BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10334_c0_seq1-m.118 5prime_partial 1261-2154(-) 298 (-)
         (297 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|328770569|gb|EGF80610.1| hypothetical protein BATDEDRAFT_2437...   109   1e-21   Batrachochytrium dendrobatidis JAM81
gi|511005620|gb|EPB86954.1| histone deacetylase 1/2 [Mucor circi...   103   7e-20   Mucor circinelloides f. circinelloides 1006PhL
gi|91079762|ref|XP_966633.1| PREDICTED: similar to histone deace...    99   1e-18   Tribolium castaneum [rust-red flour beetle]
gi|388580110|gb|EIM20427.1| histone deacetylase [Wallemia sebi C...    99   1e-18   Wallemia mellicola CBS 633.66
gi|321463880|gb|EFX74892.1| putative histone deacetylase Rpd3 pr...    99   2e-18   Daphnia pulex
gi|340373564|ref|XP_003385311.1| PREDICTED: histone deacetylase ...    98   3e-18   Amphimedon queenslandica
gi|170042097|ref|XP_001848775.1| histone deacetylase Rpd3 [Culex...    97   6e-18   Culex quinquefasciatus
gi|309400439|gb|ADO79638.1| histone deacetylase [Drosophila nasuta]    97   7e-18   Drosophila nasuta
gi|309400433|gb|ADO79635.1| histone deacetylase [Drosophila nasuta]    97   7e-18   Drosophila nasuta
gi|309400427|gb|ADO79632.1| histone deacetylase [Drosophila albo...    97   7e-18   Drosophila albomicans
gi|312371802|gb|EFR19897.1| hypothetical protein AND_21626 [Anop...    96   8e-18   
gi|195402899|ref|XP_002060037.1| GJ15512 [Drosophila virilis] >g...    96   8e-18   Drosophila virilis
gi|195125223|ref|XP_002007081.1| GI12742 [Drosophila mojavensis]...    96   1e-17   Drosophila mojavensis
gi|157106706|ref|XP_001649445.1| histone deacetylase [Aedes aegy...    95   2e-17   Aedes aegypti
gi|332375094|gb|AEE62688.1| unknown [Dendroctonus ponderosae] >g...    95   2e-17   Dendroctonus ponderosae
gi|478253198|gb|ENN73569.1| hypothetical protein YQE_09818, part...    95   3e-17   Dendroctonus ponderosae
gi|196008889|ref|XP_002114310.1| hypothetical protein TRIADDRAFT...    94   3e-17   Trichoplax adhaerens
gi|195011655|ref|XP_001983253.1| GH15691 [Drosophila grimshawi] ...    94   3e-17   Drosophila grimshawi
gi|157106708|ref|XP_001649446.1| histone deacetylase [Aedes aegy...    94   3e-17   Aedes aegypti
gi|384494644|gb|EIE85135.1| histone deacetylase RPD3 [Rhizopus d...    94   4e-17   Rhizopus delemar RA 99-880
gi|309400441|gb|ADO79639.1| histone deacetylase [Drosophila nasuta]    94   5e-17   Drosophila nasuta
gi|2583090|gb|AAC23917.1| putative histone deacetylase HDAC1 [Dr...    94   5e-17   Drosophila melanogaster
gi|1666637|emb|CAA70455.1| histone deacetylase [Drosophila melan...    94   6e-17   Drosophila melanogaster
gi|194747495|ref|XP_001956187.1| GF25085 [Drosophila ananassae] ...    94   6e-17   Drosophila ananassae
gi|388582081|gb|EIM22387.1| histone deacetylase [Wallemia sebi C...    94   7e-17   Wallemia mellicola CBS 633.66
gi|3659524|gb|AAC61494.1| putative histone deacetylase [Drosophi...    93   7e-17   Drosophila melanogaster
gi|24657891|ref|NP_647918.2| Rpd3 [Drosophila melanogaster] >gi|...    93   7e-17   Drosophila melanogaster
gi|195491828|ref|XP_002093731.1| GE21462 [Drosophila yakuba] >gi...    93   8e-17   Drosophila yakuba
gi|195587822|ref|XP_002083660.1| GD13856 [Drosophila simulans] >...    93   8e-17   
gi|384875340|gb|AFI26262.1| Rpd3 [Drosophila melanogaster]             93   8e-17   Drosophila melanogaster
gi|194866666|ref|XP_001971925.1| GG15241 [Drosophila erecta] >gi...    93   8e-17   Drosophila erecta
gi|307215210|gb|EFN89982.1| Histone deacetylase Rpd3 [Harpegnath...    93   9e-17   Harpegnathos saltator
gi|330841173|ref|XP_003292577.1| hypothetical protein DICPUDRAFT...    93   9e-17   Dictyostelium purpureum
gi|195189897|ref|XP_002029476.1| GL22005 [Drosophila persimilis]...    93   9e-17   Drosophila persimilis
gi|332020933|gb|EGI61327.1| Histone deacetylase Rpd3 [Acromyrmex...    93   1e-16   Acromyrmex echinatior
gi|195429008|ref|XP_002062556.1| GK16595 [Drosophila willistoni]...    93   1e-16   Drosophila willistoni
gi|158295965|ref|XP_316539.2| AGAP006511-PA [Anopheles gambiae s...    92   2e-16   Anopheles gambiae str. PEST
gi|307176124|gb|EFN65822.1| Histone deacetylase Rpd3 [Camponotus...    92   2e-16   Camponotus floridanus
gi|268607740|ref|NP_001161325.1| Rpd3 histone deacetylase [Nason...    91   3e-16   Nasonia vitripennis
gi|195176220|ref|XP_002028716.1| GL22935 [Drosophila persimilis]...    91   3e-16   Drosophila persimilis
gi|512927856|ref|XP_004931440.1| PREDICTED: LOW QUALITY PROTEIN:...    91   3e-16   Bombyx mori [silk moth]
gi|12963262|gb|AAK11183.1|AF321130_1 histone deacetylase 2 [Ratt...    91   4e-16   Rattus norvegicus [brown rat]
gi|350400285|ref|XP_003485786.1| PREDICTED: histone deacetylase ...    91   4e-16   Bombus impatiens
gi|198463008|ref|XP_001352649.2| GA20378 [Drosophila pseudoobscu...    91   4e-16   Drosophila pseudoobscura pseudoobscura
gi|62087960|dbj|BAD92427.1| histone deacetylase 2 variant [Homo ...    91   5e-16   Homo sapiens [man]
gi|498931174|ref|XP_004519082.1| PREDICTED: histone deacetylase ...    91   5e-16   Ceratitis capitata
gi|209154690|gb|ACI33577.1| Histone deacetylase 2 [Salmo salar]        90   6e-16   Salmo salar
gi|432107862|gb|ELK32919.1| Histone deacetylase 2 [Myotis davidii]     90   6e-16   Myotis davidii
gi|470299839|ref|XP_004346729.1| histone deacetylase 2 [Capsaspo...    90   7e-16   Capsaspora owczarzaki ATCC 30864
gi|449680092|ref|XP_002162290.2| PREDICTED: probable histone dea...    90   7e-16   
gi|384486542|gb|EIE78722.1| hypothetical protein RO3G_03427 [Rhi...    90   7e-16   Rhizopus delemar RA 99-880
gi|380012355|ref|XP_003690250.1| PREDICTED: histone deacetylase ...    90   8e-16   
gi|344248728|gb|EGW04832.1| Histone deacetylase 2 [Cricetulus gr...    90   8e-16   Cricetulus griseus [Chinese hamsters]
gi|193783546|dbj|BAG53457.1| unnamed protein product [Homo sapiens]    90   8e-16   Homo sapiens [man]
gi|465796405|emb|CCV00661.1| unnamed protein product [Malassezia...    90   8e-16   Malassezia sympodialis ATCC 42132
gi|345778325|ref|XP_532270.3| PREDICTED: histone deacetylase 2 [...    90   8e-16   
gi|340718122|ref|XP_003397521.1| PREDICTED: hypothetical protein...    90   8e-16   
gi|164662701|ref|XP_001732472.1| hypothetical protein MGL_0247 [...    90   8e-16   Malassezia globosa CBS 7966
gi|328788017|ref|XP_394976.4| PREDICTED: histone deacetylase Rpd...    90   8e-16   Apis mellifera [European honey bee]
gi|397503309|ref|XP_003822268.1| PREDICTED: histone deacetylase ...    90   8e-16   
gi|354482575|ref|XP_003503473.1| PREDICTED: histone deacetylase ...    90   9e-16   
gi|332213073|ref|XP_003255643.1| PREDICTED: histone deacetylase ...    90   9e-16   Nomascus leucogenys [White-cheeked Gibbon]
gi|348561437|ref|XP_003466519.1| PREDICTED: histone deacetylase ...    90   9e-16   
gi|507643174|ref|XP_004702067.1| PREDICTED: histone deacetylase ...    90   9e-16   Echinops telfairi [lesser hedgehog tenrec]
gi|449272245|gb|EMC82256.1| Histone deacetylase 2, partial [Colu...    90   9e-16   Columba livia [carrier pigeon]
gi|444709097|gb|ELW50129.1| Histone deacetylase 2 [Tupaia chinen...    90   9e-16   Tupaia chinensis
gi|388851970|emb|CCF54326.1| probable histone deacetylase [Ustil...    89   1e-15   Ustilago hordei
gi|355562127|gb|EHH18759.1| hypothetical protein EGK_15423 [Maca...    89   1e-15   Macaca mulatta [rhesus macaque]
gi|260799294|ref|XP_002594632.1| hypothetical protein BRAFLDRAFT...    89   1e-15   Branchiostoma floridae
gi|326916047|ref|XP_003204323.1| PREDICTED: histone deacetylase ...    89   1e-15   
gi|512905204|ref|XP_004900565.1| PREDICTED: histone deacetylase ...    89   1e-15   
gi|338710739|ref|XP_001916752.2| PREDICTED: histone deacetylase ...    89   1e-15   
gi|344264495|ref|XP_003404327.1| PREDICTED: LOW QUALITY PROTEIN:...    89   1e-15   Loxodonta africana [African bush elephant]
gi|60654411|gb|AAX29896.1| histone deacetylase 2 [synthetic cons...    89   1e-15   synthetic construct
gi|507706424|ref|XP_004645947.1| PREDICTED: histone deacetylase ...    89   1e-15   Octodon degus
gi|171846760|gb|AAI61939.1| Hdac2 protein [Rattus norvegicus]          89   1e-15   Rattus norvegicus [brown rat]
gi|301774829|ref|XP_002922834.1| PREDICTED: histone deacetylase ...    89   1e-15   Ailuropoda melanoleuca
gi|513015605|ref|XP_004869140.1| PREDICTED: histone deacetylase ...    89   1e-15   Heterocephalus glaber [naked mole rat]
