 197 TDQF 200



>gi|302844588|ref|XP_002953834.1| hypothetical protein VOLCADRAFT_94577 [Volvox carteri f.
           nagariensis]
 gi|300260942|gb|EFJ45158.1| hypothetical protein VOLCADRAFT_94577 [Volvox carteri f.
           nagariensis]
          Length = 186

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 117/184 (63%), Gaps = 3/184 (1%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTR+GD G++SL+NG+R  KDD VF ALG VDEL+S++GVA  +       L ++L  I
Sbjct: 3   IYTRSGDTGQASLYNGDRLYKDDAVFQALGDVDELNSALGVAASFLTN--KTLLEQLEII 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEE-NVNILESWIDNLDNQLPPLKNFILPSGG 135
           Q +LI+VGS +ATP  +S  +KL  T F    +   LE WID +D  LPPLKNFILPSGG
Sbjct: 61  QSRLIDVGSAVATPLPTSPENKLQRTHFPGVVHAQQLEGWIDAMDEHLPPLKNFILPSGG 120

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIEN 195
             +  LH  RSVCRRAER  V L   +     V  YLNRLSDF F AAR+ A  +   E 
Sbjct: 121 RGSSALHHARSVCRRAERSVVVLSRRQTISLEVNTYLNRLSDFLFTAARFTAHSDGVPEV 180

Query: 196 YYEQ 199
            Y++
Sbjct: 181 IYKK 184



>gi|470426319|ref|XP_004337884.1| ATP:cob(I)alamin adenosyltransferase [Acanthamoeba castellanii str.
           Neff]
 gi|440794716|gb|ELR15871.1| ATP:cob(I)alamin adenosyltransferase [Acanthamoeba castellanii str.
           Neff]
          Length = 389

 Score =  172 bits (435), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 106/136 (77%), Gaps = 1/136 (0%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD G+SSLF GERR+K+D VF+ALGT DEL+S +G+A  YC+++ NGL++KL  I
Sbjct: 16  IYTKTGDGGESSLFTGERRAKEDVVFHALGTTDELNSFVGLAREYCEQSKNGLDEKLQMI 75

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L+++G+N+ATPRN+++      T F + +V  LE WID LD +LPPLKNFILPSGG 
Sbjct: 76  QSLLLDIGANVATPRNAADADA-RRTEFSDVHVTTLEKWIDELDAELPPLKNFILPSGGL 134

Query: 137 SAVFLHQCRSVCRRAE 152
           ++  LH CRSVCRRAE
Sbjct: 135 ASSHLHVCRSVCRRAE 150



>gi|444510224|gb|ELV09549.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           [Tupaia chinensis]
          Length = 274

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/163 (52%), Positives = 110/163 (67%), Gaps = 1/163 (0%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           PK   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 45  PKVPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELIAEKGHAFAE 104

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L  T+F    V  LE WID   +QLPPL  FIL
Sbjct: 105 ELQKIQCTLQDVGSALATPRSSAREAHLKHTAFGAGPVLELEQWIDRYSSQLPPLTAFIL 164

Query: 132 PSG-GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLN 173
           P G  +S+  LH CR+VCRRAER  VPLV+   T+++V K+LN
Sbjct: 165 PVGVCKSSSALHFCRAVCRRAERRVVPLVQMGETDENVAKFLN 207



>gi|485607785|gb|EOD07229.1| Cob(I)alamin adenosyltransferase, partial [Emiliania huxleyi
           CCMP1516]
          Length = 236

 Score =  171 bits (434), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 111/188 (59%), Gaps = 24/188 (12%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG------- 68
            VYTRTGDKGKSSLFNGERR KDD VF+ALG VDELS++IG+A  +C++   G       
Sbjct: 31  TVYTRTGDKGKSSLFNGERRRKDDVVFDALGAVDELSAAIGLARAHCEEGAAGCAKEEAV 90

Query: 69  ---------------LEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILE 113
                          L  +L   Q  L++VGS IATP+ SS+   L     D        
Sbjct: 91  EASVAPAPGPAGLRWLLPQLEGAQRLLLDVGSAIATPQTSSSEKHLQRVGID--GAAEAS 148

Query: 114 SWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLN 173
           + ID +D QLPPL  FILP GG  A  LH  R+VCRR+ER  VPLVEA      VG YLN
Sbjct: 149 ARIDTMDAQLPPLTVFILPGGGAPAAALHLSRAVCRRSERCVVPLVEAGDCPAEVGVYLN 208

Query: 174 RLSDFFFV 181
           RLSD+FFV
Sbjct: 209 RLSDYFFV 216



>gi|299115666|emb|CBN75866.1| flagellar associated protein, cobalamin adenosyltransferase-like
           protein [Ectocarpus siliculosus]
          Length = 283

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/187 (45%), Positives = 120/187 (64%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS +YTR+GDKG S L+N E R K D  F ALG +DEL++S+ +A  + + A NGL + 
Sbjct: 74  KKSFLYTRSGDKGTSQLYNMETRPKSDPSFEALGNMDELNASLALAVAHSELARNGLSEM 133

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           LV IQ  +I+  + +ATPR++S+  K+S T F     + LE+ ID LD + PPLK FI+P
Sbjct: 134 LVAIQSLIIDASALVATPRDNSSARKISRTGFPTWCTDQLEACIDELDARTPPLKTFIVP 193

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG +A  LH  R VCRRAER   PL+      + V +Y+NRLSD  F AARYA++ +  
Sbjct: 194 GGGLAASHLHLARCVCRRAERSLQPLLGTGQGVEEVARYINRLSDLLFAAARYASVVDGK 253

Query: 193 IENYYEQ 199
            E  +++
Sbjct: 254 PERPWKK 260



>gi|303289078|ref|XP_003063827.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226454895|gb|EEH52200.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 218

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 120/189 (63%), Gaps = 3/189 (1%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGN---GLEDK 72
            VYTRTGD G S LFN ERR KDDDVF ALG VDEL  +IGVA  + +   +    L  +
Sbjct: 20  KVYTRTGDDGSSCLFNMERRDKDDDVFEALGDVDELGVAIGVACAHLEDPIDERGALLAR 79

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L EIQ +L++VGS +ATP   S+  K   TSF+  +   LE+WID  D  LPPLK FILP
Sbjct: 80  LKEIQSRLLDVGSAVATPLGESSEWKRDRTSFEASHATTLEAWIDEYDAHLPPLKTFILP 139

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           SGG ++  LH  R V RRAER  VPL+      +SVG YLNRLSDF + AAR+ AM +  
Sbjct: 140 SGGHASARLHVARVVARRAERRCVPLIRRGDCVESVGVYLNRLSDFLYTAARFVAMRQGK 199

Query: 193 IENYYEQRR 201
            E  Y++ +
Sbjct: 200 AETPYKKAK 208



>gi|46446375|ref|YP_007740.1| hypothetical protein pc0741 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|499488651|ref|WP_011175291.1| hypothetical protein [Candidatus Protochlamydia amoebophila]
 gi|46400016|emb|CAF23465.1| conserved hypothetical protein [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 194

 Score =  169 bits (427), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 112/172 (65%), Gaps = 2/172 (1%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG--NGLEDKLV 74
           +YTRTGDKG +SLF G+R SK+D     LGTVDE +SSIG+A     K      ++++L 
Sbjct: 3   IYTRTGDKGTTSLFTGKRVSKNDVFIETLGTVDEGNSSIGMAISLLPKEPFYQQIKEQLE 62

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
            IQ  L +VG+ +ATPR S +  KL  T FD+E + ++E WID ++ +LPPLKNFILP G
Sbjct: 63  VIQHALFDVGAALATPRTSQHAKKLEKTRFDQEEIRLVEKWIDQMETELPPLKNFILPGG 122

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
             +   LH  RS+ RRAER+ VPL E     + +  YLNRLSD+ FV +R+ 
Sbjct: 123 HSAGAALHLSRSIIRRAERLVVPLYEQADVVEDILIYLNRLSDYLFVVSRFV 174



>gi|513210422|ref|XP_004945684.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X9 [Gallus gallus]
 gi|513210425|ref|XP_004945685.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X10 [Gallus gallus]
 gi|513234673|ref|XP_004949975.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X4 [Gallus gallus]
 gi|513235707|ref|XP_004950156.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X4 [Gallus gallus]
 gi|513235711|ref|XP_004950157.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X5 [Gallus gallus]
          Length = 192

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 104/153 (67%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           +   P  +   +YTRTGD+G SS F GERR K D +F ALGT DELSS+IG+A+    + 
Sbjct: 36  EGGPPSARSPRIYTRTGDEGFSSTFTGERRPKGDRIFEALGTTDELSSAIGLASELSSEK 95

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L ++QC L +VGSNIATP +S+  + L  TSF EE +  LE WID    QLPP
Sbjct: 96  GHAFVEQLHKVQCMLQDVGSNIATPLSSAREAHLKRTSFSEEPILELEKWIDRYSEQLPP 155

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPL 158
           L+ FILPSGG+S+  LH  R+VCRRAER +V L
Sbjct: 156 LRAFILPSGGKSSAALHFSRAVCRRAERWSVQL 188



>gi|148687965|gb|EDL19912.1| methylmalonic aciduria (cobalamin deficiency) type B homolog
           (human), isoform CRA_d [Mus musculus]
          Length = 246

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 92/196 (46%), Positives = 116/196 (59%), Gaps = 9/196 (4%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   ++
Sbjct: 48  KIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAMELVTEKGHMFAEE 107

Query: 73  LVEIQCKLIEVGSNI-ATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           L ++   +        A   N    +    T+F E  V  LE WID   +QLPPLK FIL
Sbjct: 108 LQKVSSIIFAHDRAFGACDLNCQLAASPEHTAFQEGPVLELERWIDKYSSQLPPLKAFIL 167

Query: 132 P--------SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAA 183
           P        SGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  A
Sbjct: 168 PVGIGVLNLSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVA 227

Query: 184 RYAAMFEKHIENYYEQ 199
           RYAAM E   E  Y++
Sbjct: 228 RYAAMKEGSQEKIYKK 243



>gi|513210428|ref|XP_004945686.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform X11 [Gallus gallus]
 gi|513234676|ref|XP_004949976.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X5 [Gallus gallus]
 gi|513235714|ref|XP_004950158.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X6 [Gallus gallus]
          Length = 183

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/148 (52%), Positives = 101/148 (68%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           +   P  +   +YTRTGD+G SS F GERR K D +F ALGT DELSS+IG+A+    + 
Sbjct: 36  EGGPPSARSPRIYTRTGDEGFSSTFTGERRPKGDRIFEALGTTDELSSAIGLASELSSEK 95

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L ++QC L +VGSNIATP +S+  + L  TSF EE +  LE WID    QLPP
Sbjct: 96  GHAFVEQLHKVQCMLQDVGSNIATPLSSAREAHLKRTSFSEEPILELEKWIDRYSEQLPP 155

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAER 153
           L+ FILPSGG+S+  LH  R+VCRRAER
Sbjct: 156 LRAFILPSGGKSSAALHFSRAVCRRAER 183



>gi|330791517|ref|XP_003283839.1| hypothetical protein DICPUDRAFT_26607 [Dictyostelium purpureum]
 gi|325086225|gb|EGC39618.1| hypothetical protein DICPUDRAFT_26607 [Dictyostelium purpureum]
          Length = 266

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 120/202 (59%), Gaps = 17/202 (8%)

Query: 15  SNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANH--YCKKAGNGLEDK 72
           S +YT+TGDKG S+LFNGERRSK + +FN LG+VDELSS +GVA     C K      DK
Sbjct: 31  SKIYTKTGDKGTSALFNGERRSKCNPIFNVLGSVDELSSHLGVAKEQLVCLKTEIQSVDK 90

Query: 73  ------------LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLD 120
                       +  IQC L++VGSN+ATP  +S+   L    F +++   LE+WID   
Sbjct: 91  DRTNTIHKVIEEIESIQCLLLDVGSNVATPATTSSEQHLMRAKFSDDHTTQLENWIDEHT 150

Query: 121 NQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEA---EVTEQSVGKYLNRLSD 177
             L PLKNFILP GG SA  L  CRSVCRR+ER  V + E    +    SV  +LNRLSD
Sbjct: 151 LHLQPLKNFILPGGGLSASQLQVCRSVCRRSERELVLMREQLGEDSVNPSVMHFLNRLSD 210

Query: 178 FFFVAARYAAMFEKHIENYYEQ 199
           + F  AR +   +K  E+ Y++
Sbjct: 211 YLFTVARLSTHIQKVEESVYKR 232



>gi|358332211|dbj|GAA50903.1| cob(I)alamin adenosyltransferase [Clonorchis sinensis]
          Length = 301

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/208 (45%), Positives = 118/208 (56%), Gaps = 23/208 (11%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVA-NHYCKKAGN---- 67
           +   +YTRTGDKG S+LFNGERR K D VF ALGTVDELS +I VA  H  +   N    
Sbjct: 88  RTMKIYTRTGDKGFSNLFNGERRPKTDRVFQALGTVDELSCTIAVALAHIHQHTTNVDPN 147

Query: 68  ----GLEDKLVEIQCKLIEVGSNIATP----------RNSSNTSKLSFTSFDEENVNI-L 112
                L D+L  IQC+L  VGS+IATP           +   + + +   F ++ ++  L
Sbjct: 148 IKISTLCDELERIQCRLQAVGSSIATPLPEPENELPAPHPKRSQRYAHIDFPDQAISGEL 207

Query: 113 ESWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPL---VEAEVTEQSVG 169
           E WID +  +LPPL+ FILPSGG     LH  R+VCRRAER  V L   V   V E  V 
Sbjct: 208 EPWIDRMTAELPPLRQFILPSGGLPGSTLHLARAVCRRAERRVVLLNTSVPHPVVEPEVI 267

Query: 170 KYLNRLSDFFFVAARYAAMFEKHIENYY 197
           +YLNRLSD+ F AARY        E +Y
Sbjct: 268 RYLNRLSDYLFTAARYVTHLFGLPEKHY 295



>gi|290996460|ref|XP_002680800.1| predicted protein [Naegleria gruberi]
 gi|284094422|gb|EFC48056.1| predicted protein [Naegleria gruberi]
          Length = 183

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 122/197 (61%), Gaps = 30/197 (15%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHY------CKKAGNG-- 68
           +YT+TGDKG +SL++GERR+KDD VF+ALG+VDEL++++G+A  +      C + G    
Sbjct: 3   IYTKTGDKGTTSLYSGERRTKDDLVFDALGSVDELNANLGLAYEHLLQIKLCDELGETDM 62

Query: 69  -----LEDKLVEIQCKLIEVGSNIATP-RNSSNTSKLSFTSFDEENVNILESWIDNLDNQ 122
                L+  L  +Q +L+++GS IATP   +++  K++   FD  N+  +E+WID LD  
Sbjct: 63  NNIELLKSSLTSVQSRLLDLGSCIATPIETTTSEDKINRVKFDNSNIEKVENWIDTLDGS 122

Query: 123 LPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVA 182
           LPPLKNFILP GG +A  LH  R+VC                 + V KYLNRLSDF FVA
Sbjct: 123 LPPLKNFILPGGGLTASQLHVARTVCL----------------EDVQKYLNRLSDFLFVA 166

Query: 183 ARYAAMFEKHIENYYEQ 199
           ARYA+  E   E  Y++
Sbjct: 167 ARYASKIEGKEEVVYKK 183



>gi|224005112|ref|XP_002296207.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|209586239|gb|ACI64924.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 188

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 108/174 (62%), Gaps = 6/174 (3%)

Query: 18  YTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEIQ 77
           YTR GD G S LF GERR K DDVF A+GTVDEL S +GV       +   L ++L+++ 
Sbjct: 1   YTRKGDAGTSQLFTGERRDKHDDVFEAMGTVDELCSVVGVVYSQLMTSNEALPEQLLDVM 60

Query: 78  CKLIEVGSNIATP----RNSSNTSKLSFT-SFDEENVNILESWIDNLDNQLPPLKNFILP 132
            +L +VGS+IA P       SNT  +     F   N ++LE WID + +QLP L +F+LP
Sbjct: 61  SRLFDVGSHIARPAPKQAQQSNTEMVQTKRPFHPHNTDLLEEWIDTMTDQLPELTSFVLP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEA-EVTEQSVGKYLNRLSDFFFVAARY 185
           +G  ++  LH  R+VCRRAER  VPLV+  E  + +   Y+NRLSD+ F AARY
Sbjct: 121 TGSPASAQLHVARTVCRRAERRMVPLVQRDESCDPAALSYVNRLSDYLFTAARY 174



>gi|355786511|gb|EHH66694.1| hypothetical protein EGM_03737 [Macaca fascicularis]
          Length = 281

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 124/232 (53%), Gaps = 37/232 (15%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG SS F GERR KDD VF A+GT DELSS+IG A     + G+   +
Sbjct: 47  PRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFAVELVTEKGHIFAE 106

Query: 72  KLVEIQCKLI-EVGSNI-ATPR-------------------------NSSNTSKLSF--- 101
           +L ++    + EVG     +PR                         N     K+ F   
Sbjct: 107 ELQKLLAGPVDEVGQQCHGSPRITHFTLTDAHCKRATAGPPQQGWVSNKDVVLKVQFAFK 166

Query: 102 -------TSFDEENVNILESWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERV 154
                  T+F+   +  LE WID    QLPPL  FILPSGG+ +  LH CR+VCRRAER 
Sbjct: 167 CQPVQEYTTFESGPILELEQWIDKYTCQLPPLTAFILPSGGKISSALHFCRAVCRRAERR 226

Query: 155 TVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYYEQRRDDRES 206
            VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E + E  Y++     ES
Sbjct: 227 VVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYKKNDPSAES 278



>gi|326435499|gb|EGD81069.1| hypothetical protein PTSG_11014 [Salpingoeca sp. ATCC 50818]
          Length = 272

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 123/225 (54%), Gaps = 32/225 (14%)

Query: 7   DNNP---KPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIG-VANHYC 62
           D  P   KP KS +YTRTGDKG S L+ G+RR K D VF  LG VDEL+S  G V  H  
Sbjct: 6   DTGPQARKPPKSMLYTRTGDKGTSQLYTGQRRPKTDIVFECLGHVDELNSQFGLVREHLD 65

Query: 63  KKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNI--LESWIDNLD 120
            +  + ++  L EIQC L+E+G++IA+P        +S   FD++  N+  LE  ID LD
Sbjct: 66  ARLLHDVDADLHEIQCLLMELGTHIASP------GVVSVKDFDDDATNLKWLERRIDELD 119

Query: 121 NQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEA------------------- 161
           ++LPPL+NFILPSGG++A  +H  R VCRRAER  V L +                    
Sbjct: 120 SELPPLRNFILPSGGKAAAHMHLARCVCRRAERALVHLRQCSNDDDNDDNGSDDDDDDDS 179

Query: 162 -EVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYYEQRRDDRE 205
                 +  K++NRLSDF F  AR  A     IE  ++ + D R 
Sbjct: 180 GGACSAAALKFINRLSDFAFCCARVCAFRTGGIETVFQSKPDRRH 224



>gi|452824573|gb|EME31575.1| cob(I)alamin adenosyltransferase [Galdieria sulphuraria]
          Length = 281

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 114/191 (59%), Gaps = 16/191 (8%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG-LED 71
           K+  +YTRTGDKGKSSL  GER+ KDD VF  LGT+DEL++ +G+   YC+      L  
Sbjct: 77  KRIRIYTRTGDKGKSSLLTGERKPKDDAVFEVLGTIDELNAHVGLCVVYCRSVEKSVLTT 136

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSK----LSFTSFDEENVNILESWIDNLDNQLPPLK 127
           KL ++Q  L +VG+ IA+  +S   +K    L+   FD   V  +E WID L+  LPPL+
Sbjct: 137 KLEDVQSSLFDVGAAIASHSSSVEKTKGNLDLAKFRFDHGKVEEIEQWIDELEESLPPLR 196

Query: 128 NFILPSGGESAVFLHQCRSVCRRAERV-------TVPLVEAEVTE----QSVGKYLNRLS 176
           NFILPSGG     LH  R+V RR ER        T+P ++    +    Q VG+YLNRL 
Sbjct: 197 NFILPSGGLLGAQLHITRAVGRRTERRFWTAFQHTLPTIQDSKDQIEALQCVGQYLNRLG 256

Query: 177 DFFFVAARYAA 187
           D  FVAAR AA
Sbjct: 257 DLLFVAARIAA 267



>gi|412985482|emb|CCO18928.1| ATP:cob(I)alamin adenosyltransferase [Bathycoccus prasinos]
          Length = 276

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 118/206 (57%), Gaps = 26/206 (12%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK-- 63
           +D   +  K  VYT+TGD G SSL+N ERR K D  F ALG  DE + ++G+A  + +  
Sbjct: 58  NDAKDEMTKFKVYTKTGDDGTSSLYNLERRKKSDLTFEALGDCDETNVAVGIARVHARDF 117

Query: 64  -------KAGNGL----------EDKLVE---IQCKLIEVGSNIATPRNSSNTS---KLS 100
                     +G           ED L     IQ +L++VGS +ATP  S  T    K+ 
Sbjct: 118 FLFNNNNNNNSGATTSADMNCFDEDVLPHLEIIQSRLLDVGSAVATPMTSEKTKDGMKMR 177

Query: 101 FTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVE 160
              FDE +V+ +ESWID  + +LP L NF+ P G + A FLHQ R++CRR ER   P+VE
Sbjct: 178 -CRFDESHVDAIESWIDAYEEELPALTNFLCPGGTKFAAFLHQARAICRRCERKVQPMVE 236

Query: 161 AEVTEQSVGKYLNRLSDFFFVAARYA 186
           +   E+SVG YLNRLSD+ FVAAR A
Sbjct: 237 SGDVEKSVGMYLNRLSDYLFVAARVA 262



>gi|219119145|ref|XP_002180339.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217408596|gb|EEC48530.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 405

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/196 (42%), Positives = 113/196 (57%), Gaps = 28/196 (14%)

Query: 18  YTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGN-----GLEDK 72
           YTRTGD G+S L  GERRSK D VF A+GTVDEL S +GV +   ++  +      L++ 
Sbjct: 175 YTRTGDLGQSMLLTGERRSKADVVFEAMGTVDELCSIVGVVHAELQRPDDEHEYGALQEW 234

Query: 73  LVEIQCKLIEVGSNIATP----RNSSNTSKLSFT-------------------SFDEENV 109
           L+E+  +L ++GS++A P    RN    +                         FD +++
Sbjct: 235 LLEVMSRLFDIGSHVAKPKRLKRNQHADTVSDDDDASSTSEEDRVFVADGIGGGFDRQHI 294

