BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10324_c0_seq1-m.114 5prime_partial 345-1703(-) 453 (-)
         (452 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|328767845|gb|EGF77893.1| hypothetical protein BATDEDRAFT_2722...   156   1e-35   Batrachochytrium dendrobatidis JAM81
gi|321476188|gb|EFX87149.1| hypothetical protein DAPPUDRAFT_3127...   130   7e-28   Daphnia pulex
gi|198417594|ref|XP_002130649.1| PREDICTED: uncharacterized prot...   130   1e-27   Ciona intestinalis [sea vase]
gi|156402794|ref|XP_001639775.1| predicted protein [Nematostella...   125   3e-26   Nematostella vectensis
gi|512913847|ref|XP_004927993.1| PREDICTED: uncharacterized prot...   116   1e-23   
gi|157136216|ref|XP_001656778.1| hypothetical protein AaeL_AAEL0...   114   5e-23   Aedes aegypti
gi|158300952|ref|XP_320746.4| AGAP011764-PA [Anopheles gambiae s...   113   1e-22   Anopheles gambiae str. PEST
gi|72010481|ref|XP_786746.1| PREDICTED: uncharacterized protein ...   113   1e-22   Strongylocentrotus purpuratus [purple urchin]
gi|312381709|gb|EFR27395.1| hypothetical protein AND_05929 [Anop...   113   1e-22   
gi|170047986|ref|XP_001851482.1| conserved hypothetical protein ...   113   1e-22   Culex quinquefasciatus
gi|405978767|gb|EKC43130.1| Uncharacterized protein C22orf9-like...   113   1e-22   Crassostrea gigas
gi|357613729|gb|EHJ68688.1| hypothetical protein KGM_13289 [Dana...   112   2e-22   Danaus plexippus [American monarch]
gi|242025486|ref|XP_002433155.1| conserved hypothetical protein ...   112   2e-22   Pediculus humanus corporis [human body lice]
gi|189236528|ref|XP_975467.2| PREDICTED: similar to conserved hy...   112   3e-22   Tribolium castaneum [rust-red flour beetle]
gi|291241833|ref|XP_002740815.1| PREDICTED: predicted protein-li...   111   3e-22   
gi|307207314|gb|EFN85064.1| Uncharacterized protein C22orf9-like...   110   6e-22   Harpegnathos saltator
gi|449671358|ref|XP_002170387.2| PREDICTED: uncharacterized prot...   110   1e-21   
gi|308511499|ref|XP_003117932.1| hypothetical protein CRE_00575 ...   109   2e-21   Caenorhabditis remanei
gi|339240677|ref|XP_003376264.1| conserved hypothetical protein ...   107   7e-21   Trichinella spiralis
gi|268579979|ref|XP_002644972.1| Hypothetical protein CBG10937 [...   107   8e-21   Caenorhabditis briggsae
gi|17550490|ref|NP_509174.1| Protein C16E9.2, isoform a [Caenorh...   107   1e-20   Caenorhabditis elegans [roundworm]
gi|341897025|gb|EGT52960.1| hypothetical protein CAEBREN_21304 [...   106   1e-20   Caenorhabditis brenneri
gi|449273316|gb|EMC82839.1| Putative protein C22orf9 like protei...   105   4e-20   Columba livia [carrier pigeon]
gi|327273377|ref|XP_003221457.1| PREDICTED: uncharacterized prot...   103   7e-20   Anolis carolinensis [Carolina anole]
gi|348522648|ref|XP_003448836.1| PREDICTED: uncharacterized prot...   103   1e-19   
gi|513160687|ref|XP_416465.4| PREDICTED: uncharacterized protein...   103   1e-19   Gallus gallus [bantam]
gi|499028408|ref|XP_004564930.1| PREDICTED: uncharacterized prot...   103   1e-19   
gi|513160691|ref|XP_004938096.1| PREDICTED: uncharacterized prot...   103   1e-19   
gi|499028406|ref|XP_004564929.1| PREDICTED: uncharacterized prot...   103   1e-19   Maylandia zebra
gi|483512413|gb|EOB00878.1| Uncharacterized protein C22orf9-like...   102   2e-19   Anas platyrhynchos [duck]
gi|326912478|ref|XP_003202577.1| PREDICTED: uncharacterized prot...   102   2e-19   
gi|513160697|ref|XP_004938098.1| PREDICTED: uncharacterized prot...   102   2e-19   
gi|312087241|ref|XP_003145393.1| hypothetical protein LOAG_09818...   102   2e-19   Loa loa
gi|449482094|ref|XP_002187924.2| PREDICTED: uncharacterized prot...   102   3e-19   
gi|498926183|ref|XP_004517840.1| PREDICTED: serine-rich adhesin ...   102   3e-19   Ceratitis capitata
gi|393905150|gb|EJD73881.1| hypothetical protein LOAG_18727 [Loa...   101   4e-19   Loa loa
gi|198457553|ref|XP_001360710.2| GA21937 [Drosophila pseudoobscu...   101   4e-19   Drosophila pseudoobscura pseudoobscura
gi|513160694|ref|XP_004938097.1| PREDICTED: uncharacterized prot...   101   5e-19   
gi|195150761|ref|XP_002016319.1| GL11518 [Drosophila persimilis]...   101   5e-19   Drosophila persimilis
gi|195441981|ref|XP_002068739.1| GK17865 [Drosophila willistoni]...   101   5e-19   Drosophila willistoni
gi|194882333|ref|XP_001975266.1| GG20656 [Drosophila erecta] >gi...   101   6e-19   Drosophila erecta
gi|195335123|ref|XP_002034225.1| GM21752 [Drosophila sechellia] ...   101   6e-19   Drosophila sechellia
gi|195124467|ref|XP_002006714.1| GI21217 [Drosophila mojavensis]...   101   6e-19   Drosophila mojavensis
gi|194756632|ref|XP_001960580.1| GF11434 [Drosophila ananassae] ...   101   6e-19   Drosophila ananassae
gi|166157929|ref|NP_001107374.1| uncharacterized protein LOC1001...   100   6e-19   Xenopus tropicalis [western clawed frog]
gi|195381149|ref|XP_002049317.1| GJ20819 [Drosophila virilis] >g...   100   6e-19   Drosophila virilis
gi|195584112|ref|XP_002081859.1| GD11243 [Drosophila simulans] >...   100   7e-19   
gi|24654329|ref|NP_611183.1| CG9646 [Drosophila melanogaster] >g...   100   7e-19   Drosophila melanogaster
gi|195488847|ref|XP_002092486.1| GE11641 [Drosophila yakuba] >gi...   100   7e-19   Drosophila yakuba
gi|21428746|gb|AAM50033.1| SD21944p [Drosophila melanogaster]         100   7e-19   Drosophila melanogaster
gi|148236388|ref|NP_001079690.1| uncharacterized protein KIAA093...   100   9e-19   Xenopus laevis [clawed frog]
gi|499028410|ref|XP_004564931.1| PREDICTED: uncharacterized prot...   100   1e-18   Maylandia zebra
gi|126258174|sp|Q801S4.2|K0930_XENLA RecName: Full=Uncharacteriz...   100   1e-18   Xenopus laevis [clawed frog]
gi|395819588|ref|XP_003783164.1| PREDICTED: uncharacterized prot...   100   1e-18   
gi|195056331|ref|XP_001995064.1| GH22838 [Drosophila grimshawi] ...   100   1e-18   Drosophila grimshawi
gi|328789567|ref|XP_392206.3| PREDICTED: hypothetical protein LO...   100   2e-18   
gi|307167593|gb|EFN61137.1| Uncharacterized protein C22orf9-like...   100   2e-18   Camponotus floridanus
gi|340710383|ref|XP_003393771.1| PREDICTED: hypothetical protein...   100   2e-18   Bombus terrestris [large earth bumblebee]
gi|383853483|ref|XP_003702252.1| PREDICTED: uncharacterized prot...   100   2e-18   Megachile rotundata
gi|332024598|gb|EGI64796.1| Uncharacterized protein C22orf9-like...   100   2e-18   Acromyrmex echinatior
gi|345487891|ref|XP_001604539.2| PREDICTED: hypothetical protein...   100   2e-18   
gi|402884542|ref|XP_003905739.1| PREDICTED: uncharacterized prot...    98   4e-18   
gi|410926637|ref|XP_003976784.1| PREDICTED: uncharacterized prot...    98   4e-18   
gi|432964881|ref|XP_004087016.1| PREDICTED: uncharacterized prot...    98   4e-18   
gi|402884540|ref|XP_003905738.1| PREDICTED: uncharacterized prot...    98   5e-18   
gi|170575267|ref|XP_001893168.1| MGC53303 protein [Brugia malayi...    98   5e-18   Brugia malayi [agent of lymphatic filariasis]
gi|504155727|ref|XP_004589775.1| PREDICTED: uncharacterized prot...    98   6e-18   Ochotona princeps [southern American pika]
gi|395537704|ref|XP_003770833.1| PREDICTED: uncharacterized prot...    98   6e-18   
gi|466057345|ref|XP_004279630.1| PREDICTED: uncharacterized prot...    97   8e-18   
gi|410965820|ref|XP_003989438.1| PREDICTED: uncharacterized prot...    97   9e-18   
gi|345776713|ref|XP_538331.3| PREDICTED: uncharacterized protein...    97   9e-18   
gi|57863293|ref|NP_056079.1| uncharacterized protein KIAA0930 is...    97   1e-17   Homo sapiens [man]
gi|297709139|ref|XP_002831301.1| PREDICTED: uncharacterized prot...    97   1e-17   
gi|507532733|ref|XP_004650438.1| PREDICTED: uncharacterized prot...    97   1e-17   Jaculus jaculus
gi|507693077|ref|XP_004642512.1| PREDICTED: uncharacterized prot...    97   1e-17   Octodon degus
gi|395753540|ref|XP_002831300.2| PREDICTED: uncharacterized prot...    97   1e-17   
gi|397482458|ref|XP_003812442.1| PREDICTED: uncharacterized prot...    97   1e-17   Pan paniscus [bonobo]
gi|57863295|ref|NP_001009880.1| uncharacterized protein KIAA0930...    97   1e-17   Homo sapiens [man]
gi|426394815|ref|XP_004063682.1| PREDICTED: uncharacterized prot...    97   1e-17   Gorilla gorilla gorilla [lowland gorilla]
gi|397482456|ref|XP_003812441.1| PREDICTED: uncharacterized prot...    96   2e-17   Pan paniscus [bonobo]
gi|470607648|ref|XP_004314658.1| PREDICTED: uncharacterized prot...    96   2e-17   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|511903371|ref|XP_004771183.1| PREDICTED: uncharacterized prot...    96   2e-17   
gi|403282738|ref|XP_003932797.1| PREDICTED: uncharacterized prot...    96   2e-17   Saimiri boliviensis boliviensis
gi|426394813|ref|XP_004063681.1| PREDICTED: uncharacterized prot...    96   2e-17   Gorilla gorilla gorilla [lowland gorilla]
gi|119593780|gb|EAW73374.1| chromosome 22 open reading frame 9, ...    96   2e-17   Homo sapiens [man]
gi|511992570|ref|XP_004813944.1| PREDICTED: uncharacterized prot...    96   2e-17   
gi|301775077|ref|XP_002922960.1| PREDICTED: uncharacterized prot...    96   2e-17   
gi|471390759|ref|XP_004380059.1| PREDICTED: uncharacterized prot...    96   2e-17   Trichechus manatus latirostris
gi|50510715|dbj|BAD32343.1| mKIAA0930 protein [Mus musculus]           96   2e-17   Mus musculus [mouse]
gi|23468240|gb|AAH38414.1| C22orf9 protein, partial [Homo sapiens]     96   3e-17   Homo sapiens [man]
gi|471390762|ref|XP_004380060.1| PREDICTED: uncharacterized prot...    96   3e-17   Trichechus manatus latirostris
gi|348551097|ref|XP_003461367.1| PREDICTED: uncharacterized prot...    96   3e-17   
gi|354500847|ref|XP_003512508.1| PREDICTED: uncharacterized prot...    96   3e-17   
gi|85701776|ref|NP_001028445.1| uncharacterized protein KIAA0930...    96   3e-17   Mus musculus [mouse]
gi|502132736|ref|XP_004501504.1| PREDICTED: uncharacterized prot...    96   3e-17   Cicer arietinum [garbanzo]
gi|291414554|ref|XP_002723526.1| PREDICTED: C22orf9 protein-like...    95   3e-17   
gi|119371895|sp|Q3UE31.2|K0930_MOUSE RecName: Full=Uncharacteriz...    95   3e-17   Mus musculus [mouse]
gi|338721437|ref|XP_001488217.3| PREDICTED: uncharacterized prot...    95   4e-17   
gi|358412566|ref|XP_001789220.2| PREDICTED: uncharacterized prot...    95   4e-17   
gi|297475484|ref|XP_002688024.1| PREDICTED: uncharacterized prot...    95   5e-17   
gi|472393263|ref|XP_004415902.1| PREDICTED: uncharacterized prot...    95   5e-17   Odobenus rosmarus divergens
gi|90083154|dbj|BAE90659.1| unnamed protein product [Macaca fasc...    94   7e-17   Macaca fascicularis [crab eating macaque]
gi|474174276|gb|EMS57699.1| hypothetical protein TRIUR3_16590 [T...    94   8e-17   Triticum urartu
gi|512881989|ref|XP_004895360.1| PREDICTED: uncharacterized prot...    94   8e-17   
gi|74215288|dbj|BAE41862.1| unnamed protein product [Mus musculus]     94   9e-17   Mus musculus [mouse]
gi|512966567|ref|XP_004845466.1| PREDICTED: uncharacterized prot...    94   9e-17   
gi|470530363|ref|XP_004368236.1| Hypothetical protein ACA1_29567...    94   9e-17   Acanthamoeba castellanii str. Neff
gi|426394817|ref|XP_004063683.1| PREDICTED: uncharacterized prot...    94   1e-16   Gorilla gorilla gorilla [lowland gorilla]
gi|511992568|ref|XP_004813943.1| PREDICTED: uncharacterized prot...    94   1e-16   
gi|511992578|ref|XP_004813948.1| PREDICTED: uncharacterized prot...    94   1e-16   
gi|478527835|ref|XP_004438098.1| PREDICTED: uncharacterized prot...    94   1e-16   
gi|511992566|ref|XP_004813942.1| PREDICTED: uncharacterized prot...    94   1e-16   
gi|511903369|ref|XP_004771182.1| PREDICTED: uncharacterized prot...    94   1e-16   Mustela putorius furo [black ferret]
gi|431899987|gb|ELK07922.1| hypothetical protein PAL_GLEAN100071...    94   1e-16   Pteropus alecto
gi|511903365|ref|XP_004771181.1| PREDICTED: uncharacterized prot...    94   1e-16   Mustela putorius furo [black ferret]
gi|512881985|ref|XP_004895359.1| PREDICTED: uncharacterized prot...    93   1e-16   
gi|512966565|ref|XP_004845465.1| PREDICTED: uncharacterized prot...    93   2e-16   Heterocephalus glaber [naked mole rat]
gi|350583704|ref|XP_003481569.1| PREDICTED: uncharacterized prot...    93   2e-16   
gi|351706872|gb|EHB09791.1| hypothetical protein GW7_03015 [Hete...    93   2e-16   Heterocephalus glaber [naked mole rat]
gi|402534533|ref|NP_001257976.1| uncharacterized protein KIAA093...    93   2e-16   Rattus norvegicus [brown rat]
gi|460384746|ref|XP_004238070.1| PREDICTED: uncharacterized prot...    93   2e-16   Solanum lycopersicum
gi|460384748|ref|XP_004238071.1| PREDICTED: uncharacterized prot...    92   2e-16   
gi|478259753|gb|ENN79594.1| hypothetical protein YQE_03965, part...    92   2e-16   Dendroctonus ponderosae
gi|326511815|dbj|BAJ92052.1| predicted protein [Hordeum vulgare ...    92   3e-16   Hordeum vulgare subsp. vulgare [barley]
gi|302772296|ref|XP_002969566.1| hypothetical protein SELMODRAFT...    92   3e-16   Selaginella moellendorffii
gi|478259754|gb|ENN79595.1| hypothetical protein YQE_03965, part...    92   5e-16   Dendroctonus ponderosae
gi|302774835|ref|XP_002970834.1| hypothetical protein SELMODRAFT...    91   5e-16   Selaginella moellendorffii
gi|344298531|ref|XP_003420945.1| PREDICTED: LOW QUALITY PROTEIN:...    91   6e-16   
gi|507635845|ref|XP_004700282.1| PREDICTED: uncharacterized prot...    91   7e-16   Echinops telfairi [lesser hedgehog tenrec]
gi|440905579|gb|ELR55948.1| hypothetical protein M91_12339, part...    91   7e-16   Bos mutus
gi|511992572|ref|XP_004813945.1| PREDICTED: uncharacterized prot...    91   9e-16   
gi|511903373|ref|XP_004771184.1| PREDICTED: uncharacterized prot...    91   9e-16   
gi|470109413|ref|XP_004290992.1| PREDICTED: uncharacterized prot...    90   1e-15   Fragaria vesca subsp. vesca
gi|356510612|ref|XP_003524031.1| PREDICTED: uncharacterized prot...    89   2e-15   
gi|350583702|ref|XP_003481568.1| PREDICTED: uncharacterized prot...    89   2e-15   Sus scrofa [pigs]
gi|256084132|ref|XP_002578286.1| hypothetical protein [Schistoso...    89   4e-15   
gi|56754130|gb|AAW25254.1| SJCHGC06789 protein [Schistosoma japo...    88   5e-15   Schistosoma japonicum
gi|402585680|gb|EJW79619.1| hypothetical protein WUBG_09472, par...    88   6e-15   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|350529331|ref|NP_001121760.2| uncharacterized protein LOC1000...    87   1e-14   
gi|159155804|gb|AAI54551.1| Zgc:172139 protein [Danio rerio]           86   2e-14   Danio rerio [leopard danio]
gi|488523196|ref|XP_004453489.1| PREDICTED: uncharacterized prot...    81   8e-13   Dasypus novemcinctus
gi|475517749|gb|EMT06126.1| Glycerol-3-phosphate dehydrogenase S...    78   5e-12   Aegilops tauschii


>gi|328767845|gb|EGF77893.1| hypothetical protein BATDEDRAFT_27226 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 482

 Score =  156 bits (394), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 107/327 (32%), Positives = 154/327 (47%), Gaps = 70/327 (21%)

Query: 149 PNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSRMDVKETSM-ECSYPLIYYVIDDYEDMF 207
           P++ SN      S   +++ ++K+V+A P KSRMDVK+  M ECS+PL+YY ++D+E   
Sbjct: 196 PSETSNTRTGNKSRMVAQRRITKKVFASPYKSRMDVKDAVMNECSFPLVYYTVNDFESHA 255

Query: 208 EHLIVTDGEYLCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXX 267
            HL +++ EYLCVEL+ TIP+                                       
Sbjct: 256 LHLPISEREYLCVELSFTIPDNQSSSAYAAATDKVASISL----------------EEDS 299

Query: 268 GPFPQPSNDSKITLFQGAASYSNLLEIYKQK----------AANKLNKRFKMGPVTP--- 314
            PFP P N +K+ LFQGA  YS+LL+ Y+QK          A   +N+        P   
Sbjct: 300 TPFPVPPNHTKVILFQGAVPYSSLLDNYQQKGLAVQSQFRQAWTNMNRHSSAASTNPNTG 359

Query: 315 ---------PTEYIMMRGPGGKGHAQVAITASSLDEANEDNFL--DITTSESNFVSSINA 363
                     TEYIMMRGP GKG  QVAIT       + D+++  D+ + ES+ V + + 
Sbjct: 360 EVDLNRSAGRTEYIMMRGPNGKGQCQVAIT-------DNDSYVSADVVSQESSAVEN-SP 411

Query: 364 NSDIEPWNFNSGNSSNTLTINNGKTTIRNPQRSTSSNSFFQSLKRLSQSITDKSSSDPES 423
            S  +   F      N L  N G     +  R          LK+            PES
Sbjct: 412 PSFTDRLRFFGSVVKNQLIGNTGSLGDHHAHRL---------LKK------------PES 450

Query: 424 LKCCMTFVNVPWTSIITDLITYARKKQ 450
           L+C MT+VNVPW SI +DL+ +A++K+
Sbjct: 451 LRCSMTYVNVPWQSISSDLLEFAKQKK 477



 Score = 82.0 bits (201), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/82 (53%), Positives = 55/82 (67%), Gaps = 9/82 (10%)

Query: 74  EFFLVNSDTK-NDDLLFFVRQTHSENENL-------DPVFVKRKTTPNSLPPLDDAVLWK 125
           +FF+  +  + +DDLLFFVRQ  S ++N        D V VKR+T    +P LDD V WK
Sbjct: 2   DFFIKTTGFEVHDDLLFFVRQLPSNSKNSPTALPDSDAVLVKRRTA-GVIPALDDVVDWK 60

Query: 126 ETFFLNLIVQLPCKLTVAVCTR 147
           ++FFLNLI QLPC LTVAVCTR
Sbjct: 61  QSFFLNLISQLPCTLTVAVCTR 82



>gi|321476188|gb|EFX87149.1| hypothetical protein DAPPUDRAFT_312713 [Daphnia pulex]
          Length = 488

 Score =  130 bits (327), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 177/401 (44%), Gaps = 95/401 (23%)

Query: 57  SDQDLDAGDPRWPNLFEEFFLVNSDTK--NDDLLFFVRQTHSENENL------DPVFVKR 108
           SD  L  G P W +LF   FL  SD     DDLLFFVR+   +            V V R
Sbjct: 46  SDFVLLHGTPYWTDLFVRHFLFESDQSIDADDLLFFVRKKLIKGSTRFLMKFETEVEVFR 105

Query: 109 KTTPNSLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRT-PNDNSNGPNQKTSMTCSK 166
           + +   LP  D  V W+ET +LNLI+ Q    LT+AVCTRT P D          +   K
Sbjct: 106 RDS-KKLPIGDPDVAWEETLYLNLIIHQFDYMLTLAVCTRTSPKD----------LQVLK 154

Query: 167 KHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTI 226
           +H  +RVYA P++ RMDVK    E +YP I +++D++++++E ++V DGE +CVEL  T 
Sbjct: 155 RHC-QRVYASPSRRRMDVKGDLEEITYPNICFMVDNFDEVYEDMLVRDGEMVCVELVAT- 212

Query: 227 PNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAA 286
            N+                                         PQ        LF G+ 
Sbjct: 213 -NRRG--------------------------------------VPQG------VLFLGSI 227

Query: 287 SYSNLLEIYKQKA--ANKLNKRFKM----GPVTPPTEYIMMRGPGGKGHAQVAITASSLD 340
            Y  L ++Y  +A    ++ ++F M    G  T   E++ M+GP GKGH+++A+T     
Sbjct: 228 RYEALKKVYDSRASLGTRVAQKFSMGLWNGASTHRMEFVRMKGPQGKGHSEMAVTKP--- 284

