BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10299_c0_seq1-m.112 5prime_partial 320-1240(-) 307 (-)
         (306 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511009021|gb|EPB90273.1| hypothetical protein HMPREF1544_0295...   151   2e-34   Mucor circinelloides f. circinelloides 1006PhL
gi|511003428|gb|EPB84831.1| hypothetical protein HMPREF1544_0840...   151   2e-34   Mucor circinelloides f. circinelloides 1006PhL
gi|511005415|gb|EPB86757.1| hypothetical protein HMPREF1544_0645...   142   9e-32   Mucor circinelloides f. circinelloides 1006PhL
gi|328772209|gb|EGF82248.1| expressed protein [Batrachochytrium ...   142   1e-31   Batrachochytrium dendrobatidis JAM81
gi|384486311|gb|EIE78491.1| hypothetical protein RO3G_03195 [Rhi...   107   5e-21   Rhizopus delemar RA 99-880
gi|348664944|gb|EGZ04781.1| hypothetical protein PHYSODRAFT_5357...    77   4e-12   Phytophthora sojae
gi|325183603|emb|CCA18063.1| conserved hypothetical protein [Alb...    75   3e-11   Albugo laibachii Nc14
gi|156406022|ref|XP_001641030.1| predicted protein [Nematostella...    74   4e-11   Nematostella vectensis
gi|410074683|ref|XP_003954924.1| hypothetical protein KAFR_0A035...    74   6e-11   Kazachstania africana CBS 2517


>gi|511009021|gb|EPB90273.1| hypothetical protein HMPREF1544_02959 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 481

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (63%), Gaps = 16/151 (10%)

Query: 52  HADMVKAAAEISSKFVALEVRPEAWRELQFMHISNFPQSNCSKCKKDICLQCGDPTHHTG 111
             D+   A+ IS + VALEV PEAW++ QF H++NFP   C  C    CLQCG+  H  G
Sbjct: 289 QPDLYDQASNISKQLVALEVIPEAWKQTQFWHVANFPVEQCDHCGDKSCLQCGEKAH-LG 347

Query: 112 MTCIQYMRHKVANPHLFITNQSLLCNDKNDITDALENTKWKLANSKSCPNCSILINRDDG 171
             C++ ++ K+ N             D  ++T  ++   WKL +++ CPNCS++INRD+G
Sbjct: 348 RNCLENLKLKLKNNR-----------DNEELTSTIQ---WKLNHTRPCPNCSVMINRDEG 393

Query: 172 CNKVDCLHCGYRFCWICRSGWS-EKCGFYRC 201
           CNKVDCL CGYRFCW C SGWS +KCGFY+C
Sbjct: 394 CNKVDCLLCGYRFCWRCGSGWSQQKCGFYQC 424



>gi|511003428|gb|EPB84831.1| hypothetical protein HMPREF1544_08401 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 392

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 91/146 (62%), Gaps = 16/146 (10%)

Query: 57  KAAAEISSKFVA-LEVRPEAWRELQFMHISNFPQSNCSKCKKDICLQCGDPTHHTGMTCI 115
           + A  IS +F+    V+PE W++LQF HISNFPQ NC+ C   ICL CG   H  G+ C 
Sbjct: 203 RFAHNISQEFINNFFVKPEVWKQLQFAHISNFPQMNCTSCHASICLHCGYDAHQ-GLNCE 261

Query: 116 QYMRHKVANPHLFITNQSLLCNDKNDITDALENTKWKLANSKSCPNCSILINRDDGCNKV 175
           + M+              L+  DK    D  E  +WKL NS+ CPNCSI+INRD+GCNKV
Sbjct: 262 ENMK--------------LMAADKATAKDIKETVEWKLENSRRCPNCSIMINRDEGCNKV 307

Query: 176 DCLHCGYRFCWICRSGWSEKCGFYRC 201
           DC +CG+ FCW CRS W++ CGFYRC
Sbjct: 308 DCSYCGFCFCWACRSSWADGCGFYRC 333



>gi|511005415|gb|EPB86757.1| hypothetical protein HMPREF1544_06455 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 492

 Score =  142 bits (359), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 103/186 (55%), Gaps = 22/186 (11%)

Query: 35  LNKKRPLKNSS----HHKLKTH-------ADMVKAAAEISSKFVALEVRPEAWRELQFMH 83
           L KK   +NS+    HH+L           D    A +IS K + LE+RP+ W+ LQF H
Sbjct: 280 LFKKMEWRNSTIIDIHHQLIQKLLQACQTVDQTTKAKDISLKILQLELRPDTWKRLQFDH 339