Query: 110 NILESWIDNLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVG 169
           + LE WID +   LP L +FILP+G  SA  LH  R VCRRAER  VPLV+A + + +  
Sbjct: 295 HTLEDWIDQMTEDLPELLSFILPTGAISAAQLHNARCVCRRAERRVVPLVQAGICDPNAL 354

Query: 170 KYLNRLSDFFFVAARY 185
           KYLNRLSDFFF AAR+
Sbjct: 355 KYLNRLSDFFFSAARW 370



>gi|496378061|ref|WP_009087051.1| cobalamin adenosyltransferase [Elizabethkingia anophelis]
 gi|365756266|gb|EHM98181.1| Cob(I)alamin adenosyltransferase PduO [Elizabethkingia anophelis
           Ag1]
 gi|442563493|gb|ELR80704.1| hypothetical protein D505_03037 [Elizabethkingia anophelis R26]
          Length = 191

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 115/190 (60%), Gaps = 17/190 (8%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHY-----CKKAGNGLED 71
           +YT+TGDKG+++L+ G R SK      A GT+DEL++ IGVA  +     C K       
Sbjct: 5   IYTKTGDKGETALYGGTRVSKASARVEAYGTIDELNAFIGVAKSHIDDSDCLK------- 57

Query: 72  KLVEIQCKLIEVGSNIATPRN----SSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLK 127
           +L EIQ  L  +GS  ATP +    ++  S+L  T   EE+++ LE W+D +D  L PL+
Sbjct: 58  QLAEIQYDLFTLGSEAATPIDKVYLANGKSRLPVT-IKEEDISKLEVWMDKMDESLEPLQ 116

Query: 128 NFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
            FILP GG++A FLH  R++CRRAER  V L E E     + KYLNRLSD+ FV ARY +
Sbjct: 117 FFILPGGGKAATFLHAARTICRRAERGMVFLNETEEVRLELIKYLNRLSDYLFVMARYVS 176

Query: 188 MFEKHIENYY 197
           M +   E Y+
Sbjct: 177 MLDNEQEEYW 186



>gi|66814610|ref|XP_641484.1| hypothetical protein DDB_G0279905 [Dictyostelium discoideum AX4]
 gi|60469517|gb|EAL67509.1| hypothetical protein DDB_G0279905 [Dictyostelium discoideum AX4]
          Length = 291

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 87/218 (39%), Positives = 126/218 (57%), Gaps = 36/218 (16%)

Query: 15  SNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYC-----------K 63
           S +YT+TGDKG S+LFNGERR KDD +F ALG+VDELSS +G++  +            K
Sbjct: 27  SKIYTKTGDKGTSALFNGERRKKDDQIFQALGSVDELSSQLGLSKEHLIVLRKEINNEKK 86

Query: 64  KAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNL-DNQ 122
           +  N + D++ +IQC L+++GS+IATP  S    +   + F++ +   LE+W+D+  +N 
Sbjct: 87  ELANRVIDEIEQIQCLLLDIGSHIATPSYSEEQFQ-KRSQFNDFHTTQLENWVDHYTNNH 145

Query: 123 LPPLKNFILPSGGESAVFLHQCRSVCRRAER--VTVPLVEAEV----------------- 163
           L PLKNFILP GG ++  LH CRSVCRR+ER  +T+  +E E                  
Sbjct: 146 LAPLKNFILPGGGLTSASLHVCRSVCRRSERELITMTNLENEYENNNNNNNNNNNNNNNN 205

Query: 164 ----TEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYY 197
                   V +++NRLSD+ F  AR +   E   E+ Y
Sbjct: 206 NNNEISSPVLRFINRLSDYLFTIARISNKIEGGEESIY 243



>gi|268574480|ref|XP_002642217.1| C. briggsae CBR-MMAB-1 protein [Caenorhabditis briggsae]
          Length = 245

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 115/200 (57%), Gaps = 6/200 (3%)

Query: 1   FFLMTDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANH 60
           FF MT  N+ +  K      TGD G+SSL+N ERR KDDD FNALGT DELSS +GV   
Sbjct: 28  FFSMTSSNSGRGFKQG--RGTGDSGQSSLYNSERRWKDDDTFNALGTTDELSSYLGVCGS 85

Query: 61  YCKKAGNGLED---KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWID 117
             +  G G++D    L  +QC L +VG+++ATP  SS+  K   T FD   V  + + ID
Sbjct: 86  SAQNDG-GMDDVVETLTRLQCCLQDVGAHLATPPKSSSERKQKKTMFDVAMVEWINAEID 144

Query: 118 NLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSD 177
              + LP ++ FIL  GG ++  L   R++CRRAER  VPL+  E  +    K+LNR+SD
Sbjct: 145 RYGDDLPAIRQFILSGGGVTSANLQYARAICRRAERSVVPLMREENIDPMALKFLNRMSD 204

Query: 178 FFFVAARYAAMFEKHIENYY 197
             FV  R A M  K  E  Y
Sbjct: 205 LLFVLGRTACMRNKFDELTY 224



>gi|510826779|ref|WP_016199917.1| Cob(I)alamin adenosyltransferase PduO [Elizabethkingia
           meningoseptica]
 gi|507150883|gb|EOR29152.1| Cob(I)alamin adenosyltransferase PduO [Elizabethkingia
           meningoseptica ATCC 13253 = NBRC 12535]
          Length = 191

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 114/185 (61%), Gaps = 7/185 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG+++L+ G R SK      A GT+DEL++ IGVA  +         ++L +I
Sbjct: 5   IYTKTGDKGETALYGGTRVSKASARVEAYGTIDELNAFIGVAKSHIDD--KDCVEQLAKI 62

Query: 77  QCKLIEVGSNIATPRN----SSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q  L  +GS  ATP +    ++  S+L  T   EE+++ LE W+D +D  L PL+ FILP
Sbjct: 63  QYDLFTLGSEAATPLDKIYLANGKSRLPVT-IKEEDISGLEVWMDKMDESLEPLQFFILP 121

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG++A FLH  R++CRRAER  V L E E     + KYLNRLSD+ F+ ARY +M +  
Sbjct: 122 GGGKAATFLHVARTICRRAERGMVFLNETEEVRPELIKYLNRLSDYLFIMARYVSMLDNE 181

Query: 193 IENYY 197
            E Y+
Sbjct: 182 REEYW 186



>gi|385809377|ref|YP_005845773.1| Cob(I)alamin adenosyltransferase [Ignavibacterium album JCM 16511]
 gi|504372559|ref|WP_014559661.1| cobalamin adenosyltransferase [Ignavibacterium album]
 gi|383801425|gb|AFH48505.1| Cob(I)alamin adenosyltransferase [Ignavibacterium album JCM 16511]
          Length = 183

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 3/169 (1%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG++SLF GER  K +   NA GT+DEL+S IG+A    K   N + D L+++
Sbjct: 3   IYTKTGDKGETSLFGGERVKKSNQRINAYGTIDELNSFIGLALTEVK--SNEIRDLLIDL 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q KL  VGS++ATP    N  KL+ T  +E  +   ES IDN   +L  L+NFILP G +
Sbjct: 61  QNKLFVVGSDLATPDTEKN-KKLNITRTEENFIKKAESDIDNFTEKLDELRNFILPGGSK 119

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
            +  LH CR++CRRAER  V L E E   +++  +LNR+SD FFV +RY
Sbjct: 120 GSAMLHVCRTICRRAEREVVALKELEKVNENIIIFLNRISDLFFVLSRY 168



>gi|507110252|emb|CDF34025.1| unnamed protein product [Chondrus crispus]
          Length = 225

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 115/186 (61%), Gaps = 17/186 (9%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVA--------NHYCKKAGNG 68
           VYTRTGD GK+SLFNG R +K+  + +A GTVDE +++IG+A         H  +   + 
Sbjct: 3   VYTRTGDTGKTSLFNGARVAKNHALIDAYGTVDECNAAIGLACSHLASPNAHLAENTESD 62

Query: 69  LEDKLV-----EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQL 123
            E KLV      IQ  L ++G+++ATPR++S+ +K++ T F       LE WID +D  L
Sbjct: 63  SERKLVLSRLHTIQNYLFDLGAHLATPRSTSSDNKIARTQFSSNASTQLEEWIDAMDKDL 122

Query: 124 PPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLV---EAEVTEQSVGKYLNRLSDFFF 180
            PL  F+LP G  SA  LH  R++ RRAER   PL    E E+ ++S  +++NRLSD+ F
Sbjct: 123 APLTTFVLPGGHPSAAALHLARTIARRAERAVTPLFVDGEQEI-DESAFQFINRLSDYLF 181

Query: 181 VAARYA 186
           VA+RYA
Sbjct: 182 VASRYA 187



>gi|300176889|emb|CBK25458.2| unnamed protein product [Blastocystis hominis]
          Length = 210

 Score =  149 bits (375), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 75/175 (42%), Positives = 113/175 (64%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE 75
           ++ TR+GD+G S L+NG+R  K D  F  LGT+DE +S IG++  +   + + L+  L  
Sbjct: 25  DITTRSGDQGMSCLYNGKRFPKSDIHFEVLGTLDECNSFIGLSREFMTDSCSLLDSYLEN 84

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           +QC L +V + +ATP + S   +++ T F E +V  LE W   LD +LP   +FILPSGG
Sbjct: 85  VQCLLFDVCAAVATPLSQSRERQVNKTHFSESHVQELEKWSYLLDRELPKQDSFILPSGG 144

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFE 190
           ++A  LH  R++CRRAER    L++ +    SV +++NRLSDF ++AARYA+M E
Sbjct: 145 KAASHLHVSRAICRRAERSLSMLLQNKDVSTSVYQFVNRLSDFLYIAARYASMKE 199



>gi|341896250|gb|EGT52185.1| hypothetical protein CAEBREN_17860 [Caenorhabditis brenneri]
          Length = 214

 Score =  149 bits (375), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 108/179 (60%), Gaps = 2/179 (1%)

Query: 21  TGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGN--GLEDKLVEIQC 78
           TGD G+SSL+N ERR KDDD FNALGT DELSS +GV     +  G+   + + L  +QC
Sbjct: 16  TGDSGQSSLYNLERRWKDDDTFNALGTTDELSSFLGVCGVSAQNDGSMGDVVETLTRLQC 75

Query: 79  KLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGESA 138
            L +VG+++ATP  +S+  K   T+FD   V  + + ID   + LPP++ FIL  GG ++
Sbjct: 76  CLQDVGAHLATPPKNSSERKQKKTAFDVAMVEWINAEIDRYGDDLPPIRQFILSGGGMTS 135

Query: 139 VFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYY 197
             L   R++CRRAER  VPL+  E  +    K+LNR+SD  FV  R A M  K  E  Y
Sbjct: 136 AQLQYARAICRRAERSIVPLMRDEDVDPMALKFLNRMSDLLFVLGRTACMRSKKEELTY 194



>gi|167533449|ref|XP_001748404.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163773216|gb|EDQ86859.1| predicted protein [Monosiga brevicollis MX1]
          Length = 242

 Score =  148 bits (374), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 81/185 (43%), Positives = 110/185 (59%), Gaps = 3/185 (1%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGV--ANHYCKKAGNGLEDKL 73
            +YTRTGD G S+L  GERR K D  F A+GTVDELSS++GV  A+   ++A   + ++L
Sbjct: 38  KIYTRTGDAGTSALLTGERRPKYDPCFEAVGTVDELSSALGVTMASIRSEQALQDINEQL 97

Query: 74  VEIQCKLIEVGSNIATPRNSSNTSKL-SFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
             IQC L +V S + TP + +    L    + DE  V  LE+ ID  + +L PLKNFILP
Sbjct: 98  QRIQCILQDVSSCLVTPDDDATPEHLRKAVALDEAFVTELEALIDAHEEELAPLKNFILP 157

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG ++   H  R+VCRRAER  V L + +  + +  K+LNRLSD+ F  AR A   +  
Sbjct: 158 GGGPASASFHVARTVCRRAERRAVELQQVQAVQPAALKFLNRLSDYLFTLARVACHRQGE 217

Query: 193 IENYY 197
            E  Y
Sbjct: 218 EELVY 222



>gi|308487772|ref|XP_003106081.1| CRE-MMAB-1 protein [Caenorhabditis remanei]
 gi|308254655|gb|EFO98607.1| CRE-MMAB-1 protein [Caenorhabditis remanei]
          Length = 246

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 108/179 (60%), Gaps = 2/179 (1%)

Query: 21  TGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG--NGLEDKLVEIQC 78
           TGD G+SSL+N ERR KDDD FNALG  DELSS +GV     +  G  N + + L  +QC
Sbjct: 47  TGDSGQSSLYNNERRWKDDDSFNALGATDELSSFLGVCGASAQNDGEMNDVVETLTRLQC 106

Query: 79  KLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGESA 138
            L +VG+++ATP  +S+  K   T+FD   V  + + ID   ++LP ++ FIL  GG ++
Sbjct: 107 CLQDVGAHLATPPKNSSERKQKKTAFDVSMVEWINAEIDRYGDELPGIRQFILSGGGVTS 166

Query: 139 VFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYY 197
             L   R+VCRRAER  VPL+  E  +    K+LNR+SD  FV  R A M  K+ E  Y
Sbjct: 167 ANLQYARAVCRRAERCVVPLIREENVDPMALKFLNRMSDLLFVLGRTACMRNKNEELTY 225



>gi|426374099|ref|XP_004053920.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Gorilla gorilla gorilla]
          Length = 222

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/195 (43%), Positives = 116/195 (59%), Gaps = 22/195 (11%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLED 71
           P+   +YT+TGDKG+  +F  E     +  F AL  V E               G+   +
Sbjct: 47  PRIPKIYTKTGDKGE--IFGTE-----NGRF-ALELVTE--------------KGHTFAE 84

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L +IQC L +VGS +ATPR+S+  + L +T+F+   +  LE WID   +QLPPL  FIL
Sbjct: 85  ELQKIQCILQDVGSALATPRSSAREAHLKYTTFEAGPILELEQWIDKYTSQLPPLTAFIL 144

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           PSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARYAAM E 
Sbjct: 145 PSGGKISSALHFCRAVCRRAERRVVPLVQMGETDVNVAKFLNRLSDYLFTLARYAAMKEG 204

Query: 192 HIENYYEQRRDDRES 206
           + E  Y++     ES
Sbjct: 205 NQEKIYKKNDPSAES 219



>gi|495978022|ref|WP_008702601.1| ATP/cobalamin adenosyltransferase [Rhodopirellula maiorica]
 gi|460163711|gb|EMI17863.1| ATP/cobalamin adenosyltransferase [Rhodopirellula maiorica SM1]
          Length = 195

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 117/189 (61%), Gaps = 15/189 (7%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG--NGLEDKLV 74
           +YTRTGD G + LF G R +KDDD   A GTVDEL++ +G+     + AG  + ++ +L 
Sbjct: 13  IYTRTGDAGSTGLFGGPRVAKDDDRIEAYGTVDELNACLGLV----RSAGVSSTMDSQLC 68

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
           +IQ  L  +G+ +ATP    N  +      D+ +V  LE WID  ++ LPPLKNFILP+G
Sbjct: 69  QIQHALFSIGAELATP----NPDEHGMRIIDDVHVKQLEGWIDEHESVLPPLKNFILPAG 124

Query: 135 GESAVFLHQCRSVCRRAERVTVPLV---EAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
             +A  LH  RS+CRRAER  V LV   EA V+E+ +  YLNRLSD  FV +R A  F+ 
Sbjct: 125 VAAATHLHLARSICRRAERRVVTLVRRHEASVSEELI-VYLNRLSDLLFVLSRVAN-FDA 182

Query: 192 HIENYYEQR 200
           ++++   QR
Sbjct: 183 NVDDDPWQR 191



>gi|511000697|gb|EPB82218.1| ATP:cob(I)alamin adenosyltransferase [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 146

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (68%), Gaps = 2/134 (1%)

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDE--ENVNILESWIDNLDNQL 123
           GN L +KL++IQC L +VGSN+ATPR  SN ++L+ T FD   ++V  +E WID  D QL
Sbjct: 10  GNELVEKLIKIQCLLQDVGSNLATPREQSNEARLARTRFDADGQHVKAMEDWIDEYDQQL 69

Query: 124 PPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAA 183
           P L  FILPSGG+S+  LH  RSVCRRAER   PLV  ++ + SVG +LNRLSDF F AA
Sbjct: 70  PKLTKFILPSGGKSSASLHVARSVCRRAERRVQPLVRDQLCDNSVGIFLNRLSDFLFNAA 129

Query: 184 RYAAMFEKHIENYY 197
           R+AA  +   E  Y
Sbjct: 130 RWAAQSQGKEEKIY 143



>gi|397689251|ref|YP_006526505.1| ATP:cob(I)alamin adenosyltransferase [Melioribacter roseus P3M-2]
 gi|504667827|ref|WP_014854929.1| cobalamin adenosyltransferase [Melioribacter roseus]
 gi|395810743|gb|AFN73492.1| ATP:cob(I)alamin adenosyltransferase, putative [Melioribacter
           roseus P3M-2]
          Length = 179

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 101/169 (59%), Gaps = 6/169 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG +SL  GER  KDD   NA GTVDEL+S +G+A    +     L + L  I
Sbjct: 3   IYTKTGDKGTTSLLGGERVFKDDQRLNAYGTVDELNSLLGLAAAEIENPE--LLEVLRGI 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q +L EVG ++ATP +S    K+    FD      LES ID  + +LP LKNFILP G  
Sbjct: 61  QAELFEVGVDLATPADS----KVKIDRFDTAKAERLESLIDKFEERLPVLKNFILPGGSR 116

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           +   LH  R+VCRRAER T  L++    +  V  YLNRLSD  FV ARY
Sbjct: 117 AGALLHYARTVCRRAERETAALMKTVEIKNPVLVYLNRLSDLLFVLARY 165



>gi|156402373|ref|XP_001639565.1| predicted protein [Nematostella vectensis]
 gi|156226694|gb|EDO47502.1| predicted protein [Nematostella vectensis]
          Length = 128

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 85/124 (68%)

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQC L +VGSNIATPR +S   K+  T F E +V ILE WID   NQLP L NFILPSGG
Sbjct: 1   IQCILQDVGSNIATPRETSRQDKIKRTEFSEMHVPILERWIDEYHNQLPALTNFILPSGG 60

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIEN 195
           +++  LH  R+VCRRAER  VPLV +   + +VGK+LNRLSDF F AAR+AA  E   E 
Sbjct: 61  KASSLLHVARTVCRRAERRVVPLVTSGSVDPNVGKFLNRLSDFLFTAARFAAKTEGREEK 120

Query: 196 YYEQ 199
            Y +
Sbjct: 121 IYHR 124



>gi|407450947|ref|YP_006722671.1| hypothetical protein B739_0163 [Riemerella anatipestifer RA-CH-1]
 gi|504750143|ref|WP_014937245.1| cobalamin adenosyltransferase [Riemerella anatipestifer]
 gi|403311930|gb|AFR34771.1| hypothetical protein B739_0163 [Riemerella anatipestifer RA-CH-1]
          Length = 190

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/185 (42%), Positives = 108/185 (58%), Gaps = 7/185 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD G +SL+ G R SK      A GT+DEL++ +GVA  Y ++A   + ++L  I
Sbjct: 3   IYTKTGDSGATSLYGGTRVSKAHLRVEAYGTIDELNACLGVAKSYIQEAE--VLEQLKTI 60

Query: 77  QCKLIEVGSNIATPRN----SSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q  L  +GS  ATP +    ++  S+L      +  +  LE WID  D QL PL+ FILP
Sbjct: 61  QFDLFTLGSESATPVDKLFLANGKSRLPLV-IGQNEIETLERWIDAFDEQLEPLQFFILP 119

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG+++  LH  R+VCRRAER  V L E E     + KYLNRLSD+ FV ARY +     
Sbjct: 120 GGGKASARLHVARTVCRRAERYLVALSEQEEVRAELIKYLNRLSDYLFVLARYISHLHHE 179

Query: 193 IENYY 197
            E Y+
Sbjct: 180 PEEYW 184



>gi|115534154|ref|NP_498038.2| Protein MMAB-1 [Caenorhabditis elegans]
 gi|351058303|emb|CCD65737.1| Protein MMAB-1 [Caenorhabditis elegans]
          Length = 214

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 107/179 (59%), Gaps = 2/179 (1%)

Query: 21  TGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGN--GLEDKLVEIQC 78
           TGD G+SSL+N ERR KDDD FNALG  DELSS +GV     +  G+   + + L  +QC
Sbjct: 16  TGDSGQSSLYNNERRWKDDDTFNALGATDELSSFLGVCGASAQNDGSMSDVVETLTRLQC 75

Query: 79  KLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGESA 138
            L +VG+++ATP  +S+  K   T+FD   V  + + ID   + LP ++ FIL  GG ++
Sbjct: 76  CLQDVGAHLATPPKNSSERKQKKTAFDIAMVEWINAEIDRYGDALPAIRQFILSGGGMTS 135

Query: 139 VFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYY 197
             L   R++CRRAER  VPL+  E  +    K+LNR+SD  FV  R A M  K+ E  Y
Sbjct: 136 AQLQYSRAICRRAERSIVPLMRDEDVDPMALKFLNRMSDLLFVLGRTACMRNKNEELTY 194



>gi|495116168|ref|WP_007840985.1| cobalamin adenosyltransferase [Chryseobacterium sp. CF314]
 gi|398084266|gb|EJL74962.1| ATP:cob(I)alamin adenosyltransferase [Chryseobacterium sp. CF314]
          Length = 189

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 113/185 (61%), Gaps = 7/185 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG+++L+ G R SK     ++ G +DEL+S IG+A  + + A   +  +L +I
Sbjct: 3   IYTKTGDKGQTALYGGTRVSKASARVDSYGNIDELNSFIGIAKSHIEDAE--VLAQLKKI 60

Query: 77  QCKLIEVGSNIATPRN----SSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q  L  VGS  ATP +    ++  S+L      E+ +  LE W+D  +++L PL+ FILP
Sbjct: 61  QFDLFTVGSEAATPVDKLMLANGKSRLPLI-ISEKEIEELEQWMDAFEDKLEPLQYFILP 119

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG+SA FLH  R++CRRAER  V L E+E     + KYLNRLSD+ FV ARY +     
Sbjct: 120 GGGKSATFLHAARTICRRAERSLVFLNESEEIRPELIKYLNRLSDYLFVLARYISKLNNE 179