gi|465979268|ref|XP_004264753.1| PREDICTED: histone deacetylase ...    89   1e-15   Orcinus orca [Orca]
gi|45382275|ref|NP_990162.1| histone deacetylase 2 [Gallus gallu...    89   1e-15   
gi|402868496|ref|XP_003898337.1| PREDICTED: histone deacetylase ...    89   1e-15   Papio anubis [Doguera baboon]
gi|335279374|ref|XP_001925353.2| PREDICTED: histone deacetylase ...    89   1e-15   Sus scrofa [pigs]
gi|332027663|gb|EGI67731.1| Histone deacetylase Rpd3 [Acromyrmex...    89   1e-15   Acromyrmex echinatior
gi|224048285|ref|XP_002192530.1| PREDICTED: histone deacetylase ...    89   1e-15   Taeniopygia guttata
gi|126310452|ref|XP_001368989.1| PREDICTED: histone deacetylase ...    89   1e-15   Monodelphis domestica
gi|115495423|ref|NP_001068614.1| histone deacetylase 2 [Bos taur...    89   1e-15   Bos taurus [bovine]
gi|293336691|ref|NP_001518.3| histone deacetylase 2 [Homo sapien...    89   1e-15   Homo sapiens [man]
gi|66828287|ref|XP_647498.1| histone deacetylase family protein ...    89   1e-15   Dictyostelium discoideum AX4
gi|71051977|gb|AAH31055.2| HDAC2 protein, partial [Homo sapiens]       89   1e-15   Homo sapiens [man]
gi|426234509|ref|XP_004011238.1| PREDICTED: histone deacetylase ...    89   1e-15   Ovis aries [domestic sheep]
gi|1667394|gb|AAC50814.1| transcriptional regulator homolog RPD3...    89   1e-15   Homo sapiens [man]
gi|53749670|ref|NP_001005432.1| histone deacetylase 2 [Xenopus (...    89   1e-15   Xenopus tropicalis [western clawed frog]
gi|74185170|dbj|BAE22585.1| unnamed protein product [Mus musculus]     89   1e-15   Mus musculus [mouse]
gi|327261622|ref|XP_003215628.1| PREDICTED: histone deacetylase ...    89   1e-15   Anolis carolinensis [Carolina anole]
gi|431838729|gb|ELK00659.1| Histone deacetylase 2 [Pteropus alecto]    89   1e-15   Pteropus alecto
gi|3023934|sp|P70288.1|HDAC2_MOUSE RecName: Full=Histone deacety...    89   1e-15   Mus musculus [mouse]
gi|488515061|ref|XP_004449541.1| PREDICTED: histone deacetylase ...    89   1e-15   Dasypus novemcinctus
gi|89268122|emb|CAJ81536.1| histone deacetylase 2 [Xenopus (Silu...    89   1e-15   Xenopus tropicalis [western clawed frog]
gi|87162464|ref|NP_032255.2| histone deacetylase 2 [Mus musculus...    89   1e-15   Mus musculus [mouse]
gi|395534795|ref|XP_003769422.1| PREDICTED: histone deacetylase ...    89   1e-15   
gi|147901906|ref|NP_001084011.1| histone deacetylase 2 [Xenopus ...    89   1e-15   Xenopus laevis [clawed frog]
gi|208022663|ref|NP_445899.1| histone deacetylase 2 [Rattus norv...    89   1e-15   Rattus norvegicus [brown rat]
gi|148922187|gb|AAI46377.1| Histone deacetylase 2 [synthetic con...    89   1e-15   synthetic construct
gi|351710106|gb|EHB13025.1| Histone deacetylase 2 [Heterocephalu...    89   1e-15   Heterocephalus glaber [naked mole rat]
gi|194384520|dbj|BAG59420.1| unnamed protein product [Homo sapiens]    89   1e-15   Homo sapiens [man]
gi|114608973|ref|XP_518700.2| PREDICTED: histone deacetylase 2 i...    89   1e-15   Pan troglodytes
gi|332213071|ref|XP_003255642.1| PREDICTED: histone deacetylase ...    89   1e-15   Nomascus leucogenys [White-cheeked Gibbon]
gi|383864165|ref|XP_003707550.1| PREDICTED: histone deacetylase ...    89   1e-15   Megachile rotundata
gi|149430741|ref|XP_001521848.1| PREDICTED: histone deacetylase ...    89   2e-15   
gi|483525083|gb|EOB08826.1| Histone deacetylase 2, partial [Anas...    89   2e-15   Anas platyrhynchos [duck]
gi|241626601|ref|XP_002407932.1| histone deacetylase 1, 2 ,3, pu...    89   2e-15   Ixodes scapularis [blacklegged tick]
gi|505754937|gb|EOQ99225.1| Histone deacetylase clr6 [Wallemia i...    89   2e-15   Wallemia ichthyophaga EXF-994
gi|465989351|gb|EMP38066.1| Histone deacetylase 2, partial [Chel...    89   2e-15   Chelonia mydas [green seaturtle]
gi|281340052|gb|EFB15636.1| hypothetical protein PANDA_011849 [A...    89   2e-15   Ailuropoda melanoleuca
gi|296484177|tpg|DAA26292.1| TPA: histone deacetylase 2 [Bos tau...    89   2e-15   Bos taurus [bovine]
gi|291244267|ref|XP_002742021.1| PREDICTED: histone deacetylase ...    88   2e-15   
gi|27545221|ref|NP_775343.1| histone deacetylase 1 [Danio rerio]...    88   3e-15   Danio rerio [leopard danio]
gi|358057427|dbj|GAA96776.1| hypothetical protein E5Q_03447 [Mix...    88   3e-15   Mixia osmundae IAM 14324
gi|511009552|gb|EPB90793.1| histone deacetylase clr6 [Mucor circ...    87   4e-15   Mucor circinelloides f. circinelloides 1006PhL
gi|281206669|gb|EFA80855.1| WD40 repeat-containing protein [Poly...    87   4e-15   Polysphondylium pallidum PN500
gi|213402171|ref|XP_002171858.1| histone deacetylase clr6 [Schiz...    87   4e-15   Schizosaccharomyces japonicus yFS275
gi|32450592|gb|AAH54208.1| Hdac2 protein, partial [Xenopus laevis]     87   5e-15   Xenopus laevis [clawed frog]
gi|357620335|gb|EHJ72565.1| histone deacetylase Rpd3 [Danaus ple...    87   5e-15   Danaus plexippus [American monarch]
gi|55716026|gb|AAH85375.1| Histone deacetylase 1 [Danio rerio] >...    87   5e-15   Danio rerio [leopard danio]
gi|471561598|gb|EMR63332.1| putative histone deacetylase rpd3 pr...    87   7e-15   Eutypa lata UCREL1
gi|505792365|ref|XP_004606149.1| PREDICTED: histone deacetylase ...    86   8e-15   
gi|342321515|gb|EGU13448.1| Histone deacetylase [Rhodotorula glu...    86   9e-15   Rhodotorula toruloides ATCC 204091
gi|505791260|ref|XP_004605841.1| PREDICTED: histone deacetylase ...    86   9e-15   Sorex araneus [Eurasian shrew]
gi|430811539|emb|CCJ31025.1| unnamed protein product, partial [P...    86   1e-14   Pneumocystis jirovecii
gi|443897234|dbj|GAC74575.1| histone deacetylase complex, cataly...    86   1e-14   Moesziomyces antarcticus T-34
gi|313217502|emb|CBY38585.1| unnamed protein product [Oikopleura...    86   1e-14   Oikopleura dioica
gi|321253561|ref|XP_003192774.1| histone deacetylase 1-1 (hd1) [...    86   1e-14   Cryptococcus gattii WM276
gi|409083086|gb|EKM83443.1| hypothetical protein AGABI1DRAFT_110...    86   1e-14   Agaricus bisporus var. burnettii JB137-S8
gi|426201863|gb|EKV51786.1| hypothetical protein AGABI2DRAFT_198...    86   1e-14   Agaricus bisporus var. bisporus H97
gi|393247958|gb|EJD55465.1| hypothetical protein AURDEDRAFT_1097...    86   1e-14   Auricularia subglabra TFB-10046 SS5
gi|425876821|gb|AFY07417.1| histone deacetylase 1-like protein [...    86   1e-14   Schmidtea mediterranea [freshwater planarian]
gi|499031134|ref|XP_004566277.1| PREDICTED: histone deacetylase ...    86   1e-14   Maylandia zebra
gi|501307976|dbj|GAC96889.1| potential Sin3.Rpd3 histone deacety...    86   2e-14   Pseudozyma hubeiensis SY62
gi|348531120|ref|XP_003453058.1| PREDICTED: histone deacetylase ...    86   2e-14   
gi|358342847|dbj|GAA41197.2| histone deacetylase 1/2 [Clonorchis...    85   2e-14   Clonorchis sinensis [oriental liver fluke]
gi|148222828|ref|NP_001081491.1| probable histone deacetylase 1-...    85   2e-14   Xenopus laevis [clawed frog]
gi|472584340|gb|EMS21934.1| histone deacetylase 1/2 [Rhodosporid...    85   2e-14   Rhodotorula toruloides NP11
gi|148229549|ref|NP_001079396.1| histone deacetylase 1 [Xenopus ...    85   2e-14   Xenopus laevis [clawed frog]
gi|470251008|ref|XP_004358601.1| histone deacetylase family prot...    85   2e-14   Dictyostelium fasciculatum
gi|465959399|gb|EMP28416.1| Histone deacetylase 1 [Chelonia mydas]     85   3e-14   Chelonia mydas [green seaturtle]
gi|470318556|gb|EMR10209.1| hypothetical protein PNEG_01482 [Pne...    85   3e-14   Pneumocystis murina B123
gi|321263085|ref|XP_003196261.1| histone deacetylase 1 (hd1) [Cr...    84   3e-14   Cryptococcus gattii WM276
gi|58270722|ref|XP_572517.1| histone deacetylase 1 (hd1) [Crypto...    84   3e-14   Cryptococcus neoformans var. neoformans JEC21
gi|58265630|ref|XP_569971.1| histone deacetylase 1-1 (hd1) [Cryp...    84   4e-14   Cryptococcus neoformans var. neoformans JEC21
gi|3023928|sp|O42227.1|HDA1B_XENLA RecName: Full=Probable histon...    84   5e-14   Xenopus laevis [clawed frog]
gi|226478802|emb|CAX72896.1| histone deacetylase 1/2 [Schistosom...    84   6e-14   Schistosoma japonicum
gi|507714112|ref|XP_004648093.1| PREDICTED: histone deacetylase ...    83   7e-14   
gi|71896231|ref|NP_001025564.1| histone deacetylase 1 [Xenopus (...    83   7e-14   Xenopus tropicalis [western clawed frog]
gi|19112125|ref|NP_595333.1| histone deacetylase (class I) Clr6 ...    83   7e-14   Schizosaccharomyces pombe 972h-
gi|256071317|ref|XP_002571987.1| histone deacetylase [Schistosom...    83   8e-14   