Query: 341 EANEDNFLDITTSESNFVSS--INANSDIEPWNFNSGNSSNTLTINNGKTTIRNP-QRST 397
              + + LD   SE  F ++   +A  D EP +  S      L+  +G   I N  QR  
Sbjct: 285 ---KSSGLDTPCSEPGFSATELWDAEWDSEPEDLCSNTRQRRLSEPSGGMPISNRCQRPN 341

Query: 398 SSNSFFQSLKRLSQSITDKSSSDPESLKCCMTFVNVPWTSI 438
           +S+             T+ S S+ E L  C    N  W  I
Sbjct: 342 TSHQM--------NGTTNMSRSENEGLDKC----NNTWNEI 370



>gi|198417594|ref|XP_002130649.1| PREDICTED: uncharacterized protein KIAA0930-like [Ciona
           intestinalis]
          Length = 384

 Score =  130 bits (326), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 108/393 (27%), Positives = 188/393 (47%), Gaps = 76/393 (19%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTPNSLPPLDDAVLWKET 127
           W  +F ++FL  ++  +DDLLF+V++T S  E+ + V V R+ + N+    D A  W ET
Sbjct: 38  WTQIFAKYFLHANNPHHDDLLFYVKKTESL-ESQNEVVVYRRESMNAPGLGDPAYDWTET 96

Query: 128 FFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSRMDVKE 186
            +LN+I+Q +   LT A+CT+    N  G      +T  KK VS+ VYA P++  M+ KE
Sbjct: 97  VYLNMIIQQMEYTLTCAICTKAETGNPKG-----DVTVHKK-VSQHVYASPSRHNMENKE 150

Query: 187 TSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXXXXXXXXXX 246
              E SYP I++ ID +++++  LI+ +GE +CVE+  +  +K                 
Sbjct: 151 GGTEMSYPNIFFTIDSFDEVWSDLILHEGEIVCVEVIASDKSKKLSS------------- 197

Query: 247 YYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQ--KAANKLN 304
                                             +F G+  Y +L+++Y++  KA NK  
Sbjct: 198 ---------------------------------VIFLGSVKYDSLVKVYERRTKAPNKFT 224

Query: 305 KRFKMG--PVTPPTEYIMMRGPGGKGHAQVAITASSLDEAN-------EDNFLDITTSES 355
           +   +G    +   E++ M+GPGGKG+A++AI  S+ D A+        D     +++ +
Sbjct: 225 QFMTLGLYKTSDSVEFVRMKGPGGKGYAEMAIQKSNSDTAHYKSTECASDESKASSSTTT 284

Query: 356 NFVSSINANSDIEPWNFNSGNSSNTLTINNGKTTIRNPQRSTSSNSFFQSLKRLSQSITD 415
           +   S++++      N  SG + +  T    K+  R       + S   S +R   SI  
Sbjct: 285 SASCSLHSSKSESSINEPSGGNKDFPTAVYSKSEQRE------NVSLPSSPQRKRASIPT 338

Query: 416 KSSSDPESLKCCMTFVNVPWTSIITDLI-TYAR 447
            ++    +LK  +T+V +PW  II D++ TY +
Sbjct: 339 TTT----ALKTHLTYVTLPWHKIILDILQTYEK 367



>gi|156402794|ref|XP_001639775.1| predicted protein [Nematostella vectensis]
 gi|156226905|gb|EDO47712.1| predicted protein [Nematostella vectensis]
          Length = 232

 Score =  125 bits (314), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 129/278 (46%), Gaps = 67/278 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLD----PVFVKRKTTPNSLPPLDD-AV 122
           W  LF ++F+   D   DDLLF+V+         D     + V RK T N LP L D  +
Sbjct: 11  WTRLFSQYFIYKHDDSRDDLLFYVKSAAPSKRGKDSSKSEILVFRKDTKN-LPSLGDPDI 69

Query: 123 LWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSR 181
            W+ET +LNLI+ Q    LT AVCT+        P++K       + +S++VYA P++ R
Sbjct: 70  DWEETVYLNLILHQFEYTLTCAVCTK--------PHEKELRIL--RRISQQVYATPSRRR 119

Query: 182 MDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXXXXX 241
           MD K  + E SYP I++VIDD+E+ F+   V D E +CVEL                   
Sbjct: 120 MDSKGETTEISYPNIFFVIDDFEETFKDFTVKDNEMVCVELVAR---------------- 163

Query: 242 XXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQKA-- 299
                                           +   K  +F G+  + +L ++Y+ +A  
Sbjct: 164 ------------------------------DKTESFKGVVFLGSIRFESLKKVYENRASM 193

Query: 300 ANKLNKRFKMG--PVTPPTEYIMMRGPGGKGHAQVAIT 335
           A K+ ++  MG        E+I M+GP GKGHA++AI+
Sbjct: 194 ATKVAQKMSMGWWKGQSTVEFIKMKGPSGKGHAEMAIS 231



>gi|512913847|ref|XP_004927993.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Bombyx mori]
          Length = 397

 Score =  116 bits (291), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 102/384 (26%), Positives = 168/384 (43%), Gaps = 89/384 (23%)

Query: 64  GDPRWPNLFEEFFLVNSDTK--NDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL   +     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 47  GTTYWTDLFVRHFLFQEEQAIDCDDLLFFVRKRHVKGSSRYLPKYETDVEVFRKDS-KKL 105

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNLIV Q    LT+A+CTRT       P +   +   K+H S++VY
Sbjct: 106 PIGDPEIDWEETVYLNLIVHQFDYTLTLAICTRTS------PKE---LQVLKRH-SQKVY 155

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL            
Sbjct: 156 ASPSRRKMDTKGEGEEMTYPHICFMVDNFDEVFCDIVVRDGEMVCVELVAR--------- 206

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                     ++  +F G+  Y  L  +
Sbjct: 207 -------------------------------------GRGGSAQAVIFLGSIRYDTLTRV 229

Query: 295 YKQKA---ANKLNKRFKMGPVTPPT----EYIMMRGPGGKGHAQVAITASSLDEANEDNF 347
           Y  +    + K+ +R   G +   T    E++ M+GPGGKGHA++A++            
Sbjct: 230 YDSRQTSLSTKVAQRMSFGLLGSKTAARCEFVRMKGPGGKGHAEMAVSRP------RGAG 283

Query: 348 LDITTSESNFVSSINANSDIEPWNFNSGNSSNTLTINNGKTTIRNPQRSTSSNSFFQSLK 407
           +D  TSE    ++       + W+ +       L +   +  + +P  S + N+F +S  
Sbjct: 284 VDTPTSEPGLAAT-------DMWDSDWDEDPEELFVYRHQRRLSDP--SANINNFTRSGW 334

Query: 408 RLSQSITDKSSSDPESLKCCMTFV 431
           R ++   DKS S+ E L   ++ V
Sbjct: 335 R-TKDNRDKSRSENEGLDSMVSGV 357



>gi|157136216|ref|XP_001656778.1| hypothetical protein AaeL_AAEL003445 [Aedes aegypti]
 gi|108881046|gb|EAT45271.1| AAEL003445-PA [Aedes aegypti]
          Length = 887

 Score =  114 bits (285), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 137/293 (46%), Gaps = 80/293 (27%)

Query: 64  GDPRWPNLFEEFFLVNSDTKN----DDLLFFVRQTHSENENL------DPVFVKRKTTPN 113
           G   W +LF   FL  ++ ++    DDLLFFVR+ H +  +         + V RK +  
Sbjct: 54  GTTYWTDLFVRHFLFQTEKQHSIDCDDLLFFVRKKHVKGSSRVMPKYETEIEVFRKDS-R 112

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LNL++ Q    LT+A+CTRT       P +   +   ++H S++
Sbjct: 113 KLPIGDPDVDWEETVYLNLVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQK 162

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           VYA P++ +MD K  S E +YP I +++D+++++F  ++V DGE +CVEL  T       
Sbjct: 163 VYASPSRRKMDTKGESEEITYPHICFMVDNFDEVFHDILVRDGEMVCVELVAT------- 215

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKI--TLFQGAASYSN 290
                                                      D  +   +F G+  Y  
Sbjct: 216 -----------------------------------------DRDGSVQGVIFLGSIRYDA 234

Query: 291 LLEIYKQKA---ANKLNKRFKMGPVT---PPT--EYIMMRGPGGKGHAQVAIT 335
           L ++Y  +     +K+ +R   G  +   P T  E++ M+GP GKGHA++A+T
Sbjct: 235 LKKVYDARQSSLGSKVAQRMSFGLFSSGGPQTRCEFVRMKGPQGKGHAEMAVT 287



>gi|158300952|ref|XP_320746.4| AGAP011764-PA [Anopheles gambiae str. PEST]
 gi|157013406|gb|EAA00390.4| AGAP011764-PA [Anopheles gambiae str. PEST]
          Length = 891

 Score =  113 bits (283), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 151/326 (46%), Gaps = 86/326 (26%)

Query: 64  GDPRWPNLFEEFFLVNSDTKN----DDLLFFVRQTHSENENL------DPVFVKRKTTPN 113
           G   W +LF   FL  S+ ++    DDLLFFVR+ H +  +         + V RK +  
Sbjct: 53  GTTYWTDLFVRHFLFQSEPEHSIDCDDLLFFVRKKHIKGSSRAMPRYETEIEVFRKDS-R 111

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LNL++ Q    LT+A+CTRT       P +   +   ++H S++
Sbjct: 112 KLPIGDPDVDWEETVYLNLVIHQFNYTLTLAICTRT------SPKE---LQVLRRH-SQK 161

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           VYA P++ +MD K  S E +YP I +++D+++++F  ++V DGE +CVEL  T       
Sbjct: 162 VYASPSRRKMDTKGDSEEITYPHICFMVDNFDEVFHDILVRDGEMVCVELVAT------- 214

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKI--TLFQGAASYSN 290
                                                      D  +   +F G+  Y  
Sbjct: 215 -----------------------------------------DRDGSVQGVIFLGSIRYDA 233

Query: 291 LLEIYKQKA---ANKLNKRFKMGPVT---PPT--EYIMMRGPGGKGHAQVAITASSLDEA 342
           L ++Y  +     +K+ +R   G  +   P T  E++ M+GP GKGHA++A+T       
Sbjct: 234 LKKVYDARQSSLGSKVAQRMSFGLFSSGGPQTRCEFVRMKGPQGKGHAEMAVTKP----- 288

Query: 343 NEDNFLDITTSESNFVSSINANSDIE 368
            + + ++  TSE  F ++   +S+ E
Sbjct: 289 -KGSGVETPTSEPGFCATDMWDSEWE 313



>gi|72010481|ref|XP_786746.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 2
           [Strongylocentrotus purpuratus]
 gi|390344020|ref|XP_003726025.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 1
           [Strongylocentrotus purpuratus]
          Length = 410

 Score =  113 bits (283), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 188/413 (45%), Gaps = 91/413 (22%)

Query: 68  WPNLFEEFFLVNS-DTKNDDLLFFVRQ---THSENENLDPVFVKRKTTPNSLPPLDDA-V 122
           W  LF + F+    +   DD+LFF+ +   T  ++     + V R+ + N LP L +  +
Sbjct: 53  WARLFSQHFVAEVPEELRDDMLFFIHRKQPTSRQDRQQARLEVFRQDSKN-LPSLGEPNI 111

Query: 123 LWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSR 181
            W+ET +LNLI+Q     LT AVC ++          + ++T  +KH +++V+A P++ R
Sbjct: 112 DWEETVYLNLILQQYNYILTCAVCIKS----------EGTLTILRKH-TEQVFASPSRRR 160

Query: 182 MDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXXXXX 241
           MD K    E SYP I+++ID+++++F    V +G+  CVEL  +                
Sbjct: 161 MDSKGEESEVSYPNIFFIIDNFDEIFGDFTVQEGQMFCVELVAS---------------- 204

Query: 242 XXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQKA-- 299
                                     GPF       +  +F G+  +  L ++Y  +A  
Sbjct: 205 -----------------------EKQGPF-------RSVVFLGSVRHEALKKVYDNRASV 234

Query: 300 ANKLNKRFKMG---PVTPPTEYIMMRGPGGKGHAQVAITASSLDEANEDNFLDITTSESN 356
           ++K+  +  MG         E+I MRGP GKG A+VA++ +S   + E +  D+ ++  +
Sbjct: 235 SSKVASKVSMGFFQGGRGRVEFIRMRGPEGKGFAEVAVSRASWSSSVESSTEDVHSASES 294

Query: 357 FVSSINA--------------NSDIEPWNFNSGNSSNTL-TINNGK---TTIRNPQRSTS 398
           F S+ +                S I      S + S TL T+ NGK      ++      
Sbjct: 295 FDSTTDGPSTSTGSLPRDVIIGSPIHKGLRKSQSDSETLSTLTNGKDEEAACQSEDEGPP 354

Query: 399 SNSFFQSLKRLSQS---ITDKSSSDPESLKCCMTFVNVPWTSIITDLITYARK 448
           S+   + ++R S +   +T +S+  P +L   +T+V +PW  II D++   +K
Sbjct: 355 SSWSRRWMRRTSDALLRLTMRSTQVP-ALNVHLTYVTLPWHRIIADVLEVKKK 406



>gi|312381709|gb|EFR27395.1| hypothetical protein AND_05929 [Anopheles darlingi]
          Length = 1503

 Score =  113 bits (282), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 150/326 (46%), Gaps = 86/326 (26%)

Query: 64  GDPRWPNLFEEFFLVNSDTKN----DDLLFFVRQTHSENENLD------PVFVKRKTTPN 113
           G   W +LF   FL  S+ ++    DDLLFFVR+ H +  +         + V RK +  
Sbjct: 61  GTTYWTDLFVRHFLFQSEPEHSIDCDDLLFFVRKKHIKGSSRTMPKYETEIEVFRKDS-R 119

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LNL++ Q    LT+A+CTRT       P +   +   ++H S++
Sbjct: 120 KLPIGDPDVDWEETVYLNLVIHQFNYTLTLAICTRT------SPKE---LQVLRRH-SQK 169

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           VYA P++ +MD K  S E +YP I +++D+++++F  ++V DGE +CVEL  T       
Sbjct: 170 VYASPSRRKMDTKGDSEEITYPHICFMVDNFDEVFHDILVRDGEMVCVELVAT------- 222

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKI--TLFQGAASYSN 290
                                                      D  +   +F G+  Y  
Sbjct: 223 -----------------------------------------DRDGSVQGVIFLGSIRYDA 241

Query: 291 LLEIYKQKA---ANKLNKRFKMGPVT---PPT--EYIMMRGPGGKGHAQVAITASSLDEA 342
           L  +Y  +     +K+ +R   G  +   P T  E++ M+GP GKGHA++A+T       
Sbjct: 242 LKRVYDARQSSLGSKVAQRMSFGLFSSGGPQTRCEFVRMKGPQGKGHAEMAVTKP----- 296

Query: 343 NEDNFLDITTSESNFVSSINANSDIE 368
            + + ++  TSE  F ++   +S+ E
Sbjct: 297 -KGSGVETPTSEPGFCATDMWDSEWE 321



>gi|170047986|ref|XP_001851482.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167870233|gb|EDS33616.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 871

 Score =  113 bits (282), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 151/326 (46%), Gaps = 86/326 (26%)

Query: 64  GDPRWPNLFEEFFLVNSDTKN----DDLLFFVRQTHSENENL------DPVFVKRKTTPN 113
           G   W +LF   FL  ++ ++    DDLLFFVR+ H +  +         + V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEKRHTIDCDDLLFFVRKKHVKGSSRVMPKYETEIEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LNL++ Q    LT+A+CTRT       P +   +   ++H S++
Sbjct: 107 KLPIGDPDVDWEETVYLNLVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQK 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           VYA P++ +MD K  S E +YP I +++D+++++F  ++V DGE +CVEL  +       
Sbjct: 157 VYASPSRRKMDTKGESEEITYPHICFMVDNFDEVFHDILVRDGEMVCVELVAS------- 209

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKI--TLFQGAASYSN 290
                                                      D  +   +F G+  Y  
Sbjct: 210 -----------------------------------------DRDGSVQGVIFLGSIRYDA 228

Query: 291 LLEIYKQKAAN---KLNKR-----FKMGPVTPPTEYIMMRGPGGKGHAQVAITASSLDEA 342
           L ++Y  + ++   K+ +R     F  G  +   E++ M+GP GKGHA++A+T       
Sbjct: 229 LKKVYDARQSSLSTKVAQRMSFGLFSSGGPSTRCEFVRMKGPQGKGHAEMAVTKP----- 283

Query: 343 NEDNFLDITTSESNFVSSINANSDIE 368
            + + ++  TSE  F ++   +S+ E
Sbjct: 284 -KGSGVETPTSEPGFCATDMWDSEWE 308



>gi|405978767|gb|EKC43130.1| Uncharacterized protein C22orf9-like protein [Crassostrea gigas]
          Length = 391

 Score =  113 bits (282), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 137/295 (46%), Gaps = 71/295 (24%)

Query: 68  WPNLFEEFFLVNS---DTKNDDLLFFVRQTHS---ENENLDPVFVKRKTTPNSLPPLDDA 121
           W ++F ++F+  S   D + DD+LF+VR+TH+   ++    P     +    SLP L+D 
Sbjct: 8   WTDIFTKYFIDPSKLPDDQRDDMLFYVRKTHNPKNKSFTFRPEIEVYRRDSKSLPALEDK 67

Query: 122 VL-WKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTK 179
            + W+ET ++N+I  QL    T AVCTRT   +         +   +K  S+RVY  P+K
Sbjct: 68  TIDWEETVYMNIISHQLVYTATCAVCTRTSEHH---------LQILRK-FSQRVYPSPSK 117

Query: 180 SRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXXX 239
            RMD K T  E +YP IY+ +D++E+ F  ++V DGE + VEL  +              
Sbjct: 118 RRMDDKGTEEELTYPNIYFTVDNFEEAFGDIVVRDGELVSVELTAS-------------- 163

Query: 240 XXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQKA 299
                                                ++  +F GA  Y  L ++Y  + 
Sbjct: 164 --------------------------------DRHGRAQGVIFLGAVRYEVLKKVYDARL 191

Query: 300 A--NKLNKRFKMGPV--TPPTEYIMMRGPGGKGHAQVAIT---ASSLDEANEDNF 347
           +  +K+ +   +G +      E++ MRGP  KGHA++A++    S  +  N++NF
Sbjct: 192 SLTSKMMQTMSLGMIKQNKRVEFVRMRGPKSKGHAEIAVSRVPGSGPETPNKENF 246



>gi|357613729|gb|EHJ68688.1| hypothetical protein KGM_13289 [Danaus plexippus]
          Length = 627

 Score =  112 bits (281), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 131/292 (44%), Gaps = 75/292 (25%)

Query: 64  GDPRWPNLFEEFFLVNSDTK--NDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL   +     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 45  GTTYWTDLFVRHFLFQEEQSIDCDDLLFFVRKRHVKGSSRYLPKYETDVEVFRKDS-KKL 103

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNLIV Q    LT+A+CTRT       P +   +   K+H S++VY
Sbjct: 104 PIGDPEIDWEETVYLNLIVHQFDYTLTLAICTRT------SPKE---LQVLKRH-SQKVY 153

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL            
Sbjct: 154 ASPSRRKMDTKGEGEEMTYPHICFMVDNFDEVFCDIVVRDGEMVCVELVAR--------- 204

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                     ++  +F G+  Y  L  +
Sbjct: 205 -------------------------------------GRGGAAQAVIFLGSIRYDALTRV 227

Query: 295 YKQKAAN---KLNKRFKMG------PVTPPTEYIMMRGPGGKGHAQVAITAS 337
           Y  + ++   K+ +R   G            E++ M+GPGGKGHA+VA++ +
Sbjct: 228 YDARQSSLSTKVAQRMSFGLLGRGAGAAARCEFVRMKGPGGKGHAEVAVSRA 279



>gi|242025486|ref|XP_002433155.1| conserved hypothetical protein [Pediculus humanus corporis]
 gi|212518696|gb|EEB20417.1| conserved hypothetical protein [Pediculus humanus corporis]
          Length = 436

 Score =  112 bits (280), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 85/287 (29%), Positives = 129/287 (44%), Gaps = 72/287 (25%)

Query: 64  GDPRWPNLFEEFFLVNSD--TKNDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL  ++     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 52  GTTYWTDLFVRNFLFQTELSIDCDDLLFFVRKKHIKGSSRYLPKFETEVEVFRKDS-KKL 110

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNLI+ Q    LT+A+CTRT             +   K+H S++VY
Sbjct: 111 PIGDPDIDWEETVYLNLIIHQFDYVLTLAICTRTSC---------KELQILKRH-SQKVY 160

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+  RMD K  + + +YP I ++ID+++++F  + V DGE +CVEL  T         
Sbjct: 161 ASPSHRRMDTKGETEDMTYPYICFMIDNFDEVFSDITVRDGEMVCVELVAT--------- 211

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                     +   +F G+  Y  L  +
Sbjct: 212 -------------------------------------DREGSTHGVIFLGSIRYDALKWV 234

Query: 295 YKQK--AANKLNKRFKMGPVTPPT----EYIMMRGPGGKGHAQVAIT 335
           Y  +  A  K+++R   G  +  +    EY+ M+GP GKGHA+VA+T
Sbjct: 235 YDARVSANAKMSQRMTFGLFSSASSGRIEYVRMKGPDGKGHAEVAVT 281



>gi|189236528|ref|XP_975467.2| PREDICTED: similar to conserved hypothetical protein [Tribolium
           castaneum]
 gi|270005304|gb|EFA01752.1| hypothetical protein TcasGA2_TC007350 [Tribolium castaneum]
          Length = 676

 Score =  112 bits (279), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 89/319 (27%), Positives = 148/319 (46%), Gaps = 79/319 (24%)

Query: 64  GDPRWPNLFEEFFLVNSDT--KNDDLLFFVRQTHSENE-NLDPVF-----VKRKTTPNSL 115
           G   W +LF   FL  +++    DDLLFFVR+ H +      P F     V RK +   L
Sbjct: 45  GTTYWTDLFVRHFLFQNESTIDCDDLLFFVRKKHVKGSPRYLPKFETEVDVFRKDS-RKL 103

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNLI+ Q    LT+A+CTRT       P +   +   K+H S++VY
Sbjct: 104 PIGDPDIDWEETVYLNLIIHQFEYTLTLAICTRT------SPKE---LQVLKRH-SQKVY 153

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P++ RMD K    E +YP I +++D+++++F  ++V DGE +CVEL  +         
Sbjct: 154 ASPSRRRMDTKGEVEEMTYPHICFMVDNFDEVFHDILVRDGEMVCVELVAS--------- 204