Query: 193 IENYY 197
            E Y+
Sbjct: 180 PEEYW 184



>gi|495863953|ref|WP_008588532.1| ATP:cob(I)alamin adenosyltransferase [Salimicrobium sp. MJ3]
 gi|407019849|gb|EKE32564.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Salimicrobium
           sp. MJ3]
          Length = 185

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 103/173 (59%), Gaps = 10/173 (5%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE- 75
           +YTR+GDKGK+SL +G+R  K  +   A GT DE +S IGVA  Y +K      DK++E 
Sbjct: 3   IYTRSGDKGKTSLIHGDRVPKSHERVEAYGTCDEANSVIGVAISYLRKEDFTGRDKMLEE 62

Query: 76  ---IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
              IQ  L  VG+ +ATP+      K  F    +E+VN LE+ ID  D  LP LKNFILP
Sbjct: 63  MNRIQTILFHVGAELATPK-----GKEVFWQLKKEHVNELEALIDQWDEDLPDLKNFILP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           +G E+A  LH  R+V RRAER    L E E+       YLNRLSD  FVAARY
Sbjct: 118 TGVEAAAHLHMARTVVRRAERYASAL-EEELNNPLAVSYLNRLSDLLFVAARY 169



>gi|326429486|gb|EGD75056.1| hypothetical protein PTSG_12477 [Salpingoeca sp. ATCC 50818]
          Length = 252

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 112/197 (56%), Gaps = 9/197 (4%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGDKG SSLF GERRSK D VF ALG++DE+SS IG+A    K   + LED    +
Sbjct: 56  IYTRTGDKGTSSLFTGERRSKGDAVFEALGSIDEVSSFIGLA--IAKIDSDNLED----L 109

Query: 77  QCKLIEVGSNIATPR--NSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
           + +L E+  +  +PR   S+  +++  TS        LE WID +   LPPLKNFILP G
Sbjct: 110 RSQLYEMLEHT-SPRLSTSATEARIERTSVPASYTEDLEGWIDAMTQTLPPLKNFILPGG 168

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIE 194
            E    LH  R+ CRRAER  V     +   ++  + +NRLSD+ F AAR+A       E
Sbjct: 169 TELGAALHCARTACRRAERRVVEANAHDEISETAMQLINRLSDYLFTAARHATATVGGEE 228

Query: 195 NYYEQRRDDRESNLVKR 211
             Y      RE +L +R
Sbjct: 229 LVYLSATKRRERSLTRR 245



>gi|148656112|ref|YP_001276317.1| ATP--cobalamin adenosyltransferase [Roseiflexus sp. RS-1]
 gi|500594130|ref|WP_011956713.1| ATP:cob(I)alamin adenosyltransferase [Roseiflexus sp. RS-1]
 gi|148568222|gb|ABQ90367.1| ATP:cob(I)alamin adenosyltransferase [Roseiflexus sp. RS-1]
          Length = 188

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 105/172 (61%), Gaps = 11/172 (6%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG--LEDKLV 74
           +YTRTGD+G++ L+ G R  KD     A GTVDE +++IGVA    + AG G  L+  L 
Sbjct: 3   IYTRTGDEGETGLWGGLRVPKDAPRVQAYGTVDECNAAIGVA----RAAGVGAELDALLA 58

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
            +Q  L  VG+++ATP  ++N  ++     D+E V  LE  ID L+ +L PL+ FILP G
Sbjct: 59  RVQNDLFVVGADLATPGEAANIPRI-----DQEAVQALEQAIDELEARLEPLRQFILPGG 113

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
             SA +LH  R++CRRAER  V L   E     V  YLNRLSD  FVAAR+A
Sbjct: 114 SLSAAYLHLARTICRRAERRVVALSHNEPVNPQVAVYLNRLSDLLFVAARFA 165



>gi|297692908|ref|XP_002823771.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial [Pongo abelii]
          Length = 159

 Score =  143 bits (360), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 69/141 (48%), Positives = 94/141 (66%)

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+    +L +IQC L +VGS +ATPR+S+  + L +T+F+   +  LE WID   +QLPP
Sbjct: 16  GHTFAKELQKIQCTLQDVGSALATPRSSAREAHLKYTTFEAGPILELEQWIDKYTSQLPP 75

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           L  FILPSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY
Sbjct: 76  LTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARY 135

Query: 186 AAMFEKHIENYYEQRRDDRES 206
           AAM + + E  Y++     ES
Sbjct: 136 AAMKQGNQEQIYKKNDPSAES 156



>gi|495576011|ref|WP_008300590.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase [Bhargavaea
           cecembensis]
 gi|470232390|gb|EMR05498.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase [Bhargavaea
           cecembensis DSE10]
          Length = 183

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 106/176 (60%), Gaps = 11/176 (6%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVA-NHYCKKAGNGLEDKLV- 74
           +YTRTGDKG++SL  G+R SK D + +A GT DE +S+IG+  +H  ++  +G +D +  
Sbjct: 3   IYTRTGDKGQTSLIYGKRVSKTDPLVDAYGTCDEANSAIGLGLSHLHQEFFDGKDDLMAA 62

Query: 75  --EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
             +IQ  L  VG+ +ATP       KL     ++  +  LE WID  D +LPPLKNFILP
Sbjct: 63  FHQIQTVLFHVGAELATPEGKEVKWKL-----EKPEIERLEQWIDRYDAELPPLKNFILP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAM 188
            G  +A  LH  R+V RRAER    L+  +     V  YLNRLSDF FVAARY  M
Sbjct: 118 GGHPAAAGLHYARTVVRRAERAA--LLVGDHVNPDVLAYLNRLSDFLFVAARYVNM 171



>gi|483505444|gb|EOA97021.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial,
           partial [Anas platyrhynchos]
          Length = 126

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 86/122 (70%)

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           +QC L +VGSNIATP +S+  + L  T+F E+ V  LE WID+   QLPPL+ FILPSGG
Sbjct: 1   VQCMLQDVGSNIATPLSSAREAHLKRTAFSEKPVLELEQWIDSYSEQLPPLRAFILPSGG 60

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIEN 195
           +S+  LH  R+VCRRAER  VPLV+A   + +V KYLNRLSD+ FV ARYAAM E   E 
Sbjct: 61  KSSAALHFSRAVCRRAERCVVPLVQAGEADPNVAKYLNRLSDYLFVLARYAAMKEGKEEK 120

Query: 196 YY 197
            Y
Sbjct: 121 IY 122



>gi|255536391|ref|YP_003096762.1| Cob(I)alamin adenosyltransferase PduO [Flavobacteriaceae bacterium
           3519-10]
 gi|506287209|ref|WP_015806984.1| cobalamin adenosyltransferase [Flavobacteriaceae bacterium 3519-10]
 gi|255342587|gb|ACU08700.1| Cob(I)alamin adenosyltransferase PduO [Flavobacteriaceae bacterium
           3519-10]
          Length = 189

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 111/185 (60%), Gaps = 7/185 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD G+++L+ G R SK      A G +DEL+S IG A    + + + +  +L +I
Sbjct: 3   IYTKTGDSGETALYGGTRVSKASARVEAYGNIDELNSFIGFAK--AEISDDLVLTQLKKI 60

Query: 77  QCKLIEVGSNIATPRN----SSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q  L  VGS  ATP +    ++  S+LS     E  +  LE+W+D  +N+L PL+ FILP
Sbjct: 61  QFDLFTVGSESATPTDKLTLANGKSRLSLM-ISETEIEELENWMDAFENELEPLQYFILP 119

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG+ A  LH CR+VCRRAER  V L E+E     + KYLNRLSD+ FV ARY + F   
Sbjct: 120 GGGKGATSLHICRTVCRRAERSLVYLNESEEVRPELIKYLNRLSDYLFVLARYVSKFNGD 179

Query: 193 IENYY 197
            E Y+
Sbjct: 180 TEEYW 184



>gi|490461657|ref|WP_004332220.1| cobalamin adenosyltransferase [Porphyromonas endodontalis]
 gi|229317855|gb|EEN83753.1| ATP:cob(I)alamin adenosyltransferase [Porphyromonas endodontalis
           ATCC 35406]
          Length = 188

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 104/172 (60%), Gaps = 4/172 (2%)

Query: 14  KSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKL 73
           KSN+YTRTGD+G +SL  G+R  K D      G+VDEL+S IG+     ++      ++L
Sbjct: 3   KSNLYTRTGDRGTTSLVGGQRIKKSDLRLECYGSVDELNSFIGLLR--AEELETSSAEQL 60

Query: 74  VEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPS 133
             IQ  L  +GSN+AT  ++S+    +F+   EE +  LE W+D LD   PP+  FILP+
Sbjct: 61  AAIQNNLFVIGSNLAT--DTSSRELKAFSQVSEEVIIALEGWVDQLDEATPPMTGFILPA 118

Query: 134 GGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           GG SA   H CR+V RR ER+   L E    ++ + +Y+NRLSD+FF  ARY
Sbjct: 119 GGRSAALCHVCRTVTRRVERLLYRLEEEVPVDEPLERYINRLSDYFFALARY 170



>gi|311270785|ref|XP_003132971.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial isoform 2 [Sus scrofa]
          Length = 207

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 93/134 (69%)

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L +IQC L ++G+ +ATPR+S+  + L  T+F+   +  LE WID   +QLPP
Sbjct: 67  GHPFAEELQKIQCSLQDIGAALATPRSSAREAHLKHTTFEVGPILELEQWIDRYSSQLPP 126

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           L  FILPSGG+S+  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY
Sbjct: 127 LTAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQTGETDVNVAKFLNRLSDYLFTLARY 186

Query: 186 AAMFEKHIENYYEQ 199
           AAM E + E  Y++
Sbjct: 187 AAMKEGNPEKIYKK 200



>gi|283781894|ref|YP_003372649.1| ATP/cobalamin adenosyltransferase [Pirellula staleyi DSM 6068]
 gi|502677331|ref|WP_012913048.1| ATP:cob(I)alamin adenosyltransferase [Pirellula staleyi]
 gi|283440347|gb|ADB18789.1| ATP/cobalamin adenosyltransferase [Pirellula staleyi DSM 6068]
          Length = 182

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 105/172 (61%), Gaps = 8/172 (4%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGD+G++ LF G R  KD+    A GTVDEL++ +G+A   C+     +E  L ++
Sbjct: 3   IYTRTGDEGETGLFGGPRVRKDNARIEAYGTVDELNAFLGLAR--CETLPPLIEHVLEQV 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L  VG+ +ATP       KL+     + +V  LE  ID L+  L PL+NFILP G +
Sbjct: 61  QADLFSVGAELATP----EPQKLNMPLVGDADVTQLELAIDALEEPLQPLRNFILPGGTK 116

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQS--VGKYLNRLSDFFFVAARYA 186
           +A  LH  R VCRRAER  V L  AE  E S  + +YLNRLSD+ FVAARYA
Sbjct: 117 AAATLHVARGVCRRAERWVVHLGAAEQVEISPWIIRYLNRLSDYLFVAARYA 168



>gi|497268367|ref|WP_009582584.1| Cob(I)alamin adenosyltransferase PduO [Fulvivirga imtechensis]
 gi|441435714|gb|ELR69101.1| Cob(I)alamin adenosyltransferase PduO [Fulvivirga imtechensis AK7]
          Length = 182

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 101/168 (60%), Gaps = 5/168 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           VYT+TGDKG ++LF G R SK  D  NA GT+DEL+S IG+     ++  +     LVE+
Sbjct: 3   VYTKTGDKGTTALFGGARVSKSHDRINAYGTIDELNSYIGLVRD--QEVNHKRRTILVEV 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q +L  +GS +AT        K+      E+++  LE  ID ++ +LPP+KNFILP G  
Sbjct: 61  QDRLFTIGSVLAT---EPGNKKVKTPHLGEDDIEALEVEIDKMEEELPPMKNFILPGGHP 117

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           S  F H  R VCRRAER+ V L + E     V +YLNRLSD+ FV AR
Sbjct: 118 SVSFCHVARCVCRRAERLVVALNDHEAVNPLVIQYLNRLSDYLFVLAR 165



>gi|313207182|ref|YP_004046359.1| ATP/cobalamin adenosyltransferase [Riemerella anatipestifer ATCC
           11845 = DSM 15868]
 gi|383486496|ref|YP_005395408.1| ATP/cobalamin adenosyl transferase [Riemerella anatipestifer ATCC
           11845 = DSM 15868]
 gi|386320836|ref|YP_006016998.1| Adenosylcobalamin biosynthesis, ATP:cob(I)alamin
           adenosyltransferase, EutT/PduO type [Riemerella
           anatipestifer RA-GD]
 gi|442315583|ref|YP_007356886.1| hypothetical protein G148_1888 [Riemerella anatipestifer RA-CH-2]
 gi|491057825|ref|WP_004919462.1| cobalamin adenosyltransferase [Riemerella anatipestifer]
 gi|312446498|gb|ADQ82853.1| ATP/cobalamin adenosyltransferase [Riemerella anatipestifer ATCC
           11845 = DSM 15868]
 gi|315022417|gb|EFT35444.1| Cob(I)alamin adenosyltransferase PduO [Riemerella anatipestifer
           RA-YM]
 gi|325335379|gb|ADZ11653.1| Adenosylcobalamin biosynthesis, ATP:cob(I)alamin
           adenosyltransferase, EutT/PduO type [Riemerella
           anatipestifer RA-GD]
 gi|380461181|gb|AFD56865.1| ATP/cobalamin adenosyl transferase [Riemerella anatipestifer ATCC
           11845 = DSM 15868]
 gi|441484506|gb|AGC41192.1| hypothetical protein G148_1888 [Riemerella anatipestifer RA-CH-2]
          Length = 190

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 108/185 (58%), Gaps = 7/185 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD G +SL+ G R SK      A GT+DEL++ +GVA  Y ++A   + ++   I
Sbjct: 3   IYTKTGDGGVTSLYGGTRVSKAHLRVEAYGTIDELNACLGVAKSYIQEAE--VLEQFKAI 60

Query: 77  QCKLIEVGSNIATPRN----SSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q  L  +GS  ATP +    +++ S+L      +  +  LE WID  D +L PL+ FILP
Sbjct: 61  QFDLFTLGSESATPVDKLFLANDKSRLPLV-IGQNEIEALERWIDAFDERLEPLQLFILP 119

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG+++  LH  R+VCRRAER  V L E E     + KYLNRLSD+ FV ARY +     
Sbjct: 120 GGGKASAHLHVARTVCRRAERYLVALSEQEEVRAELIKYLNRLSDYLFVLARYISHLHSE 179

Query: 193 IENYY 197
            E Y+
Sbjct: 180 PEEYW 184



>gi|401423110|ref|XP_003876042.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
 gi|322492282|emb|CBZ27557.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 376

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 112/195 (57%), Gaps = 19/195 (9%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG----- 66
           PK+S VYT+TGD G S+LF GERR K D VF ALG++DELSS +G+A    + A      
Sbjct: 173 PKRSMVYTKTGDNGASALFTGERRRKADVVFEALGSIDELSSHVGLARAMLRSAAARHEH 232

Query: 67  -NGLEDKLVEIQCKLIEVGSNIATP--RNSSNTSKLSFTSFDE-----ENVNILESWIDN 118
              +   L EIQ +L+  G+ +ATP  +N  + +    T   +     E    L   ID 
Sbjct: 233 DEAMMCMLAEIQQELLNAGTVVATPTAKNLEDETAKHMTEILDGYRFAEKTEELAKSIDI 292

Query: 119 LDNQLPPLKNFILPSGGESA-VFLHQCRSVCRRAERVTVPLVE---AEVTE--QSVGKYL 172
           +DN+L PL+ FILP GG  A   LH CR+ CRRAER  V L +   A  T+  +    Y+
Sbjct: 293 IDNRLAPLRVFILPGGGNVASAQLHVCRTTCRRAERRMVTLGDLYGATYTDHLRQATVYM 352

Query: 173 NRLSDFFFVAARYAA 187
           NRLSDFFFVAAR  A
Sbjct: 353 NRLSDFFFVAARSVA 367



>gi|188580955|ref|YP_001924400.1| ATP--cobalamin adenosyltransferase [Methylobacterium populi BJ001]
 gi|501428942|ref|WP_012453612.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Methylobacterium
           populi]
 gi|179344453|gb|ACB79865.1| ATP--cobalamin adenosyltransferase [Methylobacterium populi BJ001]
          Length = 190

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 108/178 (60%), Gaps = 10/178 (5%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YTRTGD+G + L NGERRSK D    A GTVDE ++ IG+A    + A   L+  
Sbjct: 3   KLNRIYTRTGDQGTTGLANGERRSKADLRVEAYGTVDETNACIGLARLTAEPA---LDAM 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD--EENVNILESWIDNLDNQLPPLKNFI 130
           L  IQ  L ++G+++ATP    + + L +         V  LE+ ID L+  +PPLK+F+
Sbjct: 60  LARIQNDLFDLGADLATP---PSDTPLGYEPLRVVAAQVQRLEAEIDALNANIPPLKSFV 116

Query: 131 LPSGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           LP G  +A  LH  R+VCRRAER+ V L  VE+E       +YLNRLSDF FVA+R A
Sbjct: 117 LPGGSATAAALHLARTVCRRAERLVVALSGVESEAISAEALQYLNRLSDFLFVASRAA 174



>gi|194379708|dbj|BAG58206.1| unnamed protein product [Homo sapiens]
          Length = 159

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/141 (48%), Positives = 93/141 (65%)

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L +IQC L +VGS +ATP +S+  + L +T+F    +  LE WID   +QLPP
Sbjct: 16  GHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPP 75

Query: 126 LKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           L  FILPSGG+ +  LH CR+VCRRAER  VPLV+   T+ +V K+LNRLSD+ F  ARY
Sbjct: 76  LTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARY 135

Query: 186 AAMFEKHIENYYEQRRDDRES 206
           AAM E + E  Y++     ES
Sbjct: 136 AAMKEGNQEKIYKKNDPSAES 156



>gi|156743715|ref|YP_001433844.1| ATP--cobalamin adenosyltransferase [Roseiflexus castenholzii DSM
           13941]
 gi|501071202|ref|WP_012122249.1| ATP:cob(I)alamin adenosyltransferase [Roseiflexus castenholzii]
 gi|156235043|gb|ABU59826.1| ATP--cobalamin adenosyltransferase [Roseiflexus castenholzii DSM
           13941]
          Length = 191

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 103/172 (59%), Gaps = 11/172 (6%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG--NGLEDKLV 74
           +YTRTGD+G++ L+ G R  KD     A GTVDE +++IGVA    + AG    L+  L 
Sbjct: 6   IYTRTGDEGETGLWGGLRVPKDAPRVQAYGTVDECNAAIGVA----RSAGVDTYLDALLA 61

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
            +Q  L  VG+++ATP  ++N  ++       + V  LE  ID L+ QL PL+ FILP G
Sbjct: 62  RVQSDLFVVGADLATPGEAANIPRIG-----ADAVQALEQAIDELEAQLEPLRQFILPGG 116

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
             SA +LH  R++CRRAER  V L  +E     +  YLNRLSDF FVAAR A
Sbjct: 117 APSAAYLHLARTICRRAERRVVTLSRSEPVNPQITIYLNRLSDFLFVAARCA 168



>gi|495907966|ref|WP_008632545.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Halobacillus sp.
           BAB-2008]
 gi|432191882|gb|ELK48801.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Halobacillus sp.
           BAB-2008]
          Length = 185

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 106/173 (61%), Gaps = 10/173 (5%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE- 75
           +YTR+GDKG++SL  G+R  K+D    A GT DE +S IG+A  Y +K     +D  ++ 
Sbjct: 3   IYTRSGDKGQTSLIYGQRVPKNDVRVEAYGTCDEANSHIGLALSYLRKEDWADKDAFMQA 62

Query: 76  ---IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
              +Q  L  VG+ +ATP+      K+      +E++++LE+ ID  D  L PLKNFILP
Sbjct: 63  LENVQTVLFHVGAELATPKGKEVMWKVK-----KEHIDLLENQIDEWDQSLDPLKNFILP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           SG E++   H  R+V RRAER+ V L E ++    V  YLNRLSDF FVAARY
Sbjct: 118 SGHEASASFHLARTVVRRAERIAVAL-EEDLQNPLVVSYLNRLSDFLFVAARY 169



>gi|495803093|ref|WP_008527672.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium sp.
           Pop5]
 gi|403705652|gb|EJZ21189.1| cobalamin adenosultransferase [Rhizobium sp. Pop5]
          Length = 192

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 110/176 (62%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR+KDD    A GT+DE +S+IG+A  +     + L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLVSGPRRTKDDLRVEAYGTIDEANSAIGLARLHTTGLPD-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP ++            E  V+ +E  ID L+  L PLK+FILP
Sbjct: 62  LMAIQNDLFDLGADLATP-DTGEPPAYEPLRIVETQVDRIERDIDRLNAGLEPLKSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLV--EAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A +LH  R++ RRAER+ V LV  + E+  Q+  KY+NRLSDF FVAAR+A
Sbjct: 121 GGRPAAAYLHLARTIARRAERLMVALVRTDGEIVGQAAMKYVNRLSDFLFVAARHA 176



>gi|374328618|ref|YP_005078802.1| ATP--cobalamin adenosyltransferase [Pseudovibrio sp. FO-BEG1]
 gi|504049226|ref|WP_014283220.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Pseudovibrio sp.
           FO-BEG1]
 gi|359341406|gb|AEV34780.1| ATP--cobalamin adenosyltransferase [Pseudovibrio sp. FO-BEG1]
          Length = 191

 Score =  138 bits (348), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 102/170 (60%), Gaps = 1/170 (0%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD G ++L +GERR K D    A GTVDE +S +G+   +  K    L++ L  I
Sbjct: 7   IYTKTGDDGTTALGSGERRQKHDLRIEAYGTVDETNSIVGIVRLHASKEMPVLDELLGRI 66

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L ++G+++ATP    +          E  V+ LE  ID ++ +L PLK+F+LP G  
Sbjct: 67  QNDLFDLGADLATPDTGEDLGYEPL-RITENQVSALEDAIDQMNVELTPLKSFVLPGGTP 125

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
            A +LHQ R+V RRAER+   L + E   +   +YLNRLSD FFVA+RYA
Sbjct: 126 LATYLHQARTVSRRAERLVAALYQKEKVNKQALQYLNRLSDLFFVASRYA 175



>gi|398016265|ref|XP_003861321.1| hypothetical protein, conserved [Leishmania donovani]
 gi|322499546|emb|CBZ34620.1| hypothetical protein, conserved [Leishmania donovani]
          Length = 376