gi|209154478|gb|ACI33471.1| Probable histone deacetylase 1-B [Sa...    83   9e-14   Salmo salar
gi|71005666|ref|XP_757499.1| hypothetical protein UM01352.1 [Ust...    83   1e-13   
gi|449488911|ref|XP_002194370.2| PREDICTED: histone deacetylase ...    83   1e-13   
gi|126216326|gb|ABN81193.1| histone deacetylase 1 [Schistosoma m...    83   1e-13   Schistosoma mansoni
gi|11967857|emb|CAC19454.1| histone deacetylase [Ustilago maydis]      83   1e-13   Ustilago maydis
gi|19070647|gb|AAL83942.1|AF352394_1 putative histone deacetylas...    83   1e-13   Physarum polycephalum
gi|343427236|emb|CBQ70764.1| probable Hda2-Histone deacetylase [...    83   1e-13   Sporisorium reilianum SRZ2
gi|327288082|ref|XP_003228757.1| PREDICTED: histone deacetylase ...    82   1e-13   
gi|134109825|ref|XP_776462.1| hypothetical protein CNBC5170 [Cry...    82   1e-13   Cryptococcus neoformans var. neoformans B-3501A
gi|430811164|emb|CCJ31339.1| unnamed protein product [Pneumocyst...    82   1e-13   Pneumocystis jirovecii
gi|410911136|ref|XP_003969046.1| PREDICTED: probable histone dea...    82   2e-13   
gi|358056605|dbj|GAA97574.1| hypothetical protein E5Q_04252 [Mix...    82   2e-13   Mixia osmundae IAM 14324
gi|157837995|ref|NP_989487.1| histone deacetylase 1 [Gallus gall...    82   2e-13   Gallus gallus [bantam]
gi|326933089|ref|XP_003212642.1| PREDICTED: histone deacetylase ...    82   2e-13   
gi|2827430|gb|AAB99850.1| histone deacetylase 1 [Gallus gallus]        82   2e-13   Gallus gallus [bantam]
gi|449273084|gb|EMC82692.1| Histone deacetylase 1, partial [Colu...    82   3e-13   Columba livia [carrier pigeon]
gi|483512076|gb|EOB00696.1| Histone deacetylase 1, partial [Anas...    82   3e-13   Anas platyrhynchos [duck]
gi|47551069|ref|NP_999711.1| histone deacetylase 1 [Strongylocen...    81   3e-13   Strongylocentrotus purpuratus [purple urchin]
gi|402579982|gb|EJW73933.1| hypothetical protein WUBG_15159, par...    81   4e-13   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|254566249|ref|XP_002490235.1| Histone deacetylase [Komagatael...    80   5e-13   Komagataella phaffii GS115
gi|328709372|ref|XP_001946324.2| PREDICTED: histone deacetylase ...    80   5e-13   Acyrthosiphon pisum
gi|403160872|ref|XP_003321297.2| histone deacetylase 1/2 [Puccin...    80   5e-13   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|443689292|gb|ELT91729.1| hypothetical protein CAPTEDRAFT_1758...    80   7e-13   Capitella teleta
gi|344235663|gb|EGV91766.1| Histone deacetylase 1 [Cricetulus gr...    80   8e-13   Cricetulus griseus [Chinese hamsters]
gi|459172185|ref|XP_004225492.1| PREDICTED: LOW QUALITY PROTEIN:...    80   8e-13   Ciona intestinalis [sea vase]
gi|407921727|gb|EKG14866.1| Histone deacetylase superfamily [Mac...    79   1e-12   Macrophomina phaseolina MS6
gi|170575666|ref|XP_001893332.1| Histone deacetylase 1 [Brugia m...    79   1e-12   Brugia malayi [agent of lymphatic filariasis]
gi|320582857|gb|EFW97074.1| Histone deacetylase [Ogataea parapol...    79   2e-12   
gi|470530821|ref|XP_004368316.1| Type-1 histone deacetylase 1, p...    79   2e-12   Acanthamoeba castellanii str. Neff
gi|312076531|ref|XP_003140903.1| histone deacetylase 1 [Loa loa]       79   2e-12   Loa loa
gi|393908162|gb|EFO23171.2| histone deacetylase 1 [Loa loa]            79   2e-12   Loa loa
gi|328853510|gb|EGG02648.1| hypothetical protein MELLADRAFT_3845...    79   2e-12   Melampsora larici-populina 98AG31
gi|170086091|ref|XP_001874269.1| histone deacetylase complex, ca...    78   3e-12   Laccaria bicolor S238N-H82
gi|393218816|gb|EJD04304.1| hypothetical protein FOMMEDRAFT_8160...    78   3e-12   Fomitiporia mediterranea MF3/22
gi|156408678|ref|XP_001641983.1| predicted protein [Nematostella...    78   3e-12   Nematostella vectensis
gi|67533353|ref|XP_662097.1| hypothetical protein AN4493.2 [Aspe...    77   4e-12   Aspergillus nidulans FGSC A4
gi|321259966|ref|XP_003194703.1| hypothetical protein CGB_F2490W...    77   4e-12   Cryptococcus gattii WM276
gi|170578252|ref|XP_001894336.1| histone deacetylase 1 (HD1) [Br...    77   4e-12   Brugia malayi [agent of lymphatic filariasis]
gi|392597105|gb|EIW86427.1| histone deacetylase complex catalyti...    77   4e-12   Coniophora puteana RWD-64-598 SS2
gi|393230311|gb|EJD37919.1| hypothetical protein AURDEDRAFT_1166...    77   5e-12   Auricularia subglabra TFB-10046 SS5
gi|390604222|gb|EIN13613.1| histone deacetylase complex catalyti...    77   5e-12   Punctularia strigosozonata HHB-11173 SS5
gi|513030729|gb|AGO10754.1| AaceriAGR395Wp [Saccharomycetaceae s...    77   5e-12   Saccharomycetaceae sp. 'Ashbya aceri'
gi|225562715|gb|EEH10994.1| histone deacetylase [Ajellomyces cap...    77   6e-12   Histoplasma capsulatum G186AR
gi|472585964|gb|EMS23506.1| histone deacetylase 1/2 [Rhodosporid...    77   6e-12   Rhodotorula toruloides NP11
gi|240279524|gb|EER43029.1| histone deacetylase RpdA [Ajellomyce...    77   7e-12   Histoplasma capsulatum H143
gi|325092651|gb|EGC45961.1| histone deacetylase RpdA [Ajellomyce...    77   7e-12   Histoplasma capsulatum H88
gi|242008175|ref|XP_002424887.1| histone deacetylase RPD3, putat...    77   7e-12   Pediculus humanus corporis [human body lice]
gi|212543437|ref|XP_002151873.1| histone deacetylase RpdA/Rpd3 [...    77   8e-12   Talaromyces marneffei ATCC 18224
gi|367019356|ref|XP_003658963.1| histone deacetylase RPD3-like p...    77   8e-12   Myceliophthora thermophila ATCC 42464
gi|367053145|ref|XP_003656951.1| histone deacetylase-like protei...    77   8e-12   Thielavia terrestris NRRL 8126
gi|47213589|emb|CAF93492.1| unnamed protein product [Tetraodon n...    76   1e-11   Tetraodon nigroviridis
gi|328703842|ref|XP_001946595.2| PREDICTED: histone deacetylase ...    76   1e-11   Acyrthosiphon pisum
gi|149016232|gb|EDL75478.1| rCG23915 [Rattus norvegicus]               76   1e-11   Rattus norvegicus [brown rat]
gi|14333978|gb|AAK58884.1| reduced potassium dependency 3 Rpd3p ...    76   1e-11   Kluyveromyces lactis
gi|470317926|gb|EMR09616.1| hypothetical protein PNEG_02199 [Pne...    76   1e-11   Pneumocystis murina B123
gi|366997625|ref|XP_003683549.1| hypothetical protein TPHA_0A003...    76   1e-11   Tetrapisispora phaffii CBS 4417
gi|12963260|gb|AAK11182.1|AF321129_1 histone deacetylase 1 [Ratt...    76   1e-11   Rattus norvegicus [brown rat]
gi|164661303|ref|XP_001731774.1| hypothetical protein MGL_1042 [...    76   1e-11   Malassezia globosa CBS 7966
gi|328709501|ref|XP_001943175.2| PREDICTED: histone deacetylase ...    76   1e-11   
gi|401884823|gb|EJT48964.1| histone deacetylase 1 (hd1) [Trichos...    75   1e-11   Trichosporon asahii var. asahii CBS 2479
gi|406694461|gb|EKC97788.1| histone deacetylase 1 (hd1) [Trichos...    75   1e-11   Trichosporon asahii var. asahii CBS 8904
gi|358368808|dbj|GAA85424.1| histone deacetylase RpdA/Rpd3 [Aspe...    75   1e-11   Aspergillus kawachii IFO 4308
gi|505755416|gb|EOQ99633.1| Histone deacetylase RPD3 [Wallemia i...    75   2e-11   Wallemia ichthyophaga EXF-994
gi|45201491|ref|NP_987061.1| AGR395Wp [Ashbya gossypii ATCC 1089...    75   2e-11   Eremothecium gossypii ATCC 10895
gi|293337197|ref|NP_001168837.1| uncharacterized protein LOC1003...    75   2e-11   
gi|391337144|ref|XP_003742933.1| PREDICTED: histone deacetylase ...    75   2e-11   Metaseiulus occidentalis
gi|402581368|gb|EJW75316.1| hypothetical protein WUBG_13778, par...    75   2e-11   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|367008140|ref|XP_003678570.1| hypothetical protein TDEL_0A002...    75   2e-11   Torulaspora delbrueckii
gi|145238426|ref|XP_001391860.1| histone deacetylase 1 [Aspergil...    75   2e-11   Aspergillus niger CBS 513.88
gi|392571343|gb|EIW64515.1| histone deacetylase [Trametes versic...    75   2e-11   Trametes versicolor FP-101664 SS1
gi|331224551|ref|XP_003324947.1| histone deacetylase 1/2 [Puccin...    75   2e-11   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|425769279|gb|EKV07776.1| Histone deacetylase RpdA/Rpd3 [Penic...    75   2e-11   Penicillium digitatum Pd1
gi|478430997|ref|NP_445898.1| histone deacetylase 1-like [Rattus...    75   2e-11   Rattus norvegicus [brown rat]
gi|50308073|ref|XP_454037.1| hypothetical protein [Kluyveromyces...    75   2e-11   Kluyveromyces lactis NRRL Y-1140
gi|154321467|ref|XP_001560049.1| hypothetical protein BC1G_01608...    75   3e-11   Botrytis cinerea B05.10
gi|347830984|emb|CCD46681.1| similar to histone deacetylase RpdA...    75   3e-11   Botrytis cinerea T4