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +   +  +F G+  Y  L ++
Sbjct: 205 -------------------------------------DRAGTVQGVIFLGSIRYDALKKV 227

Query: 295 YKQKAAN---KLNKRFKMGPVTPPT----EYIMMRGPGGKGHAQVAITASSLDEANEDNF 347
           Y  + ++   K+ +R   G  +  +    E++ M+GP GKGHA++A+T        + + 
Sbjct: 228 YDARQSSLSTKMAQRMTFGLFSTASSQRCEFVRMKGPQGKGHAEMAVTKP------KGSG 281

Query: 348 LDITTSESNFVSSINANSD 366
           ++  TSE  F ++   +SD
Sbjct: 282 VETPTSEPGFCATDMWDSD 300



>gi|291241833|ref|XP_002740815.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii]
          Length = 422

 Score =  111 bits (278), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 134/294 (45%), Gaps = 75/294 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVR--------QTHSENENLDPVFVKRKTTPNSLPPLD 119
           W  LF+  F+ + D   DD+LF+VR        Q  +E   LD VF   +     LP L 
Sbjct: 44  WTQLFKHHFVESIDELRDDMLFYVRKREEIDRDQVQNEKVKLD-VF---RRDAKILPSLG 99

Query: 120 DA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALP 177
           D  + W+++ +LNLI+Q     LT A+C +   D          +   KKH S+ VYA P
Sbjct: 100 DPDIDWEQSVYLNLILQQFEYTLTCAICRKPGKD----------IHVIKKH-SQSVYASP 148

Query: 178 TKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXX 237
           +K +MD K    E +YP IY++ID++++ F  +++ +G+ +CVEL               
Sbjct: 149 SKRQMDSKGEVAEVAYPNIYFIIDNFDEAFGDMMIEEGQMVCVELVAQ------------ 196

Query: 238 XXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQ 297
                                         G F       +  +F G+  Y  L  +Y+ 
Sbjct: 197 ---------------------------EKLGTF-------QGVIFLGSVRYEALRRVYEG 222

Query: 298 KA--ANKLNKRFKMGPVT--PPTEYIMMRGPGGKGHAQVAITASSLDEANEDNF 347
           +A  A+++ +R  +G  T     E+I M+GP GKGHA++A++    D+ ++  +
Sbjct: 223 RASMASRIAQRMSLGKYTGRGRMEFIRMKGPEGKGHAEMAVSRYKPDDGHDSYY 276



>gi|307207314|gb|EFN85064.1| Uncharacterized protein C22orf9-like protein [Harpegnathos
           saltator]
          Length = 715

 Score =  110 bits (276), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 132/287 (45%), Gaps = 72/287 (25%)

Query: 64  GDPRWPNLFEEFFLVNSD--TKNDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL  ++     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 49  GTTYWTDLFVRHFLFQAEHTIDGDDLLFFVRKKHVKTSSRYLPKFETEVDVFRKDS-KKL 107

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNL+V Q    LT+A+CTRT       P +   +   ++H S++VY
Sbjct: 108 PIGDPDIDWEETVYLNLVVHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQKVY 157

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P++ RMD K    E +YP I +++D+++++F  ++V DGE +CVEL  +         
Sbjct: 158 ASPSRRRMDAKGDLEEMTYPHICFMVDNFDEVFCDILVRDGEMVCVELVAS--------- 208

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                      +  +F G+  Y  L ++
Sbjct: 209 -------------------------------------DREGAVQGVIFLGSIRYDALKKV 231

Query: 295 YKQKA--ANKLNKRFKM----GPVTPPTEYIMMRGPGGKGHAQVAIT 335
           Y  ++  + K+ +R       G  +   E++ M+GP GKGHA++A+T
Sbjct: 232 YDARSSLSTKMAQRMTFGLFSGAASQRIEFVRMKGPRGKGHAEMAVT 278



>gi|449671358|ref|XP_002170387.2| PREDICTED: uncharacterized protein KIAA0930 homolog [Hydra
           magnipapillata]
          Length = 382

 Score =  110 bits (275), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 115/419 (27%), Positives = 181/419 (43%), Gaps = 107/419 (25%)

Query: 61  LDAGDPRWPNLFEEFFL----VNSDTKN---------DDLLFFVRQTHSENENLDPVFVK 107
           ++A +  WP+LF  +F+     +SD +N         DD+LF+V+  ++++ N   VF  
Sbjct: 33  VNADESLWPSLFGCYFMGISSEDSDNRNETAENQQNDDDMLFYVQSKYNQSGNEIKVF-- 90

Query: 108 RKTTPNSLPPLDD-AVLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCS 165
           RKT+ N LP L D  + W E+ +LN+I+  +   LT A+CTR P  N      KTS+   
Sbjct: 91  RKTSKN-LPGLGDPHINWMESVYLNMIMHDMEYTLTCAICTRLPT-NDLKVLYKTSL--- 145

Query: 166 KKHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
                 +V+A     RMD K  S + SYP I+++ID Y+++FE + +   E LCVEL+  
Sbjct: 146 ------KVHASHHMRRMDSKGESSDLSYPNIFFIIDSYDEVFESMSIEQEEILCVELSA- 198

Query: 226 IPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGA 285
                                Y G                             I +F G+
Sbjct: 199 --------------------KYKGTK-------------------------ENIVIFLGS 213

Query: 286 ASYSNLLEIYKQKA--ANKLNKRFK---MGPVTPPTEYIMMRGPGGKGHAQ--VAITASS 338
             +  LL  Y+ K     K  ++     +G  T   EYI MRGP GKG A+  + +  ++
Sbjct: 214 VRHEALLMTYEAKTTIGTKFAQKMSWINLGGSTDHFEYIRMRGPYGKGFAEMRIGLCKNN 273

Query: 339 LDEANEDNFL---DITTSESNFVSSINANSDI------EPWNFNSGNSSNTLTINNGKTT 389
           L E N  N     D+ +S  N    +N N+ I       P       SSN  T N     
Sbjct: 274 LVEHNGINRHRNKDVNSSSINCNCRLNENNQIYAPTTASPDKCMKCGSSNKKT-NTSNNL 332

Query: 390 IRNPQRSTSSNSFFQSLKRLSQSITDKSSSDPESLKCCMTFVNVPWTSIITDLITYARK 448
           + NP +      +FQ           +S  +  +L   +T+V +PW+ I+ D++   +K
Sbjct: 333 LANPVK------WFQG----------RSKIEVPTLSPHLTYVTLPWSRIMKDILILKQK 375



>gi|308511499|ref|XP_003117932.1| hypothetical protein CRE_00575 [Caenorhabditis remanei]
 gi|308238578|gb|EFO82530.1| hypothetical protein CRE_00575 [Caenorhabditis remanei]
          Length = 463

 Score =  109 bits (272), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 110/453 (24%), Positives = 188/453 (41%), Gaps = 115/453 (25%)

Query: 54  ELFSDQDLDA------GDPRWPNLFEEFFLVNS-------DTKNDDLLFFVRQTH----- 95
           +L + QD D        + +W  LF EF + N+         ++DD++++V Q       
Sbjct: 54  KLATQQDGDGFTMVQNNEVKWAKLFMEFIIGNAYCQSTKCQAQSDDMIWYVHQAKLTNSF 113

Query: 96  --SENENLDPVFVKRKTTPNSLPPLDDAVLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDN 152
               N+NL  VF  R+ + N   P DD   W+ET  LN+I+Q +   +T AVCT+T    
Sbjct: 114 YIQGNQNLLQVF--RRHSKNQPTPCDDNYNWEETVCLNIIMQQIDFYVTCAVCTKT---- 167

Query: 153 SNGPNQKTSMTCSKKHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIV 212
             GP    ++   +K+  +RV+  P++ RMD K  + E +YP +Y+ ID +E++F  +IV
Sbjct: 168 --GPQ---NLQIIRKNC-QRVFPSPSRRRMDSKGENEEITYPKLYFAIDGFEEIFNDVIV 221

Query: 213 TDGEYLCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQ 272
            DGE +CVEL      K                                           
Sbjct: 222 RDGECVCVELVARDRQKTRES--------------------------------------- 242

Query: 273 PSNDSKITLFQGAASYSNLLEIYKQKAANKLNKRFK-MGPVTPPTEYIMMRGPGGKGHAQ 331
                   +F G+  Y  L ++Y  KA++      K M       E++ MRGP GKG+A+
Sbjct: 243 -------VVFLGSIRYEILKQVYDTKASSTWQWAQKLMKAGDRRQEFVRMRGPQGKGYAE 295

Query: 332 VAI------------TASSLD------------EANEDNFLDITTSESNFVSSIN---AN 364
           +A+            T + +D            E+ E +      SE+N         + 
Sbjct: 296 MAVARVPNCGYETPLTENPIDFSELAGVSEKKRESVEQSLGKRRMSETNLAGGTRMFPSR 355

Query: 365 SDIEPWNFNSGN--SSNTLTINN----GKTTIRNPQRSTSSNSFF--QSLKRLSQSITDK 416
           S   P + + G    S   T+N       + I +      +N  +  +   ++   + +K
Sbjct: 356 SIATPSHSSRGRRWQSEADTVNQYPEVEGSNIDDELDEGPTNKLWSMRGFAQVWHGLREK 415

Query: 417 SSSDPESLKCCMTFVNVPWTSIITDLITYARKK 449
             ++   L   +T+V +PW SI+ DL++  +K+
Sbjct: 416 KRAECTPLNAFLTYVTLPWNSILNDLLSERQKR 448



>gi|339240677|ref|XP_003376264.1| conserved hypothetical protein [Trichinella spiralis]
 gi|316975032|gb|EFV58491.1| conserved hypothetical protein [Trichinella spiralis]
          Length = 457

 Score =  107 bits (267), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 111/432 (25%), Positives = 176/432 (40%), Gaps = 117/432 (27%)

Query: 68  WPNLFEEFFLVNSDT-------KNDDLLFFV-RQTHSENENLDP----VFVKRKTTPNSL 115
           W  +F EFFLVN+         + DD+L++V   +   N  L      + V RKT+    
Sbjct: 47  WARIFAEFFLVNAHCTKSHCSFQTDDILWYVPHSSFIYNSFLTSQSGFIKVYRKTSKKQP 106

Query: 116 PPLDDAVLWKETFFLNLIV-------QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKH 168
            P   ++ W+ET +LNL++       ++   LT AVCTRT   N         +   KK+
Sbjct: 107 SPGSQSINWEETLYLNLLLHENTVFFEVEYVLTCAVCTRTSPQN---------LQILKKY 157

Query: 169 VSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPN 228
            S+RVYA P++ RMD K  S E +YP I + +D++E +F+ +++ DGE +CVEL      
Sbjct: 158 -SQRVYASPSRHRMDSKGESEEFTYPNICFPVDNFEQVFKEIVIRDGECVCVELVA---- 212

Query: 229 KXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASY 288
                                                        S     T+F G+  Y
Sbjct: 213 ------------------------------------------KDLSGQYVSTIFLGSIRY 230

Query: 289 SNLLEIYKQKAANKLNKRFKMGPVT--PPTEYIMMRGPGGKGHAQVAIT----------A 336
             L ++Y  K  +  N    +   T     E+++MRGP GKG A++A+            
Sbjct: 231 EVLKQVYDSKICSTWNWANNLIRSTGHKRLEFVIMRGPRGKGFAEMAVARVPVQGYQTPV 290

Query: 337 SSLDEANEDNFL-----------DITTSESNFVSSI---NANSDIEPWNFNSGNSSNTL- 381
           SS+   +E + L           D   S  + V+S    N  S   P       +  +  
Sbjct: 291 SSIGSYDEKDLLSAVKAYQRRRSDTNLSRWSCVTSSFYENYKSTCHPVKKCPSETDTSRQ 350

Query: 382 -------TINNGKTTIRNPQRST----SSNSFFQSLKRLSQSITDKSSSDPESLKCCMTF 430
                  TI++G   I N   +     S+  F Q+  RL     +K  +D   L   +T+
Sbjct: 351 WPEVEASTIDDGSNKIGNESLALGQLWSTRGFSQAWHRLR----EKRRADCVPLNAHLTY 406

Query: 431 VNVPWTSIITDL 442
           + +PW+SI+  L
Sbjct: 407 ITLPWSSIVAVL 418



>gi|268579979|ref|XP_002644972.1| Hypothetical protein CBG10937 [Caenorhabditis briggsae]
          Length = 454

 Score =  107 bits (267), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 108/445 (24%), Positives = 185/445 (41%), Gaps = 107/445 (24%)

Query: 54  ELFSDQDLDA------GDPRWPNLFEEFFLVNS-------DTKNDDLLFFVRQTH----- 95
           +L + QD D        + +W  LF EF + N+          +DD++++V Q       
Sbjct: 53  KLATQQDGDGFTMVQNNEVKWAKLFMEFIIGNAYCQSTKCHAHSDDMIWYVNQAKLTNSF 112

Query: 96  --SENENLDPVFVKRKTTPNSLPPLDDAVLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDN 152
               N++L  VF  R+   N   P DD   W+ET  LN+I+Q +   +T AVCT+T    
Sbjct: 113 YIQGNQSLLQVF--RRNGKNQPAPADDNYNWEETVCLNIIMQQIDFYVTCAVCTKT---- 166

Query: 153 SNGPNQKTSMTCSKKHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIV 212
             GP    ++   +K+  +RV+  P++ RMD K  + E +YP +Y+ ID +E++F  +IV
Sbjct: 167 --GPQ---NLQIIRKNC-QRVFPSPSRRRMDSKGENEEITYPKLYFAIDGFEEIFNDVIV 220

Query: 213 TDGEYLCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQ 272
            DGE +CVEL      K                                           
Sbjct: 221 RDGECVCVELVARDRQKTRES--------------------------------------- 241

Query: 273 PSNDSKITLFQGAASYSNLLEIYKQKAANKLNKRFK-MGPVTPPTEYIMMRGPGGKGHAQ 331
                   +F G+  Y  L ++Y  KA++      K M       E++ MRGP GKG+A+
Sbjct: 242 -------VVFLGSIRYEILKQVYDTKASSTWQWAQKLMKAGDRRQEFVRMRGPQGKGYAE 294

Query: 332 VAITA---SSLDEANEDNFLDIT-------------TSESNFVSSIN---ANSDIEPWNF 372
           +A+T       +    +N +D +              SE+N         + S   P + 
Sbjct: 295 MAVTRVPNCGYETPLTENPIDFSELAGVEQSLGKRRMSETNLAGGTRMFPSRSIATPSHS 354

Query: 373 NSGN--SSNTLTINN----GKTTIRNPQRSTSSNSFF--QSLKRLSQSITDKSSSDPESL 424
           + G    S   T+N       + I +      +N  +  +   ++   + +K  ++   L
Sbjct: 355 SRGRRWQSEADTVNQYPEVEGSNIDDELDEGPTNKLWSMRGFAQVWHGLREKKRAECTPL 414

Query: 425 KCCMTFVNVPWTSIITDLITYARKK 449
              +T+V +PW SI+ DL++  +K+
Sbjct: 415 NAFLTYVTLPWNSILNDLLSERQKR 439



>gi|17550490|ref|NP_509174.1| Protein C16E9.2, isoform a [Caenorhabditis elegans]
 gi|351058153|emb|CCD64767.1| Protein C16E9.2, isoform a [Caenorhabditis elegans]
          Length = 457

 Score =  107 bits (266), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 103/426 (24%), Positives = 178/426 (41%), Gaps = 101/426 (23%)

Query: 67  RWPNLFEEFFL-------VNSDTKNDDLLFFVRQTH-------SENENLDPVFVKRKTTP 112
           +W  LF EF +             +DD++++V Q           N++L  VF  R+ + 
Sbjct: 75  KWAKLFMEFIIGTAYCQSTKCQAHSDDMIWYVHQAKLSNSFYIQGNQSLLQVF--RRHSK 132

Query: 113 NSLPPLDDAVLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSK 171
           N   P DD+  W+ET  LN+I+Q +   +T AVCT+T      GP    ++   +K+  +
Sbjct: 133 NQPTPCDDSYNWEETVCLNIIMQQIDFYVTCAVCTKT------GPQ---NLQIIRKNC-Q 182

Query: 172 RVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXX 231
           RV+  P++ RMD K  + E +YP +Y+ ID +E++F  +IV DGE +CVEL      K  
Sbjct: 183 RVFPSPSRRRMDSKGENEEITYPKLYFAIDGFEEVFNDVIVRDGECVCVELVARDRQKTR 242

Query: 232 XXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNL 291
                                                            +F G+  Y  L
Sbjct: 243 ES----------------------------------------------VVFLGSIRYEIL 256

Query: 292 LEIYKQKAANKLNKRFKMGPVTP-PTEYIMMRGPGGKGHAQVAI------------TASS 338
            ++Y  KA++      K+  V     E++ MRGP GKG+A++A+            T + 
Sbjct: 257 KQVYDTKASSTWQWAQKLMKVGDRRQEFVRMRGPQGKGYAEMAVARVPNCGYETPLTENP 316

Query: 339 LD----EANEDNFLDITTSESNFVSSIN---ANSDIEPWNFNSGN--SSNTLTINN---- 385
           +D       E +      SE+N         + S   P + + G    S   T+N     
Sbjct: 317 IDFSELAGVEQSLGKRRMSETNLAGGTRMFPSRSIATPSHSSRGRRWQSEADTVNQYPEV 376

Query: 386 GKTTIRNPQRSTSSNSFF--QSLKRLSQSITDKSSSDPESLKCCMTFVNVPWTSIITDLI 443
             + I +      +N  +  +   ++   + +K  ++   L   +T+V +PW SI+ DL+
Sbjct: 377 EGSNIDDELDEGPTNKLWSMRGFAQVWHGLREKKRAECTPLNAFLTYVTLPWNSILNDLL 436

Query: 444 TYARKK 449
           +  +K+
Sbjct: 437 SERQKR 442



>gi|341897025|gb|EGT52960.1| hypothetical protein CAEBREN_21304 [Caenorhabditis brenneri]
          Length = 405

 Score =  106 bits (265), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 128/285 (44%), Gaps = 74/285 (25%)

Query: 67  RWPNLFEEFFLVNS-------DTKNDDLLFFVRQTH-------SENENLDPVFVKRKTTP 112
           +W  LF EF + N+         ++DD++++V Q           N+NL  VF  R+ + 
Sbjct: 73  KWAKLFMEFIIGNAYCQSTKCVAQSDDMIWYVHQAKLTNSFYIQGNQNLLQVF--RRHSK 130

Query: 113 NSLPPLDDAVLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSK 171
           N   P DD+  W+ET  LN+I+Q +   +T AVCT+T      GP    ++   +K+  +
Sbjct: 131 NQPTPCDDSYNWEETVCLNIIMQQIDFYVTCAVCTKT------GPQ---NLQIIRKNC-Q 180

Query: 172 RVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXX 231
           RV+  P++ RMD K  + E +YP +Y+ ID +E++F  +IV DGE +CVEL      K  
Sbjct: 181 RVFPSPSRRRMDSKGENEEITYPKLYFAIDGFEEIFNDVIVRDGECVCVELVARDRQKTR 240

Query: 232 XXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNL 291
                                                            +F G+  Y  L
Sbjct: 241 ES----------------------------------------------VVFLGSIRYEIL 254

Query: 292 LEIYKQKAANKLNKRFK-MGPVTPPTEYIMMRGPGGKGHAQVAIT 335
            ++Y  KA++      K M       E++ MRGP GKG+A++A+ 
Sbjct: 255 KQVYDTKASSTWQWAQKLMKAGDRRQEFVRMRGPQGKGYAEMAVA 299



>gi|449273316|gb|EMC82839.1| Putative protein C22orf9 like protein, partial [Columba livia]
          Length = 369

 Score =  105 bits (261), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 129/283 (45%), Gaps = 69/283 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS-------ENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR+  S       E +    V V R+ +   LP L D
Sbjct: 13  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSGDSTEGKKQVEVEVYRRDS-KKLPGLGD 71

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 72  PDIDWEESVYLNLILQKLDYVVTCAVCTRSDGGDIHIHKKK----------SQQVFASPS 121

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +             
Sbjct: 122 KHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------------- 168

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              SN  +  +FQG+  Y  L ++Y  +
Sbjct: 169 ---------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNR 195

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
              A K+ +R   G       E++ M+GP GKGHA++A++  S
Sbjct: 196 VSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 238



>gi|327273377|ref|XP_003221457.1| PREDICTED: uncharacterized protein C22orf9-like [Anolis
           carolinensis]
          Length = 429

 Score =  103 bits (258), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 132/283 (46%), Gaps = 69/283 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENENLD-----PVFVKRKTTPNSLPPLDD 120
           W  +F  +F+    ++ DD+LF+VR+  ++   +N D      V V R+ +   LP L D
Sbjct: 63  WTWMFSTYFMEKLASRQDDMLFYVRRKLSYVGEDNGDGKKQVEVEVYRRDS-KKLPGLGD 121

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+  LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 122 PDIDWEESVCLNLILQKLDYIVTCAVCTRSDGGDIHIHRKK----------SQQVFASPS 171

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL  +             
Sbjct: 172 KHPMDSKGEESKISYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAS------------- 218

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              SN  +  +FQG+  Y  L ++Y  +
Sbjct: 219 ---------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNR 245

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
              A K+ +R   G       E++ M+GP GKGHA++A++  S
Sbjct: 246 VSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 288



>gi|348522648|ref|XP_003448836.1| PREDICTED: uncharacterized protein KIAA0930-like [Oreochromis
           niloticus]
          Length = 422

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 128/280 (45%), Gaps = 70/280 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT-------HSENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR+        +SE + ++    +R +    LP L D
Sbjct: 59  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSADNSEGKKVEVEVYRRDS--KKLPGLGD 116

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K           + V+A P+
Sbjct: 117 PDIDWEESVYLNLILQKLDYVVTCAVCTRSDAGDIHIHKKKC----------QEVFASPS 166

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL  +             
Sbjct: 167 KHAMDSKGEESKMSYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAS------------- 213

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              SN  +  +FQG+  Y  L ++Y  +
Sbjct: 214 ---------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNR 240

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
              A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 241 VSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 280



>gi|513160687|ref|XP_416465.4| PREDICTED: uncharacterized protein KIAA0930-like isoform X5 [Gallus
           gallus]
          Length = 425

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 128/280 (45%), Gaps = 69/280 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS-------ENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR+  S       + +    V V R+ +   LP L D
Sbjct: 59  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSGDSTDGKKQVEVEVYRRDS-KKLPGLGD 117

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 118 PDIDWEESVYLNLILQKLDYVVTCAVCTRSDGGDIHIHKKK----------SQQVFASPS 167

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +             
Sbjct: 168 KHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------------- 214

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              SN  +  +FQG+  Y  L ++Y  +
Sbjct: 215 ---------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNR 241

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
              A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 242 VSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 281



>gi|499028408|ref|XP_004564930.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2
           [Maylandia zebra]
          Length = 422