Query: 84  ISNFPQSNCSKCKKDICLQCGDPTHHTGMTCIQYMRHKVANPHLFITNQSLLCNDKNDIT 143
           IS F   +C  C K++CLQCG+ +H    TC + M+  +       +N            
Sbjct: 340 ISMFSDMSCPTCCKEMCLQCGEDSHSQVATCEENMKQLIQQNEATGSN-----------A 388

Query: 144 DALENTKWKLANSKSCPNCSILINRDDGCNKVDCLHCGYRFCWICRSGWSEKCGFYRCRM 203
           D ++  KWK+ NS+ CP+CSI+INRD+GCNKVDC  CG+ FCW CRS WSE C ++ C  
Sbjct: 389 DYIQTLKWKMENSRKCPSCSIMINRDEGCNKVDCTLCGFSFCWECRSIWSESCSYFVCIN 448

Query: 204 GKRKKG 209
            + K+ 
Sbjct: 449 DRNKQS 454



>gi|328772209|gb|EGF82248.1| expressed protein [Batrachochytrium dendrobatidis JAM81]
          Length = 409

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 92/148 (62%), Gaps = 16/148 (10%)

Query: 57  KAAAEISSKFVALEVRPEAWRELQFMHISNFPQSNCSKCKKDICLQCGDPTHHTGMTCIQ 116
           K  ++IS  F++LE+  E W+ELQF+H+ +FPQ+ C  C + IC  CG   +HTG +C  
Sbjct: 238 KRLSDISECFISLELSSEKWKELQFLHLKSFPQAMCHCCDQSICFSCGQSPYHTGQSCTD 297

Query: 117 YMRHKVANPHLFITNQSLLCNDKNDITDALENTKWKLANSKSCPNCSILINRDDGCNKVD 176
            +R  +A+                   D + + +WKL NSK CPNCS+LINRD+GCNKVD
Sbjct: 298 CIRDTIAD---------------GGSVDVISSLQWKLDNSKQCPNCSVLINRDEGCNKVD 342

Query: 177 CLHCGYRFCWICRSGWSE-KCGFYRCRM 203
           CL+CG++FCW C   + +  C +YRC++
Sbjct: 343 CLYCGHKFCWQCLGQFDKGSCAYYRCQL 370



>gi|384486311|gb|EIE78491.1| hypothetical protein RO3G_03195 [Rhizopus delemar RA 99-880]
          Length = 313

 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 88/181 (48%), Gaps = 48/181 (26%)

Query: 14  IMEMYEHITEKMGKILGLRFNLNKKRPLKNSSHHKLKTHADMVKAAAEISSKFVALEVRP 73
           I E+Y  I   + K++               SH K     D+   A+ IS + VALE+ P
Sbjct: 160 IQELYHQIIPVLRKVV---------------SHQK-----DLYDLASNISKQLVALEIIP 199

Query: 74  EAWRELQFMHISNFPQSNCSKCKKDICLQCGDPTHHTGMTCIQYMRHKVANPHLFITNQS 133
           E W++ QF HIS FP   C  C   +CLQCG   H  G++C+++++ ++       TN  
Sbjct: 200 EIWKQTQFRHISYFPMETCMNCGDKLCLQCGQVAHF-GLSCLEHLKSELMQS----TN-- 252

Query: 134 LLCNDKNDITDALENTKWKLANSKSCPNCSILINRDDGCNKVDCLHCGYRFCWICRSGWS 193
                    T+     +WKL ++            D+GCNKVDCL CGYRFCW C S W+
Sbjct: 253 ---------TEYTSTIQWKLNHT------------DEGCNKVDCLQCGYRFCWRCGSAWT 291

Query: 194 E 194
           +
Sbjct: 292 Q 292



>gi|348664944|gb|EGZ04781.1| hypothetical protein PHYSODRAFT_535714 [Phytophthora sojae]
 gi|348678351|gb|EGZ18168.1| hypothetical protein PHYSODRAFT_360629 [Phytophthora sojae]
          Length = 534

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 84/209 (40%), Gaps = 49/209 (23%)

Query: 62  ISSKFVALEVRPEAWRELQFMHISNF----------PQSNCSK--------------CKK 97
           +S +     V PE +R+     + +F          P + CSK              C  
Sbjct: 224 VSDEIFKQIVSPEDYRKYARFLLRSFVDINKGVKWCPSAGCSKAITSAGGLLSVTCTCGC 283