gi|255942905|ref|XP_002562221.1| Pc18g03850 [Penicillium chrysog...    75   3e-11   Penicillium rubens Wisconsin 54-1255
gi|432947249|ref|XP_004083964.1| PREDICTED: histone deacetylase ...    75   3e-11   Oryzias latipes [Japanese rice fish]
gi|225709884|gb|ACO10788.1| Histone deacetylase 1 [Caligus roger...    75   3e-11   Caligus rogercresseyi
gi|405121239|gb|AFR96008.1| histone deacetylase 2 [Cryptococcus ...    75   3e-11   Cryptococcus neoformans var. grubii H99
gi|343055635|gb|AEL79596.1| Histone deacetylase 1 [Pantholops ho...    75   3e-11   Pantholops hodgsonii
gi|510952845|gb|AGN56197.1| histone deacetylase RpdA [Penicilliu...    75   3e-11   Penicillium citrinum
gi|50285207|ref|XP_445032.1| hypothetical protein [Candida glabr...    75   3e-11   Candida glabrata CBS 138
gi|407919962|gb|EKG13181.1| Histone deacetylase superfamily [Mac...    75   3e-11   Macrophomina phaseolina MS6
gi|156053950|ref|XP_001592901.1| hypothetical protein SS1G_05823...    74   3e-11   Sclerotinia sclerotiorum 1980 UF-70
gi|470632759|ref|XP_004322371.1| PREDICTED: LOW QUALITY PROTEIN:...    74   3e-11   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|432884272|ref|XP_004074465.1| PREDICTED: probable histone dea...    74   4e-11   Oryzias latipes [Japanese rice fish]
gi|432884274|ref|XP_004074466.1| PREDICTED: probable histone dea...    74   4e-11   
gi|403213303|emb|CCK67805.1| hypothetical protein KNAG_0A01160 [...    74   4e-11   Kazachstania naganishii CBS 8797
gi|444707342|gb|ELW48624.1| Histone deacetylase 1 [Tupaia chinen...    74   4e-11   Tupaia chinensis
gi|301115106|ref|XP_002905282.1| histone deacetylase, putative [...    74   4e-11   Phytophthora infestans T30-4
gi|358390497|gb|EHK39902.1| hypothetical protein TRIATDRAFT_1636...    74   4e-11   Trichoderma atroviride IMI 206040
gi|405963641|gb|EKC29198.1| Histone deacetylase Rpd3 [Crassostre...    74   4e-11   Crassostrea gigas
gi|402079504|gb|EJT74769.1| histone deacetylase RPD3 [Gaeumannom...    74   5e-11   Gaeumannomyces graminis var. tritici R3-111a-1
gi|507694877|ref|XP_004643035.1| PREDICTED: histone deacetylase ...    74   5e-11   
gi|297282850|ref|XP_001096929.2| PREDICTED: histone deacetylase ...    74   5e-11   
gi|410075699|ref|XP_003955432.1| hypothetical protein KAFR_0A086...    74   5e-11   Kazachstania africana CBS 2517
gi|410041916|ref|XP_003951328.1| PREDICTED: histone deacetylase ...    74   5e-11   
gi|148698240|gb|EDL30187.1| mCG12239 [Mus musculus]                    74   5e-11   Mus musculus [mouse]
gi|350585862|ref|XP_003127820.3| PREDICTED: histone deacetylase ...    74   5e-11   
gi|406605314|emb|CCH43270.1| Histone deacetylase 1 [Wickerhamomy...    74   5e-11   Wickerhamomyces ciferrii
gi|488563498|ref|XP_004471453.1| PREDICTED: histone deacetylase ...    74   5e-11   
gi|440635253|gb|ELR05172.1| hypothetical protein GMDG_07213 [Geo...    74   5e-11   Pseudogymnoascus destructans 20631-21
gi|114555339|ref|XP_001162233.1| PREDICTED: histone deacetylase ...    74   5e-11   
gi|338722021|ref|XP_001499986.3| PREDICTED: histone deacetylase ...    74   6e-11   
gi|426328765|ref|XP_004025420.1| PREDICTED: histone deacetylase ...    74   6e-11   Gorilla gorilla gorilla [lowland gorilla]
gi|397515946|ref|XP_003828202.1| PREDICTED: histone deacetylase ...    74   6e-11   
gi|332254588|ref|XP_003276412.1| PREDICTED: histone deacetylase ...    74   6e-11   Nomascus leucogenys [White-cheeked Gibbon]
gi|348685268|gb|EGZ25083.1| hypothetical protein PHYSODRAFT_3117...    74   6e-11   Phytophthora sojae
gi|504161253|ref|XP_004591679.1| PREDICTED: histone deacetylase ...    74   6e-11   Ochotona princeps [southern American pika]
gi|242776089|ref|XP_002478774.1| histone deacetylase, putative [...    74   6e-11   Talaromyces stipitatus ATCC 10500
gi|348512569|ref|XP_003443815.1| PREDICTED: probable histone dea...    74   6e-11   Oreochromis niloticus
gi|499025982|ref|XP_004563736.1| PREDICTED: probable histone dea...    74   6e-11   Maylandia zebra
gi|291408885|ref|XP_002720761.1| PREDICTED: histone deacetylase ...    74   6e-11   Oryctolagus cuniculus [European rabbit]
gi|478503289|ref|XP_004425952.1| PREDICTED: histone deacetylase ...    74   6e-11   
gi|114555329|ref|XP_519834.2| PREDICTED: histone deacetylase 1 i...    74   6e-11   
gi|431891137|gb|ELK02014.1| Histone deacetylase 1 [Pteropus alecto]    74   6e-11   Pteropus alecto
gi|1665723|dbj|BAA08909.1| RPD3 protein [Homo sapiens] >gi|60819...    74   6e-11   Homo sapiens [man]
gi|440896947|gb|ELR48738.1| Histone deacetylase 1, partial [Bos ...    74   6e-11   Bos mutus
gi|355564817|gb|EHH21317.1| hypothetical protein EGK_04341 [Maca...    74   6e-11   Macaca mulatta [rhesus macaque]
gi|148706511|gb|EDL38458.1| mCG128529 [Mus musculus]                   74   6e-11   Mus musculus [mouse]
gi|512977721|ref|XP_004850908.1| PREDICTED: histone deacetylase ...    74   6e-11   Heterocephalus glaber [naked mole rat]
gi|507563288|ref|XP_004665328.1| PREDICTED: histone deacetylase ...    74   6e-11   Jaculus jaculus
gi|507935236|ref|XP_004678799.1| PREDICTED: histone deacetylase ...    74   7e-11   Condylura cristata
gi|70794768|ref|NP_001020580.1| histone deacetylase 1 [Rattus no...    74   7e-11   
gi|348570686|ref|XP_003471128.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|465990288|ref|XP_004266568.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|426328763|ref|XP_004025419.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|332829216|ref|XP_001163573.2| PREDICTED: histone deacetylase ...    74   7e-11   
gi|13128860|ref|NP_004955.2| histone deacetylase 1 [Homo sapiens...    74   7e-11   
gi|395857855|ref|XP_003801297.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|512851249|ref|XP_004887243.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|6680193|ref|NP_032254.1| histone deacetylase 1 [Mus musculus]...    74   7e-11   
gi|507655415|ref|XP_004705065.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|82697313|ref|NP_001032521.1| histone deacetylase 1 [Bos tauru...    74   7e-11   
gi|354476944|ref|XP_003500683.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|470654309|ref|XP_004329860.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|2347180|gb|AAB68398.1| putative histone deacetylase [Mus musc...    74   7e-11   
gi|350585844|ref|XP_003356353.2| PREDICTED: histone deacetylase ...    74   7e-11   
gi|351701636|gb|EHB04555.1| Histone deacetylase 1 [Heterocephalu...    74   7e-11   
gi|344287540|ref|XP_003415511.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|332254586|ref|XP_003276411.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|296207351|ref|XP_002750618.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|30583783|gb|AAP36140.1| Homo sapiens histone deacetylase 1 [s...    74   7e-11   
gi|471362995|ref|XP_004372056.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|403293205|ref|XP_003937612.1| PREDICTED: histone deacetylase ...    74   7e-11   
gi|328724942|ref|XP_001946674.2| PREDICTED: histone deacetylase ...    73   7e-11   
gi|505780762|ref|XP_004603624.1| PREDICTED: histone deacetylase ...    73   7e-11   
gi|444323189|ref|XP_004182235.1| hypothetical protein TBLA_0I005...    73   7e-11   
gi|410897953|ref|XP_003962463.1| PREDICTED: histone deacetylase ...    73   7e-11   
gi|47219554|emb|CAG09908.1| unnamed protein product [Tetraodon n...    73   8e-11   
gi|402853779|ref|XP_003891567.1| PREDICTED: histone deacetylase ...    73   8e-11   
gi|499031815|ref|XP_004566615.1| PREDICTED: probable histone dea...    73   8e-11   
gi|499031813|ref|XP_004566614.1| PREDICTED: probable histone dea...    73   8e-11   
gi|410966695|ref|XP_003989865.1| PREDICTED: histone deacetylase ...    73   8e-11   
gi|19526271|gb|AAL89665.1|AF411956_6 histone deacetylase [Takifu...    73   8e-11   
gi|348517417|ref|XP_003446230.1| PREDICTED: probable histone dea...    73   8e-11   
gi|511832641|ref|XP_004740973.1| PREDICTED: histone deacetylase ...    73   9e-11   
gi|385302784|gb|EIF46896.1| histone deacetylase [Dekkera bruxell...    73   9e-11   
gi|410730429|ref|XP_003671394.2| hypothetical protein NDAI_0G037...    73   9e-11   
gi|126134313|ref|XP_001383681.1| hypothetical protein PICST_5781...    73   9e-11   
gi|511832643|ref|XP_004740974.1| PREDICTED: histone deacetylase ...    73   1e-10   
gi|73949981|ref|XP_544435.2| PREDICTED: histone deacetylase 1 is...    73   1e-10   
gi|301773006|ref|XP_002921911.1| PREDICTED: histone deacetylase ...    73   1e-10   