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 128/280 (45%), Gaps = 70/280 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT-------HSENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR+        +SE + ++    +R +    LP L D
Sbjct: 59  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSADNSEGKKVEVEVYRRDS--KKLPGLGD 116

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K           + V+A P+
Sbjct: 117 PDIDWEESVYLNLILQKLDYVVTCAVCTRSDAGDIHIHKKKC----------QEVFASPS 166

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL  +             
Sbjct: 167 KHAMDSKGEESKMSYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAS------------- 213

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              SN  +  +FQG+  Y  L ++Y  +
Sbjct: 214 ---------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNR 240

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
              A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 241 VSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 280



>gi|513160691|ref|XP_004938096.1| PREDICTED: uncharacterized protein KIAA0930-like isoform X6 [Gallus
           gallus]
          Length = 424

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 130/279 (46%), Gaps = 68/279 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENENLD----PVFVKRKTTPNSLPPLDDA 121
           W  +F  +F+     + DD+LF+VR+  ++   ++ D     V V R+ +   LP L D 
Sbjct: 59  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSGDSTDGKKVEVEVYRRDS-KKLPGLGDP 117

Query: 122 -VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTK 179
            + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+K
Sbjct: 118 DIDWEESVYLNLILQKLDYVVTCAVCTRSDGGDIHIHKKK----------SQQVFASPSK 167

Query: 180 SRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXXX 239
             MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +              
Sbjct: 168 HPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------------- 213

Query: 240 XXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK- 298
                                             SN  +  +FQG+  Y  L ++Y  + 
Sbjct: 214 --------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNRV 241

Query: 299 -AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
             A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 242 SVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 280



>gi|499028406|ref|XP_004564929.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1
           [Maylandia zebra]
          Length = 421

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 128/280 (45%), Gaps = 70/280 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT-------HSENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR+        +SE + ++    +R +    LP L D
Sbjct: 59  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSADNSEGKKVEVEVYRRDS--KKLPGLGD 116

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K           + V+A P+
Sbjct: 117 PDIDWEESVYLNLILQKLDYVVTCAVCTRSDAGDIHIHKKKC----------QEVFASPS 166

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL  +             
Sbjct: 167 KHAMDSKGEESKMSYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAS------------- 213

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              SN  +  +FQG+  Y  L ++Y  +
Sbjct: 214 ---------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNR 240

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
              A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 241 VSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 280



>gi|483512413|gb|EOB00878.1| Uncharacterized protein C22orf9-like protein, partial [Anas
           platyrhynchos]
          Length = 366

 Score =  102 bits (255), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 129/283 (45%), Gaps = 69/283 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT-------HSENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR+         +E +    V V R+ +   LP L D
Sbjct: 13  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYVSGDSTEGKKQVEVEVYRRDS-KKLPGLGD 71

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 72  PDIDWEESVYLNLILQKLDYVVTCAVCTRSDGGDIHIHKKK----------SQQVFASPS 121

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +             
Sbjct: 122 KHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------------- 168

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              SN  +  +FQG+  Y  L ++Y  +
Sbjct: 169 ---------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNR 195

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
              A K+ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 196 VSVAAKMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 238



>gi|326912478|ref|XP_003202577.1| PREDICTED: uncharacterized protein C22orf9-like [Meleagris
           gallopavo]
          Length = 418

 Score =  102 bits (255), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 128/280 (45%), Gaps = 69/280 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS-------ENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR+  S       + +    V V R+ +   LP L D
Sbjct: 52  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSGDSTDGKKQVEVEVYRRDS-KKLPGLGD 110

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 111 PDIDWEESVYLNLILQKLDYVVTCAVCTRSDGGDIHIHKKK----------SQQVFASPS 160

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +             
Sbjct: 161 KHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------------- 207

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              SN  +  +FQG+  Y  L ++Y  +
Sbjct: 208 ---------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNR 234

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
              A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 235 VSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 274



>gi|513160697|ref|XP_004938098.1| PREDICTED: uncharacterized protein KIAA0930-like isoform X8 [Gallus
           gallus]
          Length = 398

 Score =  102 bits (254), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 128/280 (45%), Gaps = 69/280 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS-------ENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR+  S       + +    V V R+ +   LP L D
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSGDSTDGKKQVEVEVYRRDS-KKLPGLGD 90

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 91  PDIDWEESVYLNLILQKLDYVVTCAVCTRSDGGDIHIHKKK----------SQQVFASPS 140

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +             
Sbjct: 141 KHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------------- 187

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              SN  +  +FQG+  Y  L ++Y  +
Sbjct: 188 ---------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNR 214

Query: 299 --AANKLNKRFKMGPVTP-PTEYIMMRGPGGKGHAQVAIT 335
              A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 215 VSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 254



>gi|312087241|ref|XP_003145393.1| hypothetical protein LOAG_09818 [Loa loa]
          Length = 431

 Score =  102 bits (254), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 94/361 (26%), Positives = 156/361 (43%), Gaps = 97/361 (26%)

Query: 2   FKDKEKGKVNMAHLQLILDRLIS--ENLHGPISATPNSAVTSHQRMFRSPGSQPELF--- 56
           + +K+KG ++++  Q      I+  + L+G      NS +   + +F      P ++   
Sbjct: 49  YNEKKKGAISLS-CQYTGKSGINLLDGLYGARVEVSNSEINQERHLF------PMIYFAV 101

Query: 57  SDQDLDA---GDPRWPNLFEEFFL-------VNSDTKNDDLLFFVRQTH--------SEN 98
           +D+D +     + +W  LF +F          N    +DD+L++V             E+
Sbjct: 102 TDKDFEVISNHERKWCKLFADFIAGSTYCNAKNCAAHSDDMLWYVSMQQLNRDFCIGQED 161

Query: 99  ENLDPVFVKRKTTPNSLPPLDDAVL-WKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGP 156
             L    V R+ +PN  P L+D ++ W+ET  LNLI+Q L  ++T AVC +T   N    
Sbjct: 162 GQLQ---VYRRQSPNK-PVLNDPLINWEETVCLNLILQQLDFQVTCAVCIKTSPQNL--- 214

Query: 157 NQKTSMTCSKKHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGE 216
            Q     C      +RVY  P+K RMD K    E +YP IY+ IDD+E +F  ++V DGE
Sbjct: 215 -QILRKNC------QRVYPSPSKRRMDSKGECEEITYPKIYFAIDDFEQIFSDVVVRDGE 267

Query: 217 YLCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSND 276
            +CVEL      K                                              +
Sbjct: 268 CVCVELVARDRRK----------------------------------------------N 281

Query: 277 SKITLFQGAASYSNLLEIYKQKAANKLNKRFKMGPVTP---PTEYIMMRGPGGKGHAQVA 333
            +  +F G+  Y  L + Y  +A+   + ++    +TP     E++ MRGP GKG+A++A
Sbjct: 282 CEAVIFLGSIRYEVLKQAYDSRAS--FSWQWAQKLITPNQRRREFVRMRGPHGKGYAEMA 339

Query: 334 I 334
           +
Sbjct: 340 V 340



>gi|449482094|ref|XP_002187924.2| PREDICTED: uncharacterized protein KIAA0930 homolog [Taeniopygia
           guttata]
          Length = 364

 Score =  102 bits (253), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 128/280 (45%), Gaps = 69/280 (24%)

Query: 71  LFEEFFLVNSDTKNDDLLFFVRQTHS-------ENENLDPVFVKRKTTPNSLPPLDDA-V 122
           +F  +F+     + DD+LF+VR+  S       E +    V V R+ +   LP L D  +
Sbjct: 1   MFSTYFMEKWAPRQDDMLFYVRRKLSYVTGESTEGKKQVEVEVYRRDS-KKLPGLGDPDI 59

Query: 123 LWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSR 181
            W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+K  
Sbjct: 60  DWEESVYLNLILQKLDYVVTCAVCTRSDGGDIHIHKKK----------SQQVFASPSKHP 109

Query: 182 MDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXXXXX 241
           MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +                
Sbjct: 110 MDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS---------------- 153

Query: 242 XXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK--A 299
                                           SN  +  +FQG+  Y  L ++Y  +   
Sbjct: 154 ------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNRVSV 183

Query: 300 ANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           A K+ +R   G       E++ M+GP GKGHA++A++  S
Sbjct: 184 AAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 223



>gi|498926183|ref|XP_004517840.1| PREDICTED: serine-rich adhesin for platelets-like [Ceratitis
           capitata]
          Length = 993

 Score =  102 bits (253), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 97/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD------PVFVKRKTTPN 113
           G   W +LF   FL  S+      +DDLLFFVR+ H ++ +         V V RK +  
Sbjct: 47  GTTYWTDLFVRHFLFQSEPVHSIDSDDLLFFVRKKHVKSSSRHMPKYETEVDVFRKDS-R 105

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 106 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 155

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 156 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 207



>gi|393905150|gb|EJD73881.1| hypothetical protein LOAG_18727 [Loa loa]
          Length = 433

 Score =  101 bits (252), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 108/440 (24%), Positives = 181/440 (41%), Gaps = 111/440 (25%)

Query: 52  QPELFSDQDLDA---GDPRWPNLFEEFFL-------VNSDTKNDDLLFFVRQTH------ 95
           Q +L  D+D +     + +W  LF +F          N    +DD+L++V          
Sbjct: 35  QNQLTFDKDFEVISNHERKWCKLFADFIAGSTYCNAKNCAAHSDDMLWYVSMQQLNRDFC 94

Query: 96  --SENENLDPVFVKRKTTPNSLPPLDDAVL-WKETFFLNLIVQ-LPCKLTVAVCTRTPND 151
              E+  L    V R+ +PN  P L+D ++ W+ET  LNLI+Q L  ++T AVC +T   
Sbjct: 95  IGQEDGQLQ---VYRRQSPNK-PVLNDPLINWEETVCLNLILQQLDFQVTCAVCIKTSPQ 150

Query: 152 NSNGPNQKTSMTCSKKHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLI 211
           N     Q     C      +RVY  P+K RMD K    E +YP IY+ IDD+E +F  ++
Sbjct: 151 NL----QILRKNC------QRVYPSPSKRRMDSKGECEEITYPKIYFAIDDFEQIFSDVV 200

Query: 212 VTDGEYLCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFP 271
           V DGE +CVEL      K                                          
Sbjct: 201 VRDGECVCVELVARDRRK------------------------------------------ 218

Query: 272 QPSNDSKITLFQGAASYSNLLEIYKQKAANKLNKRFKMGPVTP---PTEYIMMRGPGGKG 328
               + +  +F G+  Y  L + Y  +A+   + ++    +TP     E++ MRGP GKG
Sbjct: 219 ----NCEAVIFLGSIRYEVLKQAYDSRAS--FSWQWAQKLITPNQRRREFVRMRGPHGKG 272

Query: 329 HAQVAIT--ASSLDEA----NEDNFLDITTSESNFVSSINANS-----DIEPWNFNSGNS 377
           +A++A+   A+   E        NF D+       +S  N +       + P   + G  
Sbjct: 273 YAEMAVMRLANCGYETPVSEQSLNFEDLGQCGMRRMSDTNLSHYPKRLTMTP-GLSEGYD 331

Query: 378 SNTLTINNGKTTIRNPQRSTSSNSF-----------FQSLKRLSQS---ITDKSSSDPES 423
           ++       +T   N  R   +NS              S++   Q+   + +K  ++   
Sbjct: 332 ASRGRRWQSETDTLNQYREVEANSIDDVLNEGMMSRLWSVRGFGQAWHWLREKRRAESMP 391

Query: 424 LKCCMTFVNVPWTSIITDLI 443
           L   +T++ +PW++++ DL+
Sbjct: 392 LNAFLTYITLPWSTVLDDLL 411



>gi|198457553|ref|XP_001360710.2| GA21937 [Drosophila pseudoobscura pseudoobscura]
 gi|198136018|gb|EAL25285.2| GA21937 [Drosophila pseudoobscura pseudoobscura]
          Length = 892

 Score =  101 bits (252), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSDTKN----DDLLFFVRQTHSENENLD------PVFVKRKTTPN 113
           G   W +LF   FL  ++ ++    DDLLFFVR+ H ++ +         V V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPEHSIDSDDLLFFVRKKHVKSSSRHMPKYETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|513160694|ref|XP_004938097.1| PREDICTED: uncharacterized protein KIAA0930-like isoform X7 [Gallus
           gallus]
          Length = 429

 Score =  101 bits (251), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 130/284 (45%), Gaps = 73/284 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENENLD---------PVFVKRKTTPNSLP 116
           W  +F  +F+     + DD+LF+VR+  ++   ++ D          V V R+ +   LP
Sbjct: 59  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSGDSTDGKKVSEPQVEVEVYRRDS-KKLP 117

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+
Sbjct: 118 GLGDPDIDWEESVYLNLILQKLDYVVTCAVCTRSDGGDIHIHKKK----------SQQVF 167

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 168 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 218

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  SN  +  +FQG+  Y  L ++
Sbjct: 219 -------------------------------------DKSNTFQGVIFQGSIRYEALKKV 241

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
           Y  +   A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 242 YDNRVSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 285



>gi|195150761|ref|XP_002016319.1| GL11518 [Drosophila persimilis]
 gi|194110166|gb|EDW32209.1| GL11518 [Drosophila persimilis]
          Length = 892

 Score =  101 bits (251), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSDTKN----DDLLFFVRQTHSENENLD------PVFVKRKTTPN 113
           G   W +LF   FL  ++ ++    DDLLFFVR+ H ++ +         V V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPEHSIDSDDLLFFVRKKHVKSSSRHMPKYETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|195441981|ref|XP_002068739.1| GK17865 [Drosophila willistoni]
 gi|194164824|gb|EDW79725.1| GK17865 [Drosophila willistoni]
          Length = 898

 Score =  101 bits (251), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSDTKN----DDLLFFVRQTHSENENLD------PVFVKRKTTPN 113
           G   W +LF   FL  ++ ++    DDLLFFVR+ H ++ +         V V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPQHSIDSDDLLFFVRKKHVKSSSRHMPKYETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|194882333|ref|XP_001975266.1| GG20656 [Drosophila erecta]
 gi|190658453|gb|EDV55666.1| GG20656 [Drosophila erecta]
          Length = 890

 Score =  101 bits (251), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD-PVF-----VKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +   P F     V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPVHSIDSDDLLFFVRKKHVKSSSRQMPKFETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|195335123|ref|XP_002034225.1| GM21752 [Drosophila sechellia]
 gi|194126195|gb|EDW48238.1| GM21752 [Drosophila sechellia]
          Length = 889

 Score =  101 bits (251), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD-PVF-----VKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +   P F     V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPVHSIDSDDLLFFVRKKHVKSSSRHMPKFETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|195124467|ref|XP_002006714.1| GI21217 [Drosophila mojavensis]
 gi|193911782|gb|EDW10649.1| GI21217 [Drosophila mojavensis]
          Length = 927

 Score =  101 bits (251), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD------PVFVKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +         V V RK +  
Sbjct: 47  GTTYWTDLFVRHFLFQTEPVHSIDSDDLLFFVRKKHVKSSSRHMPKYETEVEVFRKDS-R 105

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 106 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 155

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 156 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 207



>gi|194756632|ref|XP_001960580.1| GF11434 [Drosophila ananassae]
 gi|190621878|gb|EDV37402.1| GF11434 [Drosophila ananassae]
          Length = 891

 Score =  101 bits (251), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD-PVF-----VKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +   P F     V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPVHSIDSDDLLFFVRKKHVKSSSRHMPKFETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|166157929|ref|NP_001107374.1| uncharacterized protein LOC100135200 [Xenopus (Silurana)
           tropicalis]
 gi|163916295|gb|AAI57244.1| LOC100135200 protein [Xenopus (Silurana) tropicalis]
 gi|213624521|gb|AAI71214.1| hypothetical protein LOC100135200 [Xenopus (Silurana) tropicalis]
 gi|213625733|gb|AAI71216.1| hypothetical protein LOC100135200 [Xenopus (Silurana) tropicalis]
          Length = 425

 Score =  100 bits (250), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 128/283 (45%), Gaps = 69/283 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT-------HSENENLDPVFVKRKTTPNSLPPLDD 120
           W  ++  +F+     + DD+LF+VR+         +E      V V RK +   LP L D
Sbjct: 58  WTWMYSTYFMEKWAPRQDDMLFYVRRKPAYMGTDGTEGRKQVEVEVYRKDS-KKLPGLGD 116

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 117 PDIDWEESVYLNLILQKLDYMVTCAVCTRSDAGDIHIHKKK----------SQQVFASPS 166

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL                
Sbjct: 167 KHPMDSKGEESKISYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAR------------- 213

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              +N  +  +FQG+  Y  L ++Y  +
Sbjct: 214 ---------------------------------DKTNTFQGVIFQGSIRYEALKKVYDNR 240

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
              A K+ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 241 VSVAAKMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 283



>gi|195381149|ref|XP_002049317.1| GJ20819 [Drosophila virilis]
 gi|194144114|gb|EDW60510.1| GJ20819 [Drosophila virilis]
          Length = 909

 Score =  100 bits (250), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD------PVFVKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +         V V RK +  
Sbjct: 47  GTTYWTDLFVRHFLFQTEPVHSIDSDDLLFFVRKKHVKSSSRHMPKYETEVEVFRKDS-R 105

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 106 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 155

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 156 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 207



>gi|195584112|ref|XP_002081859.1| GD11243 [Drosophila simulans]
 gi|194193868|gb|EDX07444.1| GD11243 [Drosophila simulans]
          Length = 888

 Score =  100 bits (250), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD-PVF-----VKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +   P F     V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPVHSIDSDDLLFFVRKKHVKSSSRHMPKFETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|24654329|ref|NP_611183.1| CG9646 [Drosophila melanogaster]
 gi|7302838|gb|AAF57912.1| CG9646 [Drosophila melanogaster]
          Length = 889

 Score =  100 bits (250), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD-PVF-----VKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +   P F     V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPVHSIDSDDLLFFVRKKHVKSSSRHMPKFETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|195488847|ref|XP_002092486.1| GE11641 [Drosophila yakuba]
 gi|194178587|gb|EDW92198.1| GE11641 [Drosophila yakuba]
          Length = 889

 Score =  100 bits (250), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD-PVF-----VKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +   P F     V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPVHSIDSDDLLFFVRKKHVKSSSRHMPKFETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|21428746|gb|AAM50033.1| SD21944p [Drosophila melanogaster]
          Length = 889

 Score =  100 bits (250), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD-PVF-----VKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +   P F     V RK +  
Sbjct: 48  GTTYWTDLFVRHFLFQTEPMHSIDSDDLLFFVRKKHVKSSSRHMPKFETEVEVFRKDS-R 106

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 107 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 156

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 157 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 208



>gi|148236388|ref|NP_001079690.1| uncharacterized protein KIAA0930 homolog [Xenopus laevis]
 gi|28703807|gb|AAH47259.1| MGC53303 protein [Xenopus laevis]
          Length = 425

 Score =  100 bits (249), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 128/283 (45%), Gaps = 69/283 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT-------HSENENLDPVFVKRKTTPNSLPPLDD 120
           W  ++  +F+     + DD+LF+VR+         +E      V V RK +   LP L D
Sbjct: 58  WTWMYSTYFMEKWAPRQDDMLFYVRRKPAYMGPDGNEGRKQVEVEVYRKDS-KKLPGLGD 116

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 117 PDIDWEESVYLNLILQKLDYMVTCAVCTRSDAGDIHIHKKK----------SQQVFASPS 166

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL                
Sbjct: 167 KHPMDSKGEESKISYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAR------------- 213

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              +N  +  +FQG+  Y  L ++Y  +
Sbjct: 214 ---------------------------------DKTNTFQGVIFQGSIRYEALKKVYDNR 240

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
              A K+ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 241 VSVAAKMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 283



>gi|499028410|ref|XP_004564931.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3
           [Maylandia zebra]
 gi|499028412|ref|XP_004564932.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4
           [Maylandia zebra]
          Length = 360

 Score =  100 bits (248), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 127/277 (45%), Gaps = 70/277 (25%)

Query: 71  LFEEFFLVNSDTKNDDLLFFVRQT-------HSENENLDPVFVKRKTTPNSLPPLDDA-V 122
           +F  +F+     + DD+LF+VR+        +SE + ++    +R +    LP L D  +
Sbjct: 1   MFSTYFMEKWAPRQDDMLFYVRRKLSYVSADNSEGKKVEVEVYRRDS--KKLPGLGDPDI 58

Query: 123 LWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSR 181
            W+E+ +LNLI+Q L   +T AVCTR+   + +   +K           + V+A P+K  
Sbjct: 59  DWEESVYLNLILQKLDYVVTCAVCTRSDAGDIHIHKKKC----------QEVFASPSKHA 108

Query: 182 MDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXXXXX 241
           MD K    + SYP I+++ID++E++F  + V +GE +CVEL  +                
Sbjct: 109 MDSKGEESKMSYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAS---------------- 152

Query: 242 XXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK--A 299
                                           SN  +  +FQG+  Y  L ++Y  +   
Sbjct: 153 ------------------------------DKSNTFQGVIFQGSIRYEALKKVYDNRVSV 182

Query: 300 ANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
           A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 183 AAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 219



>gi|126258174|sp|Q801S4.2|K0930_XENLA RecName: Full=Uncharacterized protein KIAA0930 homolog
          Length = 399

 Score =  100 bits (248), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 128/283 (45%), Gaps = 69/283 (24%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT-------HSENENLDPVFVKRKTTPNSLPPLDD 120
           W  ++  +F+     + DD+LF+VR+         +E      V V RK +   LP L D
Sbjct: 32  WTWMYSTYFMEKWAPRQDDMLFYVRRKPAYMGPDGNEGRKQVEVEVYRKDS-KKLPGLGD 90

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 91  PDIDWEESVYLNLILQKLDYMVTCAVCTRSDAGDIHIHKKK----------SQQVFASPS 140

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXX 238
           K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL                
Sbjct: 141 KHPMDSKGEESKISYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAR------------- 187

Query: 239 XXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK 298
                                              +N  +  +FQG+  Y  L ++Y  +
Sbjct: 188 ---------------------------------DKTNTFQGVIFQGSIRYEALKKVYDNR 214

Query: 299 --AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
              A K+ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 215 VSVAAKMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 257



>gi|395819588|ref|XP_003783164.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Otolemur
           garnettii]
          Length = 403

 Score = 99.8 bits (247), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 131/287 (45%), Gaps = 73/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVR--------QTHSENENLDP---VFVKRKTTPNSLP 116
           W  +F  +F+     + DD+LF+VR        +T ++    +P   V V R+ +   LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYAGSETSTDGRKAEPEVEVEVYRRDS-KKLP 90

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTRT + + +   +K          S++V+
Sbjct: 91  GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRTDSGDIHIHRKK----------SQQVF 140

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 141 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 191