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 109/195 (55%), Gaps = 19/195 (9%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG----- 66
           PK S VYT+TGD G S+LF GERR K D VF ALG +DELSS +G+A    + A      
Sbjct: 173 PKHSMVYTKTGDNGSSALFTGERRRKADAVFEALGAIDELSSHVGLARAMLRSAAERHEH 232

Query: 67  -NGLEDKLVEIQCKLIEVGSNIATP--RNSSNTSKLSFTSFDE-----ENVNILESWIDN 118
              +   L EIQ +L+  G+ +ATP  +N  + +    T   E     E    L   ID 
Sbjct: 233 DEAMMSLLAEIQQELLNAGTVVATPTAKNVEDETAKHMTEILEGYRFPEKTEELAKNIDI 292

Query: 119 LDNQLPPLKNFILPSGGESA-VFLHQCRSVCRRAERVTVPLVE---AEVTE--QSVGKYL 172
           +D++L PL+ FILP GG  A   LH CR+ CRRAER  V L +   A  T   +    Y+
Sbjct: 293 IDSRLAPLRVFILPGGGNVASAQLHVCRTTCRRAERRMVTLGDLYGATYTNHLRQATVYM 352

Query: 173 NRLSDFFFVAARYAA 187
           NRLSDFFFVAAR  A
Sbjct: 353 NRLSDFFFVAARSVA 367



>gi|494229487|ref|WP_007138073.1| cobalamin adenosyltransferase [Flavobacterium frigoris]
 gi|379649601|gb|EIA08174.1| cob(I)alamin adenosyltransferase PduO [Flavobacterium frigoris PS1]
          Length = 189

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 103/172 (59%), Gaps = 6/172 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           VYT+TGDKG +SLF G R  KD     + GTVDEL+S IG+     +      +D LVEI
Sbjct: 3   VYTKTGDKGTTSLFGGTRVPKDHIRIESYGTVDELNSYIGLVRD--QDMNTHYKDILVEI 60

Query: 77  QCKLIEVGSNIATPRNS----SNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q +L  +G+ +ATP       S   +L      E ++ +LE+ ID+++N+LPP+ +F+LP
Sbjct: 61  QDRLFTIGAILATPPEKEVLKSGELRLQKLGIIESDIELLENEIDSMENELPPMTHFVLP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
            G  +  + H  R VCRRAER+ V L   E   ++  KYLNRLSD+ FV AR
Sbjct: 121 GGHTTVSYCHIARCVCRRAERLAVHLNHNEAVAENAIKYLNRLSDYLFVLAR 172



>gi|146088233|ref|XP_001466024.1| conserved hypothetical protein [Leishmania infantum JPCM5]
 gi|134070125|emb|CAM68458.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 376

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 110/197 (55%), Gaps = 23/197 (11%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG----- 66
           PK S VYT+TGD G S+LF GERR K D VF ALG +DELSS +G+A    + A      
Sbjct: 173 PKHSMVYTKTGDNGSSALFTGERRRKADAVFEALGAIDELSSHVGLARAMLRSAAERHEH 232

Query: 67  -NGLEDKLVEIQCKLIEVGSNIATP--RNSSNTSKLSFTSFDE-----ENVNILESWIDN 118
              +   L EIQ +L+  G+ +ATP  +N  + +    T   E     E    L   ID 
Sbjct: 233 DEAMMSLLAEIQQELLNAGTVVATPTAKNVEDETAKHMTEILEGYRFPEKTEELAKNIDI 292

Query: 119 LDNQLPPLKNFILPSGGESA-VFLHQCRSVCRRAERVTVPLVEA-------EVTEQSVGK 170
           +D++L PL+ FILP GG  A   LH CR+ CRRAER  V L +         + + +V  
Sbjct: 293 IDSRLAPLRVFILPGGGNVASAQLHVCRTTCRRAERRMVTLGDLYGVTYTNHLRQATV-- 350

Query: 171 YLNRLSDFFFVAARYAA 187
           Y+NRLSDFFFVAAR  A
Sbjct: 351 YMNRLSDFFFVAARSVA 367



>gi|163848992|ref|YP_001637036.1| ATP--cobalamin adenosyltransferase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222526952|ref|YP_002571423.1| ATP/cobalamin adenosyltransferase [Chloroflexus sp. Y-400-fl]
 gi|501216282|ref|WP_012259300.1| ATP:cob(I)alamin adenosyltransferase [Chloroflexus sp. Y-400-fl]
 gi|163670281|gb|ABY36647.1| ATP--cobalamin adenosyltransferase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222450831|gb|ACM55097.1| ATP/cobalamin adenosyltransferase [Chloroflexus sp. Y-400-fl]
          Length = 178

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 103/174 (59%), Gaps = 15/174 (8%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGN--GLEDKLV 74
           +YTRTGD G++ LF G+R  KDD    A GTVDE ++++GVA    + AG    L+  L 
Sbjct: 3   IYTRTGDAGETGLFGGQRVRKDDLRVQAYGTVDECNAALGVA----RAAGPDPALDAVLA 58

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLS--FTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
            +Q +L  VG+++A+P  S    ++S   TSF       LE  ID ++ +L PLK FILP
Sbjct: 59  VVQNQLFVVGADLASPGESPYIPRVSAELTSF-------LEEQIDAMEAELSPLKQFILP 111

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G   A  LH  R++CRRAERV V L   E     +  YLNRLSDF FVAAR A
Sbjct: 112 GGHPVAAHLHLARTICRRAERVVVTLATEEEVRPEILTYLNRLSDFLFVAARIA 165



>gi|328541738|ref|YP_004301847.1| cobalamin adenosyltransferase, methylmalonyl-CoA mutase cofactor
           biosynthesis protein [Polymorphum gilvum SL003B-26A1]
 gi|503416216|ref|WP_013650877.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Polymorphum
           gilvum]
 gi|326411490|gb|ADZ68553.1| Cobalamin adenosyltransferase, methylmalonyl-CoA mutase cofactor
           biosynthesis protein [Polymorphum gilvum SL003B-26A1]
          Length = 191

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 102/169 (60%), Gaps = 1/169 (0%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGD G ++L +GERR K D    A GTVDE ++++G+       +   +++ L  I
Sbjct: 7   IYTRTGDDGTTALGSGERRPKHDVRIEAYGTVDETNATVGLVRLNLSDSDPRVDELLARI 66

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L ++G+++ATP    +         D + V  LE  ID L+  L PL++F+LP G  
Sbjct: 67  QNDLFDLGADLATPETGKDLGYEPLRITDAQ-VKALEEAIDALNANLAPLRSFVLPGGSP 125

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           +A +LH  R+V RRAER+ V L  AE    +  +Y+NRLSDFFFVA+RY
Sbjct: 126 AAAYLHLARTVARRAERLMVNLASAEAVNPAAIRYMNRLSDFFFVASRY 174



>gi|489662727|ref|WP_003567036.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium
           leguminosarum]
 gi|393175932|gb|EJC75974.1| ATP:cob(I)alamin adenosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2012]
          Length = 192

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 108/176 (61%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR+KDD    A GT+DE +S+IG+A  +       L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLVSGPRRTKDDLRVEAYGTIDEANSAIGLARLHTSGLPK-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP ++  T         E  V+ +E  ID L+  L PLK+FILP
Sbjct: 62  LMSIQNDLFDLGADLATP-DTGETPAYEPLRIVETQVDRVEHDIDQLNADLEPLKSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A  LH  R++ RRAER+ V L  ++ E+  +   KY+NRLSDF FVAAR+A
Sbjct: 121 GGSPAAAHLHLARTIARRAERLMVALARIDGEIVSEPARKYVNRLSDFLFVAARHA 176



>gi|493728123|ref|WP_006677461.1| ATP:cob(I)alamin adenosyltransferase [Paenibacillus dendritiformis]
 gi|374390131|gb|EHQ61487.1| hypothetical protein PDENDC454_14822 [Paenibacillus dendritiformis
           C454]
          Length = 196

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 101/171 (59%), Gaps = 5/171 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK-KAGNGLEDKLVE 75
           +YTRTGD+G +SL  G R SKD    +A G +DEL+S IG A   C+  A   L ++L+E
Sbjct: 3   IYTRTGDEGTTSLIGG-RVSKDHLRVDAYGELDELNSFIGWAAACCQGDAYEELRNQLIE 61

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQ ++ + GS++A              +   E V  LE+WID  +     ++ FILP G 
Sbjct: 62  IQHEVFDCGSDVAYAEKKQGEVVYKVHA---EQVARLEAWIDEHNAHTEAIRKFILPGGS 118

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           E+A  LH CR+VCRRAER  V L   E   Q V KY+NRLSD+FFVAAR A
Sbjct: 119 EAASALHVCRTVCRRAERRLVTLAREETVHQQVMKYVNRLSDYFFVAARRA 169



>gi|149631725|ref|XP_001516376.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like, partial [Ornithorhynchus anatinus]
          Length = 149

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 94/145 (64%)

Query: 58  ANHYCKKAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWID 117
           A    ++ G+   D+L +IQ  L +VGS++ATP +S+  + L  T   E+ V  LE WID
Sbjct: 2   AAELIRENGHAFVDELEKIQGFLQDVGSSLATPNSSAREAHLKQTRLSEKPVLTLERWID 61

Query: 118 NLDNQLPPLKNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSD 177
              +QLPPL  FILPSGG+S+  LH CR+VCRRAER  VPLV+A   + +V K+LNRLSD
Sbjct: 62  CYSDQLPPLTAFILPSGGKSSSALHICRAVCRRAERRVVPLVQAGEADANVAKFLNRLSD 121

Query: 178 FFFVAARYAAMFEKHIENYYEQRRD 202
           + F  ARY AM E + E  Y++  D
Sbjct: 122 YLFALARYVAMKEGNEEKMYKKEAD 146



>gi|489707217|ref|WP_003611354.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Methylosinus
           trichosporium]
 gi|296256279|gb|EFH03359.1| ATP/cobalamin adenosyltransferase [Methylosinus trichosporium OB3b]
          Length = 193

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 101/173 (58%), Gaps = 4/173 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTR GD G +SL  GERR KDD    A G VDE +S+IGVA      A   L+  L  I
Sbjct: 7   IYTRGGDSGATSLATGERRRKDDLRVEAYGAVDEANSAIGVA-RLATAAEPALDAMLARI 65

Query: 77  QCKLIEVGSNIATP-RNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           Q  L ++G+ +ATP R     +  +  +  +  V+ LE  ID L+  L PLK+F+LP G 
Sbjct: 66  QNDLFDLGAELATPQRPGVEPNGAARLAILQSQVDRLEREIDTLNAALAPLKSFVLPGGT 125

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEA--EVTEQSVGKYLNRLSDFFFVAARYA 186
            +A  LH  R++ RRAER+ V L  A  E  +    +Y+NRLSDF FVAARYA
Sbjct: 126 AAAAHLHVARAISRRAERMMVALANAPEETVDAPALRYVNRLSDFLFVAARYA 178



>gi|390943976|ref|YP_006407737.1| ATP:cob(I)alamin adenosyltransferase [Belliella baltica DSM 15883]
 gi|504585838|ref|WP_014772940.1| cobalamin adenosyltransferase [Belliella baltica]
 gi|390417404|gb|AFL84982.1| ATP:cob(I)alamin adenosyltransferase [Belliella baltica DSM 15883]
          Length = 182

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 105/172 (61%), Gaps = 5/172 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD GK+SL  G+R SK     +A GTVDEL+S IG+     ++  +     L E+
Sbjct: 3   IYTKTGDTGKTSLLGGKRVSKGHLKIDAYGTVDELNSFIGLLRD--QEVNSSRIGFLKEV 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q +L  +G+ +AT     N  K       EE++ ++E+ ID ++ +LPPLKNFILP G +
Sbjct: 61  QDRLFTIGATLATEVGKENIKK---PDIQEEDLLLMENEIDQMEEKLPPLKNFILPGGHQ 117

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAM 188
           S  F H  R+VCRR ER  + L+E E  ++ + +YLNRLSD+ FV  R  A+
Sbjct: 118 SVSFCHLARTVCRRTERCVIDLMELEPVDEIIVRYLNRLSDYLFVLGRLMAI 169



>gi|498294039|ref|WP_010608195.1| ATP:cob(I)alamin adenosyltransferase [Marinilabilia sp. AK2]
          Length = 182

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 100/171 (58%), Gaps = 5/171 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD GK+SL  G R  K D    A GTVDEL+S IG+       A  G  D L E+
Sbjct: 3   IYTKTGDTGKTSLLGGRRVFKSDLRIEAYGTVDELNSYIGLLRDQEINAKRG--DLLKEV 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q +L  +G+ +AT     N  +       E+++ +LE  ID ++N LPPL++FILP G +
Sbjct: 61  QDRLFTIGATLATEPGKENVKR---PDLHEKDLELLEKEIDAMENTLPPLRHFILPGGHQ 117

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
              F H  R+VCRR ER  + L++ E  ++ + KYLNRLSD+ FV  R  A
Sbjct: 118 VVSFCHITRTVCRRTERCVIDLMQVEHVDEIIVKYLNRLSDYLFVLGRLIA 168



>gi|345303062|ref|YP_004824964.1| ATP/cobalamin adenosyltransferase [Rhodothermus marinus
           SG0.5JP17-172]
 gi|503832814|ref|WP_014066808.1| ATP:cob(I)alamin adenosyltransferase [Rhodothermus marinus]
 gi|345112295|gb|AEN73127.1| ATP/cobalamin adenosyltransferase [Rhodothermus marinus
           SG0.5JP17-172]
          Length = 185

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/169 (42%), Positives = 96/169 (56%), Gaps = 4/169 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGD G + LF G R  K      A GTVDEL+S +G+   +     N L+  L  +
Sbjct: 3   IYTRTGDDGTTGLFGGGRVLKSAPRIAAYGTVDELNSWLGLVRAHLLPEENELDALLQRL 62

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L + G+++ATP +S   +       +  +V  LE  ID L+ QLPPLK FILP G  
Sbjct: 63  QGMLFDTGADLATPLDSRART----VRIEPRHVEALEQEIDRLEAQLPPLKTFILPGGAP 118

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           +A  LH  R+VCRRAER  V  ++ E     V ++LNRLSD  FV AR+
Sbjct: 119 AAAMLHVARTVCRRAERHVVKAMQQETLNPEVLRFLNRLSDLLFVLARW 167



>gi|219847175|ref|YP_002461608.1| ATP/cobalamin adenosyltransferase [Chloroflexus aggregans DSM 9485]
 gi|501673587|ref|WP_012615538.1| ATP:cob(I)alamin adenosyltransferase [Chloroflexus aggregans]
 gi|219541434|gb|ACL23172.1| ATP/cobalamin adenosyltransferase [Chloroflexus aggregans DSM 9485]
          Length = 179

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 101/172 (58%), Gaps = 11/172 (6%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG--LEDKLV 74
           +YTRTGD G++ LF G R  KD     A GT DE +S+IGVA    + AG    L+  L 
Sbjct: 3   IYTRTGDTGETGLFGGPRVRKDVLRVEAYGTADECNSAIGVA----RAAGPDPMLDAVLA 58

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
           E+Q +L  VG+++A+P +S    ++S T         LE  ID ++ +L PL+ FILP G
Sbjct: 59  EVQNQLFVVGADLASPNDSPYIPRVSATM-----TAFLEEQIDAMETELAPLQQFILPGG 113

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
              A +LH  R++CRRAERV V L   E     +  YLNRLSDF FVAAR A
Sbjct: 114 TTVAAYLHLARTICRRAERVVVSLAAEEAINPELLPYLNRLSDFLFVAARIA 165



>gi|492906624|ref|WP_006037030.1| ATP:cob(I)alamin adenosyltransferase [Paenibacillus
           curdlanolyticus]
 gi|304346502|gb|EFM12335.1| ATP/cobalamin adenosyltransferase [Paenibacillus curdlanolyticus
           YK9]
          Length = 183

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 101/171 (59%), Gaps = 7/171 (4%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK--LV 74
           +YT++GDKG++SL  G+R SK D    A GT DE +S IG+A     +    +E K    
Sbjct: 3   IYTKSGDKGQTSLVYGQRVSKHDLRVQAYGTCDEANSMIGLALSSLGQGKESMEIKQSFH 62

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
            IQ KL  VG+ +ATP   +    ++     +E+V  LE++ID+LD++LPPL  FILP G
Sbjct: 63  VIQTKLFHVGAELATPSGKNVAWPIT-----DEDVRYLEAFIDDLDSKLPPLTTFILPGG 117

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
             S    H  R++ RRAER+ V L+E E     V  YLNRLSD  FV AR+
Sbjct: 118 HPSGAAFHVARTIVRRAERIVVALLERETANPVVLAYLNRLSDLLFVTARF 168



>gi|489616389|ref|WP_003520829.1| hypothetical protein [Agrobacterium tumefaciens]
 gi|474938663|gb|EMS98339.1| hypothetical protein H009_07294 [Agrobacterium tumefaciens str.
           Cherry 2E-2-2]
          Length = 192

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 107/178 (60%), Gaps = 8/178 (4%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YTRTGDKG ++L +G RR K D    A GTVDE +S+IGVA  +       L+  
Sbjct: 3   KLNKIYTRTGDKGTTALVSGPRRLKHDLRVEAYGTVDETNSAIGVARLHMGGM-EKLDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD--EENVNILESWIDNLDNQLPPLKNFI 130
           L  IQ  L ++G+++ATP    +   LS+      E  V  LE+ ID+L+  L PL +F+
Sbjct: 62  LFRIQNDLFDLGADLATP---DSGEPLSYEPLRIVESQVTRLENEIDDLNAALEPLTSFV 118

Query: 131 LPSGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           LP G  +A  LH  R+VCRRAER+ V L   E E+   +  KY NRLSDF FVAAR+A
Sbjct: 119 LPGGSAAAASLHMARTVCRRAERLMVELSVTENEIVSPAALKYANRLSDFLFVAARFA 176



>gi|302037975|ref|YP_003798297.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Candidatus
           Nitrospira defluvii]
 gi|503014217|ref|WP_013249193.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Candidatus
           Nitrospira defluvii]
 gi|300606039|emb|CBK42372.1| Cob(I)yrinic acid a,c-diamide adenosyltransferase [Candidatus
           Nitrospira defluvii]
          Length = 198

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 108/191 (56%), Gaps = 9/191 (4%)

Query: 15  SNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG------ 68
           + VYTRTGD G++ L  G++  KD     A GTVDEL++S+G+      +AGNG      
Sbjct: 4   TKVYTRTGDAGQTRLAGGQQVWKDCLRVEAYGTVDELNASVGLVRAMNAEAGNGSAASTQ 63

Query: 69  LEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKN 128
           LE  L  +Q KL +VGS +AT    +  +    T+ D   V  LE  ID    +L PLK 
Sbjct: 64  LEADLRWVQNKLFDVGSILATAPGQTFPNMPEVTAKD---VTKLEEMIDRCQEELAPLKE 120

Query: 129 FILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAM 188
           FILP GG+ +  LHQ R++CRRAER+ + L   E     + KYLNRLSD  FV AR+ + 
Sbjct: 121 FILPGGGKVSATLHQARTICRRAERICIRLSREEAVAAELNKYLNRLSDALFVLARWVSK 180

Query: 189 FEKHIENYYEQ 199
            +   E  +++
Sbjct: 181 TQGEPEFLWQR 191



>gi|493748726|ref|WP_006697713.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium
           lupini]
 gi|408488526|gb|EKJ96837.1| hypothetical protein C241_04757 [Rhizobium lupini HPC(L)]
          Length = 192

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 108/179 (60%), Gaps = 10/179 (5%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG-NGLED 71
           K + +YTRTGDKG ++L +G RR K D    A GTVDE +S+IGVA  +   AG   L+ 
Sbjct: 3   KLNKIYTRTGDKGTTALVSGPRRPKHDLRVEAYGTVDETNSAIGVARLHT--AGLEKLDA 60

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD--EENVNILESWIDNLDNQLPPLKNF 129
            L  IQ  L ++G+++ATP +      L +      E  V  LES ID+L+  L PL +F
Sbjct: 61  MLFRIQNDLFDLGADLATPDDGE---PLPYEPLRIVESQVTRLESEIDDLNATLEPLTSF 117

Query: 130 ILPSGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           +LP G  +A  LH  R+VCRRAER+ V L   E E+   +  KY NRLSDF FVAAR+A
Sbjct: 118 VLPGGSAAAANLHLARTVCRRAERLMVELSVTENEIVSPAAIKYANRLSDFLFVAARFA 176



>gi|490580604|ref|WP_004445624.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium
           leguminosarum]
          Length = 192

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 108/179 (60%), Gaps = 10/179 (5%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG-NGLED 71
           K + +YTRTGDKG ++L +G RR K D    A GTVDE +S+IGVA  +   AG   L+ 
Sbjct: 3   KLNKIYTRTGDKGTTALVSGPRRPKHDLRVEAYGTVDETNSAIGVARLHT--AGLEKLDA 60

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD--EENVNILESWIDNLDNQLPPLKNF 129
            L  IQ  L ++G+++ATP    +   L +      E  V  LES ID+L+  L PL +F
Sbjct: 61  MLFRIQNDLFDLGADLATP---DDGEPLPYEPLRIVESQVTRLESEIDDLNAALEPLTSF 117

Query: 130 ILPSGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           +LP G  +A  LH  R+VCRRAER+ V L   E E+   +  KY NRLSDF FVAAR+A
Sbjct: 118 VLPGGSAAAANLHLARTVCRRAERLMVELSVTENEIVSPAAIKYANRLSDFLFVAARFA 176



>gi|255037058|ref|YP_003087679.1| ATP/cobalamin adenosyltransferase [Dyadobacter fermentans DSM
           18053]
 gi|506292984|ref|WP_015812759.1| cobalamin adenosyltransferase [Dyadobacter fermentans]
 gi|254949814|gb|ACT94514.1| ATP/cobalamin adenosyltransferase [Dyadobacter fermentans DSM
           18053]
          Length = 186

 Score =  136 bits (342), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 109/190 (57%), Gaps = 6/190 (3%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE 75
            +YT+TGDKG +SL  G R SK     +A GT+DEL+S IG+     +    G +D L E
Sbjct: 2   KIYTKTGDKGTTSLIGGTRLSKAHVRIDAYGTIDELNSYIGMLRD--QPVNEGRKDLLKE 59

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQ +L  +GS++A+    S+  K       +E++ +LE  +D +D ++PPL+ FILP G 
Sbjct: 60  IQDRLFTIGSHLAS---ESDQKKKILPDLHDEDIVLLEKEMDLIDAKVPPLRAFILPGGH 116