>gi|328770569|gb|EGF80610.1| hypothetical protein BATDEDRAFT_24371 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 560

 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 76/113 (67%), Gaps = 3/113 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           LSE+LPYN++ +Y+GP ++L+VP+ NMENMN+  YL  MK K+ ENLR++ FAPSVQ+ Q
Sbjct: 330 LSEELPYNDYFQYFGPSFRLEVPSTNMENMNSREYLNRMKTKILENLRHLNFAPSVQIHQ 389

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGN-RRNERNY 110
           V                 D R++Q+  +   VP+NE SDSEDEG+ RRNER Y
Sbjct: 390 VPHDTYSSEDEEDENDAKDHRITQKMSDKRFVPDNERSDSEDEGDGRRNERLY 442



>gi|511005620|gb|EPB86954.1| histone deacetylase 1/2 [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 740

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 72/122 (59%), Gaps = 10/122 (8%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +  D+PYN++ EY+GP+YKLDV  +NMENMNTP YL  +K +VFENL    FAPSVQMQ+
Sbjct: 322 MGPDMPYNDYYEYFGPDYKLDVRPSNMENMNTPDYLEKIKTQVFENLSRTLFAPSVQMQE 381

Query: 61  VXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG---------NRRNERNYN 111
           V               D RM Q   +  ++PENE  DS DEG           ++ERNYN
Sbjct: 382 VPRDHDMSEDEDEQDPDNRMGQNYWDRRIMPENEYYDS-DEGEAQGAGGNLKSKHERNYN 440

Query: 112 SN 113
            +
Sbjct: 441 DD 442



>gi|91079762|ref|XP_966633.1| PREDICTED: similar to histone deacetylase [Tribolium castaneum]
 gi|270003320|gb|EEZ99767.1| hypothetical protein TcasGA2_TC002540 [Tribolium castaneum]
          Length = 490

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 71/119 (59%), Gaps = 4/119 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 324 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLDKIKTRLFENLRMLPHAPGVQVQA 383

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
           +                 D R+ Q+  +  +VPENE SDSED  EG RR+ R Y    R
Sbjct: 384 IPEDAINEESDGEEKVDKDERLPQKDLDKRIVPENEFSDSEDEGEGGRRDNRTYKGRKR 442



>gi|388580110|gb|EIM20427.1| histone deacetylase [Wallemia sebi CBS 633.66]
          Length = 475

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (58%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLP+N++L+YYGP YKLDVP  NMEN NTP YL D++ KVFE+L+ +PFAPS Q+++
Sbjct: 295 LEEDLPFNDYLDYYGPRYKLDVPETNMENHNTPEYLHDIQTKVFEHLKELPFAPSAQIRE 354

Query: 61  VXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGNRRNERNYNSNGRESSSR 120
           V               D R+S+   N    PE E  D +     R+ R    N  ++ S+
Sbjct: 355 VPSDPWPYSDQSDDELDERISKAANNIYDEPEMEEDDYQSTYKNRSNRINGRNRTQNFSK 414

Query: 121 KSR 123
           K R
Sbjct: 415 KKR 417



>gi|321463880|gb|EFX74892.1| putative histone deacetylase Rpd3 protein [Daphnia pulex]
          Length = 538

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 74/119 (62%), Gaps = 3/119 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQMQ 
Sbjct: 325 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLDKIKTRLFENLRMLPHAPGVQMQA 384