Query: 98  DICLQCGDPTHHTGMTCIQYMRHKVANPHLFITNQSLLCNDKNDITDALENTKWKLANSK 157
             CL+CG+  H + +TC Q                  L + +    +  E   W LAN+K
Sbjct: 284 VFCLRCGEEAH-SPVTCEQ------------------LASWQEKCRNESETANWILANTK 324

Query: 158 SCPNCSILINRDDGCNKVDCLHCGYRFCWICRSGW----SEKCGFYRC-RMGKRKKGKDK 212
            CP CS+ I ++ GCN + C  C Y FCWIC  GW    S   G+Y+C R     +  D 
Sbjct: 325 KCPKCSVRIEKNQGCNHMTCRSCNYEFCWICMEGWDKHGSGTGGYYKCNRYDADAQTADN 384

Query: 213 QSAR-KQQNSSQLHIQHVNNNVSEISQFG 240
            +AR K +    LH      N SE  +F 
Sbjct: 385 DAARAKAELDRYLHYYQRFANHSEAGKFA 413



>gi|325183603|emb|CCA18063.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 534

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 64/147 (43%), Gaps = 25/147 (17%)

Query: 99  ICLQCGDPTHHTGMTCIQYMRHKVANPHLFITNQSLLCNDKNDITDALENTKWKLANSKS 158
            CL+CG+  H   +TC Q                  L   +    +  E   W LAN+K 
Sbjct: 282 FCLRCGEEAH-APVTCAQ------------------LAAWQEKCRNESETANWILANTKK 322

Query: 159 CPNCSILINRDDGCNKVDCLHCGYRFCWICRSGWSE----KCGFYRC-RMGKRKKGKDKQ 213
           CP CS+ I ++ GCN + C  C Y FCWIC   WS+      G+Y+C R   +    D  
Sbjct: 323 CPKCSVRIEKNQGCNHITCKSCNYEFCWICLESWSKHGAATGGYYKCNRYDAQATIADSD 382

Query: 214 SAR-KQQNSSQLHIQHVNNNVSEISQF 239
           +AR K +    LH      N SE  +F
Sbjct: 383 AARAKAELDRYLHYYQRYANHSEAGKF 409



>gi|156406022|ref|XP_001641030.1| predicted protein [Nematostella vectensis]
 gi|156228167|gb|EDO48967.1| predicted protein [Nematostella vectensis]
          Length = 711

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (50%), Gaps = 6/122 (4%)

Query: 137 NDKNDITDALENTKWKLANSKSCPNCSILINRDDGCNKVDCLHCGYRFCWICRSGW---- 192
             +++ T+ + NT W + NSK CPNC   I + +GCN + C  C + FCW+C   W    
Sbjct: 463 TSESEKTNQVANTLWLVTNSKPCPNCKSPIQKTEGCNHMKCTKCKHEFCWVCLELWKKHS 522

Query: 193 SEKCGFYRCRMGK--RKKGKDKQSARKQQNSSQLHIQHVNNNVSEISQFGGSRDDVEMSD 250
           S   G++RC   +  RK   +  SA K+ N+  L IQ +N  +   S+F    +  ++ +
Sbjct: 523 SATGGYFRCNRYEVVRKLDIEAVSAIKEANAENLRIQELNYFLHYYSRFKNHENSYKIEE 582

Query: 251 SF 252
             
Sbjct: 583 PL 584



>gi|410074683|ref|XP_003954924.1| hypothetical protein KAFR_0A03540 [Kazachstania africana CBS 2517]
 gi|372461506|emb|CCF55789.1| hypothetical protein KAFR_0A03540 [Kazachstania africana CBS 2517]
          Length = 550

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 9/89 (10%)

Query: 141 DITDAL--------ENTKWKLANSKSCPNCSILINRDDGCNKVDCLHCGYRFCWICRSGW 192
           DIT+A         EN  W L+N+K CP CS+ I +D GCN + C  C Y FCWIC   W
Sbjct: 313 DITNAWIKKARKESENLNWVLSNTKECPKCSVNIEKDGGCNHMVCSSCKYEFCWICEGEW 372

Query: 193 SEKC-GFYRCRMGKRKKGKDKQSARKQQN 220
           +     FY+C + K + GK  +S+ ++ N
Sbjct: 373 APHGKSFYQCTLYKNEDGKYNKSSSQEAN 401