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIEN 195
            S  F H  R+VCRRAER  + L + E  E  V +YLNRLSD+ F+  R A   E  IE 
Sbjct: 117 ASVSFGHIARTVCRRAERAVIHLQQGEEVEPIVVRYLNRLSDYLFMLCR-AMTHELGIEE 175

Query: 196 YYEQRRDDRE 205
              Q R  RE
Sbjct: 176 ITWQPRVSRE 185



>gi|497276082|ref|WP_009590299.1| ATP:cob(I)alamin adenosyltransferase [Paenibacillus sp. HGF5]
 gi|328941366|gb|EGG37659.1| ATP:cob(I)alamin adenosyltransferase [Paenibacillus sp. HGF5]
          Length = 221

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 105/171 (61%), Gaps = 7/171 (4%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG-NGLEDKLVE 75
           VYTRTGD G++S+  G R  KDD    A GT+DEL+S +G A    K+A    L  +LV+
Sbjct: 38  VYTRTGDAGETSIIGG-RVPKDDPRIEAYGTIDELNSFVGQAVCLAKEADFEELYLQLVQ 96

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQ +L + GS++A  R   +  K+       E V+ LE+W+D  + + PPL+ FILP G 
Sbjct: 97  IQHELFDCGSDLAYARPREDKLKVG-----AELVDRLEAWLDAFEEKNPPLERFILPGGS 151

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
             +  LH CR+VCRRAER+TV L         V +YLNRLSD+FFVAAR A
Sbjct: 152 ALSSSLHVCRTVCRRAERLTVTLQRTTEINPEVRRYLNRLSDYFFVAARAA 202



>gi|325280600|ref|YP_004253142.1| ATP/cobalamin adenosyltransferase [Odoribacter splanchnicus DSM
           220712]
 gi|503377498|ref|WP_013612159.1| cobalamin adenosyltransferase [Odoribacter splanchnicus]
 gi|324312409|gb|ADY32962.1| ATP/cobalamin adenosyltransferase [Odoribacter splanchnicus DSM
           220712]
          Length = 184

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 106/171 (61%), Gaps = 3/171 (1%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG +SL  G+R  K+     + GT+DEL+S +G+   +  +    + ++LVEI
Sbjct: 3   IYTKTGDKGMTSLIGGKRVPKNSARLESYGTIDELNSFLGMIRSFPLE--QVIAEELVEI 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q +L +VG N+AT   +S   K+      EE++ +LE+ ID +D ++PP+K F+LP G +
Sbjct: 61  QSRLFDVGGNLATDPEASANLKVPI-GVTEEDIALLENGIDRMDAEVPPMKYFVLPGGNQ 119

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
              F H  R++CRRAER  + L      + SV KY+NRLSD+ F+ AR  A
Sbjct: 120 CVSFCHMARTICRRAERRILDLAAETEVDGSVMKYVNRLSDYLFILARKIA 170



>gi|268317147|ref|YP_003290866.1| ATP/cobalamin adenosyltransferase [Rhodothermus marinus DSM 4252]
 gi|502607004|ref|WP_012844089.1| ATP:cob(I)alamin adenosyltransferase [Rhodothermus marinus]
 gi|262334681|gb|ACY48478.1| ATP/cobalamin adenosyltransferase [Rhodothermus marinus DSM 4252]
          Length = 185

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 71/170 (41%), Positives = 95/170 (55%), Gaps = 4/170 (2%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE 75
            +YTRTGD G + LF G R  K      A GTVDEL+S +G+   +       L+  L  
Sbjct: 2   KIYTRTGDDGTTGLFGGGRVPKSHPRIAAYGTVDELNSWLGLVRAHLLPEETELDALLQR 61

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           +Q  L + G+++ATP +S   +       +  +V  LE  ID L+ QLPPLK FILP G 
Sbjct: 62  LQGMLFDTGADLATPLDSRART----VRIEPRHVEALEQEIDRLEAQLPPLKTFILPGGA 117

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
            +A  LH  R+VCRRAER  V  ++ E     V ++LNRLSD  FV AR+
Sbjct: 118 PAAAMLHVARTVCRRAERHVVKAMQQETLNPEVLRFLNRLSDLLFVLARW 167



>gi|495825820|ref|WP_008550399.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Pseudovibrio sp.
           JE062]
 gi|211958566|gb|EEA93766.1| ATP:cob(I)alamin adenosyltransferase [Pseudovibrio sp. JE062]
          Length = 191

 Score =  135 bits (341), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 103/172 (59%), Gaps = 5/172 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD G ++L +GERR K D    A GTVDE +S +G+   +  K    L++ L  I
Sbjct: 7   IYTKTGDDGTTALGSGERRQKHDLRIEAYGTVDETNSIVGIVRLHASKEMPVLDELLGRI 66

Query: 77  QCKLIEVGSNIATPRNSSNTS--KLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
           Q  L ++G+++ATP    +     L  T      V+ LE  ID ++ +L PLK+F+LP G
Sbjct: 67  QNDLFDLGADLATPDTGEDLGYEPLRITV---NQVSALEDAIDQMNVELTPLKSFVLPGG 123

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
              A +LHQ R+V RRAER+   L + E   +   +YLNRLSD FFVA+RYA
Sbjct: 124 TPLATYLHQARTVSRRAERLVAALYQKEKVNKQALQYLNRLSDLFFVASRYA 175



>gi|513235717|ref|XP_004950159.1| PREDICTED: cob(I)yrinic acid a,c-diamide adenosyltransferase,
           mitochondrial-like isoform X7 [Gallus gallus]
          Length = 166

 Score =  135 bits (340), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 84/127 (66%)

Query: 6   DDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKA 65
           +   P  +   +YTRTGD+G SS F GERR K D +F ALGT DELSS+IG+A+    + 
Sbjct: 36  EGGPPSARSPRIYTRTGDEGFSSTFTGERRPKGDRIFEALGTTDELSSAIGLASELSSEK 95

Query: 66  GNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPP 125
           G+   ++L ++QC L +VGSNIATP +S+  + L  TSF EE +  LE WID    QLPP
Sbjct: 96  GHAFVEQLHKVQCMLQDVGSNIATPLSSAREAHLKRTSFSEEPILELEKWIDRYSEQLPP 155

Query: 126 LKNFILP 132
           L+ FILP
Sbjct: 156 LRAFILP 162



>gi|511023063|ref|WP_016277372.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides massiliensis]
 gi|507752372|gb|EOS11330.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides massiliensis
           dnLKV3]
          Length = 187

 Score =  135 bits (340), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 108/190 (56%), Gaps = 10/190 (5%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS +YT+TGDKG +SL  G R  K      A GTVDEL+S +G+   Y        EDK
Sbjct: 2   KKSMIYTKTGDKGTTSLVGGTRVPKTHIRLEAYGTVDELNSHLGLLQTYLADE----EDK 57

Query: 73  --LVEIQCKLIEVGSNIATPRNSSNTSKLSFTS-FDEENVNILESWIDNLDNQLPPLKNF 129
             +  +Q KL  VGS +AT +  +   KL   S  ++E++ +LE  ID +DN+LPPL  F
Sbjct: 58  KIIFHVQNKLFSVGSYLATDQAQT---KLRMESRIEDEDIRMLEQAIDVIDNELPPLNAF 114

Query: 130 ILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMF 189
           ILP G   A   H CR+VCRRAER  + L E    +  V  ++NRLSD+ F+ AR     
Sbjct: 115 ILPGGDRGAAVGHICRTVCRRAERRILALAEECDIDVRVTAFVNRLSDYLFILARKLNQL 174

Query: 190 EKHIENYYEQ 199
            K  E Y+++
Sbjct: 175 TKTEEIYWDK 184



>gi|332373480|gb|AEE61881.1| unknown [Dendroctonus ponderosae]
          Length = 224

 Score =  135 bits (340), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 109/197 (55%), Gaps = 12/197 (6%)

Query: 8   NNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGN 67
           N P P+   +++R GD G S    GE   KD  +F+A+G  +EL S IG+A  Y  ++ +
Sbjct: 36  NAPCPQ---IFSREGDNGTSKTITGEALPKDSPIFSAIGAAEELLSYIGLAREYANESEH 92

Query: 68  GLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLK 127
              DKL  IQ  +I++ + I+  RNS       +T         LE WI     QLPP +
Sbjct: 93  EYTDKLKRIQTIIIDISTAIS--RNSKVAIPPVYTKE-------LEDWISEYAKQLPPPE 143

Query: 128 NFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
            +I+P GG ++  LH  RS+CR+AERV  PLV+ E  ++    YLNRLSDF   A+R AA
Sbjct: 144 QYIIPGGGVASASLHVARSICRKAERVVCPLVKDEKLDKEALVYLNRLSDFLLTASRIAA 203

Query: 188 MFEKHIENYYEQRRDDR 204
             ++  E+ Y  + D++
Sbjct: 204 KHDQRTESIYIPKPDEK 220



>gi|488764771|ref|WP_002687971.1| cobalamin adenosyltransferase [Bergeyella zoohelcum]
 gi|405585987|gb|EKB59779.1| ATP:cob(I)alamin adenosyltransferase [Bergeyella zoohelcum CCUG
           30536]
          Length = 191

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 7/185 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG+++L+ G R SK      A GTVDEL+S +G+A    +     L  +L +I
Sbjct: 3   IYTKTGDKGQTALYGGTRVSKSSARVEAYGTVDELNSFVGMAKSAIQ--NEKLISQLKKI 60

Query: 77  QCKLIEVGSNIATPRN----SSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q  L  +G+ +ATP +    ++  S+L     + +++  LE+WID+ +  L PL+ FILP
Sbjct: 61  QFDLFTLGAEVATPEDKLMLANGKSRLPLV-IEHQDIEKLENWIDDWEQMLQPLQFFILP 119

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           +G  ++  LH CR+V RRAER  V + E E +   + +YLNRLSD+FFV AR  A     
Sbjct: 120 AGDHASATLHVCRTVTRRAERALVFVNENENSRPELLQYLNRLSDYFFVVARVIAQENGT 179

Query: 193 IENYY 197
            E Y+
Sbjct: 180 AEEYW 184



>gi|495931413|ref|WP_008655992.1| ATP/cobalamin adenosyltransferase [Rhodopirellula europaea]
 gi|448887066|gb|EMB17454.1| ATP/cobalamin adenosyltransferase [Rhodopirellula europaea 6C]
          Length = 196

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 105/182 (57%), Gaps = 18/182 (9%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK-------KAGNGL 69
           +YTRTGD G + LF G R +KDD    A GTVDEL++++G      K       KA +GL
Sbjct: 3   IYTRTGDSGTTGLFGGPRVAKDDTRIEAYGTVDELNATLGQVRSALKEPAGQTLKANDGL 62

Query: 70  ED---KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPL 126
            +   ++ ++Q +L  +G+ +A+P    +  +       + ++  +E WID+ + QLPPL
Sbjct: 63  SELDARIAQVQHELFSIGAELASP----HPDQFDLRVIGQPHIQRIEDWIDDAEQQLPPL 118

Query: 127 KNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQ----SVGKYLNRLSDFFFVA 182
           K FILP G   A  +H  R+VCRRAER  + L +A  TE     SV  YLNRLSD+ FV 
Sbjct: 119 KQFILPGGSVLASHVHLSRAVCRRAERRVISLADAVQTETPISDSVIIYLNRLSDWLFVV 178

Query: 183 AR 184
           +R
Sbjct: 179 SR 180



>gi|478251577|gb|ENN72039.1| hypothetical protein YQE_11327, partial [Dendroctonus ponderosae]
          Length = 238

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 109/197 (55%), Gaps = 12/197 (6%)

Query: 8   NNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGN 67
           N P P+   +++R GD G S    GE   KD  +F+A+G  +EL S IG+A  Y  ++ +
Sbjct: 50  NAPCPQ---IFSREGDNGTSKTITGEALPKDSPIFSAIGAAEELLSYIGLAREYANESEH 106

Query: 68  GLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLK 127
              DKL  IQ  +I++ + I+  RNS       +T         LE WI     QLPP +
Sbjct: 107 EYTDKLKRIQTIIIDISTAIS--RNSKVAIPPVYTKE-------LEDWISEYAKQLPPPE 157

Query: 128 NFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
            +I+P GG ++  LH  RS+CR+AERV  PLV+ E  ++    YLNRLSDF   A+R AA
Sbjct: 158 QYIIPGGGVASASLHVARSICRKAERVVCPLVKDEKLDKEALVYLNRLSDFLLTASRIAA 217

Query: 188 MFEKHIENYYEQRRDDR 204
             ++  E+ Y  + D++
Sbjct: 218 KHDQRTESIYIPKPDEK 234



>gi|493328963|ref|WP_006286182.1| uncharacterized conserved protein [Paenibacillus popilliae]
 gi|410830302|dbj|GAC42693.1| uncharacterized conserved protein [Paenibacillus popilliae ATCC
           14706]
          Length = 196

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 101/171 (59%), Gaps = 5/171 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK-KAGNGLEDKLVE 75
           +YTRTGD+G +SL  G R SKD    +A G +DEL+S IG A   C+  A   L ++L+E
Sbjct: 3   IYTRTGDEGTTSLIGG-RVSKDHLRIDAYGELDELNSFIGWAAACCQGDAYEELRNQLIE 61

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQ ++ + G++IA        +     +   E V  LE+WID  +     ++ FILP G 
Sbjct: 62  IQHEVFDCGADIAYAEKKQVEAVYKVHA---EQVERLEAWIDEHNAHTAAIRKFILPGGS 118

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           E+A  LH CR++CRRAER  V L   E     V KY+NRLSD+FFVAAR A
Sbjct: 119 EAASALHVCRTICRRAERRLVTLAREETVHSQVMKYVNRLSDYFFVAARRA 169



>gi|494906686|ref|WP_007632728.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium sp.
           CCGE 510]
 gi|401811306|gb|EJT03675.1| cobalamin adenosultransferase [Rhizobium sp. CCGE 510]
          Length = 192

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 107/176 (60%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR+KDD    A GT+DE +S+IG+A  +       L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLVSGPRRTKDDLRVEAYGTIDEANSAIGLARLHTSGLPE-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP ++            E  V+ +E  ID L+  L PLK+FILP
Sbjct: 62  LMSIQNDLFDLGADLATP-DTGEPPAYEPLRIVETQVDRVEREIDQLNAGLQPLKSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLV--EAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A  LH  R++ RRAER+ V L   + E+  ++  KY+NRLSDF FVAAR+A
Sbjct: 121 GGSPAAAHLHLARTIARRAERLMVALARTDGEIVSEAAMKYVNRLSDFLFVAARHA 176



>gi|489605148|ref|WP_003509589.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Agrobacterium
           tumefaciens]
 gi|355533671|gb|EHH02995.1| hypothetical protein ATCR1_22781 [Agrobacterium tumefaciens
           CCNWGS0286]
          Length = 192

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 83/181 (45%), Positives = 107/181 (59%), Gaps = 14/181 (7%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLE-- 70
           K + +YTRTGDKG ++L +G RR K D    A GTVDE +S+IGVA  +      GLE  
Sbjct: 3   KLNKIYTRTGDKGTTALVSGPRRLKHDLRVEAYGTVDETNSAIGVARLHT----GGLERL 58

Query: 71  -DKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD--EENVNILESWIDNLDNQLPPLK 127
              L  IQ  L ++G+++ATP    N   LS+      E  V  LE+ ID L+  L PL 
Sbjct: 59  DAMLFRIQNDLFDLGADLATP---DNGEPLSYEPLRIVESQVTRLENEIDELNAALEPLT 115

Query: 128 NFILPSGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARY 185
           +F+LP G  +A  LH  R+VCRRAER+ V L   E E+   +  KY NRLSDF FVAAR+
Sbjct: 116 SFVLPGGSAAAANLHLARTVCRRAERLMVELSVSENEIVSPAALKYANRLSDFLFVAARF 175

Query: 186 A 186
           A
Sbjct: 176 A 176



>gi|497679173|ref|WP_009993357.1| putative cobalamin adenosultransferase protein [Rhizobium etli]
          Length = 192

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 105/176 (59%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR KDD    A GT+DE +S+IG+A  Y       L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLASGPRRRKDDLRVEAYGTIDEANSAIGLARLYTTDMAE-LDTM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP ++            E  V  +E  ID L+ +L PL +FILP
Sbjct: 62  LMSIQNDLFDLGADLATP-DTGEPPAYEPLRIVETQVERIERDIDRLNARLGPLTSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A  LH  R++ RRAER+ V L  +E E+   +  KY+NRLSDF FVAAR+A
Sbjct: 121 GGSPAAAHLHLARTIARRAERLMVTLARMEGEIVGGTAMKYINRLSDFLFVAARHA 176



>gi|495476759|ref|WP_008201446.1| cobalamin adenosyltransferase [Algoriphagus sp. PR1]
 gi|126574841|gb|EAZ79212.1| ATP:cob(I)alamin adenosyltransferase [Algoriphagus sp. PR1]
          Length = 182

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 107/185 (57%), Gaps = 5/185 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +Y++TGDKG ++L  G+R  K D   +A GT+DEL+S +G+        G    D L EI
Sbjct: 3   IYSKTGDKGTTALLGGKRVQKSDLRIDAYGTIDELNSFLGLVRDQPVNIGRA--DLLKEI 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q +L  +G+++AT        K       +E++ +LE+ ID ++++LPPL  FILP G +
Sbjct: 61  QDRLFTIGADLATVPGKDKVKK---PDLHKEDITLLENEIDQMESKLPPLTAFILPGGNQ 117

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           S  F H  R+VCRRAER++V L   E   + V +YLNRLSDF FV  R  +      E  
Sbjct: 118 SVSFCHVARTVCRRAERISVQLSTLEPVSELVIQYLNRLSDFLFVLGRLMSQELGAEEQT 177

Query: 197 YEQRR 201
           ++ R+
Sbjct: 178 WKPRK 182



>gi|338174726|ref|YP_004651536.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Parachlamydia
           acanthamoebae UV-7]
 gi|503690463|ref|WP_013924539.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Parachlamydia
           acanthamoebae]
 gi|336479084|emb|CCB85682.1| cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
           [Parachlamydia acanthamoebae UV-7]
          Length = 185

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 108/193 (55%), Gaps = 12/193 (6%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGN--GLEDKLV 74
           +YT+TGDKG++SL +GER  K+  +  A+G VDE +S+IG+A  +  K      L+ +L 
Sbjct: 3   IYTKTGDKGETSLSSGERVPKNHPLIEAIGNVDECNSAIGMALSFIPKNQKFKDLKARLF 62

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
            IQ  L E+G+ +A+P++             E    +LE WID +D +LPPL +FILP+G
Sbjct: 63  HIQHTLFELGALLASPQDE----------LPELGTTLLEEWIDQMDEKLPPLHHFILPNG 112

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIE 194
             ++  L   R++CRRAERV    ++     +    YLNRLSDF FVAAR       + E
Sbjct: 113 HSASTSLQLARAICRRAERVLTDAIQKNNASKESLVYLNRLSDFLFVAARLVNFISDNPE 172

Query: 195 NYYEQRRDDRESN 207
             +  +     +N
Sbjct: 173 TIWLSKLKKTTTN 185



>gi|261408891|ref|YP_003245132.1| ATP/cobalamin adenosyltransferase [Paenibacillus sp. Y412MC10]
 gi|506217358|ref|WP_015737133.1| ATP:cob(I)alamin adenosyltransferase [Paenibacillus sp. Y412MC10]
 gi|261285354|gb|ACX67325.1| ATP/cobalamin adenosyltransferase [Paenibacillus sp. Y412MC10]
          Length = 186

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 104/172 (60%), Gaps = 7/172 (4%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG-NGLEDKLV 74
            VYTRTGD G++S+  G R  KDD    A GT+DEL+S +G A    K+A    L  +LV
Sbjct: 2   KVYTRTGDAGETSIIGG-RVPKDDPRIEAYGTIDELNSFVGQAVCLAKEADFEELYLQLV 60

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
           +IQ +L + GS++A  R   +  K+       E V+ LE+W+D  + + PPL+ FILP G
Sbjct: 61  QIQHELFDCGSDLAYARPREDKLKVG-----AELVDRLEAWLDAFEEKNPPLERFILPGG 115

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
              +  LH CR+VCRRAER+TV L         V +YLNRLSD+FFV AR A
Sbjct: 116 SALSSSLHVCRTVCRRAERLTVTLQRTTEINPEVRRYLNRLSDYFFVVARAA 167



>gi|157870383|ref|XP_001683742.1| conserved hypothetical protein [Leishmania major strain Friedlin]
 gi|68126808|emb|CAJ05404.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 376

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/194 (43%), Positives = 110/194 (56%), Gaps = 19/194 (9%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG------ 66
           K S VYT+TGD G S+LF GERR K D VF ALG +DELSS +G+A    + A       
Sbjct: 174 KHSMVYTKTGDNGASALFTGERRRKADAVFEALGAIDELSSHVGLARAMLRSASERHEHD 233

Query: 67  NGLEDKLVEIQCKLIEVGSNIATP--RNSSNTSKLSFTSFDE-----ENVNILESWIDNL 119
             +   LVEIQ +L+  G+ +ATP  +N    +    T   E     E    L   ID +
Sbjct: 234 EAMMSMLVEIQQELLNAGTVVATPTAKNLEVETAKHMTEILEGYRFPEKTEELAKNIDII 293

Query: 120 DNQLPPLKNFILPSGGE-SAVFLHQCRSVCRRAERVTVPLVE---AEVTE--QSVGKYLN 173
           D+++ PL+ FILP GG  ++  LH CR+ CRRAER  V L +   A  T+  +    Y+N
Sbjct: 294 DSRIAPLRVFILPGGGNLASAQLHVCRTTCRRAERRMVTLGDLYGATYTDHLRQATVYMN 353

Query: 174 RLSDFFFVAARYAA 187
           RLSDFFFVAAR  A
Sbjct: 354 RLSDFFFVAARSVA 367



>gi|295132949|ref|YP_003583625.1| cobalamin adenosyltransferase [Zunongwangia profunda SM-A87]
 gi|502835605|ref|WP_013070581.1| cobalamin adenosyltransferase [Zunongwangia profunda]
 gi|294980964|gb|ADF51429.1| cobalamin adenosyltransferase family protein [Zunongwangia profunda
           SM-A87]
          Length = 190

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 106/172 (61%), Gaps = 6/172 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG ++LF G R  K      + GTVDEL++ IG+     +K  +     L+EI
Sbjct: 3   IYTKTGDKGTTALFGGTRVPKHHIRIESYGTVDELNAHIGLIRD--QKIDDTTAKVLLEI 60