Query: 61  VXXXXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSEDEGN-RRNERNYNSNGRE 116
           +                 D R+S R  +  + P+NE SDSEDEG+ RR++R++    R+
Sbjct: 385 IPEDAINEDSDEEDKSNPDERISIRASDKRIAPDNEYSDSEDEGDSRRDQRSFKGANRK 443



>gi|340373564|ref|XP_003385311.1| PREDICTED: histone deacetylase 1-like [Amphimedon queenslandica]
          Length = 539

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 74/122 (60%), Gaps = 5/122 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +   NM N N+P YL  +K K+FENLR IP APSVQMQ 
Sbjct: 325 VANELPYNDYFEYFGPDFKLHISPTNMTNQNSPEYLEKIKVKLFENLRLIPAAPSVQMQP 384

Query: 61  VXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG-NRRNERNYNSNGRESSS 119
           +               + R+S R R+  V  ++E SDSEDEG NRR+ R      +E S 
Sbjct: 385 IPEDAITFPEPEEKNPEERISIRDRDKRVERDDEFSDSEDEGDNRRDTR----TSKEPSG 440

Query: 120 RK 121
           RK
Sbjct: 441 RK 442



>gi|170042097|ref|XP_001848775.1| histone deacetylase Rpd3 [Culex quinquefasciatus]
 gi|167865633|gb|EDS29016.1| histone deacetylase Rpd3 [Culex quinquefasciatus]
          Length = 489

 Score = 97.1 bits (240), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 4/120 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKIKNRLFENLRMLPHAPGVQVQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VP+NE SDSED  EG RR+ R+Y    R+
Sbjct: 382 IPEDAVNDESEDEDKVDKDERLPQTDKDKRIVPDNEFSDSEDEGEGGRRDNRSYKGGARK 441



>gi|309400439|gb|ADO79638.1| histone deacetylase [Drosophila nasuta]
          Length = 518

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 70/116 (60%), Gaps = 4/116 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNS 112
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ RNY  
Sbjct: 382 IPEDAINDESEDDEKVDKDERLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRNYKG 437



>gi|309400433|gb|ADO79635.1| histone deacetylase [Drosophila nasuta]
          Length = 518

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ RNY
Sbjct: 382 IPEDAINDESEDDEKVDKDERLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRNY 435



>gi|309400427|gb|ADO79632.1| histone deacetylase [Drosophila albomicans]
 gi|309400429|gb|ADO79633.1| histone deacetylase [Drosophila nasuta]
 gi|309400431|gb|ADO79634.1| histone deacetylase [Drosophila nasuta]
 gi|309400435|gb|ADO79636.1| histone deacetylase [Drosophila nasuta]
 gi|309400437|gb|ADO79637.1| histone deacetylase [Drosophila nasuta]
          Length = 518

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ RNY
Sbjct: 382 IPEDAINDESEDDEKVDKDERLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRNY 435



>gi|312371802|gb|EFR19897.1| hypothetical protein AND_21626 [Anopheles darlingi]
          Length = 485

 Score = 96.3 bits (238), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 76/125 (60%), Gaps = 7/125 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 295 IANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKIKNRLFENLRMLPHAPGVQVQA 354

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q+ ++  +VP+NE SDSED  EG RR+ R++   G+ 
Sbjct: 355 IPEDAVNEESEDEDKVDKDERLPQQDKDKRIVPDNEFSDSEDEGEGGRRDNRSFKGQGQ- 413

Query: 117 SSSRK 121
             SRK
Sbjct: 414 --SRK 416



>gi|195402899|ref|XP_002060037.1| GJ15512 [Drosophila virilis]
 gi|194141835|gb|EDW58248.1| GJ15512 [Drosophila virilis]
          Length = 527

 Score = 96.3 bits (238), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K+++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTAEYLEKIKSRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG--NRRNERNY 110
           +                 D R+ Q  ++  +VPENE SDSEDEG   RR+ R Y
Sbjct: 382 IPEDAINDESEDEDKVDKDERLPQSDKDKRIVPENEYSDSEDEGEAGRRDNRTY 435



>gi|195125223|ref|XP_002007081.1| GI12742 [Drosophila mojavensis]
 gi|193918690|gb|EDW17557.1| GI12742 [Drosophila mojavensis]
          Length = 525

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 70/116 (60%), Gaps = 4/116 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K K+F+NLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTAEYLEKIKNKLFDNLRLLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNS 112
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ RNY  
Sbjct: 382 IPEDAINDESEDEDKVDKDERLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRNYKG 437



>gi|157106706|ref|XP_001649445.1| histone deacetylase [Aedes aegypti]
 gi|108879776|gb|EAT44001.1| AAEL004586-PB [Aedes aegypti]
          Length = 487

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 4/120 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKIKNRLFENLRMLPHAPGVQVQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VP+NE SDSED  EG RR+ R+Y    R+
Sbjct: 382 IPEDAVNEESDDEDKVDKDERLPQADKDKRIVPDNEFSDSEDEGEGGRRDNRSYKGGARK 441



>gi|332375094|gb|AEE62688.1| unknown [Dendroctonus ponderosae]
 gi|478253199|gb|ENN73570.1| hypothetical protein YQE_09818, partial [Dendroctonus ponderosae]
          Length = 473

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 4/119 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 324 IANELPYNDYFEYFGPDFKLHISPSNMANQNTQEYLEKIKTRLFENLRMLPHAPGVQVQA 383

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
           +                 D R+ Q++ +  +VP+NE SDSED  EG RR+ R+Y +  R
Sbjct: 384 IPEDAINEESDNDDKADKDERLPQKELDKRIVPDNEFSDSEDEGEGGRRDNRSYKNRKR 442



>gi|478253198|gb|ENN73569.1| hypothetical protein YQE_09818, partial [Dendroctonus ponderosae]
          Length = 482

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 73/119 (61%), Gaps = 4/119 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 324 IANELPYNDYFEYFGPDFKLHISPSNMANQNTQEYLEKIKTRLFENLRMLPHAPGVQVQA 383

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
           +                 D R+ Q++ +  +VP+NE SDSED  EG RR+ R+Y +  R
Sbjct: 384 IPEDAINEESDNDDKADKDERLPQKELDKRIVPDNEFSDSEDEGEGGRRDNRSYKNRKR 442



>gi|196008889|ref|XP_002114310.1| hypothetical protein TRIADDRAFT_64072 [Trichoplax adhaerens]
 gi|190583329|gb|EDV23400.1| hypothetical protein TRIADDRAFT_64072 [Trichoplax adhaerens]
          Length = 565

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 66/110 (60%), Gaps = 2/110 (1%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL++   NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 298 ELPYNDYFEYFGPDFKLNISPTNMTNQNTPDYIDRIKTRLFENLRMLPHAPGVQMQPIPS 357

Query: 64  XXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYN 111
                        D R+S   ++  +  + E SDSED  EG RRN + Y+
Sbjct: 358 DVQYESDEEENDPDTRISMHDKDKRIACDEEYSDSEDENEGGRRNRQEYH 407



>gi|195011655|ref|XP_001983253.1| GH15691 [Drosophila grimshawi]
 gi|193896735|gb|EDV95601.1| GH15691 [Drosophila grimshawi]
          Length = 559

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K+++FENLR +P AP VQ+  
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKSRLFENLRMLPHAPGVQITA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ RNY
Sbjct: 382 IPEDAINDESDDDEKVDKDERLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRNY 435



>gi|157106708|ref|XP_001649446.1| histone deacetylase [Aedes aegypti]
 gi|108879777|gb|EAT44002.1| AAEL004586-PA [Aedes aegypti]
          Length = 468

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 4/120 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKIKNRLFENLRMLPHAPGVQVQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VP+NE SDSED  EG RR+ R+Y    R+
Sbjct: 382 IPEDAVNEESDDEDKVDKDERLPQADKDKRIVPDNEFSDSEDEGEGGRRDNRSYKGGARK 441



>gi|384494644|gb|EIE85135.1| histone deacetylase RPD3 [Rhizopus delemar RA 99-880]
          Length = 502

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 69/116 (59%), Gaps = 10/116 (8%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           ++PYN++ EY+GP+YKLDV  +NMEN+NTP YL  +K +VFENL    FAPSVQMQ+V  
Sbjct: 240 EMPYNDYYEYFGPDYKLDVRPSNMENLNTPDYLEKIKTQVFENLSRTLFAPSVQMQEVPR 299

Query: 64  XXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGNRR---------NERNY 110
                        D R SQ   +  +VP+NE  DS DEG  +         +ERNY
Sbjct: 300 DMDMSEDEDEQDADDRYSQNFWDRRIVPDNEYYDS-DEGEAQGTMENIKSGHERNY 354



>gi|309400441|gb|ADO79639.1| histone deacetylase [Drosophila nasuta]
          Length = 518

 Score = 94.0 bits (232), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNS 112
           +                 D R+ Q  ++  +VPENE SDSED  EG  R+ RNY  
Sbjct: 382 IPEDAINDESEDDEKVDKDERLPQSDKDKRIVPENEYSDSEDEGEGGGRDNRNYKG 437



>gi|2583090|gb|AAC23917.1| putative histone deacetylase HDAC1 [Drosophila melanogaster]
          Length = 522