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N  +  +FQG+  Y  L ++
Sbjct: 192 -------------------------------------DKTNMFQGVIFQGSIRYEALKKV 214

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 215 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 261



>gi|195056331|ref|XP_001995064.1| GH22838 [Drosophila grimshawi]
 gi|193899270|gb|EDV98136.1| GH22838 [Drosophila grimshawi]
          Length = 910

 Score = 99.8 bits (247), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 22/172 (12%)

Query: 64  GDPRWPNLFEEFFLVNSD----TKNDDLLFFVRQTHSENENLD------PVFVKRKTTPN 113
           G   W +LF   FL  ++      +DDLLFFVR+ H ++ +         V V RK +  
Sbjct: 47  GTTYWTDLFVRHFLFQTEPVHSIDSDDLLFFVRKKHVKSSSRHMPKYETEVEVFRKDS-R 105

Query: 114 SLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            LP  D  V W+ET +LN+++ Q    LT+A+CTRT       P +   +   ++H S+R
Sbjct: 106 KLPIGDPDVDWEETVYLNMVIHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQR 155

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           VYA P++ +MD K    E +YP I +++D+++++F  ++V DGE +CVEL  
Sbjct: 156 VYASPSRRKMDTKGEGEEITYPHICFMVDNFDEVFSDILVRDGEMVCVELVA 207



>gi|328789567|ref|XP_392206.3| PREDICTED: hypothetical protein LOC408669 [Apis mellifera]
          Length = 692

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 20/171 (11%)

Query: 64  GDPRWPNLFEEFFLVNSD--TKNDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL  ++     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 49  GTTYWTDLFVRHFLFQAEHTIDGDDLLFFVRKKHVKTSSRYLPKFETEVDVFRKDS-KKL 107

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNL+V Q    LT+A+CTRT       P +   +   ++H S++VY
Sbjct: 108 PIGDPDIDWEETVYLNLVVHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQKVY 157

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
           A P++ RMD K    E +YP I +++D+++++F  ++V DGE +CVEL  +
Sbjct: 158 ASPSRRRMDAKGDLEEMTYPHICFMVDNFDEVFCDILVRDGEMVCVELVAS 208



>gi|307167593|gb|EFN61137.1| Uncharacterized protein C22orf9-like protein [Camponotus
           floridanus]
          Length = 712

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 20/171 (11%)

Query: 64  GDPRWPNLFEEFFLVNSD--TKNDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL  ++     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 50  GTTYWTDLFVRHFLFQAEHAIDGDDLLFFVRKKHVKTSSRYLPKFETEVDVFRKDS-KKL 108

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNL+V Q    LT+A+CTRT       P +   +   ++H S++VY
Sbjct: 109 PIGDPDIDWEETVYLNLVVHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQKVY 158

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
           A P++ RMD K    E +YP I +++D+++++F  ++V DGE +CVEL  +
Sbjct: 159 ASPSRRRMDAKGDLEEMTYPHICFMVDNFDEVFCDILVRDGEMVCVELVAS 209



>gi|340710383|ref|XP_003393771.1| PREDICTED: hypothetical protein LOC100647836 [Bombus terrestris]
 gi|350415534|ref|XP_003490673.1| PREDICTED: hypothetical protein LOC100743471 [Bombus impatiens]
          Length = 684

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 20/171 (11%)

Query: 64  GDPRWPNLFEEFFLVNSD--TKNDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL  ++     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 49  GTTYWTDLFVRHFLFQAEHTIDGDDLLFFVRKKHVKTSSRYLPKFETEVDVFRKDS-KKL 107

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNL+V Q    LT+A+CTRT       P +   +   ++H S++VY
Sbjct: 108 PIGDPDIDWEETVYLNLVVHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQKVY 157

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
           A P++ RMD K    E +YP I +++D+++++F  ++V DGE +CVEL  +
Sbjct: 158 ASPSRRRMDAKGDLEEMTYPHICFMVDNFDEVFCDILVRDGEMVCVELVAS 208



>gi|383853483|ref|XP_003702252.1| PREDICTED: uncharacterized protein LOC100877391 [Megachile
           rotundata]
          Length = 689

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 20/171 (11%)

Query: 64  GDPRWPNLFEEFFLVNSD--TKNDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL  ++     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 48  GTTYWTDLFVRHFLFQAEHTIDGDDLLFFVRKKHVKTSSRYLPKFETEVNVFRKDS-KKL 106

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNL+V Q    LT+A+CTRT       P +   +   ++H S++VY
Sbjct: 107 PIGDPDIDWEETVYLNLVVHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQKVY 156

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
           A P++ RMD K    E +YP I +++D+++++F  ++V DGE +CVEL  +
Sbjct: 157 ASPSRRRMDAKGDLEEITYPHICFMVDNFDEVFCDILVRDGEMVCVELVAS 207



>gi|332024598|gb|EGI64796.1| Uncharacterized protein C22orf9-like protein [Acromyrmex
           echinatior]
          Length = 710

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 20/171 (11%)

Query: 64  GDPRWPNLFEEFFLVNSD--TKNDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL  ++     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 50  GTTYWTDLFVRHFLFQAEHAIDGDDLLFFVRKKHVKTSSRYLPKFETEVDVFRKDS-KKL 108

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNL+V Q    LT+A+CTRT       P +   +   ++H S++VY
Sbjct: 109 PIGDPDIDWEETVYLNLVVHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQKVY 158

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
           A P++ RMD K    E +YP I +++D+++++F  ++V DGE +CVEL  +
Sbjct: 159 ASPSRRRMDAKGDLEEMTYPHICFMVDNFDEVFCDILVRDGEMVCVELVAS 209



>gi|345487891|ref|XP_001604539.2| PREDICTED: hypothetical protein LOC100120947 [Nasonia vitripennis]
          Length = 706

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 96/171 (56%), Gaps = 20/171 (11%)

Query: 64  GDPRWPNLFEEFFLVNSD--TKNDDLLFFVRQTHSENENL------DPVFVKRKTTPNSL 115
           G   W +LF   FL  ++     DDLLFFVR+ H +  +         V V RK +   L
Sbjct: 48  GTTYWTDLFVRHFLFQAEHTIDGDDLLFFVRKKHVKTSSRYLPKFETEVDVFRKDS-KKL 106

Query: 116 PPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
           P  D  + W+ET +LNL+V Q    LT+A+CTRT       P +   +   ++H S++VY
Sbjct: 107 PIGDPDIDWEETVYLNLVVHQFDYTLTLAICTRT------SPKE---LQVLRRH-SQKVY 156

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
           A P++ RMD K    E +YP I +++D+++++F  ++V DGE +CVEL  +
Sbjct: 157 ASPSRRRMDAKGDLEEMTYPHICFMVDNFDEVFCDILVRDGEMVCVELVAS 207



>gi|402884542|ref|XP_003905739.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 2
           [Papio anubis]
          Length = 386

 Score = 98.2 bits (243), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 126/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTP-----------NSLP 116
           W  +F  +F+     + DD+LF+VR+  + + +      ++ T P             LP
Sbjct: 14  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKATEPEVEVEVYRRDSKKLP 73

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V+
Sbjct: 74  GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQVF 123

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 124 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 174

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  SN  +  +FQG+  Y  L ++
Sbjct: 175 -------------------------------------DKSNTFQGVIFQGSIRYEALKKV 197

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 198 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 244



>gi|410926637|ref|XP_003976784.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Takifugu
           rubripes]
          Length = 424

 Score = 98.2 bits (243), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 127/283 (44%), Gaps = 72/283 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT-------HSENENLD---PVFVKRKTTPNSLPP 117
           W  +F  +F+       DD+LF+VR+        +SE + +     V V R+ +   LP 
Sbjct: 58  WTWMFSTYFMEKLAPPQDDMLFYVRRKPAYVGADNSEGKKVGCKVEVEVYRRDS-KKLPG 116

Query: 118 LDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYA 175
           L D  + W+E+ +LNLI+Q L   +T AVCTRT   + +   +K           + V+A
Sbjct: 117 LGDPDIDWEESVYLNLILQKLDYVVTCAVCTRTDAGDIHIHKKKC----------QEVFA 166

Query: 176 LPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXX 235
            P+K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL  +          
Sbjct: 167 SPSKHAMDSKGEESKMSYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAS---------- 216

Query: 236 XXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIY 295
                                                  N  +  +FQG+  Y  L ++Y
Sbjct: 217 ------------------------------------DKGNTFQGVIFQGSIRYEALKKVY 240

Query: 296 KQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
             +   A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 241 DNRVSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 283



>gi|432964881|ref|XP_004087016.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Oryzias
           latipes]
          Length = 412

 Score = 98.2 bits (243), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 128/286 (44%), Gaps = 75/286 (26%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT-------HSENENL-DPVF-----VKRKTTPNS 114
           W  +F  +F+     + DD+LF+VR+        + E   +   VF     V R+ +   
Sbjct: 43  WTWMFSTYFMEKWAPRQDDMLFYVRRKPAYMSADNGEGRKVRSAVFQVEVEVYRRDS-KK 101

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K           + 
Sbjct: 102 LPGLGDPDIDWEESVYLNLILQKLDYVVTCAVCTRSDAGDIHIHRKKC----------QE 151

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL  +       
Sbjct: 152 VFASPSKHAMDSKGEESKMSYPNIFFMIDNFEEVFRDMTVGEGEMVCVELVAS------- 204

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    SN  +  +FQG+  Y  L 
Sbjct: 205 ---------------------------------------DKSNTFQGVIFQGSIRYEALK 225

Query: 293 EIYKQK--AANKLNKRFKMGPVTP-PTEYIMMRGPGGKGHAQVAIT 335
           ++Y  +   A K+ +R   G       E++ M+GP GKGHA++A++
Sbjct: 226 KVYDNRVSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 271



>gi|402884540|ref|XP_003905738.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 1
           [Papio anubis]
          Length = 404

 Score = 98.2 bits (243), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 126/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTP-----------NSLP 116
           W  +F  +F+     + DD+LF+VR+  + + +      ++ T P             LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKATEPEVEVEVYRRDSKKLP 91

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V+
Sbjct: 92  GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQVF 141

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 142 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 192

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  SN  +  +FQG+  Y  L ++
Sbjct: 193 -------------------------------------DKSNTFQGVIFQGSIRYEALKKV 215

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|170575267|ref|XP_001893168.1| MGC53303 protein [Brugia malayi]
 gi|158600965|gb|EDP38000.1| MGC53303 protein, putative [Brugia malayi]
          Length = 439

 Score = 97.8 bits (242), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 130/287 (45%), Gaps = 76/287 (26%)

Query: 65  DPRWPNLFEEFFLVNS--DTKN-----DDLLFFV--RQTHSE---NENLDPVFVKRKTTP 112
           + +W  LF +F   N+  + KN     DD+L++V  +Q   +    +    + V R+ +P
Sbjct: 51  ERKWCKLFADFIAGNAYCNAKNYASHSDDMLWYVSIQQISRDFCIGQGDGQLQVYRRESP 110

Query: 113 NSLPPLDD-AVLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVS 170
           N  P L+D ++ W+ET  LNLI+Q L  ++T AVC +T   N     Q     C      
Sbjct: 111 NK-PVLNDPSINWEETVCLNLILQQLDFQVTCAVCIKTSPQNL----QILRKNC------ 159

Query: 171 KRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKX 230
           +RVY  P+K RMD K    E +YP IY+ IDD+E +F  ++V DGE +CVEL      K 
Sbjct: 160 QRVYPSPSKRRMDSKGECEEITYPEIYFAIDDFEQIFSDIVVRDGECVCVELVAKDRCK- 218

Query: 231 XXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSN 290
                                                        + +  +F G+  Y  
Sbjct: 219 ---------------------------------------------NCEAVIFLGSIRYEV 233

Query: 291 LLEIYKQKAANKLNKRFKMGPVTP---PTEYIMMRGPGGKGHAQVAI 334
           L + Y  +A+   + ++    +TP     E++ MRGP GKG+A++A+
Sbjct: 234 LKQAYDTRAS--FSWQWAQKLITPNQRRREFVRMRGPHGKGYAEMAV 278



>gi|504155727|ref|XP_004589775.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Ochotona
           princeps]
          Length = 441

 Score = 97.8 bits (242), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 87/356 (24%), Positives = 157/356 (44%), Gaps = 84/356 (23%)

Query: 8   GKVNMAHLQLILDRLISENLHGPISATPNSAVTSHQRMFRSPGSQPELFSDQDLDAG--- 64
           G  N+A   ++    ++  L   +   P + ++ +  ++RS  +     + +++ AG   
Sbjct: 3   GAENLAATDVVCGPAVAHRLIFIVRHVPGAVLSDY--IYRSKQNDVRARAVREVSAGVWC 60

Query: 65  --DPR---WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENENLD----------PVFVK 107
             D R   W  +F  +F+     + DDLLF+VR+   ++ +E+             V V 
Sbjct: 61  LKDDRIVFWTWMFSTYFMEKWAPRQDDLLFYVRRKLAYAGSESAGDGRKAAEPEVEVEVY 120

Query: 108 RKTTPNSLPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCS 165
           R+ +   LP L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K      
Sbjct: 121 RRDS-KKLPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK------ 173

Query: 166 KKHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
               S++V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +
Sbjct: 174 ----SQQVFASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFGDMTVGEGEMVCVELVAS 229

Query: 226 IPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGA 285
                                                           +N  +  +FQG+
Sbjct: 230 ----------------------------------------------DKTNTFQGVIFQGS 243

Query: 286 ASYSNLLEIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
             Y  L ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 244 IRYEALKKVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 299



>gi|395537704|ref|XP_003770833.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Sarcophilus
           harrisii]
          Length = 410

 Score = 97.8 bits (242), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 131/307 (42%), Gaps = 77/307 (25%)

Query: 49  PGSQPELFSDQDLDAGDPRWPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR 108
           P   P  F D  +      W  +F  +F+     + DD+LF+VR+  S       +   R
Sbjct: 22  PAVSPGCFKDDRIVF----WTWMFSTYFMEKWAPRQDDMLFYVRRKLSFVGREGGLGGSR 77

Query: 109 KTTPNS------------LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSN 154
             +P              LP L D  + W+E+  LNLI+Q L   +T AVCTR+   + +
Sbjct: 78  ADSPQQVDVEVYRRDSKKLPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRSDTGDIH 137

Query: 155 GPNQKTSMTCSKKHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTD 214
              +K          S++V+A P+K  MD K    + SYP I+++ID++E++F  + V +
Sbjct: 138 IHKKK----------SQQVFASPSKHPMDSKGEESKISYPNIFFMIDNFEEVFCDMFVGE 187

Query: 215 GEYLCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPS 274
           GE +CVEL  +                                                +
Sbjct: 188 GEMVCVELVAS----------------------------------------------DKA 201

Query: 275 NDSKITLFQGAASYSNLLEIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQ 331
           N  +  +FQG+  Y  L ++Y  +   A K+ +R   G       E++ M+GP GKGHA+
Sbjct: 202 NTFQGVIFQGSIRYEALKKVYDNRVSVAAKMAQRMSFGFYKYNNMEFVRMKGPQGKGHAE 261

Query: 332 VAITASS 338
           +A++  S
Sbjct: 262 MAVSRVS 268



>gi|466057345|ref|XP_004279630.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Orcinus orca]
          Length = 404

 Score = 97.4 bits (241), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 125/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTPN-----------SLP 116
           W  +F  +F+     + DD+LF+VR+  +   +   V  ++   P             LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYVGSEGAVDGRKAAEPEVEVEVYRRDSKKLP 91

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V+
Sbjct: 92  GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHVHKKK----------SQQVF 141

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 142 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 192

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  SN  +  +FQG+  Y  L ++
Sbjct: 193 -------------------------------------DKSNTFQGVIFQGSIRYEALKKV 215

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|410965820|ref|XP_003989438.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Felis catus]
          Length = 470

 Score = 97.4 bits (241), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 91/331 (27%), Positives = 144/331 (43%), Gaps = 83/331 (25%)

Query: 34  TPNS--AVTSH-QRMFRSPGS-QPELFSDQDLDAGDPR---WPNLFEEFFLVNSDTKNDD 86
            PNS  AVT     + R+P S  PE   D      D R   W  +F  +F+     + DD
Sbjct: 55  VPNSLPAVTRQVAELERAPRSCPPERLGDFSWCFKDDRIVFWTWMFSTYFMEKWAPRQDD 114

Query: 87  LLFFVRQTHS--------------ENENLDPVFVKRKTTPNSLPPLDDA-VLWKETFFLN 131
           +LF+VR+  +              E E    V V R+ +   LP L D  + W+E+  LN
Sbjct: 115 MLFYVRRKLAYAGSEGSVDGRKLAETEPEVDVEVYRRDS-KKLPGLGDPDIDWEESVCLN 173

Query: 132 LIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSRMDVKETSME 190
           LI+Q L   +T AVCTRT   + +   +K          S++V+A P+K  MD K    +
Sbjct: 174 LILQKLDYMVTCAVCTRTDGGDIHIHKKK----------SQQVFASPSKHPMDSKGEESK 223

Query: 191 CSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGX 250
            SYP I+++ID +E++F  + V +GE +CVEL  +                         
Sbjct: 224 ISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------------------------- 258

Query: 251 XXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQK--AANKLNKRFK 308
                                  +N  +  +FQG+  Y  L ++Y  +   A ++ ++  
Sbjct: 259 ---------------------DKTNMFQGVIFQGSIRYEALKKVYDNRVSVAARMAQKMS 297

Query: 309 MGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
            G       E++ M+GP GKGHA++A++  S
Sbjct: 298 FGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 328



>gi|345776713|ref|XP_538331.3| PREDICTED: uncharacterized protein KIAA0930 [Canis lupus
           familiaris]
          Length = 403

 Score = 97.1 bits (240), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 129/287 (44%), Gaps = 73/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS--------ENENLDP---VFVKRKTTPNSLP 116
           W  +F  +F+     + DD+LF+VR+  +        +    +P   V V R+ +   LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGGEGSVDGRKAEPEVEVEVYRRDS-KKLP 90

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++V+
Sbjct: 91  GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRTDGGDIHIHKKK----------SQQVF 140

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 141 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 191

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N  +  +FQG+  Y  L ++
Sbjct: 192 -------------------------------------DKTNMFQGVIFQGSIRYEALKKV 214

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 215 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 261



>gi|57863293|ref|NP_056079.1| uncharacterized protein KIAA0930 isoform a [Homo sapiens]
 gi|34530497|dbj|BAC85917.1| unnamed protein product [Homo sapiens]
          Length = 409

 Score = 97.1 bits (240), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 37  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKL 95

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 96  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 145

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 146 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 197

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 198 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 219

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 220 VYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 267



>gi|297709139|ref|XP_002831301.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 2
           [Pongo abelii]
          Length = 386

 Score = 97.1 bits (240), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 14  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSSSESGADGRKAAEPEVEVEVYRRDS-KKL 72

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 73  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 122

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 123 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 174

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 175 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 196

Query: 294 IYKQKA--ANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 197 VYDNRVSMAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 244



>gi|507532733|ref|XP_004650438.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1
           [Jaculus jaculus]
 gi|507532735|ref|XP_004650439.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2
           [Jaculus jaculus]
          Length = 404

 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 128/288 (44%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ---------THSENENLDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DDLLF+VR+         T    +  +P   V V R+ +   L
Sbjct: 32  WTWMFSAYFMERRAPRQDDLLFYVRRGPACGGCERTVDGRKAAEPEVEVEVYRRDS-KKL 90

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 91  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKK----------SQQV 140

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 141 FASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 192

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 193 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 214

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 215 VYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|507693077|ref|XP_004642512.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Octodon degus]
          Length = 453

 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 124/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTP-----------NSLP 116
           W  +F  +F+     + DD+LF+VR+  +       V  ++   P             LP
Sbjct: 36  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYTGGESSVDGRKAAEPEVEVEVYRRDSKKLP 95

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V+
Sbjct: 96  GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQVF 145

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 146 ASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 196

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N  +  +FQG+  Y  L ++
Sbjct: 197 -------------------------------------DKTNTFQGVIFQGSIRYEALKKV 219

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 220 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 266



>gi|395753540|ref|XP_002831300.2| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 1
           [Pongo abelii]
          Length = 467

 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 95  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSSSESGADGRKAAEPEVEVEVYRRDS-KKL 153

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 154 PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 203

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 204 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 255

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 256 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 277

Query: 294 IYKQKA--ANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 278 VYDNRVSMAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 325



>gi|397482458|ref|XP_003812442.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 2 [Pan
           paniscus]
          Length = 404

 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKL 90

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 91  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 140

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 141 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 192

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 193 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 214

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 215 VYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|57863295|ref|NP_001009880.1| uncharacterized protein KIAA0930 isoform b [Homo sapiens]
 gi|74748760|sp|Q6ICG6.1|K0930_HUMAN RecName: Full=Uncharacterized protein KIAA0930
 gi|47678335|emb|CAG30288.1| bK268H5.1 [Homo sapiens]
 gi|109451060|emb|CAK54391.1| C22orf9 [synthetic construct]
 gi|109451638|emb|CAK54690.1| C22orf9 [synthetic construct]
 gi|119593782|gb|EAW73376.1| chromosome 22 open reading frame 9, isoform CRA_c [Homo sapiens]
 gi|193787757|dbj|BAG52960.1| unnamed protein product [Homo sapiens]
          Length = 404

 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKL 90

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 91  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 140

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 141 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 192

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 193 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 214

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 215 VYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|426394815|ref|XP_004063682.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 2
           [Gorilla gorilla gorilla]
 gi|164691183|dbj|BAF98774.1| unnamed protein product [Homo sapiens]
 gi|221041618|dbj|BAH12486.1| unnamed protein product [Homo sapiens]
          Length = 386

 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 14  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKL 72

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 73  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 122

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 123 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 174

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 175 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 196

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 197 VYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 244



>gi|397482456|ref|XP_003812441.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 1 [Pan
           paniscus]
          Length = 467

 Score = 96.3 bits (238), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 95  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKL 153

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 154 PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 203

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 204 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 255

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 256 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 277

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 278 VYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 325



>gi|470607648|ref|XP_004314658.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Tursiops
           truncatus]
          Length = 370

 Score = 96.3 bits (238), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 125/284 (44%), Gaps = 72/284 (25%)

Query: 71  LFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTPN-----------SLPPLD 119
           +F  +F+     + DD+LF+VR+  +   +   V  ++   P             LP L 
Sbjct: 1   MFSTYFMEKWAPRQDDMLFYVRRKLAYVGSEGAVDGRKAAEPEVEVEVYRRDSKKLPGLG 60

Query: 120 DA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALP 177
           D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++V+A P
Sbjct: 61  DPDIDWEESVCLNLILQKLDYMVTCAVCTRTDGGDIHVHKKK----------SQQVFASP 110

Query: 178 TKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXX 237
           +K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +            
Sbjct: 111 SKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------------ 158