Query: 77  QCKLIEVGSNIAT-PRNSS---NTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q KL  +G+ +AT P  ++     S+L+     EE++++LE+ +D ++ +LP + +FILP
Sbjct: 61  QHKLFTIGAILATDPEKATLKNGKSRLNIPRISEEDIHLLETEMDRMNEELPEMTHFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
            G +S  F H  R VCRRAER++  L   E  ++ V KYLNRLSD+ FV AR
Sbjct: 121 GGHQSVSFCHIARCVCRRAERLSTALYNQEAFDEEVLKYLNRLSDYLFVLAR 172



>gi|498350435|ref|WP_010664591.1| cobalamin adenosyltransferase [Marinilabilia salmonicolor]
          Length = 186

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 105/176 (59%), Gaps = 4/176 (2%)

Query: 14  KSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKL 73
           KS VYT+TGDKGK+SL  G R  K      A GTVDEL+++IG+   +  +    +   +
Sbjct: 3   KSQVYTKTGDKGKTSLIGGTRVDKHHYRLEAYGTVDELNANIGMIRSWPNE--ESINKTV 60

Query: 74  VEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPS 133
           + IQ +L  +G+ +AT  + S+    +  + DE  + +LE  +D ++  LPPLKNFILP 
Sbjct: 61  LHIQDQLFMIGAYLATDDSVSDLR--TRLNSDESEITLLEREMDKMEESLPPLKNFILPG 118

Query: 134 GGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMF 189
           G  +A + H  R+VCRRAER    + E       V +YLNRLSD+FFV +RY + F
Sbjct: 119 GHPAATYAHIARTVCRRAERRVNEMAEKTDVATWVIRYLNRLSDYFFVLSRYLSNF 174



>gi|488739837|ref|WP_002663214.1| cobalamin adenosyltransferase [Bergeyella zoohelcum]
 gi|405582913|gb|EKB56888.1| ATP:cob(I)alamin adenosyltransferase [Bergeyella zoohelcum ATCC
           43767]
          Length = 191

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 111/185 (60%), Gaps = 7/185 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG+++L+ G R SK      A GTVDEL+S +G+A    +     L  +L +I
Sbjct: 3   IYTKTGDKGQTALYGGTRVSKSSARVEAYGTVDELNSFVGMAKSAIQN--EKLIGQLKKI 60

Query: 77  QCKLIEVGSNIATPRN----SSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q  L  +G+ +ATP +    ++  S+L     + +++  LE+WID+ +  L PL+ FILP
Sbjct: 61  QFDLFTLGAEVATPEDKLMLANGKSRLPLV-IEHQDIEKLENWIDDWEQILQPLQFFILP 119

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
           +G  ++  LH CR+V RRAER  V + E E +   + +YLNRLSD+FFV AR  A     
Sbjct: 120 AGDHASATLHVCRTVTRRAERALVFVNENENSRPELLQYLNRLSDYFFVVARVIAQKNGT 179

Query: 193 IENYY 197
            E Y+
Sbjct: 180 AEEYW 184



>gi|493240180|ref|WP_006212216.1| ATP:cob(I)alamin adenosyltransferase [Paenibacillus vortex]
 gi|315275681|gb|EFU39035.1| ATP/cobalamin adenosyltransferase [Paenibacillus vortex V453]
          Length = 186

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/184 (42%), Positives = 109/184 (59%), Gaps = 7/184 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG-NGLEDKLVE 75
           VYTRTGD G++S+  G R  KDD    A GT+DEL+S +G A    ++   + L  +L+ 
Sbjct: 3   VYTRTGDAGETSIIGG-RVPKDDPRIEAYGTIDELNSFVGQAVFLAQEVDFDELYLQLMR 61

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQ +L + GS++A  R   +  K+S      E V+ LE+W+D  + + PPL+ FILP G 
Sbjct: 62  IQHELFDCGSDLAYARPREDKLKVS-----AELVDNLETWLDAFEEKNPPLERFILPGGS 116

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIEN 195
             +  LH CR+VCRRAER+TV L         V +YLNRLSD+FFV AR A  F    + 
Sbjct: 117 ALSSSLHVCRTVCRRAERLTVTLQRTTEINPEVRRYLNRLSDYFFVTARAANAFSGIKDV 176

Query: 196 YYEQ 199
            YE+
Sbjct: 177 EYER 180



>gi|494842309|ref|WP_007568409.1| cobalamin adenosyltransferase [Bacteroides coprocola]
 gi|189433337|gb|EDV02322.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides coprocola DSM
           17136]
          Length = 189

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 109/189 (57%), Gaps = 6/189 (3%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS +YTRTGD G +SL  G R  K      A GTVDEL+++IGV     +     + D 
Sbjct: 2   KKSVIYTRTGDGGTTSLVGGMRVPKTHIRLEAYGTVDELNANIGVLATCVEDVA--ICDF 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ KL  +G+ +AT  + S T     +    E +  LE+ ID LDN LPPLK F+LP
Sbjct: 60  LLYIQHKLFSLGAYLAT--DQSVTELHVESQISAEAIKRLETAIDELDNSLPPLKAFVLP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAE--VTEQSVGKYLNRLSDFFFVAARYAAMFE 190
            G  SA   H CR+VCRRAER  + L E E  + +  + +++NRLSD+ F+ +R      
Sbjct: 118 GGAFSASLCHVCRTVCRRAERRILALEEHENCIIDPEIKQFVNRLSDYLFILSRKLNQLT 177

Query: 191 KHIENYYEQ 199
           +H E Y+++
Sbjct: 178 QHDEIYWDK 186



>gi|374855250|dbj|BAL58112.1| ATP--cobalamin adenosyltransferase [uncultured prokaryote]
          Length = 194

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 101/184 (54%), Gaps = 4/184 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           VYTR GD G ++L  G+R  KD     A GTVDEL+S+IGVA      A   ++ +L  +
Sbjct: 13  VYTRAGDDGTTALGGGQRVPKDSPRIEAYGTVDELNSAIGVA--LALGAAEPIKARLAVV 70

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L  +G+++      S+  +L     +  +V  LE W+D  + +L PLK+F+LP G  
Sbjct: 71  QHILFNLGADLCI--LESDKERLPAPRVEARHVEELERWMDEWNAELEPLKSFVLPGGDP 128

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           +A  LH  R+VCRRAER  + L   E     V  YLNRL DF FVAARY A      E  
Sbjct: 129 AAAQLHVARTVCRRAERRVIALSRQEAVGPYVIPYLNRLGDFLFVAARYQAKLSNTAETL 188

Query: 197 YEQR 200
           ++ R
Sbjct: 189 WDSR 192



>gi|489678375|ref|WP_003582607.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium
           leguminosarum]
 gi|393181458|gb|EJC81497.1| ATP:cob(I)alamin adenosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2297]
          Length = 192

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 105/176 (59%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR+KDD    A GT+DE +S+IGVA  +       L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLVSGPRRAKDDLRVEAYGTIDEANSAIGVARLHTSGLPE-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP      +       D + V+ LE  ID L+  L PLK+FILP
Sbjct: 62  LMSIQNDLFDLGADLATPDTGEPPTYEPLRIVDTQ-VDRLEHDIDQLNAGLEPLKSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLV--EAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A  LH  R++ RRAER+ V L   + E   +   KY+NRLSDF FVAAR+A
Sbjct: 121 GGSPAAAQLHLARTIARRAERLMVALARTDGETVSEPARKYVNRLSDFLFVAARHA 176



>gi|66812588|ref|XP_640473.1| hypothetical protein DDB_G0281875 [Dictyostelium discoideum AX4]
 gi|60468493|gb|EAL66497.1| hypothetical protein DDB_G0281875 [Dictyostelium discoideum AX4]
          Length = 190

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 119/199 (59%), Gaps = 18/199 (9%)

Query: 4   MTDDNNPKPKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK 63
           M+DD   K  +S +YT+TGDKG S+L+NGERR K+D  F++LG++DELS+ IGVA  YC 
Sbjct: 1   MSDDE--KKFRSKLYTKTGDKGTSALYNGERRPKNDTFFHSLGSIDELSACIGVALEYCL 58

Query: 64  KAGNGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEEN-VNILESWIDNLDNQ 122
              NGLE  L  I   ++++G+ IATP ++S    +  T  D+   V  LE WID +D+Q
Sbjct: 59  IDKNGLEPYLERIVGVMLDIGACIATPLDNSQEKHIKKTKLDDRKYVETLERWIDTIDSQ 118

Query: 123 LPPLKNFILPSG-GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFV 181
           LPPLK FI+P   G ++  LH  RS                +  + VG ++NRLSDF F 
Sbjct: 119 LPPLKFFIIPCNVGLASSHLHVARSF--------------SLVPEVVGIFINRLSDFLFA 164

Query: 182 AARYAAMFEKHIENYYEQR 200
           AAR+AAM     E Y+  +
Sbjct: 165 AARFAAMKSGKDEAYWTSK 183



>gi|170749366|ref|YP_001755626.1| ATP--cobalamin adenosyltransferase [Methylobacterium radiotolerans
           JCM 2831]
 gi|501276892|ref|WP_012319910.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Methylobacterium
           radiotolerans]
 gi|170655888|gb|ACB24943.1| ATP--cobalamin adenosyltransferase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 190

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 105/178 (58%), Gaps = 10/178 (5%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YTRTGDKG ++L +G+RRSK D      GTVDE ++ IG+A  + +   +G+   
Sbjct: 3   KLNRIYTRTGDKGTTALADGQRRSKADLRVETYGTVDETNACIGMARLHTQGPLDGM--- 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD--EENVNILESWIDNLDNQLPPLKNFI 130
           L  IQ  L ++G+++ATP        L +         V+ LE  ID L+  +PPLK+F+
Sbjct: 60  LGAIQNDLFDLGADLATP---PTPEPLPYEPLRIVASQVDRLERDIDALNAAIPPLKSFV 116

Query: 131 LPSGGESAVFLHQCRSVCRRAERVTVPLV--EAEVTEQSVGKYLNRLSDFFFVAARYA 186
           LP G  +A  LH  R+VCRRAER+ V L   E E       +YLNRLSDF FVA+R A
Sbjct: 117 LPGGSPAAAALHLARTVCRRAERLAVSLAAREGETVSPEALRYLNRLSDFLFVASRAA 174



>gi|495860963|ref|WP_008585542.1| cobalamin adenosyltransferase [Niabella soli]
 gi|373231565|gb|EHP51360.1| ATP/cobalamin adenosyltransferase [Niabella soli DSM 19437]
          Length = 186

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 102/173 (58%), Gaps = 8/173 (4%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK--LV 74
           +YT+TGDKG ++L  G + SK D    A GTVDEL+S  G+    CK+  + +  K  L 
Sbjct: 5   IYTKTGDKGTTALIGGTKVSKADLRIEAYGTVDELNSYTGL----CKELLSDVRSKEILQ 60

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
           E+Q +L  +G+ +A  ++    +K++     EE++ +LE  ID +  QLP +K+FILP G
Sbjct: 61  EVQDRLFTIGAVLA--QDPDKKTKMTLPDLHEEDIVLLEKEIDVMTGQLPEMKSFILPGG 118

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
                 LH  R +CRRAER+ V L E    E  V KYLNRLSD+ FV ARY  
Sbjct: 119 SVPVAQLHIARCICRRAERLVVGLSETSPVEPVVPKYLNRLSDYLFVLARYTG 171



>gi|493359084|ref|WP_006315577.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Agrobacterium
           sp. ATCC 31749]
 gi|333791070|gb|EGL62461.1| hypothetical protein AGRO_4720 [Agrobacterium sp. ATCC 31749]
          Length = 192

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 106/178 (59%), Gaps = 8/178 (4%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YTRTGDKG ++L +G RR K D    A GTVDE +S+IG+A  +       L+  
Sbjct: 3   KLNKIYTRTGDKGTTALVSGPRRLKHDLRVEAYGTVDETNSAIGIARLHTSGL-ETLDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD--EENVNILESWIDNLDNQLPPLKNFI 130
           L  IQ  L ++G+++ATP    N   LS+      +  V  LE+ ID L+  L PL +F+
Sbjct: 62  LFRIQNDLFDLGADLATP---DNGEPLSYEPLRIVKSQVTRLENEIDELNAALEPLTSFV 118

Query: 131 LPSGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           LP G  +A  LH  R++CRRAER+ V L   + E+   +  KY NRLSDF FVAAR+A
Sbjct: 119 LPGGSAAAANLHMARTICRRAERLMVELSVTDNEIVSPAALKYANRLSDFLFVAARFA 176



>gi|153006427|ref|YP_001380752.1| ATP--cobalamin adenosyltransferase [Anaeromyxobacter sp. Fw109-5]
 gi|501046613|ref|WP_012098392.1| ATP:cob(I)alamin adenosyltransferase [Anaeromyxobacter sp. Fw109-5]
 gi|152030000|gb|ABS27768.1| ATP--cobalamin adenosyltransferase [Anaeromyxobacter sp. Fw109-5]
          Length = 187

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 106/189 (56%), Gaps = 6/189 (3%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE 75
            +YT++GD+G++ LF G R  K D   +A G VDEL++++G A    +     L+  L  
Sbjct: 2   KIYTKSGDRGETGLFGGPRVRKSDARVDAYGEVDELNAALGAARAIVED--PELDGHLAR 59

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
            Q +L  VG+ +ATP ++   S  +    D      LE+ ID  D +LPPL+ F+LP G 
Sbjct: 60  AQHELFCVGAELATPHDAKARS--AIPPIDAGWTARLEAAIDAWDAELPPLRQFVLPGGT 117

Query: 136 ESAVFLHQCRSVCRRAERVTVPLV-EAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIE 194
            +A  LH  R VCRRAER  V L  E EV  +++  YLNRLSDF FVAAR A    +  E
Sbjct: 118 RTAAALHLARCVCRRAERRVVALAAEVEVAPETLA-YLNRLSDFLFVAARLANHRARREE 176

Query: 195 NYYEQRRDD 203
             +E  R D
Sbjct: 177 IAWEPPRGD 185



>gi|159185812|ref|NP_357019.2| hypothetical protein Atu3593 [Agrobacterium fabrum str. C58]
 gi|499279434|ref|WP_010973170.1| hypothetical protein [Agrobacterium fabrum]
 gi|159140946|gb|AAK89804.2| conserved hypothetical protein [Agrobacterium fabrum str. C58]
          Length = 192

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 105/177 (59%), Gaps = 8/177 (4%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YTRTGDKG ++L +G RR K D    A GTVDE +S+IG+A  +       L+  
Sbjct: 3   KLNKIYTRTGDKGTTALVSGPRRLKHDLRVEAYGTVDETNSAIGIARLHTSGL-ETLDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD--EENVNILESWIDNLDNQLPPLKNFI 130
           L  IQ  L ++G+++ATP    N   LS+      E  V  LE+ ID L+  L PL +F+
Sbjct: 62  LFRIQNDLFDLGADLATP---DNGEPLSYEPLRIVESQVMRLENEIDELNAALEPLTSFV 118

Query: 131 LPSGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARY 185
           LP G  +A  LH  R+VCRRAER+ V L   + E+   +  KY NRLSDF FVAAR+
Sbjct: 119 LPGGSAAAANLHMARTVCRRAERLMVELSVTDNEIVSPAALKYANRLSDFLFVAARF 175



>gi|150004033|ref|YP_001298777.1| hypothetical protein BVU_1468 [Bacteroides vulgatus ATCC 8482]
 gi|492443032|ref|WP_005845453.1| cobalamin adenosyltransferase [Bacteroides vulgatus]
 gi|149932457|gb|ABR39155.1| conserved hypothetical protein [Bacteroides vulgatus ATCC 8482]
 gi|254835704|gb|EET16013.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides sp. 4_3_47FAA]
 gi|294448129|gb|EFG16695.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides vulgatus PC510]
 gi|317388679|gb|EFV69525.1| hypothetical protein HMPREF9011_00045 [Bacteroides sp. 3_1_40A]
 gi|392687227|gb|EIY80523.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides vulgatus
           CL09T03C04]
 gi|507739756|gb|EOR98868.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides vulgatus dnLKV7]
          Length = 187

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS +YT+TGDKG +SL  G R  K      A GTVDEL+S +G+   Y        EDK
Sbjct: 2   KKSMIYTKTGDKGTTSLVGGTRVPKTHIRLEAYGTVDELNSYLGLLQTYLTDE----EDK 57

Query: 73  --LVEIQCKLIEVGSNIATPRNSSNTSKLSFTS-FDEENVNILESWIDNLDNQLPPLKNF 129
             +  IQ KL  VGS +AT +  +   KL   S  ++E++ +LE  ID +DN+LPPL  F
Sbjct: 58  QIIFRIQNKLFSVGSYLATDQTQT---KLRMESRIEDEDIRMLEQAIDVIDNELPPLNAF 114

Query: 130 ILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMF 189
           ILP G   A   H CR+VCRRAER  + L E    +  V  ++NRLSD+ F+  R     
Sbjct: 115 ILPGGDRGAAVGHICRTVCRRAERRILALAEECDIDARVTAFVNRLSDYLFILTRKLNHL 174

Query: 190 EKHIENYYEQ 199
            K  E ++++
Sbjct: 175 TKTDEIFWDK 184



>gi|86359373|ref|YP_471265.1| hypothetical protein RHE_CH03790 [Rhizobium etli CFN 42]
 gi|499746256|ref|WP_011426990.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium etli]
 gi|86283475|gb|ABC92538.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 192

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 104/176 (59%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR KDD    A GT+DE +S+IG+A  Y       L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLASGRRRRKDDLRVAAYGTIDEANSAIGLARLYTTGLPE-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP ++            E  V  +E  ID L+  L PLK+FILP
Sbjct: 62  LISIQNDLFDLGADLATP-DTGEPPAYEPLRIVETQVERIERDIDRLNADLDPLKSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A  LH  R++ RRAER+ V L   + E+  +   KY+NRLSDF FVAAR+A
Sbjct: 121 GGSPAAAHLHLARTIARRAERLMVTLGRTDGEIVGEIAMKYINRLSDFLFVAARHA 176



>gi|375013212|ref|YP_004990200.1| ATP:cob(I)alamin adenosyltransferase [Owenweeksia hongkongensis DSM
           17368]
 gi|503968910|ref|WP_014202904.1| cobalamin adenosyltransferase [Owenweeksia hongkongensis]
 gi|359349136|gb|AEV33555.1| ATP:cob(I)alamin adenosyltransferase [Owenweeksia hongkongensis DSM
           17368]
          Length = 181

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 103/184 (55%), Gaps = 6/184 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+ GDKG++SL  G R SK D    A GTVDEL+S IGV     K      E+ LV I
Sbjct: 3   IYTKKGDKGETSLIGGVRVSKTDTRIEAYGTVDELNSVIGVIRDSAKD--RQAEETLVSI 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L  VGS +A    S+  SK+     +  ++ +LE+ +D ++  LP LKNFILP G  
Sbjct: 61  QNILFTVGSELA----SAPGSKMKLPEVEVSDIELLETEMDKMNEDLPDLKNFILPGGDL 116

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           +A   H  R VCRRAER  V L +    ++ + KYLNRLSD+ F  AR+       +E  
Sbjct: 117 AASHCHVARCVCRRAERRAVALAQVAEVDEKIIKYLNRLSDYLFTLARFYTHKHGGVETP 176

Query: 197 YEQR 200
           ++ R
Sbjct: 177 WKTR 180



>gi|497863181|ref|WP_010177337.1| cobalamin adenosyltransferase [Aquimarina agarilytica]
          Length = 189

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 103/168 (61%), Gaps = 3/168 (1%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGD+G +SL+ G+R  K +D  +A GT+DEL+S IG+     ++     ++ L +I
Sbjct: 3   IYTKTGDEGFTSLYGGKRVPKSNDRIDAYGTIDELNSFIGLLRD--QEISITHKNFLTQI 60

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q +L  +GS +ATP N+    KL+      E +  LE+ ID+LD  L P+ +FILP G  
Sbjct: 61  QIELFSIGSILATPHNNQK-KKLNIQKISIEEIEALENEIDHLDTSLNPMTHFILPGGHV 119

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           +  + H  RS+CRRAER+   L   E  E+ V  YLNRLSD+ FV AR
Sbjct: 120 TVSYCHVARSICRRAERLAYALHHHEPLEKEVLIYLNRLSDYLFVLAR 167



>gi|332668284|ref|YP_004451072.1| ATP/cobalamin adenosyltransferase [Haliscomenobacter hydrossis DSM
           1100]
 gi|503534643|ref|WP_013768719.1| cobalamin adenosyltransferase [Haliscomenobacter hydrossis]
 gi|332337098|gb|AEE54199.1| ATP/cobalamin adenosyltransferase [Haliscomenobacter hydrossis DSM
           1100]
          Length = 183

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 102/172 (59%), Gaps = 8/172 (4%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG++ LF G+R  K D    + GTVDEL+S IG+   Y ++  +   D L  I
Sbjct: 5   IYTKTGDKGETGLFGGKRLPKYDLRIESYGTVDELNSYIGLVRDYLEE--DTTRDFLKAI 62

Query: 77  QCKLIEVGSNIAT-PRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           Q +L  +G+N+A+ P  S +T  L      E +V  LE  +D +D  LP LKNFILP G 
Sbjct: 63  QDRLFTIGANLASDPDKSMSTPDLL-----ETDVQSLEQQMDLMDETLPALKNFILPGGH 117

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
            +  F H  R+VCRRAER  V L   E  ++ V  YLNRLSD+ FV +R  A
Sbjct: 118 PTVSFCHIARTVCRRAERQVVALAANEAVDEIVMVYLNRLSDYLFVLSRKVA 169



>gi|493386115|ref|WP_006342321.1| hypothetical protein [Parachlamydia acanthamoebae]
 gi|281498092|gb|EFB40434.1| hypothetical protein pah_c205o086 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 186

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 104/183 (56%), Gaps = 12/183 (6%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGN--GLEDKLV 74
           +YT+TGDKG++SL +GER  K+  +  A+G VDE +S+IG+A  +  K      L+ +L 
Sbjct: 3   IYTKTGDKGETSLSSGERVPKNHPLIEAIGNVDECNSAIGMALSFIPKNQKFKDLKARLF 62

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
            IQ  L E+G+ +A+P++             E    +LE WID +D +LPPL +FILP+G
Sbjct: 63  HIQHTLFELGALLASPQDE----------LPELGTTLLEEWIDQMDEKLPPLHHFILPNG 112