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 323 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMVPHAPGVQIQA 382

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R+Y    + 
Sbjct: 383 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKR 442

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 443 PRLDKDTNSNKASS 456



>gi|1666637|emb|CAA70455.1| histone deacetylase [Drosophila melanogaster]
          Length = 520

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 321 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 380

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R+Y    + 
Sbjct: 381 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKR 440

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 441 PRLDKDTNSNKASS 454



>gi|194747495|ref|XP_001956187.1| GF25085 [Drosophila ananassae]
 gi|190623469|gb|EDV38993.1| GF25085 [Drosophila ananassae]
          Length = 525

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQS 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R Y    + 
Sbjct: 382 IPEDAINDESEDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRTYKGQRKR 441

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 442 PRLDKDTNSNKASS 455



>gi|388582081|gb|EIM22387.1| histone deacetylase [Wallemia sebi CBS 633.66]
          Length = 448

 Score = 93.6 bits (231), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 74/117 (63%), Gaps = 8/117 (6%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           LS  LP   +++Y+GP YKLDVP++NME++NT AYL+++K+ +FENLR+  FAPSVQMQ 
Sbjct: 326 LSPTLPTTEYIDYFGPSYKLDVPSSNMEDLNTSAYLSNLKSAIFENLRDKDFAPSVQMQP 385

Query: 61  VXXXXXXXXXXXXXXXDI-----RMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
           +               D+     R  QR  +  +  ++E SDSED  EG RRNE++Y
Sbjct: 386 I-PRMNHDDDDDNKREDLDDPNERRPQRLWDKTIQRDDEFSDSEDEGEGGRRNEQSY 441



>gi|3659524|gb|AAC61494.1| putative histone deacetylase [Drosophila melanogaster]
          Length = 521

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R+Y    + 
Sbjct: 382 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKR 441

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 442 PRLDKDTNSNKASS 455



>gi|24657891|ref|NP_647918.2| Rpd3 [Drosophila melanogaster]
 gi|68068071|sp|Q94517.2|HDAC1_DROME RecName: Full=Histone deacetylase Rpd3; Short=HD; Short=dRPD3
 gi|7292522|gb|AAF47924.1| Rpd3 [Drosophila melanogaster]
 gi|16197909|gb|AAL13716.1| GM14158p [Drosophila melanogaster]
 gi|220944798|gb|ACL84942.1| Rpd3-PA [synthetic construct]
 gi|220954578|gb|ACL89832.1| Rpd3-PA [synthetic construct]
          Length = 521

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R+Y    + 
Sbjct: 382 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKR 441

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 442 PRLDKDTNSNKASS 455



>gi|195491828|ref|XP_002093731.1| GE21462 [Drosophila yakuba]
 gi|194179832|gb|EDW93443.1| GE21462 [Drosophila yakuba]
          Length = 521

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R Y    + 
Sbjct: 382 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRTYKGQRKR 441

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 442 PRLDKDTNSNKASS 455



>gi|195587822|ref|XP_002083660.1| GD13856 [Drosophila simulans]
 gi|194195669|gb|EDX09245.1| GD13856 [Drosophila simulans]
          Length = 521

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R Y    + 
Sbjct: 382 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRTYKGQRKR 441

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 442 PRLDKDTNSNKASS 455



>gi|384875340|gb|AFI26262.1| Rpd3 [Drosophila melanogaster]
          Length = 521

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R+Y    + 
Sbjct: 382 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKR 441

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 442 PRLDKDTNSNKASS 455



>gi|194866666|ref|XP_001971925.1| GG15241 [Drosophila erecta]
 gi|195337515|ref|XP_002035374.1| GM14673 [Drosophila sechellia]
 gi|190653708|gb|EDV50951.1| GG15241 [Drosophila erecta]
 gi|194128467|gb|EDW50510.1| GM14673 [Drosophila sechellia]
          Length = 521

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R Y    + 
Sbjct: 382 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRTYKGQRKR 441

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 442 PRLDKDTNSNKASS 455



>gi|307215210|gb|EFN89982.1| Histone deacetylase Rpd3 [Harpegnathos saltator]
          Length = 498

 Score = 93.2 bits (230), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 72/121 (59%), Gaps = 5/121 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 329 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQA 388

Query: 61  VXXXXXXXXXXXXXXX---DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
           +                  D R+ QR  +  +  ENE SDSED  EG RR+ R++  + R
Sbjct: 389 IPEDGAVIEDSEAEDKINPDERLPQRDLDKRIQHENEYSDSEDEGEGGRRDNRSFKGSSR 448

Query: 116 E 116
           +
Sbjct: 449 K 449



>gi|330841173|ref|XP_003292577.1| hypothetical protein DICPUDRAFT_40779 [Dictyostelium purpureum]
 gi|325077173|gb|EGC30904.1| hypothetical protein DICPUDRAFT_40779 [Dictyostelium purpureum]
          Length = 473

 Score = 92.8 bits (229), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 52/119 (43%), Positives = 70/119 (58%), Gaps = 4/119 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L ++LPYN++LEYYGPEY+L +  NNMEN NT  YL  +K ++ ENLRN+  AP V    
Sbjct: 319 LQDELPYNDYLEYYGPEYRLHITPNNMENHNTKQYLEKLKIQLLENLRNLQHAPGVAHHD 378

Query: 61  V-XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGNRRNERNYNSNGRESS 118
           +                DIR+S+  R+  +    ELSDS+DE  RRNE N   +G E+S
Sbjct: 379 IPPDAYNYSDDEDDEDPDIRVSEADRDKRIAHAGELSDSDDEDGRRNEMN---HGLEAS 434



>gi|195189897|ref|XP_002029476.1| GL22005 [Drosophila persimilis]
 gi|194103185|gb|EDW25228.1| GL22005 [Drosophila persimilis]
          Length = 273

 Score = 92.8 bits (229), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN + EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 99  IANELPYNYYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 158

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R Y    + 
Sbjct: 159 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRAYKGQRKR 218

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 219 PRLDKDNNSNKASS 232



>gi|332020933|gb|EGI61327.1| Histone deacetylase Rpd3 [Acromyrmex echinatior]
          Length = 497

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 329 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLDKIKTRLFENLRMLPHAPGVQVQA 388

Query: 61  V---XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSN 113
           +                  D R+ QR+ +  +  ENE SDSED  EG RR+ R+Y  +
Sbjct: 389 IPEDGAVIEDSEAEEKTNPDDRLPQRELDKRMQHENEYSDSEDEGEGGRRDNRSYKGS 446



>gi|195429008|ref|XP_002062556.1| GK16595 [Drosophila willistoni]
 gi|194158641|gb|EDW73542.1| GK16595 [Drosophila willistoni]
          Length = 531

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R+Y
Sbjct: 382 IPEDAINDESEDDDKVDKDERLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSY 435



>gi|158295965|ref|XP_316539.2| AGAP006511-PA [Anopheles gambiae str. PEST]
 gi|157016285|gb|EAA11382.2| AGAP006511-PA [Anopheles gambiae str. PEST]
          Length = 470

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 4/114 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKIKNRLFENLRMLPHAPGVQVQP 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
           +                 D R+ Q+ ++  +VP+NE SDSED  EG RR+ R++
Sbjct: 382 IPEDAINDESEDEDKVDKDERLPQQDKDKRIVPDNEFSDSEDEGEGGRRDNRSF 435



>gi|307176124|gb|EFN65822.1| Histone deacetylase Rpd3 [Camponotus floridanus]
          Length = 494

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 70/118 (59%), Gaps = 5/118 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 324 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQA 383

Query: 61  VXXXXXXXXXXXXXXX---DIRMSQRQRNTLVVPENELSDSEDEGN--RRNERNYNSN 113
           +                  D R+ QR  +  +  ENE SDSEDEG   RR+ R+Y  +
Sbjct: 384 IPEDGAVIEDSEAEEKVNPDDRLPQRDLDKRMQHENEYSDSEDEGEGARRDNRSYKGS 441



>gi|268607740|ref|NP_001161325.1| Rpd3 histone deacetylase [Nasonia vitripennis]
          Length = 492

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 70/118 (59%), Gaps = 5/118 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 324 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQA 383

Query: 61  VXXXXXXXXXXXXXXX---DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSN 113
           +                  D R+ QR  +  +  ENE SDSED  EG RR+ R++  +
Sbjct: 384 IPEDGAVIEDSEADEKVNPDERLPQRDIDKRLQHENEFSDSEDEGEGGRRDNRSFKGS 441



>gi|195176220|ref|XP_002028716.1| GL22935 [Drosophila persimilis]
 gi|194111629|gb|EDW33672.1| GL22935 [Drosophila persimilis]
          Length = 530

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (58%), Gaps = 4/116 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN + EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNYYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNS 112
           +                 D R+ Q  ++  +VPENE SDSED  EG RR+ R Y  
Sbjct: 382 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRAYKG 437



>gi|512927856|ref|XP_004931440.1| PREDICTED: LOW QUALITY PROTEIN: histone deacetylase Rpd3-like
           [Bombyx mori]
          Length = 454