Query: 238 XXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQ 297
                                               SN  +  +FQG+  Y  L ++Y  
Sbjct: 159 ----------------------------------DKSNTFQGVIFQGSIRYEALKKVYDN 184

Query: 298 K--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 185 RVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 228



>gi|511903371|ref|XP_004771183.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3
           [Mustela putorius furo]
          Length = 411

 Score = 96.3 bits (238), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 126/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTP-----------NSLP 116
           W  +F  +F+     + DD+LF+VR+  +   +   V  ++   P             LP
Sbjct: 39  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEASVDGRKAAEPEVEVEVYRRDSKKLP 98

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++V+
Sbjct: 99  GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRTDGGDIHIHKKK----------SQQVF 148

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 149 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 199

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N  +  +FQG+  Y  L ++
Sbjct: 200 -------------------------------------DKTNLFQGVIFQGSIRYEALKKV 222

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 223 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 269



>gi|403282738|ref|XP_003932797.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Saimiri
           boliviensis boliviensis]
          Length = 404

 Score = 96.3 bits (238), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKL 90

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 91  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 140

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 141 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 192

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 193 --------------------------------------DKTNMFQGVIFQGSIRYEALKK 214

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 215 VYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|426394813|ref|XP_004063681.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 1
           [Gorilla gorilla gorilla]
          Length = 467

 Score = 96.3 bits (238), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 95  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKL 153

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 154 PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 203

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 204 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 255

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 256 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 277

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 278 VYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 325



>gi|119593780|gb|EAW73374.1| chromosome 22 open reading frame 9, isoform CRA_a [Homo sapiens]
 gi|168273124|dbj|BAG10401.1| C22orf9 protein [synthetic construct]
          Length = 413

 Score = 95.9 bits (237), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 41  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKL 99

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 100 PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 149

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 150 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 201

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 202 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 223

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 224 VYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 271



>gi|511992570|ref|XP_004813944.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3
           [Mustela putorius furo]
          Length = 404

 Score = 95.9 bits (237), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 126/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTP-----------NSLP 116
           W  +F  +F+     + DD+LF+VR+  +   +   V  ++   P             LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEASVDGRKAAEPEVEVEVYRRDSKKLP 91

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++V+
Sbjct: 92  GLGDPDIDWEESVCLNLILQQLDYMVTCAVCTRTDGGDIHIHKKK----------SQQVF 141

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 142 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 192

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N  +  +FQG+  Y  L ++
Sbjct: 193 -------------------------------------DKTNLFQGVIFQGSIRYEALKKV 215

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|301775077|ref|XP_002922960.1| PREDICTED: uncharacterized protein C22orf9-like [Ailuropoda
           melanoleuca]
          Length = 477

 Score = 95.9 bits (237), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 125/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTP-----------NSLP 116
           W  +F  +F+     + DD+LF+VR+  +       V  ++   P             LP
Sbjct: 105 WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGGEGSVDGRKAAEPEVEVEVYRRDSKKLP 164

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++V+
Sbjct: 165 GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRTDGGDIHIHKKK----------SQQVF 214

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 215 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 265

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N  +  +FQG+  Y  L ++
Sbjct: 266 -------------------------------------DKTNLFQGVIFQGSIRYEALKKV 288

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 289 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 335



>gi|471390759|ref|XP_004380059.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 1
           [Trichechus manatus latirostris]
          Length = 406

 Score = 95.9 bits (237), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 128/290 (44%), Gaps = 76/290 (26%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS--------------ENENLDPVFVKRKTTPN 113
           W  +F  +FL     + DD+LF+VR+  +              + E    V V R+ +  
Sbjct: 32  WTWMFSTYFLEKWAPQQDDMLFYVRRKRAFAGSEGSTDGGKPADAEPEVEVEVYRRDS-K 90

Query: 114 SLPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSK 171
            LP L D  + W+E+  LNLI+Q L   +T AVCTR+   + +   +K          S+
Sbjct: 91  KLPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRSDGGDIHIHKKK----------SQ 140

Query: 172 RVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXX 231
           +V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +      
Sbjct: 141 QVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------ 194

Query: 232 XXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNL 291
                                                     +N  +  +FQG+  Y  L
Sbjct: 195 ----------------------------------------DKTNTFQGVIFQGSIRYEAL 214

Query: 292 LEIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
            ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 215 KKVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 264



>gi|50510715|dbj|BAD32343.1| mKIAA0930 protein [Mus musculus]
          Length = 425

 Score = 95.9 bits (237), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 125/288 (43%), Gaps = 73/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR------------KTTPNSL 115
           W  +F  +F+     + DD+LF+VR+  +   N   +  ++            +     L
Sbjct: 51  WTWMFSTYFMEKLAPRQDDMLFYVRRKRAYPGNEGTIDGRKAEAEPEVEVEVYRRDSKKL 110

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 111 PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKK----------SQQV 160

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 161 FASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 212

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 213 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 234

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 235 VYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 282



>gi|23468240|gb|AAH38414.1| C22orf9 protein, partial [Homo sapiens]
          Length = 475

 Score = 95.5 bits (236), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 131/288 (45%), Gaps = 74/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   L
Sbjct: 103 WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKL 161

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 162 PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 211

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 212 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 263

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 264 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 285

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 286 VYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 333



>gi|471390762|ref|XP_004380060.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 2
           [Trichechus manatus latirostris]
          Length = 386

 Score = 95.5 bits (236), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 128/290 (44%), Gaps = 76/290 (26%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS--------------ENENLDPVFVKRKTTPN 113
           W  +F  +FL     + DD+LF+VR+  +              + E    V V R+ +  
Sbjct: 12  WTWMFSTYFLEKWAPQQDDMLFYVRRKRAFAGSEGSTDGGKPADAEPEVEVEVYRRDS-K 70

Query: 114 SLPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSK 171
            LP L D  + W+E+  LNLI+Q L   +T AVCTR+   + +   +K          S+
Sbjct: 71  KLPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRSDGGDIHIHKKK----------SQ 120

Query: 172 RVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXX 231
           +V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +      
Sbjct: 121 QVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------ 174

Query: 232 XXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNL 291
                                                     +N  +  +FQG+  Y  L
Sbjct: 175 ----------------------------------------DKTNTFQGVIFQGSIRYEAL 194

Query: 292 LEIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
            ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 195 KKVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 244



>gi|348551097|ref|XP_003461367.1| PREDICTED: uncharacterized protein KIAA0930-like [Cavia porcellus]
          Length = 456

 Score = 95.5 bits (236), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 130/290 (44%), Gaps = 76/290 (26%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ----THSENE-------NLDP---VFVKRKTTPN 113
           W  +F  +F+     + DD+LF+VR+    T SE         + +P   V V R+ +  
Sbjct: 82  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYTGSEGSADARKLPDAEPEVDVEVYRRDS-K 140

Query: 114 SLPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSK 171
            LP L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S+
Sbjct: 141 KLPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQ 190

Query: 172 RVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXX 231
           +V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +      
Sbjct: 191 QVFASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------ 244

Query: 232 XXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNL 291
                                                     +N  +  +FQG+  Y  L
Sbjct: 245 ----------------------------------------DKTNTFQGVIFQGSIRYEAL 264

Query: 292 LEIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
            ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 265 KKVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 314



>gi|354500847|ref|XP_003512508.1| PREDICTED: uncharacterized protein KIAA0930-like [Cricetulus
           griseus]
          Length = 385

 Score = 95.5 bits (236), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 125/288 (43%), Gaps = 73/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR------------KTTPNSL 115
           W  +F  +F+     + DD+LF+VR+  +   N   V  ++            +     L
Sbjct: 12  WTWMFSTYFMEKLAPRQDDMLFYVRRKRAYPGNDSSVDGRKAEAEPEVEVEVYRRDSKKL 71

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 72  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKK----------SQQV 121

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 122 FASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 173

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 174 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 195

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 196 VYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 243



>gi|85701776|ref|NP_001028445.1| uncharacterized protein KIAA0930 homolog [Mus musculus]
 gi|74207907|dbj|BAE29080.1| unnamed protein product [Mus musculus]
          Length = 447

 Score = 95.5 bits (236), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 125/288 (43%), Gaps = 73/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR------------KTTPNSL 115
           W  +F  +F+     + DD+LF+VR+  +   N   +  ++            +     L
Sbjct: 75  WTWMFSTYFMEKLAPRQDDMLFYVRRKRAYPGNEGTIDGRKAEAEPEVEVEVYRRDSKKL 134

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 135 PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKK----------SQQV 184

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 185 FASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 236

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 237 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 258

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 259 VYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 306



>gi|502132736|ref|XP_004501504.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1
           [Cicer arietinum]
          Length = 396

 Score = 95.5 bits (236), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 82/330 (24%), Positives = 148/330 (44%), Gaps = 46/330 (13%)

Query: 37  SAVTSHQRMFRSPGSQPELFSDQDLDAGDPRWPNLFEEFFLVNSDTK---NDDLLFFVRQ 93
           S V  H  +      + +  SD ++D     W ++F+ +F+   +++   +DDL+FFVR+
Sbjct: 16  SMVKKHSNLIGKTVVEEQDSSDVEMDM--KFWHDVFDLYFVRGKESRGRQDDDLVFFVRK 73

Query: 94  -------THSENENLDPVFVKRKT--TPNSLPPLDDAVLWKETFFLNLIVQLPCKLTVAV 144
                  +++++E++DP FV+R      N +      V W+ +F+LNLI      +TVA+
Sbjct: 74  LVSRSSGSNNDSESVDPYFVRRWAPELSNLVDETSIDVDWRRSFYLNLIAHTSFSVTVAI 133

Query: 145 CTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSRMDV---KETSMECSYPLIYYVID 201
           C+     N     + TS++   K V K VYA P++    +   KE     +YP I + ID
Sbjct: 134 CSHQVLQNHQA-GKDTSLSPIYK-VVKTVYASPSRVNFQLDSKKEVETTPAYPDICFAID 191

Query: 202 DYEDMFEHLIVTDGEY-LCVEL----AVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXX 256
           D++  F+ +++T+ ++  CV L        P +                 +         
Sbjct: 192 DFDSTFDAVVLTEKDHCYCVVLNAHDGAAFPIEEVSNDCSTSDNSSPELCF--------- 242

Query: 257 XXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQKAANKLNKRFKMGPVTPPT 316
                      G       D+K+TLF G  SY  + + Y     ++       G     T
Sbjct: 243 -----------GTNSTKKKDTKLTLFSGFVSYQMVRDAY-DAGKSRFGSLLSGGHYPGKT 290

Query: 317 EYIMMRGPGGKGHAQVAITASSLDEANEDN 346
           + I M+GPGG+G  +VA++  S D++ +D+
Sbjct: 291 DRIYMKGPGGRGEVEVAVSGVS-DQSQQDS 319



>gi|291414554|ref|XP_002723526.1| PREDICTED: C22orf9 protein-like [Oryctolagus cuniculus]
          Length = 387

 Score = 95.1 bits (235), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 127/289 (43%), Gaps = 75/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQT---HSENENLD----------PVFVKRKTTPNS 114
           W  +F  +F+     + DD+LF+VR+         +LD           V V R+ +   
Sbjct: 14  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYAGSESSLDGRKVSAQPEVEVEVYRRDS-KK 72

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++
Sbjct: 73  LPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHVHKKK----------SQQ 122

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 123 VFASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 175

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 176 ---------------------------------------DKTNTFQGVIFQGSIRYEALK 196

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 197 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 245



>gi|119371895|sp|Q3UE31.2|K0930_MOUSE RecName: Full=Uncharacterized protein KIAA0930 homolog
 gi|148672496|gb|EDL04443.1| mCG13582 [Mus musculus]
          Length = 404

 Score = 95.1 bits (235), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 125/288 (43%), Gaps = 73/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR------------KTTPNSL 115
           W  +F  +F+     + DD+LF+VR+  +   N   +  ++            +     L
Sbjct: 32  WTWMFSTYFMEKLAPRQDDMLFYVRRKRAYPGNEGTIDGRKAEAEPEVEVEVYRRDSKKL 91

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 92  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKK----------SQQV 141

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 142 FASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 193

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 194 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 215

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 VYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 263



>gi|338721437|ref|XP_001488217.3| PREDICTED: uncharacterized protein KIAA0930-like [Equus caballus]
          Length = 560

 Score = 95.1 bits (235), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 129/285 (45%), Gaps = 74/285 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQ----THSEN-----ENLDP---VFVKRKTTPNSL 115
           W  +F  +F+     + DD+LF+VR+      SE+     +  +P   V V R+ +   L
Sbjct: 188 WTWMFSTYFMEKWAPRQDDMLFYVRRKLAFAGSESGADGRKAAEPEVEVEVYRRDS-KKL 246

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 247 PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQV 296

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 297 FASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 348

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 349 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 370

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++
Sbjct: 371 VYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 415



>gi|358412566|ref|XP_001789220.2| PREDICTED: uncharacterized protein KIAA0930 [Bos taurus]
          Length = 404

 Score = 95.1 bits (235), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 125/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTP-----------NSLP 116
           W  +F  +F+     + DD+LF+VR+  +   +   +  ++   P             LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAFAGSEGALDGRKAAEPEVEVEVYRRDSKKLP 91

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTR    + +   ++          S++V+
Sbjct: 92  GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKR----------SQQVF 141

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 142 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 192

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N  +  +FQG+  Y  L ++
Sbjct: 193 -------------------------------------DKTNTFQGVIFQGSIRYEALKKV 215

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 YDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|297475484|ref|XP_002688024.1| PREDICTED: uncharacterized protein KIAA0930 [Bos taurus]
 gi|296486906|tpg|DAA29019.1| TPA: hypothetical protein BOS_6223 [Bos taurus]
          Length = 603

 Score = 94.7 bits (234), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 125/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTPN-----------SLP 116
           W  +F  +F+     + DD+LF+VR+  +   +   +  ++   P             LP
Sbjct: 231 WTWMFSTYFMEKWAPRQDDMLFYVRRKLAFAGSEGALDGRKAAEPEVEVEVYRRDSKKLP 290

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTR    + +   ++          S++V+
Sbjct: 291 GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKR----------SQQVF 340

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 341 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 391

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N  +  +FQG+  Y  L ++
Sbjct: 392 -------------------------------------DKTNTFQGVIFQGSIRYEALKKV 414

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 415 YDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 461



>gi|472393263|ref|XP_004415902.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Odobenus
           rosmarus divergens]
          Length = 404

 Score = 94.7 bits (234), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 125/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTPN-----------SLP 116
           W  +F  +F+     + DD+LF+VR+  +   +   V  ++   P             LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEGSVDGRKAAEPEVEVEVYRRDSKKLP 91

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V+
Sbjct: 92  GLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQVF 141

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 142 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 192

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N  +  +FQG+  Y  L ++
Sbjct: 193 -------------------------------------DKTNLFQGVIFQGSIRYEALKKV 215

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|90083154|dbj|BAE90659.1| unnamed protein product [Macaca fascicularis]
          Length = 370

 Score = 94.4 bits (233), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 125/284 (44%), Gaps = 72/284 (25%)

Query: 71  LFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTP-----------NSLPPLD 119
           +F  +F+     + DD+LF+VR+  + + +      ++ T P             LP L 
Sbjct: 1   MFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKATEPEVEVEVYRRDSKKLPGLG 60

Query: 120 DA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALP 177
           D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V+A P
Sbjct: 61  DPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQVFASP 110

Query: 178 TKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXXX 237
           +K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +            
Sbjct: 111 SKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------------ 158

Query: 238 XXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQ 297
                                               +N  +  +FQG+  Y  L ++Y  
Sbjct: 159 ----------------------------------DKTNTFQGVIFQGSIRYEALKKVYDN 184

Query: 298 K--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 185 RVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 228



>gi|474174276|gb|EMS57699.1| hypothetical protein TRIUR3_16590 [Triticum urartu]
          Length = 464

 Score = 94.0 bits (232), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 98/408 (24%), Positives = 165/408 (40%), Gaps = 83/408 (20%)

Query: 60  DLDAGDPRWPNLFEEFFL---VNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTPNSLP 116
           D++  D  W  + + FF+   V+   + DDL+FFV     + E+L P FV+R     +L 
Sbjct: 22  DVEMDDKFWHEMLDLFFVRGRVSRSREEDDLVFFVNSMMQKMEDLPPFFVRRWAP--TLE 79

Query: 117 PLDDA----VLWKETFFLNLIVQLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            L +A    V W+ +F+LNL+      +TVA+C+ +   N      K+        VSK 
Sbjct: 80  KLINANSTEVDWERSFYLNLVAHTSYTVTVALCSIS---NLRNRADKSKRLPPIYKVSKT 136

Query: 173 VYALPTKS--RMDVKETSMEC-SYPLIYYVIDDYEDMFEHLIVTDGEYL-CVEL----AV 224
           VYA P++   R+D ++      +YP IY+ +DD++D F+ ++++D E+  CV L      
Sbjct: 137 VYASPSRVNFRLDQRKAVETVPAYPNIYFSVDDFDDPFDAVVLSDPEHCYCVILNAHDGA 196

Query: 225 TIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQG 284
             P +                   G                         N  K TLF G
Sbjct: 197 AFPEETGSSNVSSNIQSAINSGSIG------------------------ENPPKRTLFSG 232

Query: 285 AASYSNLLEIYKQKAANKLNKRFKMGPVTPPTEYIMMRGPGGKGHAQVAITASSLDEANE 344
             SY N+ E Y     +K      +G      + + MRGP G+G  +VA++  + D++ E
Sbjct: 233 YVSYQNVREAY-DAGRSKFGSFLSLGQDNTKLDKLFMRGPEGRGEVEVAVSGIA-DQSRE 290

Query: 345 DNFLDITTSESNFVSSINANSDIEPWNFNSGNSSNTLTINNGKTTIRNPQRSTSSNSFFQ 404
            +  D                        +G++   L         +  +++  + S   
Sbjct: 291 RSKKD------------------------AGDNFRVLVRKAASAASKLAEQAFEAAS--- 323

Query: 405 SLKRLSQSITDKSSSDP-ESLKCCMTFVNVPWTSIITDLITYARKKQQ 451
                     +K S D    LKCC+  V++PW  I  DL+  A+   +
Sbjct: 324 ---------ANKRSDDKLLPLKCCLMSVSLPWDFIAHDLLHKAQMAHE 362



>gi|512881989|ref|XP_004895360.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4
           [Heterocephalus glaber]
          Length = 404

 Score = 94.0 bits (232), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 126/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR-----------KTTPNSLP 116
           W  +F  +F+     + DD+LF+VR+  + + +   V  ++           +     LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESSVDGRKVAEPEVEVEVYRRDSKKLP 91

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V+
Sbjct: 92  GLGDPDIDWEESVCLNLILQKLDYVVTCAVCTRADGGDIHIHKKK----------SQQVF 141

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 142 ASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 192

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +  S+  +FQG+  Y  L ++
Sbjct: 193 -------------------------------------DKTTMSQGVIFQGSIRYEALKKV 215

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|74215288|dbj|BAE41862.1| unnamed protein product [Mus musculus]
          Length = 447

 Score = 94.0 bits (232), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 125/288 (43%), Gaps = 73/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR------------KTTPNSL 115
           W  +F  +F+     + DD+LF+VR+  +   N   +  ++            +     L
Sbjct: 75  WTWMFSTYFMEKLAPRQDDMLFYVRRKRAYPGNEGTIDGRKAEAEPEVEVEVYRRDSKKL 134

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 135 PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKK----------SQQV 184

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD +    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 185 FASPSKHPMDSEGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 236

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 237 --------------------------------------DKTNTFQGVIFQGSIRYEALKK 258

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 259 VYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 306



>gi|512966567|ref|XP_004845466.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2
           [Heterocephalus glaber]
          Length = 404

 Score = 94.0 bits (232), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 126/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR-----------KTTPNSLP 116
           W  +F  +F+     + DD+LF+VR+  + + +   V  ++           +     LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESSVDGRKVAEPEVEVEVYRRDSKKLP 91

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V+
Sbjct: 92  GLGDPDIDWEESVCLNLILQKLDYVVTCAVCTRADGGDIHIHKKK----------SQQVF 141

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 142 ASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 192

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +  S+  +FQG+  Y  L ++
Sbjct: 193 -------------------------------------DKTTMSQGVIFQGSIRYEALKKV 215

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|470530363|ref|XP_004368236.1| Hypothetical protein ACA1_295670 [Acanthamoeba castellanii str.
           Neff]
 gi|440804604|gb|ELR25481.1| Hypothetical protein ACA1_295670 [Acanthamoeba castellanii str.
           Neff]
          Length = 357

 Score = 94.0 bits (232), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 123/285 (43%), Gaps = 48/285 (16%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFV---------RQTHSENENLDPVFVKRK--TTPNSLP 116
           W   F   F++  D   DDLLFFV           +    +     FV RK     + LP
Sbjct: 23  WAEFFWTDFVLKDDPNMDDLLFFVPDQPLAQPVAGSADGGQQGSKFFVVRKHEDAEHKLP 82

Query: 117 PLDD-AVLWKETFFLNLIVQLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYA 175
              D ++ W+ET+FLN+I     K   +  T TP  +++        T  ++ V   VYA
Sbjct: 83  KRGDRSINWQETYFLNIITNHLKKGRGSTVT-TPRSSAHD-------TAKRQRVETCVYA 134

Query: 176 LPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVT-DGEYLCVELAVTIPNKXXXXX 234
            PT+ RMD+KE  +  +YP I++ ++D+++M + + V+ +GE +CV+L  T+P       
Sbjct: 135 SPTQVRMDMKEDEVTETYPTIFFAVNDFQEMLQDITVSEEGELVCVKLLATMPE------ 188

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNL--- 291
                        +                   GP         +T+F GA  Y  +   
Sbjct: 189 -------GSSTSLHLAAVMSKTDPQTPTLTKKGGP---------VTIFSGAVGYEIVRQA 232

Query: 292 --LEIYKQKAANKLNKRFKMGPVTPPTEYIMMRGPGGKGHAQVAI 334
             +E  KQ + + L    +    +P   ++ M+GP GKG AQ+A+
Sbjct: 233 FGMEAKKQNSPSTLRWLTRSRDKSPQQVFLNMKGPSGKGKAQMAV 277



>gi|426394817|ref|XP_004063683.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 3
           [Gorilla gorilla gorilla]
 gi|31566150|gb|AAH53595.1| C22orf9 protein [Homo sapiens]
          Length = 370

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 130/285 (45%), Gaps = 74/285 (25%)

Query: 71  LFEEFFLVNSDTKNDDLLFFVRQ--THSENEN-------LDP---VFVKRKTTPNSLPPL 118
           +F  +F+     + DD+LF+VR+   +S +E+        +P   V V R+ +   LP L
Sbjct: 1   MFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESGADGRKAAEPEVEVEVYRRDS-KKLPGL 59

Query: 119 DDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYAL 176
            D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V+A 
Sbjct: 60  GDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQVFAS 109