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIE 194
             ++  L   R++CRRAER     ++     +    YLNRLSDF FVAAR       + E
Sbjct: 113 HSASTSLQLARAICRRAERALTDAIQKNNASKESLVYLNRLSDFLFVAARLVNFISDNPE 172

Query: 195 NYY 197
             +
Sbjct: 173 TIW 175



>gi|226226010|ref|YP_002760116.1| hypothetical protein GAU_0604 [Gemmatimonas aurantiaca T-27]
 gi|501978902|ref|WP_012682093.1| ATP:cob(I)alamin adenosyltransferase [Gemmatimonas aurantiaca]
 gi|226089201|dbj|BAH37646.1| hypothetical protein GAU_0604 [Gemmatimonas aurantiaca T-27]
          Length = 181

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/171 (42%), Positives = 96/171 (56%), Gaps = 2/171 (1%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE 75
            +YTRTGD G ++LF G R  KD     A G VDEL++S+G+A   C +    +++ LV 
Sbjct: 2   KIYTRTGDTGGTALFGGGRVGKDHPRVEAYGDVDELNASLGMAR--CIEVMPRIDEVLVP 59

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQ  L  +G+ +ATP +      L+    DEE +  LE  ID  D +L PL++FI+P G 
Sbjct: 60  IQRDLFAIGALLATPDHDKMRDHLAKARIDEERIAELERAIDQCDQELEPLRSFIIPGGT 119

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
             A  LH  R+VCRRAER  V L +       V  YLNRLSD  F  AR A
Sbjct: 120 PKAAALHVARTVCRRAERRVVHLAQEIELPALVITYLNRLSDLLFTLARVA 170



>gi|489638850|ref|WP_003543290.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium
           leguminosarum]
 gi|393168259|gb|EJC68306.1| ATP:cob(I)alamin adenosyltransferase [Rhizobium leguminosarum bv.
           viciae WSM1455]
          Length = 192

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 105/176 (59%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR KDD    A GT+DE +S+IG+A  +       L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLVSGPRRLKDDLRVEAYGTIDEANSAIGLARLHTPDLPE-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP ++            E  V+ +E  ID L+  L PLK+FILP
Sbjct: 62  LMSIQNDLFDLGADLATP-DTGEPPAYEPLRIAETQVDRVERDIDQLNAGLEPLKSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLV--EAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A  LH  R++ RRAER+ V L   + E+  +   KY+NRLSDF FVAAR+A
Sbjct: 121 GGSPAAAHLHLARTIARRAERLMVALARTDGEIVGEPAMKYVNRLSDFLFVAARHA 176



>gi|297624454|ref|YP_003705888.1| ATP/cobalamin adenosyltransferase [Truepera radiovictrix DSM 17093]
 gi|502943732|ref|WP_013178708.1| ATP:cob(I)alamin adenosyltransferase [Truepera radiovictrix]
 gi|297165634|gb|ADI15345.1| ATP/cobalamin adenosyltransferase [Truepera radiovictrix DSM 17093]
          Length = 194

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 108/194 (55%), Gaps = 8/194 (4%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNG----LEDK 72
           +YTRTGD G ++L+ GER SKD     A GTVDE ++ +G+A     ++  G    ++  
Sbjct: 3   IYTRTGDGGTTALYGGERVSKDAARVEAYGTVDEANALLGLARAQLGRSPLGGDDDVDAL 62

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKL-SFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           L  +Q  L EVG+++ATP +S   + L   ++ D E    LE  ID L+ +LPPLK FIL
Sbjct: 63  LDALQRTLFEVGTDLATPLSSKYRANLVPLSAADAEE---LERHIDRLEAELPPLKAFIL 119

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEK 191
           P G  +A  LH  R+V RRAER    L   E     VG YLNRLSD  FV AR+  +  +
Sbjct: 120 PGGHPAAASLHLARTVVRRAERRVAGLAHEEAVNPHVGVYLNRLSDLLFVLARFVNVRSQ 179

Query: 192 HIENYYEQRRDDRE 205
             E  +  R   RE
Sbjct: 180 TPETPWRARERPRE 193



>gi|91090932|ref|XP_974318.1| PREDICTED: similar to Si:dkey-189p24.5 protein [Tribolium
           castaneum]
 gi|270014015|gb|EFA10463.1| hypothetical protein TcasGA2_TC012709 [Tribolium castaneum]
          Length = 212

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 103/187 (55%), Gaps = 6/187 (3%)

Query: 18  YTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEIQ 77
           + R GD+G S     +   KD  +F A+G  +EL S IG+A  Y ++A +   DKL  IQ
Sbjct: 28  FNRDGDRGTSKTLTSDTLPKDSKIFEAIGAAEELLSHIGLAREYAQEAEHEYSDKLKRIQ 87

Query: 78  CKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGES 137
             +I++ + I+  R++    K+   ++ +E    LE WI     QLPP + +I+P GG  
Sbjct: 88  TIIIDLSTAIS--RSNDQAKKIIPKNYTKE----LEDWILEYSKQLPPPEQYIIPGGGIP 141

Query: 138 AVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENYY 197
           +  LH  R+VCRR ERV VPLV           YLNRLSDF F+ +R AA  +K  E+ Y
Sbjct: 142 SASLHVARAVCRRTERVIVPLVNEGHLHNEALIYLNRLSDFLFIVSRMAAKLDKRTESIY 201

Query: 198 EQRRDDR 204
             + D++
Sbjct: 202 IPKPDEK 208



>gi|116254052|ref|YP_769890.1| cobalamin adenosultransferase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|499972987|ref|WP_011653705.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium
           leguminosarum]
 gi|115258700|emb|CAK09805.1| putative cobalamin adenosultransferase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 192

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 105/176 (59%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR KDD    A GT+DE +S+IG+A  +       L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLVSGPRRLKDDLRVEAYGTIDEANSAIGLARLHTADLPE-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP ++            E  V+ +E  ID L+  L PLK+FILP
Sbjct: 62  LMSIQNDLFDLGADLATP-DTGEPPAYEPLRIAETQVDRVERDIDQLNAGLEPLKSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLV--EAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A  LH  R++ RRAER+ V L   + E+  +   KY+NRLSDF FVAAR+A
Sbjct: 121 GGSPAAAHLHLARTIARRAERLMVALARTDGEIVGEPAMKYVNRLSDFLFVAARHA 176



>gi|490809622|ref|WP_004671743.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium etli]
 gi|327193376|gb|EGE60276.1| putative cobalamin adenosultransferase protein [Rhizobium etli
           CNPAF512]
          Length = 192

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 104/176 (59%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR KDD    A GT+DE +S+IG+A  Y     + L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLASGRRRRKDDLRVEAYGTIDEANSAIGLARLYTTDLAD-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP ++            E  V  +E  ID L+  L PL +FILP
Sbjct: 62  LMSIQNDLFDLGADLATP-DTGEPPAYEPLRIVETQVERIERDIDRLNADLNPLTSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A  LH  R++ RR ER+ V L  +E E+   +  KY+NRLSDF FVAAR+A
Sbjct: 121 GGSPAAAHLHLARTIARRGERLMVTLARMEGEIVGGAAMKYINRLSDFLFVAARHA 176



>gi|226310651|ref|YP_002770545.1| hypothetical protein BBR47_10640 [Brevibacillus brevis NBRC 100599]
 gi|495002736|ref|WP_007728750.1| ATP:cob(I)alamin adenosyltransferase [Brevibacillus sp. BC25]
 gi|226093599|dbj|BAH42041.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
 gi|398027652|gb|EJL21197.1| ATP:cob(I)alamin adenosyltransferase [Brevibacillus sp. BC25]
          Length = 182

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 97/171 (56%), Gaps = 7/171 (4%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHY--CKKAGNGLEDKLV 74
           +YT++GDKG++SL  G R  K  D   A GT DE +S IG+A       +    L+D   
Sbjct: 3   IYTKSGDKGETSLVAGVRVPKFADRVEAYGTCDEANSQIGLALALLPATEEWKELQDVFH 62

Query: 75  EIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSG 134
            IQ KL  VG+ +ATP        ++     EE+V  LE  ID LD +LPPL NFILP G
Sbjct: 63  VIQTKLFHVGAELATPEGKKVGWPIA-----EEDVTFLEEQIDMLDAKLPPLTNFILPGG 117

Query: 135 GESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
             +A   H  R+V RRAER  V + + E    SV KYLNRLSD+ FV AR+
Sbjct: 118 HPAAAAFHVSRTVVRRAERKAVHVAQQEQVNPSVVKYLNRLSDYLFVVARH 168



>gi|498195258|ref|WP_010509414.1| ATP:cob(I)alamin adenosyltransferase [SAR324 cluster bacterium SCGC
           AAA001-C10]
          Length = 201

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/180 (40%), Positives = 104/180 (57%), Gaps = 8/180 (4%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHY-----CKKAGN 67
           K + VYTRTGD G++ L  G+R +KD     A G+VDEL+S +G+   +       K  +
Sbjct: 3   KITKVYTRTGDTGQTGLVGGKRLTKDHPRIEAYGSVDELNSVLGIVLSFLVQKDASKRRD 62

Query: 68  GLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLK 127
            LE  L  IQ KL ++GS +AT        +++  + D E    LE  ID ++++L PLK
Sbjct: 63  KLELILEAIQQKLFDLGSELATLPGDEYVGQITLQAEDSE---WLEEIIDTMNDELQPLK 119

Query: 128 NFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
           +FILP G     FLH  R+VCRRAER  + L + ++    + KY+NRLSDF FVA R+  
Sbjct: 120 SFILPGGTSLNAFLHLARTVCRRAERDILKLKQIDLVSPEIIKYINRLSDFLFVAGRWVT 179



>gi|190893626|ref|YP_001980168.1| cobalamin adenosultransferase [Rhizobium etli CIAT 652]
 gi|501461942|ref|WP_012485387.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium etli]
 gi|190698905|gb|ACE92990.1| putative cobalamin adenosultransferase protein [Rhizobium etli CIAT
           652]
          Length = 192

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 104/176 (59%), Gaps = 4/176 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YT+TGD G + L +G RR KDD    A GT+DE +S+IG+A  Y     + L+  
Sbjct: 3   KLNKIYTKTGDDGTTGLASGPRRRKDDLRVEAYGTIDEANSAIGLARLYTTDLAD-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ  L ++G+++ATP ++            E  V  +E  ID L+  L PL +FILP
Sbjct: 62  LMSIQNDLFDLGADLATP-DTGEPPAYEPLRIVETQVERIERDIDRLNADLNPLTSFILP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPL--VEAEVTEQSVGKYLNRLSDFFFVAARYA 186
            G  +A  LH  R++ RR ER+ V L  +E E+   +  KY+NRLSDF FVAAR+A
Sbjct: 121 GGSPAAAHLHLARTIARRGERLMVTLARMEGEIVGGAAMKYINRLSDFLFVAARHA 176



>gi|489067175|ref|WP_002977170.1| cobalamin adenosyltransferase [Chryseobacterium gleum]
 gi|300501971|gb|EFK33111.1| ATP:cob(I)alamin adenosyltransferase [Chryseobacterium gleum ATCC
           35910]
          Length = 218

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 75/185 (40%), Positives = 109/185 (58%), Gaps = 7/185 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG+++L+ G R SK     ++ G +DEL+S IG+A  + +     +  +L +I
Sbjct: 32  IYTKTGDKGQTALYGGTRVSKASARVDSYGNIDELNSFIGIAKSHIED--EEVLRQLKKI 89

Query: 77  QCKLIEVGSNIATPRN----SSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q  L  VGS  ATP +    ++  S+L     + E   + + W+D  D +L PL+ FILP
Sbjct: 90  QFDLFTVGSEAATPVDKLMLANGKSRLPIIISETEIEELEQ-WMDAFDEKLEPLQYFILP 148

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG+ A FLH  R++CRRAER  V L E+E     + KYLNRLSD+ FV ARY +     
Sbjct: 149 GGGKPATFLHAARTICRRAERSLVFLNESEEVRPELIKYLNRLSDYLFVLARYISKLNNE 208

Query: 193 IENYY 197
            E Y+
Sbjct: 209 PEEYW 213



>gi|383767635|ref|YP_005446617.1| cob(I)alamin adenosyltransferase [Phycisphaera mikurensis NBRC
           102666]
 gi|504250831|ref|WP_014437933.1| cob(I)alamin adenosyltransferase [Phycisphaera mikurensis]
 gi|381387904|dbj|BAM04720.1| cob(I)alamin adenosyltransferase [Phycisphaera mikurensis NBRC
           102666]
          Length = 200

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 100/183 (54%), Gaps = 14/183 (7%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLE---DKL 73
           +YT+ GD+G + LF G R  KD     A GTVDEL++++G+A    + AG GL      L
Sbjct: 3   LYTKRGDRGLTDLFGGGRVPKDHLRVEAYGTVDELNAAVGLAAVRLEAAGEGLSLIAGPL 62

Query: 74  VEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPS 133
             IQ +L E+G+++ATP+      ++       E++  +E WID +D  +P + +FILP 
Sbjct: 63  GSIQRRLFEIGADLATPKRDGKGGRM-VPRIGPEHIAEIEGWIDTVDAAVPAMTSFILPG 121

Query: 134 GGESAVFLHQCRSVCRRAERVTVPLVEAEVT----------EQSVGKYLNRLSDFFFVAA 183
           G E +  LH  R++CRRAER  V L   E            E   G YLNRLSD  F  A
Sbjct: 122 GTELSARLHLARTICRRAERCCVSLGRVEEQDDVDEDHQGDEPPTGVYLNRLSDLLFAMA 181

Query: 184 RYA 186
           RYA
Sbjct: 182 RYA 184



>gi|491851675|ref|WP_005633341.1| cobalamin adenosyltransferase [Parabacteroides merdae]
 gi|154089360|gb|EDN88404.1| ATP:cob(I)alamin adenosyltransferase [Parabacteroides merdae ATCC
           43184]
 gi|409220180|gb|EKN13136.1| ATP:cob(I)alamin adenosyltransferase [Parabacteroides merdae
           CL03T12C32]
 gi|409241757|gb|EKN34524.1| ATP:cob(I)alamin adenosyltransferase [Parabacteroides merdae
           CL09T00C40]
          Length = 187

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 101/172 (58%), Gaps = 4/172 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS +YT TGDKG +SL  GER SK      + GTVDEL+S IG+     ++  +  +D 
Sbjct: 2   KKSIIYTGTGDKGTTSLVGGERVSKAHQRIESYGTVDELNSFIGLLITSLEEKAD--QDF 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ KL  +GS +AT  +  NT     +    E +  +E  ID LDN+LP ++NFILP
Sbjct: 60  LLFIQHKLFTIGSYLAT--DQENTELKVESKVMPETITRIEREIDRLDNELPKMRNFILP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
            G   A   H CR+VCRRAER    L E    E+ V  ++NRLSD+ FV AR
Sbjct: 118 GGSRPASLAHVCRTVCRRAERQIYRLAETIPVEEPVLVFINRLSDYLFVLAR 169



>gi|495501822|ref|WP_008226476.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Roseobacter sp.
           GAI101]
 gi|214043592|gb|EEB84230.1| ATP:cob(I)alamin adenosyltransferase [Roseobacter sp. GAI101]
          Length = 190

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/171 (42%), Positives = 104/171 (60%), Gaps = 4/171 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGDKG ++L NG R  K +   +A GT DEL+  +G+A    K+  +     L  I
Sbjct: 7   IYTRTGDKGDTALGNGSRVPKHNARVDAYGTADELNCFVGIARLAAKEETDA---ALSRI 63

Query: 77  QCKLIEVGSNIATPRNSSNT-SKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           Q  L ++G+++  P   ++  ++ +      E V+ LE  ID ++  L PL++FILP G 
Sbjct: 64  QNDLFDIGADLCRPDMKADAEAEYTPLRIVPEQVDRLEREIDTMNASLEPLRSFILPGGS 123

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           E A  LH CR+V RRAER+TV L E E   ++  +YLNRLSD+FFVAAR A
Sbjct: 124 ELAAHLHVCRTVARRAERLTVLLAEQEDVNEAAVRYLNRLSDWFFVAARIA 174



>gi|495421722|ref|WP_008146419.1| cobalamin adenosyltransferase [Parabacteroides johnsonii]
 gi|218225542|gb|EEC98192.1| ATP:cob(I)alamin adenosyltransferase [Parabacteroides johnsonii DSM
           18315]
 gi|409217563|gb|EKN10539.1| ATP:cob(I)alamin adenosyltransferase [Parabacteroides johnsonii
           CL02T12C29]
          Length = 187

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 101/172 (58%), Gaps = 4/172 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS +YT TGDKG +SL  GER SK      + GTVDEL+S IG+     ++  +  +D 
Sbjct: 2   KKSIIYTGTGDKGTTSLVGGERVSKAHQRIESYGTVDELNSFIGLLITSLEEKAD--QDF 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ IQ KL  +GS +AT  +  NT     +    E +  +E  ID LDN+LP ++NFILP
Sbjct: 60  LLFIQHKLFTIGSYLAT--DQENTELKIESKVMPETITRIEREIDRLDNELPKMRNFILP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
            G   A   H CR+VCRRAER    L E    E+ V  ++NRLSD+ FV AR
Sbjct: 118 GGSRPASLAHVCRTVCRRAERQIYRLAETIPVEEPVLVFMNRLSDYLFVLAR 169



>gi|325955435|ref|YP_004239095.1| ATP/cobalamin adenosyltransferase [Weeksella virosa DSM 16922]
 gi|503364245|ref|WP_013598906.1| cobalamin adenosyltransferase [Weeksella virosa]
 gi|323438053|gb|ADX68517.1| ATP/cobalamin adenosyltransferase [Weeksella virosa DSM 16922]
          Length = 188

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 100/174 (57%), Gaps = 5/174 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG +SL+ G +  K+D    + GTVDEL+S +G+   Y  +      D+++ I
Sbjct: 3   IYTKTGDKGTTSLYGGTKVKKNDIKIESYGTVDELNSVLGLIRSYTIE--QQYIDQIIHI 60

Query: 77  QCKLIEVGSNIATPRNS---SNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPS 133
           Q  L  +G+ +ATP      +N          + ++  LE WID ++  L PL +FILP 
Sbjct: 61  QKDLFNLGAELATPVEKLFLANGKPRLAVRVTKNDIETLEHWIDEIEENLAPLTHFILPG 120

Query: 134 GGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
           G  +A   H  R+VCRRAER+TV L E E    ++ KYLNRLSD+ F  AR  A
Sbjct: 121 GSLAASQAHFARTVCRRAERITVALAEIEEISPNLQKYLNRLSDYLFTLARILA 174



>gi|495939404|ref|WP_008663983.1| ATP/cobalamin adenosyltransferase [Rhodopirellula europaea]
 gi|460274769|gb|EMI28601.1| ATP/cobalamin adenosyltransferase [Rhodopirellula europaea SH398]
          Length = 196

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 105/182 (57%), Gaps = 18/182 (9%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK-------KAGNGL 69
           +YTRTGD G + LF G R +KDD    A GTVDEL++++G      K       +A +GL
Sbjct: 3   IYTRTGDSGTTGLFGGPRVAKDDTRIEAYGTVDELNATLGQVRSALKEPAGQTSQANDGL 62

Query: 70  ED---KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPL 126
            +   ++ ++Q +L  +G+ +A+P    +  +       + ++  +E WID+ + +LPPL
Sbjct: 63  SELDARIAQVQHELFSIGAELASP----HPDQFDLRVIGQPHIQRIEDWIDDAEQRLPPL 118

Query: 127 KNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQ----SVGKYLNRLSDFFFVA 182
           K FILP G   A  +H  R+VCRRAER  + L +A  TE     SV  YLNRLSD+ FV 
Sbjct: 119 KQFILPGGSVLASHVHLSRAVCRRAERRVISLADAVQTETPISDSVIIYLNRLSDWLFVV 178

Query: 183 AR 184
           +R
Sbjct: 179 SR 180



>gi|493839309|ref|WP_006786464.1| ATP--cobalamin adenosyltransferase [Thiorhodospira sibirica]
 gi|349796075|gb|EGZ49866.1| ATP/cobalamin adenosyltransferase [Thiorhodospira sibirica ATCC
           700588]
          Length = 187

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 102/189 (53%), Gaps = 11/189 (5%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           + S +YTR GD GK+ L +GER  KD  +  ALG VDEL+S +GV      +    + + 
Sbjct: 4   RLSKLYTRMGDDGKTRLADGERIPKDAPLIQALGDVDELNSLLGVV--LAAELPPAVTEV 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L+ +Q  L ++G  +A P    +  +L         +  LE+ ID  + QL PLK FILP
Sbjct: 62  LLAVQNDLFDLGGELAVP----HAQRLQMA-----RITWLETQIDQFNAQLAPLKEFILP 112

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            GG++A F H  R+VCRRAER  + L  +    + +  Y+NRLSD  FV AR  A  + H
Sbjct: 113 GGGQTATFCHLARAVCRRAERQLITLSHSRNLSEPLVAYMNRLSDLLFVCARIIATAQGH 172

Query: 193 IENYYEQRR 201
            E  +   R
Sbjct: 173 AERMWHSAR 181



>gi|154338541|ref|XP_001565495.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134062544|emb|CAM42407.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 376

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 111/202 (54%), Gaps = 33/202 (16%)

Query: 12  PKKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG----- 66
           PK+S VYT+TGD G S+LF GERR K D VF ALG +DELSS +G+A    + A      
Sbjct: 173 PKRSMVYTKTGDNGTSALFTGERRKKADAVFEALGAIDELSSHVGLARAMLRSAAERREH 232

Query: 67  -NGLEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESW---------- 115
              +   L  IQ +L+  G+ +ATP     T+K       +  + ILE +          
Sbjct: 233 DEAMMSMLEGIQQELLNAGTVVATP-----TAKNPEDEATKHMMTILEGYRFLDKTEEIA 287

Query: 116 --IDNLDNQLPPLKNFILPSGGESA-VFLHQCRSVCRRAERVTVPLVEA-------EVTE 165
             ID +D++L PL+ FILP GG  A   LH CR+ CRRAER  V + +         + +
Sbjct: 288 RNIDIIDSRLTPLRVFILPGGGNVASAQLHVCRTTCRRAERRMVKVRDLYGETYTDHLRQ 347