Query: 177 PTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXXX 236
           P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +           
Sbjct: 110 PSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS----------- 158

Query: 237 XXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYK 296
                                                +N  +  +FQG+  Y  L ++Y 
Sbjct: 159 -----------------------------------DKTNTFQGVIFQGSIRYEALKKVYD 183

Query: 297 QK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
            +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 184 NRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 228



>gi|511992568|ref|XP_004813943.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2
           [Mustela putorius furo]
          Length = 406

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 126/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTT-------------PNS 114
           W  +F  +F+     + DD+LF+VR+  +   +   V  +++                  
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEASVDGRKRAEAEPEVEVEVYRRDSKK 91

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++
Sbjct: 92  LPGLGDPDIDWEESVCLNLILQQLDYMVTCAVCTRTDGGDIHIHKKK----------SQQ 141

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 142 VFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 194

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 195 ---------------------------------------DKTNLFQGVIFQGSIRYEALK 215

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 264



>gi|511992578|ref|XP_004813948.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X7
           [Mustela putorius furo]
          Length = 398

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 126/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTT-------------PNS 114
           W  +F  +F+     + DD+LF+VR+  +   +   V  +++                  
Sbjct: 24  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEASVDGRKRAEAEPEVEVEVYRRDSKK 83

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++
Sbjct: 84  LPGLGDPDIDWEESVCLNLILQQLDYMVTCAVCTRTDGGDIHIHKKK----------SQQ 133

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 134 VFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 186

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 187 ---------------------------------------DKTNLFQGVIFQGSIRYEALK 207

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 208 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 256



>gi|478527835|ref|XP_004438098.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Ceratotherium
           simum simum]
          Length = 552

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 125/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR-------------KTTPNS 114
           W  +F  +F+     + DD+LF+VR+  +   +   V  ++             +     
Sbjct: 20  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAFTGSESGVDARKLAEAEPEVEVEVYRRDSKK 79

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++
Sbjct: 80  LPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHKKK----------SQQ 129

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 130 VFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 182

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 183 ---------------------------------------DKTNMFQGVIFQGSIRYEALK 203

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 204 KVYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 252



>gi|511992566|ref|XP_004813942.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1
           [Mustela putorius furo]
          Length = 413

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 126/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTT-------------PNS 114
           W  +F  +F+     + DD+LF+VR+  +   +   V  +++                  
Sbjct: 39  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEASVDGRKRAEAEPEVEVEVYRRDSKK 98

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++
Sbjct: 99  LPGLGDPDIDWEESVCLNLILQQLDYMVTCAVCTRTDGGDIHIHKKK----------SQQ 148

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 149 VFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 201

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 202 ---------------------------------------DKTNLFQGVIFQGSIRYEALK 222

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 223 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 271



>gi|511903369|ref|XP_004771182.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X2
           [Mustela putorius furo]
          Length = 398

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 126/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTT-------------PNS 114
           W  +F  +F+     + DD+LF+VR+  +   +   V  +++                  
Sbjct: 24  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEASVDGRKRAEAEPEVEVEVYRRDSKK 83

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++
Sbjct: 84  LPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRTDGGDIHIHKKK----------SQQ 133

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 134 VFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 186

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 187 ---------------------------------------DKTNLFQGVIFQGSIRYEALK 207

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 208 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 256



>gi|431899987|gb|ELK07922.1| hypothetical protein PAL_GLEAN10007155, partial [Pteropus alecto]
          Length = 391

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 124/291 (42%), Gaps = 76/291 (26%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR---------------KTTP 112
           W  +F  +F+     + DD+LF+VR+  +   +      ++               +   
Sbjct: 15  WTWMFSTYFMERGAPRQDDMLFYVRRKRAFAGSEGGADRRKLAEAEPEVEVEVEVYRRDS 74

Query: 113 NSLPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVS 170
             LP L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S
Sbjct: 75  KKLPGLGDPDIDWEESVCLNLILQKLDYVVTCAVCTRADGGDIHIHKKK----------S 124

Query: 171 KRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKX 230
           ++V+A P+K  MD K      SYP I+++ID +E++F  + V +GE +CVEL  +     
Sbjct: 125 QQVFASPSKHPMDSKGEESRISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS----- 179

Query: 231 XXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSN 290
                                                      SN  +  +FQG+  Y  
Sbjct: 180 -----------------------------------------DKSNTFQGVIFQGSIRYEA 198

Query: 291 LLEIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           L ++Y  +   A ++ ++  +G       E++ M+GP GKGHA++A++  S
Sbjct: 199 LKKVYDNRVSVAARVAQKMSLGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 249



>gi|511903365|ref|XP_004771181.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1
           [Mustela putorius furo]
          Length = 413

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 126/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTT-------------PNS 114
           W  +F  +F+     + DD+LF+VR+  +   +   V  +++                  
Sbjct: 39  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEASVDGRKRAEAEPEVEVEVYRRDSKK 98

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++
Sbjct: 99  LPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRTDGGDIHIHKKK----------SQQ 148

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 149 VFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 201

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 202 ---------------------------------------DKTNLFQGVIFQGSIRYEALK 222

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 223 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 271



>gi|512881985|ref|XP_004895359.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X3
           [Heterocephalus glaber]
          Length = 406

 Score = 93.2 bits (230), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 126/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR-------------KTTPNS 114
           W  +F  +F+     + DD+LF+VR+  + + +   V  ++             +     
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESSVDGRKLPEAEPEVEVEVYRRDSKK 91

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++
Sbjct: 92  LPGLGDPDIDWEESVCLNLILQKLDYVVTCAVCTRADGGDIHIHKKK----------SQQ 141

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 142 VFASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 194

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +  S+  +FQG+  Y  L 
Sbjct: 195 ---------------------------------------DKTTMSQGVIFQGSIRYEALK 215

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 264



>gi|512966565|ref|XP_004845465.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X1
           [Heterocephalus glaber]
          Length = 406

 Score = 93.2 bits (230), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 126/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR-------------KTTPNS 114
           W  +F  +F+     + DD+LF+VR+  + + +   V  ++             +     
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESSVDGRKLPEAEPEVEVEVYRRDSKK 91

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++
Sbjct: 92  LPGLGDPDIDWEESVCLNLILQKLDYVVTCAVCTRADGGDIHIHKKK----------SQQ 141

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 142 VFASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 194

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +  S+  +FQG+  Y  L 
Sbjct: 195 ---------------------------------------DKTTMSQGVIFQGSIRYEALK 215

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 264



>gi|350583704|ref|XP_003481569.1| PREDICTED: uncharacterized protein KIAA0930-like isoform 2 [Sus
           scrofa]
          Length = 404

 Score = 92.8 bits (229), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 124/287 (43%), Gaps = 72/287 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS-----------ENENLDPVFVKRKTTPNSLP 116
           W  +F  +F+     + DD+LF+VR+  +           +    +      +     LP
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLALAGSEGAPDGRKVTEPEVEVEVYRRDSKKLP 91

Query: 117 PLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVY 174
            L D  + W+E+  LNLI+Q L   +T AVCTRT + + +   +K          S++V+
Sbjct: 92  GLGDPDIDWEESVCLNLILQKLDYVVTCAVCTRTDSGDIHVHKKK----------SQQVF 141

Query: 175 ALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXX 234
           A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +         
Sbjct: 142 ASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS--------- 192

Query: 235 XXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEI 294
                                                  +N     +FQG+  Y  L ++
Sbjct: 193 -------------------------------------DKTNTFHGVIFQGSIRYEALKKV 215

Query: 295 YKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 YDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 262



>gi|351706872|gb|EHB09791.1| hypothetical protein GW7_03015 [Heterocephalus glaber]
          Length = 554

 Score = 92.8 bits (229), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 126/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR-------------KTTPNS 114
           W  +F  +F+     + DD+LF+VR+  + + +   V  ++             +     
Sbjct: 137 WTWMFSTYFMEKWAPRQDDMLFYVRRKLAYSGSESSVDGRKLPEAEPEVEVEVYRRDSKK 196

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++
Sbjct: 197 LPGLGDPDIDWEESVCLNLILQKLDYVVTCAVCTRADGGDIHIHKKK----------SQQ 246

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 247 VFASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 299

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +  S+  +FQG+  Y  L 
Sbjct: 300 ---------------------------------------DKTTMSQGVIFQGSIRYEALK 320

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 321 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 369



>gi|402534533|ref|NP_001257976.1| uncharacterized protein KIAA0930 homolog [Rattus norvegicus]
 gi|119371896|sp|Q4G008.2|K0930_RAT RecName: Full=Uncharacterized protein KIAA0930 homolog
 gi|149065720|gb|EDM15593.1| similar to CG9646-PA [Rattus norvegicus]
          Length = 404

 Score = 92.8 bits (229), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 124/288 (43%), Gaps = 73/288 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR------------KTTPNSL 115
           W  +F  +F+     + DD+LF+VR+  +   +      ++            +     L
Sbjct: 32  WTWMFSTYFMEKLAPRQDDMLFYVRRKRAYTGSESTADGRKAEAEPEVEVEVYRRDSKKL 91

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR    + +   +K          S++V
Sbjct: 92  PGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKK----------SQQV 141

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           +A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +        
Sbjct: 142 FASPSKHPMDSKGEESKMSYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS-------- 193

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLE 293
                                                   +N  +  +FQG+  Y  L +
Sbjct: 194 --------------------------------------DKTNMFQGVIFQGSIRYEALKK 215

Query: 294 IYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           +Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 216 VYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 263



>gi|460384746|ref|XP_004238070.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 1
           [Solanum lycopersicum]
          Length = 389

 Score = 92.8 bits (229), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 106/408 (25%), Positives = 167/408 (40%), Gaps = 96/408 (23%)

Query: 65  DPR-WPNLFEEFFLVNSDTKN---DDLLFFVR----QTHSENENLD---PVFVKRKTTPN 113
           DPR W  + + +F+   +++    DDL+FFV+    Q H  NEN     P FV+R     
Sbjct: 40  DPRFWHGVMDVYFIRGRESRGRQEDDLVFFVKKLHLQKHGSNENESANSPYFVRRWA--- 96

Query: 114 SLPPLDDA-------VLWKETFFLNLIVQLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSK 166
             P LDD        V W+ +F+LNLI Q    +TVA+C++    N      +      K
Sbjct: 97  --PKLDDLIGASASDVDWRRSFYLNLIAQTSFSVTVAICSQQVLQNYQTGKDRPLSPIYK 154

Query: 167 KHVSKRVYALPTK------SRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYL-C 219
             V K VYA P++      SR +V+ TS   +YP I + +DD++  F+ +++TD ++  C
Sbjct: 155 --VVKTVYASPSRINFHLDSRKEVETTS---AYPEICFAVDDFDSTFDAVVLTDVDHCYC 209

Query: 220 VEL----AVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSN 275
           V L        P +                                      G  P    
Sbjct: 210 VLLNAHDGAAFPRE--------------------RIRQDCSPADTSSSDTSSGKAPT--- 246

Query: 276 DSKITLFQGAASYSNLLEIYKQKAANKLNKRFKMGPVTPPTEYIMMRGPGGKGHAQVAIT 335
            SKITLF G  SY  + + Y     +       +  V   T+ I M+GPGG+G  +VA++
Sbjct: 247 -SKITLFSGFVSYQMVRDAY-DAGRSGFGSLLSLHSVG-KTDRIYMKGPGGRGEVEVAVS 303

Query: 336 ASSLDEANEDNFLDITTSESNFVSSINANSDIEPWNFNSGNSSNTLTINNGKTTIRNPQR 395
              +D++ +D               ++ NS          +S   L+ +     +R   R
Sbjct: 304 G-VVDQSKQD---------------LSQNS-------VDHDSKKGLSFS---AVVR---R 334

Query: 396 STSSNSFFQSLKRLSQSITDKSSSDPESLKCCMTFVNVPWTSIITDLI 443
           + S  S        + S T      P  LKCC+  +++PW  I  DL+
Sbjct: 335 AASVASEAAKHAYAAASATRDEGMIP--LKCCLMSISLPWEHIAHDLL 380



>gi|460384748|ref|XP_004238071.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform 2
           [Solanum lycopersicum]
          Length = 373

 Score = 92.4 bits (228), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 106/408 (25%), Positives = 167/408 (40%), Gaps = 96/408 (23%)

Query: 65  DPR-WPNLFEEFFLVNSDTKN---DDLLFFVR----QTHSENENLD---PVFVKRKTTPN 113
           DPR W  + + +F+   +++    DDL+FFV+    Q H  NEN     P FV+R     
Sbjct: 24  DPRFWHGVMDVYFIRGRESRGRQEDDLVFFVKKLHLQKHGSNENESANSPYFVRRWA--- 80

Query: 114 SLPPLDDA-------VLWKETFFLNLIVQLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSK 166
             P LDD        V W+ +F+LNLI Q    +TVA+C++    N      +      K
Sbjct: 81  --PKLDDLIGASASDVDWRRSFYLNLIAQTSFSVTVAICSQQVLQNYQTGKDRPLSPIYK 138

Query: 167 KHVSKRVYALPTK------SRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYL-C 219
             V K VYA P++      SR +V+ TS   +YP I + +DD++  F+ +++TD ++  C
Sbjct: 139 --VVKTVYASPSRINFHLDSRKEVETTS---AYPEICFAVDDFDSTFDAVVLTDVDHCYC 193

Query: 220 VEL----AVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSN 275
           V L        P +                                      G  P    
Sbjct: 194 VLLNAHDGAAFPRE--------------------RIRQDCSPADTSSSDTSSGKAPT--- 230

Query: 276 DSKITLFQGAASYSNLLEIYKQKAANKLNKRFKMGPVTPPTEYIMMRGPGGKGHAQVAIT 335
            SKITLF G  SY  + + Y     +       +  V   T+ I M+GPGG+G  +VA++
Sbjct: 231 -SKITLFSGFVSYQMVRDAY-DAGRSGFGSLLSLHSVG-KTDRIYMKGPGGRGEVEVAVS 287

Query: 336 ASSLDEANEDNFLDITTSESNFVSSINANSDIEPWNFNSGNSSNTLTINNGKTTIRNPQR 395
              +D++ +D               ++ NS          +S   L+ +     +R   R
Sbjct: 288 G-VVDQSKQD---------------LSQNS-------VDHDSKKGLSFS---AVVR---R 318

Query: 396 STSSNSFFQSLKRLSQSITDKSSSDPESLKCCMTFVNVPWTSIITDLI 443
           + S  S        + S T      P  LKCC+  +++PW  I  DL+
Sbjct: 319 AASVASEAAKHAYAAASATRDEGMIP--LKCCLMSISLPWEHIAHDLL 364



>gi|478259753|gb|ENN79594.1| hypothetical protein YQE_03965, partial [Dendroctonus ponderosae]
          Length = 1266

 Score = 92.4 bits (228), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 132/295 (44%), Gaps = 81/295 (27%)

Query: 87  LLFFVRQTHSENENLDPVFVKRKTTPNSLPPLDDAVLWKETFFLNLIV-QLPCKLTVAVC 145
           LL   R T+ +      V V RK +   LP  D  + W+ET +LNLI+ Q    LT+A+C
Sbjct: 33  LLKDGRHTNGQQGFWTEVDVFRKDS-KKLPIGDPDIDWEETVYLNLIIHQFEYTLTLAIC 91

Query: 146 TRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYED 205
           TRT       P +   +   K+H S++VYA P++ RMD K    E +YP I +++D++++
Sbjct: 92  TRT------SPKELQVL---KRH-SQKVYASPSRRRMDTKGDVEEITYPHICFMVDNFDE 141

Query: 206 MFEHLIVTDGEYLCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXX 265
           +F+ ++V DGE +CVEL                                           
Sbjct: 142 VFQDILVRDGEMVCVELVAA---------------------------------------- 161

Query: 266 XXGPFPQPSNDSKITLFQG-----AASYSNLLEIYKQKAAN---KLNKRFKMGPVTPPT- 316
                       K+   QG     +  Y  L ++Y  + ++   K+ ++   G  +  T 
Sbjct: 162 -----------DKVGTVQGVIFLGSIRYDALKKVYDARQSSLGTKMAQKMTFGLFSNSTA 210

Query: 317 ---EYIMMRGPGGKGHAQVAITASSLDEANEDNFLDITTSESNFVSSINANSDIE 368
              E++ M+GP GKGHA++A+T        + + ++  TSE  F ++   +SD E
Sbjct: 211 QRCEFVRMKGPQGKGHAEMAVTKP------KGSGVETPTSEPGFCATEMWDSDCE 259



>gi|326511815|dbj|BAJ92052.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 354

 Score = 92.0 bits (227), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 104/407 (25%), Positives = 164/407 (40%), Gaps = 81/407 (19%)

Query: 51  SQPELFSDQDLDAGDPRWPNLFEEFFL---VNSDTKNDDLLFFVRQTHSENENLDPVFVK 107
           S+P       +D  D  W  + + FF+   V+   + DDL+FFV  +  + E+L P FV+
Sbjct: 6   SRPRTIHRTSMD--DKFWHEMLDLFFVRGRVSRSREEDDLVFFVNSSMQKMEDLPPFFVR 63

Query: 108 RKTTPNSLPPLDDA----VLWKETFFLNLIVQLPCKLTVAVCTRTPNDNSNGPNQKTSMT 163
           R     +L  L +A    V W+ +F+LNL+      +TVA+C+ +   N      K+   
Sbjct: 64  RWAP--TLEKLINANSTEVDWERSFYLNLVAHTSYTVTVALCSIS---NLRNRADKSKRL 118

Query: 164 CSKKHVSKRVYALPTKS--RMDVKETSMEC-SYPLIYYVIDDYEDMFEHLIVTDGEY-LC 219
                VSK VYA P++   R+D ++      +YP IY+ +DD++D F+ ++++D E+  C
Sbjct: 119 PPIYKVSKTVYASPSRVNFRLDQRKAVETVPAYPNIYFSVDDFDDPFDAVVLSDPEHCYC 178

Query: 220 VELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDS-- 277
           V L                        + G                  G F   SN    
Sbjct: 179 VIL----------------------NAHDGAAFPEEPESSNVSSNIKSG-FNSGSNGESP 215

Query: 278 -KITLFQGAASYSNLLEIYKQKAANKLNKRFKMGPVTPPTEYIMMRGPGGKGHAQVAITA 336
            K TLF G  SY N+ E Y     +K      +G      + + MRGP G+G  +VA   
Sbjct: 216 PKRTLFSGYVSYQNVREAY-DAGRSKFGSFLSLGQDNTKLDKLFMRGPEGRGEVEVA--- 271

Query: 337 SSLDEANEDNFLDITTSESNFVSSINANSDIEPWNFNSGNSSNTLTINNGKTTIRNPQRS 396
                                VS I   S   P   +SG++   L         +  + +
Sbjct: 272 ---------------------VSGIADQSRERPKK-DSGDNFRVLVRKAASAASKLAEHA 309

Query: 397 TSSNSFFQSLKRLSQSITDKSSSDPESLKCCMTFVNVPWTSIITDLI 443
             + S   + KRL   +          LKCC+  V++PW  I  DL+
Sbjct: 310 FEAAS---ANKRLDDKLL--------PLKCCLMSVSLPWDFIAHDLL 345



>gi|302772296|ref|XP_002969566.1| hypothetical protein SELMODRAFT_91353 [Selaginella moellendorffii]
 gi|300163042|gb|EFJ29654.1| hypothetical protein SELMODRAFT_91353 [Selaginella moellendorffii]
          Length = 364

 Score = 92.0 bits (227), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 130/302 (43%), Gaps = 74/302 (24%)

Query: 62  DAGDPR-WPNLFEEFF---LVNSDTKNDDLLFFVRQTHSENEN----------LDPVFVK 107
           ++GD   W  + + FF   LV S T +DDLLFFV     E              +P FV+
Sbjct: 25  ESGDSHFWQEMLDMFFVRGLVESKTTSDDLLFFVNLLSLEFGGGGFNDEGKIFAEPCFVR 84

Query: 108 RKTTPNSLPPLDD---AVLWKETFFLNLIVQLPCKLTVAVCTRTP---NDNSNGPNQKTS 161
           R   P     L D    V W+ +F+LNL+V     LTV++C+R       NS+G + +  
Sbjct: 85  R-WQPQLSKVLGDRTREVDWRRSFYLNLVVHTTYTLTVSICSREELLRYRNSSGSSLE-- 141

Query: 162 MTCSKKHVSKRVYALPTKSRMDVKETSME---CSYPLIYYVIDDYEDMFEHLIVTDGEY- 217
              S   ++K V+A P++S    K +       SYP IY+ +DD++D FEHLI+ + ++ 
Sbjct: 142 ---SIYKITKNVFASPSRSNFQTKSSKASETVSSYPDIYFSVDDHDDTFEHLILKNEDHC 198

Query: 218 LCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDS 277
            CV L  T                                          G   +  + S
Sbjct: 199 YCVLLHAT-----------------------------------GGAAFGSGRLIRGKDGS 223

Query: 278 K----ITLFQGAASYSNLLEIYKQKAANKLNKRFKMGPVTPPTEYIMMRGPGGKGHAQVA 333
           +    +TLF G  SY  +   ++   + KL+  F    +   +E ++MRGPGG+G   V 
Sbjct: 224 RSSAVVTLFSGFVSYEMVRSAFE---SGKLS--FGFLHLGGKSERLVMRGPGGRGEVDVI 278

Query: 334 IT 335
           +T
Sbjct: 279 VT 280



>gi|478259754|gb|ENN79595.1| hypothetical protein YQE_03965, partial [Dendroctonus ponderosae]
          Length = 1274

 Score = 91.7 bits (226), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 121/267 (45%), Gaps = 80/267 (29%)

Query: 115 LPPLDDAVLWKETFFLNLIV-QLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           LP  D  + W+ET +LNLI+ Q    LT+A+CTRT       P +   +   K+H S++V
Sbjct: 76  LPIGDPDIDWEETVYLNLIIHQFEYTLTLAICTRT------SPKELQVL---KRH-SQKV 125

Query: 174 YALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXX 233
           YA P++ RMD K    E +YP I +++D+++++F+ ++V DGE +CVEL           
Sbjct: 126 YASPSRRRMDTKGDVEEITYPHICFMVDNFDEVFQDILVRDGEMVCVELVAA-------- 177

Query: 234 XXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQG-----AASY 288
                                                       K+   QG     +  Y
Sbjct: 178 -------------------------------------------DKVGTVQGVIFLGSIRY 194

Query: 289 SNLLEIYKQKAAN---KLNKRFKMGPVTPPT----EYIMMRGPGGKGHAQVAITASSLDE 341
             L ++Y  + ++   K+ ++   G  +  T    E++ M+GP GKGHA++A+T      
Sbjct: 195 DALKKVYDARQSSLGTKMAQKMTFGLFSNSTAQRCEFVRMKGPQGKGHAEMAVTKP---- 250