Query: 166 QSVGKYLNRLSDFFFVAARYAA 187
            +V  Y+NRLSDFFFVAAR  A
Sbjct: 348 ATV--YVNRLSDFFFVAARSIA 367



>gi|430749381|ref|YP_007212289.1| ATP:cob(I)alamin adenosyltransferase [Thermobacillus composti KWC4]
 gi|505066946|ref|WP_015254048.1| ATP:cob(I)alamin adenosyltransferase [Thermobacillus composti]
 gi|430733346|gb|AGA57291.1| ATP:cob(I)alamin adenosyltransferase [Thermobacillus composti KWC4]
          Length = 195

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 99/169 (58%), Gaps = 9/169 (5%)

Query: 18  YTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAG--NGLEDKLVE 75
           YTR GD G++S+  G  R KDD    A GT+DEL+S +G+A    ++      L D+L+ 
Sbjct: 4   YTRKGDSGRTSIIGGRVR-KDDVRVEAYGTIDELNSFVGLAEAALRRVDRLGDLADELLL 62

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQ +L + GS++A   +     K+S      E V  LE  ID LD + PPL  FILP G 
Sbjct: 63  IQQELFDCGSDLAYA-DKPEVFKMSM-----EPVERLERQIDALDGEAPPLARFILPGGS 116

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
           E+A  LH CR+VCRRAER    L   +    +V  YLNRLSD+FFVAAR
Sbjct: 117 EAAALLHVCRTVCRRAERRAATLAAEKPVNDAVPAYLNRLSDWFFVAAR 165



>gi|495555372|ref|WP_008279951.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Roseovarius sp.
           TM1035]
 gi|149144696|gb|EDM32725.1| cobalamin adenosyltransferase [Roseovarius sp. TM1035]
          Length = 190

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 103/171 (60%), Gaps = 4/171 (2%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGD G+++L NG R +K      A GTVDE+++++G+A  Y K   +  +D L  I
Sbjct: 7   IYTRTGDAGETALGNGTRVAKHSARVTAYGTVDEVNATVGLARLYAK---DETDDALARI 63

Query: 77  QCKLIEVGSNIATP-RNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           Q  L ++G+++  P       ++          V+ LE+ ID ++  L PL++FILP G 
Sbjct: 64  QNDLFDLGADLCRPDMERDKDAEYPPLRMASSQVDRLEAEIDAMNKHLEPLRSFILPGGS 123

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
             A  LH CR+V RRAER+TV L   E   +S  KYLNRLSD+FFVA+R A
Sbjct: 124 PLAAHLHLCRTVSRRAERLTVELSALENVNESALKYLNRLSDWFFVASRMA 174



>gi|494153883|ref|WP_007093626.1| cobalamin adenosyltransferase [Kordia algicida]
 gi|161324461|gb|EDP95791.1| probable cobalamin adenosyltransferase [Kordia algicida OT-1]
          Length = 191

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 104/172 (60%), Gaps = 6/172 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YT+TGDKG ++LF G R  K     ++ GTVDEL+S IG+     ++     ++ L+EI
Sbjct: 3   IYTKTGDKGTTALFGGTRVPKHHIRIDSYGTVDELNSHIGLIRD--QEIDKHYQNVLMEI 60

Query: 77  QCKLIEVGSNIAT-PRNSS---NTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q  L  VG+ +AT P  ++      +L+     EEN+ +LE  +D +++ LPP+ +F+LP
Sbjct: 61  QDLLFTVGAVLATDPEKATLKNGKDRLNIPRISEENIAVLEREMDTMNDALPPMTHFVLP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
            G ++  F H  R VCRRAER+   L E E  ++   KYLNRLSD+ FV AR
Sbjct: 121 GGHQTVSFCHIARCVCRRAERLASALYEIEPFDEHTLKYLNRLSDYLFVLAR 172



>gi|83644749|ref|YP_433184.1| hypothetical protein HCH_01926 [Hahella chejuensis KCTC 2396]
 gi|499715096|ref|WP_011395830.1| ATP--cobalamin adenosyltransferase [Hahella chejuensis]
 gi|83632792|gb|ABC28759.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396]
          Length = 185

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 72/176 (40%), Positives = 101/176 (57%), Gaps = 12/176 (6%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK-KAGNGLED 71
           + S +YTRTGDKG + L NGER +K+     A+G VDE +S +GV    C+    + L  
Sbjct: 4   RLSKIYTRTGDKGTTGLGNGERIAKNALRVEAMGAVDETNSVLGVV--ICELTQDDPLHA 61

Query: 72  KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFIL 131
           +L  IQ  L ++G  ++ P               +++++ LE W+D ++ +LPPLKNFIL
Sbjct: 62  QLQSIQNDLFDLGGELSIP---------GHIIIIDKHISRLEEWLDQINEELPPLKNFIL 112

Query: 132 PSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAA 187
           P G  +A   H  RS+CRRAER  V L + E     +  YLNRLSD+ FVAAR  A
Sbjct: 113 PGGDRAASHCHMARSICRRAERTVVSLAQQEQLNPCLQGYLNRLSDYLFVAARALA 168



>gi|496255169|ref|WP_008968554.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Bradyrhizobium
           sp. STM 3843]
 gi|365423850|emb|CCE06031.1| putative ATP:cob(I)alamin adenosyltransferase, monofunctional PduO
           type [Bradyrhizobium sp. STM 3843]
          Length = 190

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 103/172 (59%), Gaps = 6/172 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTRTGD G ++L NGERR K D   +A GTVDE +++IGV   +  +A   ++  L  I
Sbjct: 7   IYTRTGDDGTTALGNGERRPKFDLRVSAYGTVDETNAAIGVVRLHLAEAPE-IDAMLSLI 65

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L ++G+++A P+      +L   S     V+ LE  ID L+ QLPPL +F+LP G  
Sbjct: 66  QNDLFDLGADLAVPQRDGKAERLRVVS---SQVDRLERDIDALNAQLPPLTSFVLPGGTP 122

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEA--EVTEQSVGKYLNRLSDFFFVAARYA 186
           +   LH  R++CRRAER+   L     E   ++  +Y+NRLSDF FVA+R A
Sbjct: 123 AGAHLHLARTICRRAERLMAELAAQPNEPVSEAALRYMNRLSDFLFVASRAA 174



>gi|494126467|ref|WP_007066242.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Fulvimarina
           pelagi]
 gi|114539147|gb|EAU42267.1| hypothetical protein FP2506_05496 [Fulvimarina pelagi HTCC2506]
          Length = 188

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 4/174 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YTRTGDKG + L NGERR K D      GTVDEL++ IG+A  +       L+D 
Sbjct: 3   KLNKIYTRTGDKGDTMLGNGERRPKHDLRVETYGTVDELNAVIGLARLHSL---GDLDDM 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           L  IQ +L ++G+ +ATP    +         D + V+ LE+ ID ++ +L PLK+F+LP
Sbjct: 60  LARIQNELFDLGAELATPHTGEDLGFEPLKVVDSQ-VDRLEAEIDRMNEKLEPLKSFVLP 118

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           +G   A  LH  R+V RR ER+ V L + E    +  +Y+NRLSD  FV  R A
Sbjct: 119 AGTPVAAHLHHARTVARRVERLMVALSKKEPVADTALRYVNRLSDHLFVCGRIA 172



>gi|383458451|ref|YP_005372440.1| putative ATP:cob(I)alamin adenosyltransferase [Corallococcus
           coralloides DSM 2259]
 gi|504212173|ref|WP_014399275.1| ATP:cob(I)alamin adenosyltransferase [Corallococcus coralloides]
 gi|380735171|gb|AFE11173.1| putative ATP:cob(I)alamin adenosyltransferase [Corallococcus
           coralloides DSM 2259]
          Length = 186

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 100/169 (59%), Gaps = 4/169 (2%)

Query: 16  NVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVE 75
            +YT+TGD G++ LF G R +KDD + +A G VDEL++++G+A  +   A   LE  L  
Sbjct: 2   KIYTKTGDAGETGLFGGGRVAKDDALVDAYGEVDELNATLGLARTFPLPAD--LEHFLQR 59

Query: 76  IQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGG 135
           IQ +L  VG+ +ATP ++   + +       E V  +E  ID  + +LP + +FILP G 
Sbjct: 60  IQDQLFTVGAVLATPPHTKAAAHIP--ELRPEWVEEMERHIDRYEEELPKMTHFILPGGS 117

Query: 136 ESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
            +A  LH  R+VCRRAER  V L+  +    +V  YLNRLSD  FV AR
Sbjct: 118 PAAAALHLSRTVCRRAERRVVTLLREDKAPPAVAMYLNRLSDLLFVVAR 166



>gi|493884679|ref|WP_006830855.1| ATP:cob(I)alamin adenosyltransferase [Planococcus antarcticus]
 gi|388463391|gb|EIM05748.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Planococcus
           antarcticus DSM 14505]
          Length = 183

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 98/172 (56%), Gaps = 11/172 (6%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCK----KAGNGLEDK 72
           +YT+TGDKG +SL  G R +K+D V  A GT DE +S IG+A  +      +    L + 
Sbjct: 3   IYTKTGDKGTTSLVYGTRVAKNDAVVEAYGTCDEANSLIGLAIGHMNTEFFEEKEALCEV 62

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
             EIQ  L  VG+ +ATP+      KL     +E++V  LE WID  D ++PPL NFILP
Sbjct: 63  FHEIQTTLFHVGAELATPKGKEVKWKL-----EEQDVFKLEQWIDRYDAEVPPLSNFILP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
            G  S   LH  R+V RRAER  + +        +V  YLNRLSDF FVAAR
Sbjct: 118 GGHPSGAALHVARTVVRRAERTALSI--GTDVPPTVLAYLNRLSDFLFVAAR 167



>gi|498337279|ref|WP_010651435.1| ATP:cob(I)alamin adenosyltransferase [Oceanobacillus sp. Ndiop]
          Length = 185

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 101/173 (58%), Gaps = 10/173 (5%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK----AGNGLEDK 72
           +YTR+GDKG +SL  G+R  K+     A GT DE +S IG+A  +  K          ++
Sbjct: 3   IYTRSGDKGLTSLVYGQRVPKNHLRVEAYGTCDEANSFIGLALSFLDKEEWDGKQAFLEQ 62

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           +  IQ  L  VGS ++TP+    T +L     DE     +E+ ID  D QL PLKNFILP
Sbjct: 63  MNRIQTILFHVGSELSTPKEKEVTWRLKQKHIDE-----MEAQIDEWDEQLEPLKNFILP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARY 185
           SG  ++  LH  R+V RRAER+ V L + E+  + V  YLNRLSDF FVAARY
Sbjct: 118 SGHSASSALHTARTVVRRAERIVVGLGD-ELENELVFSYLNRLSDFLFVAARY 169



>gi|496841559|ref|WP_009382027.1| ATP--cobalamin adenosyltransferase [Candidatus Poribacteria sp.
           WGA-A3]
 gi|283829960|gb|EFC34239.1| ATP--cobalamin adenosyltransferase [Candidatus Poribacteria sp.
           WGA-A3]
          Length = 193

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 106/191 (55%), Gaps = 9/191 (4%)

Query: 15  SNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHY------CKKAGNG 68
           S VYT++GD GK+ L  G+   KD     A GTVDEL+S IG+A           K G  
Sbjct: 4   SKVYTKSGDAGKTRLAGGQEVWKDSLRVEAYGTVDELNSVIGIARALNAEQPKSVKTGKK 63

Query: 69  LEDKLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKN 128
           LE+ L  IQ KL +VG  +AT    +  +  + T+   ++V  LE  ID     L PLK 
Sbjct: 64  LEEHLRWIQNKLFDVGGILATAPGETFKNMPTVTA---DHVARLERLIDACQEDLEPLKE 120

Query: 129 FILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAM 188
           FILP GG+ + FLHQ R+VCRRAER+ V L   E     + ++LNRLSD  FV AR+ A 
Sbjct: 121 FILPGGGKVSGFLHQTRTVCRRAERLCVSLSREENVPPELVRFLNRLSDALFVLARWTAK 180

Query: 189 FEKHIENYYEQ 199
            +   E  +E+
Sbjct: 181 TQGEPEYLWER 191



>gi|490430235|ref|WP_004302366.1| cobalamin adenosyltransferase [Bacteroides ovatus]
 gi|229451914|gb|EEO57705.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides sp. 2_2_4]
 gi|292632948|gb|EFF51535.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides ovatus SD CMC 3f]
 gi|298515153|gb|EFI39034.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides sp. 3_1_23]
 gi|335942592|gb|EGN04434.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides ovatus 3_8_47FAA]
          Length = 187

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/186 (40%), Positives = 104/186 (55%), Gaps = 4/186 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS VYT+TGDKG +SL  G R  K      A GTVDEL+S +G  N Y +   +   D 
Sbjct: 2   KKSLVYTKTGDKGTTSLVGGSRVPKTHIRLEAYGTVDELNSHLGWLNTYLQDESD--RDF 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           ++ IQ KL  +GS++AT +  +     S  +   ENV  +E  ID LD QLP L  FI+P
Sbjct: 60  ILSIQHKLFAIGSHLATDQEKTQLKAASIIT--PENVENIEREIDKLDEQLPELCAFIIP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            G   A   H CR++CRRAER  + L E       V  ++NRLSD+ FV +R     E++
Sbjct: 118 GGSRGAAVCHVCRTICRRAERRILALSETCTISPEVLAFVNRLSDYLFVLSRKINFDEQN 177

Query: 193 IENYYE 198
            E +++
Sbjct: 178 NEIFWD 183



>gi|32472259|ref|NP_865253.1| hypothetical protein RB2976 [Rhodopirellula baltica SH 1]
 gi|499431660|ref|WP_011119124.1| ATP:cob(I)alamin adenosyltransferase [Rhodopirellula baltica]
 gi|32443495|emb|CAD72937.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 196

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 103/182 (56%), Gaps = 18/182 (9%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKK-------AGNGL 69
           +YTRTGD G + LF G R +KDD    A GTVDEL++++G      K+       A +GL
Sbjct: 3   IYTRTGDSGTTGLFGGPRVAKDDTRIEAYGTVDELNATLGQVRSALKESAGEATAANDGL 62

Query: 70  ED---KLVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPL 126
            +   ++ ++Q +L  +G+ +A+P    +  +         ++  +E WID+ + QLPPL
Sbjct: 63  SELDARIAQVQHELFSIGAELASP----HPDQFDLRVIGPVHIQRIEDWIDDAEQQLPPL 118

Query: 127 KNFILPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGK----YLNRLSDFFFVA 182
           K FILP G   A  +H  R+VCRRAER  + L +A  TE  +      YLNRLSD+ FV 
Sbjct: 119 KQFILPGGSILASHVHLSRAVCRRAERRVISLADAVQTETPISDTVIIYLNRLSDWLFVV 178

Query: 183 AR 184
           +R
Sbjct: 179 SR 180



>gi|406959441|gb|EKD86781.1| hypothetical protein ACD_37C00146G0002 [uncultured bacterium]
          Length = 179

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 101/184 (54%), Gaps = 9/184 (4%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           +YTR GDKGK+SLF+G + SK+D   NA+GT+DEL+S IG+A        + +  +L EI
Sbjct: 5   IYTRKGDKGKTSLFDGTKVSKNDPRINAVGTIDELNSVIGIAIAQIPNPKSQIRKELEEI 64

Query: 77  QCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILPSGGE 136
           Q  L E+G  +A P  +            E      E  ID L  +LP L +FILP GG 
Sbjct: 65  QNDLFEIGGALAFPYKTPLEQL-------EHRPGEFEELIDKLTEKLPELSDFILPGGGR 117

Query: 137 SAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKHIENY 196
           +  +LH  R+VCRRAER TV L  +   +  +  YLNRLSD  F  AR     EK  E  
Sbjct: 118 AGSYLHLARTVCRRAERSTVQL--SNKIDPLILIYLNRLSDLLFTFARVVNYREKRKEKI 175

Query: 197 YEQR 200
           + +R
Sbjct: 176 WRKR 179



>gi|490424193|ref|WP_004296388.1| cobalamin adenosyltransferase [Bacteroides ovatus]
 gi|156111578|gb|EDO13323.1| hypothetical protein BACOVA_01074 [Bacteroides ovatus ATCC 8483]
 gi|392661466|gb|EIY55050.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides ovatus
           CL02T12C04]
 gi|392678241|gb|EIY71649.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides ovatus
           CL03T12C18]
          Length = 187

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/186 (40%), Positives = 104/186 (55%), Gaps = 4/186 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS VYT+TGDKG +SL  G R  K      A GTVDEL+S +G  N Y +   +   D 
Sbjct: 2   KKSLVYTKTGDKGTTSLVGGSRVPKTHIRLEAYGTVDELNSHLGWLNTYLQDESD--RDF 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           ++ IQ KL  +GS++AT +  +     S  +   ENV  +E  ID LD QLP L  FI+P
Sbjct: 60  ILSIQHKLFAIGSHLATDQEKTQLKAASIIT--PENVENIEREIDRLDEQLPELCAFIIP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            G   A   H CR++CRRAER  + L E       V  ++NRLSD+ FV +R     E++
Sbjct: 118 GGSRGAAVCHVCRTICRRAERRILALSETCTISPEVLAFVNRLSDYLFVLSRKINFDEQN 177

Query: 193 IENYYE 198
            E +++
Sbjct: 178 NEIFWD 183



>gi|491925120|ref|WP_005675351.1| cobalamin adenosyltransferase [Bacteroides caccae]
 gi|149130572|gb|EDM21778.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides caccae ATCC
           43185]
          Length = 187

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/186 (40%), Positives = 106/186 (56%), Gaps = 4/186 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS VYT+TGDKG +SL  G R  K      A GTVDEL+S++G+ N Y +   +   + 
Sbjct: 2   KKSLVYTKTGDKGTTSLVGGSRVPKTHIRLEAYGTVDELNSNLGLLNTYLQNETD--RNF 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           ++ IQ KL  +GS++AT +  +     S  S   E+V  +E  ID LD QLP L  FI+P
Sbjct: 60  ILGIQHKLFAIGSHLATDQEKTQLKAASIISM--EDVERIEREIDKLDEQLPELCAFIIP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            G   A   H CR+VCRRAER  + L E       V  ++NRLSD+ FV +R     E++
Sbjct: 118 GGSRGAAICHVCRTVCRRAERRILALSETCTISPEVLAFVNRLSDYLFVLSRKMNFDEQN 177

Query: 193 IENYYE 198
            E +++
Sbjct: 178 NEIFWD 183



>gi|383450586|ref|YP_005357307.1| hypothetical protein KQS_06450 [Flavobacterium indicum GPTSA100-9]
 gi|504201273|ref|WP_014388375.1| cobalamin adenosyltransferase [Flavobacterium indicum]
 gi|380502208|emb|CCG53250.1| Protein of unknown function [Flavobacterium indicum GPTSA100-9]
          Length = 192

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 101/172 (58%), Gaps = 6/172 (3%)

Query: 17  VYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDKLVEI 76
           VYT+TGDKG +SLF G R  K      + GTVDEL+S IG+     +      +  L+EI
Sbjct: 3   VYTKTGDKGTTSLFGGTRVPKHHVRIESYGTVDELNSYIGLIRD--QDINPEYKAILIEI 60

Query: 77  QCKLIEVGSNIATPRNS----SNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           Q +L  VG+ +ATP       +   +L+      +++ +LE+ ID++D +LPP+ +F+LP
Sbjct: 61  QDRLFTVGAIMATPPEKEVLKNGQPRLNINRISNQDIELLETQIDSMDAELPPMTHFVLP 120

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAAR 184
            G  +  + H  R VCRRAER+   L E E  ++ V  YLNRLSD+ FV AR
Sbjct: 121 GGHTTVSYCHVTRCVCRRAERLATHLNEIEPIDEQVLTYLNRLSDYLFVLAR 172



>gi|496285765|ref|WP_008997803.1| cobalamin adenosyltransferase [Bacteroides sp. D2]
 gi|313697476|gb|EFS34311.1| ATP:cob(I)alamin adenosyltransferase [Bacteroides sp. D2]
          Length = 187

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/186 (40%), Positives = 104/186 (55%), Gaps = 4/186 (2%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           KKS VYT+TGDKG +SL  G R  K      A GTVDEL+S +G  N Y +   +   D 
Sbjct: 2   KKSLVYTKTGDKGTTSLVGGSRVPKTHIRLEAYGTVDELNSHLGWLNTYLQDESD--RDF 59

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFDEENVNILESWIDNLDNQLPPLKNFILP 132
           ++ IQ KL  +GS++AT +  +     S  +   ENV  +E  ID LD QLP L  FI+P
Sbjct: 60  ILSIQHKLFAIGSHLATDQEKTQLKAASIIT--PENVENIEREIDKLDEQLPELCAFIIP 117

Query: 133 SGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYAAMFEKH 192
            G   A   H CR++CRRAER  + L E       V  ++NRLSD+ FV +R     E++
Sbjct: 118 GGSRGAAVCHVCRTICRRAERRILTLSETCTISPEVLAFVNRLSDYLFVLSRKINFDEQN 177

Query: 193 IENYYE 198
            E +++
Sbjct: 178 NEIFWD 183



>gi|495041679|ref|WP_007766529.1| cob(I)yrinic acid a,c-diamide adenosyltransferase [Rhizobium sp.
           CF080]
 gi|398063276|gb|EJL55022.1| ATP:cob(I)alamin adenosyltransferase [Rhizobium sp. CF080]
          Length = 190

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 100/176 (56%), Gaps = 6/176 (3%)

Query: 13  KKSNVYTRTGDKGKSSLFNGERRSKDDDVFNALGTVDELSSSIGVANHYCKKAGNGLEDK 72
           K + +YTRTGD G ++L +G RR K D    A G VDE +S+IG+A  +       L+  
Sbjct: 3   KLNKIYTRTGDNGTTALVSGPRRDKHDLRVEAYGAVDETNSTIGLARLHTAGMAE-LDAM 61

Query: 73  LVEIQCKLIEVGSNIATPRNSSNTSKLSFTSFD--EENVNILESWIDNLDNQLPPLKNFI 130
           L  IQ  L ++G+++ATP       KL +      E     LE+ ID L+  L PL +F+
Sbjct: 62  LFRIQNDLFDLGADLATPDTGE---KLDYEPLRIVEAQATRLETEIDALNAHLDPLTSFV 118

Query: 131 LPSGGESAVFLHQCRSVCRRAERVTVPLVEAEVTEQSVGKYLNRLSDFFFVAARYA 186
           LP G  +A  LH  R+V RRAER+ V L   E    +  KY+NRLSDF FVAAR+A
Sbjct: 119 LPGGSTAAAHLHLARTVSRRAERLMVELSRGETVGTAALKYINRLSDFLFVAARFA 174