Query: 342 ANEDNFLDITTSESNFVSSINANSDIE 368
             + + ++  TSE  F ++   +SD E
Sbjct: 251 --KGSGVETPTSEPGFCATEMWDSDCE 275



>gi|302774835|ref|XP_002970834.1| hypothetical protein SELMODRAFT_94386 [Selaginella moellendorffii]
 gi|300161545|gb|EFJ28160.1| hypothetical protein SELMODRAFT_94386 [Selaginella moellendorffii]
          Length = 367

 Score = 91.3 bits (225), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 130/302 (43%), Gaps = 74/302 (24%)

Query: 62  DAGDPR-WPNLFEEFF---LVNSDTKNDDLLFFVRQTHSENEN----------LDPVFVK 107
           ++GD   W  + + FF   LV S T +DDLLFFV     E              +P FV+
Sbjct: 25  ESGDSHFWQEMLDMFFVRGLVQSKTTSDDLLFFVNLLSLEFGGGGFNDEGKIFAEPCFVR 84

Query: 108 RKTTPNSLPPLDD---AVLWKETFFLNLIVQLPCKLTVAVCTRTP---NDNSNGPNQKTS 161
           R   P     L D    V W+ +F+LNL+V     LTV++C+R       NS+G + +  
Sbjct: 85  R-WQPQLSKVLGDRTREVDWRRSFYLNLVVHTTYTLTVSICSREELLRYRNSSGSSLE-- 141

Query: 162 MTCSKKHVSKRVYALPTKSRMDVKETSME---CSYPLIYYVIDDYEDMFEHLIVTDGEY- 217
              S   ++K V+A P++S    K +       SYP IY+ +DD++D FEHLI+ + ++ 
Sbjct: 142 ---SIYKITKNVFASPSRSNFQTKSSKASETVSSYPDIYFSVDDHDDTFEHLILKNEDHC 198

Query: 218 LCVELAVTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDS 277
            CV L  T                                          G   +  + S
Sbjct: 199 YCVLLHAT-----------------------------------GGAAFGSGRLIRGKDGS 223

Query: 278 K----ITLFQGAASYSNLLEIYKQKAANKLNKRFKMGPVTPPTEYIMMRGPGGKGHAQVA 333
           +    +TLF G  SY  +   ++   + KL+  F    +   +E ++MRGPGG+G   V 
Sbjct: 224 RSSAVVTLFSGFVSYEMVRSAFE---SGKLS--FGFLHLGGKSERLVMRGPGGRGEVDVI 278

Query: 334 IT 335
           +T
Sbjct: 279 VT 280



>gi|344298531|ref|XP_003420945.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein
           KIAA0930-like [Loxodonta africana]
          Length = 407

 Score = 91.3 bits (225), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 123/289 (42%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS-------------ENENLDPVFVKRKTTPNS 114
           W  +F  +F+     + DD+LF+VR+  +                  +      +     
Sbjct: 34  WTWMFSTYFMEKWAPQQDDMLFYVRRKRAFAGSESGTEEGKVAEMEPEVEVEVYRRDSKK 93

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTR+   + +   +K          S++
Sbjct: 94  LPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRSDGGDIHIHKKK----------SQQ 143

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 144 VFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 196

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 197 ---------------------------------------DKTNMFQGVIFQGSIRYEALK 217

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 218 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 266



>gi|507635845|ref|XP_004700282.1| PREDICTED: uncharacterized protein KIAA0930 homolog [Echinops
           telfairi]
          Length = 373

 Score = 90.9 bits (224), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 131/286 (45%), Gaps = 78/286 (27%)

Query: 71  LFEEFFLVNSDTKNDDLLFFVRQ-----THSENENLDP----------VFVKRKTTPNSL 115
           +F  +F+ +   + DD+LF+VR+     + S +E+  P          V V R+ +   L
Sbjct: 1   MFSTYFMESWAPQQDDMLFYVRRKRAFPSGSSSESGTPEGSKPEPEVEVEVYRRDS-KKL 59

Query: 116 PPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRV 173
           P L D  + W+E+  LNLI+Q L   +T AVCTR+   + +   +K          S++V
Sbjct: 60  PGLGDPDIDWEESVCLNLILQKLDYLVTCAVCTRSDGGDIHIHRKK----------SQQV 109

Query: 174 YALPTKSRMDVK-ETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           +A P+K  MD K E   + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 110 FASPSKHPMDSKGEEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 162

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 163 ---------------------------------------DKTNTFQGVIFQGSIRYEALK 183

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAIT 335
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++
Sbjct: 184 KVYDNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVS 229



>gi|440905579|gb|ELR55948.1| hypothetical protein M91_12339, partial [Bos grunniens mutus]
          Length = 397

 Score = 90.9 bits (224), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 125/289 (43%), Gaps = 74/289 (25%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKR-------------KTTPNS 114
           W  +F  +F+     + DD+LF+VR+  +   +   +  ++             +     
Sbjct: 23  WTWMFSTYFMEKWAPRQDDMLFYVRRKLAFAGSEGALDGRKLAEAEPEVEVEVYRRDSKK 82

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTR    + +   ++          S++
Sbjct: 83  LPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRADGGDIHIHRKR----------SQQ 132

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXX 232
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +       
Sbjct: 133 VFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS------- 185

Query: 233 XXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLL 292
                                                    +N  +  +FQG+  Y  L 
Sbjct: 186 ---------------------------------------DKTNTFQGVIFQGSIRYEALK 206

Query: 293 EIYKQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
           ++Y  +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 207 KVYDNRVSVAARMAQKMSFGFYKYSNMEFVRMKGPQGKGHAEMAVSRVS 255



>gi|511992572|ref|XP_004813945.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4
           [Mustela putorius furo]
 gi|511992574|ref|XP_004813946.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X5
           [Mustela putorius furo]
 gi|511992576|ref|XP_004813947.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X6
           [Mustela putorius furo]
          Length = 372

 Score = 90.5 bits (223), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 125/286 (43%), Gaps = 74/286 (25%)

Query: 71  LFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTT-------------PNSLPP 117
           +F  +F+     + DD+LF+VR+  +   +   V  +++                  LP 
Sbjct: 1   MFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEASVDGRKRAEAEPEVEVEVYRRDSKKLPG 60

Query: 118 LDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYA 175
           L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++V+A
Sbjct: 61  LGDPDIDWEESVCLNLILQQLDYMVTCAVCTRTDGGDIHIHKKK----------SQQVFA 110

Query: 176 LPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXX 235
            P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +          
Sbjct: 111 SPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS---------- 160

Query: 236 XXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIY 295
                                                 +N  +  +FQG+  Y  L ++Y
Sbjct: 161 ------------------------------------DKTNLFQGVIFQGSIRYEALKKVY 184

Query: 296 KQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
             +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 185 DNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 230



>gi|511903373|ref|XP_004771184.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X4
           [Mustela putorius furo]
 gi|511903375|ref|XP_004771185.1| PREDICTED: uncharacterized protein KIAA0930 homolog isoform X5
           [Mustela putorius furo]
          Length = 372

 Score = 90.5 bits (223), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 125/286 (43%), Gaps = 74/286 (25%)

Query: 71  LFEEFFLVNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTT-------------PNSLPP 117
           +F  +F+     + DD+LF+VR+  +   +   V  +++                  LP 
Sbjct: 1   MFSTYFMEKWAPRQDDMLFYVRRKLAYPGSEASVDGRKRAEAEPEVEVEVYRRDSKKLPG 60

Query: 118 LDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYA 175
           L D  + W+E+  LNLI+Q L   +T AVCTRT   + +   +K          S++V+A
Sbjct: 61  LGDPDIDWEESVCLNLILQKLDYMVTCAVCTRTDGGDIHIHKKK----------SQQVFA 110

Query: 176 LPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXX 235
            P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +          
Sbjct: 111 SPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS---------- 160

Query: 236 XXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIY 295
                                                 +N  +  +FQG+  Y  L ++Y
Sbjct: 161 ------------------------------------DKTNLFQGVIFQGSIRYEALKKVY 184

Query: 296 KQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
             +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 185 DNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 230



>gi|470109413|ref|XP_004290992.1| PREDICTED: uncharacterized protein LOC101294908 [Fragaria vesca
           subsp. vesca]
          Length = 386

 Score = 90.1 bits (222), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 93/402 (23%), Positives = 155/402 (38%), Gaps = 85/402 (21%)

Query: 65  DPR-WPNLFEEFFLVNSDTK---NDDLLFFVRQTHSE--NENLDPVFVKRKTTPNSLPPL 118
           DPR W ++F+ +FL   D++   +DDL+FFVR+  S+  N+++ P FV+R       P L
Sbjct: 38  DPRFWHDVFDFYFLRGKDSRRRQDDDLVFFVRKLSSQGFNDDVPPYFVRRWA-----PKL 92

Query: 119 DD-------AVLWKETFFLNLIVQLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSK 171
           D+        V W+ +F LNLI      +TVA+C+     N      K      K  V K
Sbjct: 93  DNLLGEKALEVDWRRSFHLNLIAHTTFTVTVAICSHQDLRNHQAEQDKPLSPIYK--VVK 150

Query: 172 RVYALPTKSRMDV---KETSMECSYPLIYYVIDDYEDMFEHLIVTDGEY-LCVEL----A 223
            VYA P++    +   KE     +YP I + +DD++  F+ +++T+ ++  CV L     
Sbjct: 151 TVYASPSRVNFHLDSQKEVETTPAYPDICFAVDDFDSTFDAVVLTETDHCYCVILNAHDG 210

Query: 224 VTIPNKXXXXXXXXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQ 283
              P                                              +  SK+TLF 
Sbjct: 211 AAFPTAKEPDDCSSSDTSSLKVDISSVK----------------------AKSSKLTLFS 248

Query: 284 GAASYSNLLEIYKQKAANKLNKRFKMGPVTPPTEYIMMRGPGGKGHAQVAITASSLDEAN 343
           G  SY  + + Y     ++      +       + + M+GPGG G  +VA++   +D++ 
Sbjct: 249 GFVSYQMVRDAY-DAGKSRFGNLLSLAHSPGKQDRLYMKGPGGHGEVEVAVSG-VVDQSQ 306

Query: 344 EDN--FLDITTSESNFVSSINANSDIEPWNFNSGNSSNTLTINNGKTTIRNPQRSTSSNS 401
           +D   F  +T+                   F  G                    + SS+ 
Sbjct: 307 QDTGPFSPVTSKT----------------GFGIGFMVRKAASVASVAAKNAYAAAASSHG 350

Query: 402 FFQSLKRLSQSITDKSSSDPESLKCCMTFVNVPWTSIITDLI 443
           F + L                 LKCC+  +++PW  I  DL+
Sbjct: 351 FDEELI---------------PLKCCLMSISLPWEHIAYDLL 377



>gi|356510612|ref|XP_003524031.1| PREDICTED: uncharacterized protein LOC100796388 [Glycine max]
          Length = 400

 Score = 89.4 bits (220), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 147/337 (43%), Gaps = 56/337 (16%)

Query: 37  SAVTSHQRMFRSPGSQPELFSDQDLDAGDPRWPNLFEEFFLVNSDTK---NDDLLFFVRQ 93
           S V  H  +      + +  SD ++D     W ++F+ +F+   +++   +DDL+FFVR+
Sbjct: 16  SMVKKHSNLIGKTVVEEQHASDIEMDM--RFWHDVFDLYFVCGKESRGRQDDDLVFFVRK 73

Query: 94  THSEN-------ENLDPVFVKRKT--TPNSLPPLDDAVLWKETFFLNLIVQLPCKLTVAV 144
             S         E++DP FV+R      N +      V W+ +F+LNLI      +TVA+
Sbjct: 74  LGSHGSGSNNKTESVDPYFVRRWAPKLSNLVDETSIDVNWRRSFYLNLIAHTSFSVTVAI 133

Query: 145 CT-------RTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKSRMDV-KETSMEC--SYP 194
           C+       R   D   G  Q T ++   K V K VYA P++    +  E +ME   +YP
Sbjct: 134 CSHQDLLNHRAGQDTPAG--QDTPLSPIYK-VVKTVYASPSRVNFQLDSEKAMETTPAYP 190

Query: 195 LIYYVIDDYEDMFEHLIVTDGEYL-CVEL----AVTIPNKXXXXXXXXXXXXXXXXXYYG 249
            I + IDD++  F+ +++T+ ++  CV L        P++                    
Sbjct: 191 DICFAIDDFDSTFDAVVLTEKDHCYCVVLNAHDGAAFPSEKVANDCSTSDSSSLPVHSS- 249

Query: 250 XXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIYKQKAANKLNKRFKM 309
                                     ++K+TL  G  SY  + + Y     ++      +
Sbjct: 250 ---------------------SAKKRNTKLTLLSGFVSYQMVRDAY-DAGRSRFGSLLSV 287

Query: 310 GPVTPPTEYIMMRGPGGKGHAQVAITASSLDEANEDN 346
           G  +  T+ I M+GPGG+G  +VA++  + D++ +D+
Sbjct: 288 GHSSGKTDRIYMKGPGGRGEVEVAVSGVA-DQSQQDS 323



>gi|350583702|ref|XP_003481568.1| PREDICTED: uncharacterized protein KIAA0930-like isoform 1 [Sus
           scrofa]
          Length = 372

 Score = 89.4 bits (220), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 123/286 (43%), Gaps = 74/286 (25%)

Query: 71  LFEEFFLVNSDTKNDDLLFFVRQ----THSENE---------NLDPVFVKRKTTPNSLPP 117
           +F  +F+     + DD+LF+VR+      SE             +      +     LP 
Sbjct: 1   MFSTYFMEKWAPRQDDMLFYVRRKLALAGSEGAPDGRKPAEAEPEVEVEVYRRDSKKLPG 60

Query: 118 LDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYA 175
           L D  + W+E+  LNLI+Q L   +T AVCTRT + + +   +K          S++V+A
Sbjct: 61  LGDPDIDWEESVCLNLILQKLDYVVTCAVCTRTDSGDIHVHKKK----------SQQVFA 110

Query: 176 LPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVTIPNKXXXXXX 235
            P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +          
Sbjct: 111 SPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS---------- 160

Query: 236 XXXXXXXXXXXYYGXXXXXXXXXXXXXXXXXXGPFPQPSNDSKITLFQGAASYSNLLEIY 295
                                                 +N     +FQG+  Y  L ++Y
Sbjct: 161 ------------------------------------DKTNTFHGVIFQGSIRYEALKKVY 184

Query: 296 KQK--AANKLNKRFKMGPVT-PPTEYIMMRGPGGKGHAQVAITASS 338
             +   A ++ ++   G       E++ M+GP GKGHA++A++  S
Sbjct: 185 DNRVSVAARMAQKMSFGFYKYNNMEFVRMKGPQGKGHAEMAVSRVS 230



>gi|256084132|ref|XP_002578286.1| hypothetical protein [Schistosoma mansoni]
          Length = 621

 Score = 88.6 bits (218), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 89/164 (54%), Gaps = 19/164 (11%)

Query: 68  WPNLFEEFFLV-----NSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTPNSLPPL-DDA 121
           W NLF + FL      + D   DDLLFFV     ++   +    +R ++  +LP L DD 
Sbjct: 63  WFNLFTQAFLSPALENSVDGPGDDLLFFVHLLKQKDRKPELSVFRRNSS--NLPKLTDDY 120

Query: 122 VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPTKS 180
           V W+ET +LNL++Q     +TVAVCTRT      GP +   +    K  S+ VYA P+  
Sbjct: 121 VDWEETVYLNLLMQYFVYVVTVAVCTRT------GPQEWQIL----KKFSQTVYASPSHR 170

Query: 181 RMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAV 224
           +M++K +  E  YP +Y+ ID+YE+ F   ++ D E + VEL  
Sbjct: 171 QMNMKGSYEEIVYPDLYFTIDNYEEAFGECVLRDSECINVELTA 214



>gi|56754130|gb|AAW25254.1| SJCHGC06789 protein [Schistosoma japonicum]
          Length = 378

 Score = 88.2 bits (217), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 97/187 (51%), Gaps = 19/187 (10%)

Query: 43  QRMFRSPGSQPELFSDQDLDAGDPRWPNLFEEFFLV-----NSDTKNDDLLFFVRQTHSE 97
           QR   +     + F    +++ +  W  LF + FL      + D   DDLLF+V      
Sbjct: 38  QRGLYTENILKDGFDGAVINSHNDFWFGLFTQAFLSPALESSVDGPGDDLLFYVHHLKQN 97

Query: 98  NENLDPVFVKRKTTPNSLPPL-DDAVLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNG 155
           NE  +    +R ++  +LP L DD + W+ET +LNL++Q     +T+AVCTRT      G
Sbjct: 98  NEKPELSVFRRNSS--NLPKLTDDYIDWEETVYLNLLMQYFVYVVTIAVCTRT------G 149

Query: 156 PNQKTSMTCSKKHVSKRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDG 215
           P +   +    K  S  VY+ P+  +M+VK +  + +YP +Y+ ID+YE+ F   ++ D 
Sbjct: 150 PQEWQIL----KKFSHTVYSSPSHRQMNVKGSYEQIAYPDLYFTIDNYEEAFAECVLRDS 205

Query: 216 EYLCVEL 222
           E L +EL
Sbjct: 206 ECLNIEL 212



>gi|402585680|gb|EJW79619.1| hypothetical protein WUBG_09472, partial [Wuchereria bancrofti]
          Length = 241

 Score = 87.8 bits (216), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 94/173 (54%), Gaps = 25/173 (14%)

Query: 65  DPRWPNLFEEFFLVNS--DTKN-----DDLLFFV--RQTHSE---NENLDPVFVKRKTTP 112
           + +W  LF +F   N+  + KN     DD+L++V  +Q   +    +    + V R+ +P
Sbjct: 51  ERKWCKLFADFIAGNAYCNAKNCASHSDDMLWYVSVQQVSRDFCVGQEDGQLQVYRRQSP 110

Query: 113 NSLPPLDD-AVLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVS 170
           N  P L+D ++ W+ET  LNLI+Q L  ++T AVC +T   N     Q     C      
Sbjct: 111 NK-PVLNDPSINWEETVCLNLILQQLDFQITCAVCIKTSPQNL----QILRRNC------ 159

Query: 171 KRVYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELA 223
           +RVY  P+K RMD K    E +YP IY+ IDD+E +F  ++V DGE +CVEL 
Sbjct: 160 QRVYPSPSKRRMDSKGECEEITYPKIYFAIDDFEQIFSDVVVRDGECVCVELV 212



>gi|350529331|ref|NP_001121760.2| uncharacterized protein LOC100003412 [Danio rerio]
          Length = 234

 Score = 86.7 bits (213), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 93/167 (55%), Gaps = 21/167 (12%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVR-------QTHSENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR       + ++E + ++    +R +    LP L D
Sbjct: 58  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSEDNTEGKKVEVEVYRRDS--KKLPGLGD 115

Query: 121 A-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 116 PDIDWEESVYLNLILQKLDYVVTCAVCTRSDAGDIHIHKKK----------SQQVFASPS 165

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
           K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL  +
Sbjct: 166 KHPMDSKGEESKMSYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAS 212



>gi|159155804|gb|AAI54551.1| Zgc:172139 protein [Danio rerio]
          Length = 208

 Score = 85.9 bits (211), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 93/167 (55%), Gaps = 21/167 (12%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVR-------QTHSENENLDPVFVKRKTTPNSLPPLDD 120
           W  +F  +F+     + DD+LF+VR       + ++E + ++    +R +    LP L D
Sbjct: 32  WTWMFSTYFMEKWAPRQDDMLFYVRRKLSYVSEDNTEGKKVEVEVYRRDS--KKLPGLGD 89

Query: 121 -AVLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKRVYALPT 178
             + W+E+ +LNLI+Q L   +T AVCTR+   + +   +K          S++V+A P+
Sbjct: 90  PDIDWEESVYLNLILQKLDYVVTCAVCTRSDAGDIHIHKKK----------SQQVFASPS 139

Query: 179 KSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
           K  MD K    + SYP I+++ID++E++F  + V +GE +CVEL  +
Sbjct: 140 KHPMDSKGEESKMSYPNIFFMIDNFEEVFSDMTVGEGEMVCVELVAS 186



>gi|488523196|ref|XP_004453489.1| PREDICTED: uncharacterized protein LOC101426203 [Dasypus
           novemcinctus]
          Length = 828

 Score = 80.9 bits (198), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 86/173 (49%), Gaps = 25/173 (14%)

Query: 68  WPNLFEEFFLVNSDTKNDDLLFFVRQTHS--------ENENLDPVFVKR-----KTTPNS 114
           W   F  +F+     + DD+LF+VR+  +        E   L     +      +     
Sbjct: 210 WTWTFSTYFMEKGAPRQDDMLFYVRRKLAFVGSEGGMEGRKLAEAEPEVEVEVYRRDSKK 269

Query: 115 LPPLDDA-VLWKETFFLNLIVQ-LPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
           LP L D  + W+E+  LNLI+Q L   +T AVCTR+   + +   +K          S++
Sbjct: 270 LPGLGDPDIDWEESVCLNLILQKLDYMVTCAVCTRSDGGDIHIHRKK----------SQQ 319

Query: 173 VYALPTKSRMDVKETSMECSYPLIYYVIDDYEDMFEHLIVTDGEYLCVELAVT 225
           V+A P+K  MD K    + SYP I+++ID +E++F  + V +GE +CVEL  +
Sbjct: 320 VFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEGEMVCVELVAS 372



>gi|475517749|gb|EMT06126.1| Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial [Aegilops
           tauschii]
          Length = 969

 Score = 78.2 bits (191), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 94/174 (54%), Gaps = 16/174 (9%)

Query: 60  DLDAGDPRWPNLFEEFFL---VNSDTKNDDLLFFVRQTHSENENLDPVFVKRKTTPNSLP 116
           D++  D  W  + + FF+   V+   + DDL+FFV  T  + E+L P FV+R     +L 
Sbjct: 31  DVEMDDKFWHEMLDLFFVRGRVSRSREEDDLVFFVNSTMQKMEDLPPFFVRRWAP--TLE 88

Query: 117 PLDDA----VLWKETFFLNLIVQLPCKLTVAVCTRTPNDNSNGPNQKTSMTCSKKHVSKR 172
            L +A    V W+ +F+LNL+      +TVA+C+ +   N      K+        VSK 
Sbjct: 89  KLINANSTEVDWERSFYLNLVAHTSYTVTVALCSIS---NLRNRADKSKRLPPIYKVSKT 145

Query: 173 VYALPTKS--RMDVKETSMEC-SYPLIYYVIDDYEDMFEHLIVTDGEYL-CVEL 222
           VYA P++   R+D ++      +YP IY+ +DD++D F+ ++++D E+  CV L
Sbjct: 146 VYASPSRVNFRLDQRKAVETVPAYPNIYFSVDDFDDPFDAVVLSDPEHCYCVIL 199