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 70/115 (60%), Gaps = 3/115 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 295 IANELPYNDYFEYFGPDFKLHISPSNMSNQNTPEYLEKIKNRLFENLRMLPHAPGVQVQA 354

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGN-RRNERNYNS 112
           +                 D R+ Q  ++  +  + ELSDSEDEG+ RR+ R Y +
Sbjct: 355 IPEDAVNDESDDEDKIAKDERLPQSDKDKRIANDGELSDSEDEGDGRRDNRAYRA 409



>gi|12963262|gb|AAK11183.1|AF321130_1 histone deacetylase 2 [Rattus norvegicus]
          Length = 174

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 67/117 (57%), Gaps = 4/117 (3%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXXX 64
           LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +   
Sbjct: 15  LPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPED 74

Query: 65  XXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                         D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 75  AVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 131



>gi|350400285|ref|XP_003485786.1| PREDICTED: histone deacetylase Rpd3-like [Bombus impatiens]
          Length = 492

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 70/118 (59%), Gaps = 5/118 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 324 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQP 383

Query: 61  VXXXXXXXXXXXXXXX---DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSN 113
           +                  D R+ QR  +  +  ENE SDSED  EG RR+ R++  +
Sbjct: 384 IPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQHENEYSDSEDEGEGGRRDNRSFKGS 441



>gi|198463008|ref|XP_001352649.2| GA20378 [Drosophila pseudoobscura pseudoobscura]
 gi|198151073|gb|EAL30147.2| GA20378 [Drosophila pseudoobscura pseudoobscura]
          Length = 530

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 75/134 (55%), Gaps = 4/134 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +                 D R+ Q  ++  +VPEN  SDSED  EG RR+ R Y    + 
Sbjct: 382 IPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENAYSDSEDEGEGGRRDNRAYKGQRKR 441

Query: 117 SSSRKSRASHKNSS 130
               K   S+K SS
Sbjct: 442 PRLDKDNNSNKASS 455



>gi|62087960|dbj|BAD92427.1| histone deacetylase 2 variant [Homo sapiens]
          Length = 238

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 78  ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 137

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 138 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 195



>gi|498931174|ref|XP_004519082.1| PREDICTED: histone deacetylase Rpd3-like [Ceratitis capitata]
          Length = 484

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 69/116 (59%), Gaps = 4/116 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQS 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNS 112
           +                 D R+ Q  ++  + P+NE SDSED  EG RR+ R+Y  
Sbjct: 382 IPEDAINDESEDEDKVNKDERIPQSDKDKRIDPDNEFSDSEDEGEGGRRDNRSYKG 437



>gi|209154690|gb|ACI33577.1| Histone deacetylase 2 [Salmo salar]
          Length = 468

 Score = 90.1 bits (222), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 66/112 (58%), Gaps = 4/112 (3%)

Query: 3   EDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVX 62
           ++LPYN++ EY+GP++KL +  +NM N NT  Y+  +K ++FENLR +P AP VQMQ V 
Sbjct: 328 DELPYNDYFEYFGPDFKLHISPSNMTNQNTLEYMDKIKQRLFENLRMLPHAPGVQMQTVP 387

Query: 63  XXXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
                           D RMS R  +  +  + E SDSED  EG RRNE N+
Sbjct: 388 EDAITDDTVDEDAEDPDKRMSIRASDKRIACDEEFSDSEDEGEGGRRNEANH 439



>gi|432107862|gb|ELK32919.1| Histone deacetylase 2 [Myotis davidii]
          Length = 415

 Score = 90.1 bits (222), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 255 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 314

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 315 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 372



>gi|470299839|ref|XP_004346729.1| histone deacetylase 2 [Capsaspora owczarzaki ATCC 30864]
 gi|320170201|gb|EFW47100.1| histone deacetylase 2 [Capsaspora owczarzaki ATCC 30864]
          Length = 552

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 75/126 (59%), Gaps = 1/126 (0%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++  LP+N++ EYY P++KL+V  +NMEN+NTP YL  +K  + E+LR++ FAP VQMQ+
Sbjct: 324 IATALPFNDYFEYYSPDFKLEVTPSNMENLNTPEYLETIKNALIESLRHVQFAPGVQMQE 383

Query: 61  VXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG-NRRNERNYNSNGRESSS 119
           +               D R+  R  +  V  ++ +SDSEDEG +RRN ++Y    ++ S 
Sbjct: 384 LRPVYDEDEDSDQEDPDERLPSRVSDKHVSYDDGMSDSEDEGDDRRNRQSYKKREKDDSH 443

Query: 120 RKSRAS 125
              R S
Sbjct: 444 ASRRMS 449



>gi|449680092|ref|XP_002162290.2| PREDICTED: probable histone deacetylase 1-B-like [Hydra
           magnipapillata]
          Length = 285

 Score = 89.7 bits (221), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 68/114 (59%), Gaps = 5/114 (4%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM+N NT  YL  +K +++ENLR IP AP VQM  +  
Sbjct: 79  ELPYNDYFEYFGPDFKLHIQPSNMQNQNTTDYLDKIKTRLYENLRMIPHAPGVQMAPIPE 138

Query: 62  --XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG-NRRNERNYNS 112
                            D R+S R  +  +V E E SDSEDEG  RR+E++Y +
Sbjct: 139 DGVHEESDDEEENAKSSDQRISIRASDKRIVNEAEYSDSEDEGEGRRDEKSYKT 192



>gi|384486542|gb|EIE78722.1| hypothetical protein RO3G_03427 [Rhizopus delemar RA 99-880]
          Length = 409

 Score = 89.7 bits (221), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 57/88 (64%), Gaps = 5/88 (5%)

Query: 3   EDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV- 61
           ++LPYNN+ EYYGPEYKLDVP+NNM N N+  YL  + AKV +NLR++PFAPSVQ Q+V 
Sbjct: 315 QELPYNNYFEYYGPEYKLDVPSNNMTNHNSRDYLERITAKVIDNLRSMPFAPSVQAQEVP 374

Query: 62  ----XXXXXXXXXXXXXXXDIRMSQRQR 85
                              DIR +QRQ+
Sbjct: 375 GDFNVDDYIEGEDSEAEEADIRRTQRQK 402



>gi|380012355|ref|XP_003690250.1| PREDICTED: histone deacetylase Rpd3-like, partial [Apis florea]
          Length = 486

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 70/118 (59%), Gaps = 5/118 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 318 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQS 377

Query: 61  VXXXXXXXXXXXXXXX---DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSN 113
           +                  D R+ QR  +  +  ENE SDSE+  EG RR+ R++  +
Sbjct: 378 IPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQHENEYSDSEEEGEGGRRDNRSFKGS 435



>gi|344248728|gb|EGW04832.1| Histone deacetylase 2 [Cricetulus griseus]
          Length = 458

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 298 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 357

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 358 DAVHEESGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 415



>gi|193783546|dbj|BAG53457.1| unnamed protein product [Homo sapiens]
          Length = 458

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 298 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 357

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 358 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 415



>gi|465796405|emb|CCV00661.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 492

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 51/61 (83%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           LS DLP+N +++Y+GPEYKLDVP  +M+N+NTP YL  ++ ++ +NLR++PFAPSVQMQ 
Sbjct: 328 LSSDLPFNEYIQYFGPEYKLDVPPTSMDNLNTPQYLDHVRTRIIDNLRSMPFAPSVQMQD 387

Query: 61  V 61
           V
Sbjct: 388 V 388



>gi|345778325|ref|XP_532270.3| PREDICTED: histone deacetylase 2 [Canis lupus familiaris]
 gi|410959878|ref|XP_003986525.1| PREDICTED: histone deacetylase 2 [Felis catus]
          Length = 458

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 298 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 357

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 358 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 415



>gi|340718122|ref|XP_003397521.1| PREDICTED: hypothetical protein LOC100642763 [Bombus terrestris]
          Length = 1431

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 69/115 (60%), Gaps = 5/115 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 324 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQP 383

Query: 61  V---XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
           +                  D R+ QR  +  +  ENE SDSED  EG RR+ R++
Sbjct: 384 IPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQHENEYSDSEDEGEGGRRDNRSF 438



>gi|164662701|ref|XP_001732472.1| hypothetical protein MGL_0247 [Malassezia globosa CBS 7966]
 gi|159106375|gb|EDP45258.1| hypothetical protein MGL_0247 [Malassezia globosa CBS 7966]
          Length = 484

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 67/112 (59%), Gaps = 9/112 (8%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  DLP+N++++Y+GPEYKLDVP+  M+N+NTP YL  ++ ++ +NLR++PFAPSVQMQ+
Sbjct: 328 LPVDLPFNDYIQYFGPEYKLDVPSTGMDNLNTPQYLDGLRTRIIDNLRSMPFAPSVQMQE 387

Query: 61  VXXXXXXXXXXX--------XXXXDIRMSQRQRNTLVVPENE-LSDSEDEGN 103
                                   D R+SQR R+       + LSD EDE N
Sbjct: 388 TPRTSLLSAAGADPDLSEDEDSDLDERISQRLRDRHTQAFGDVLSDDEDEPN 439



>gi|328788017|ref|XP_394976.4| PREDICTED: histone deacetylase Rpd3 isoform 1 [Apis mellifera]
          Length = 492

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 70/118 (59%), Gaps = 5/118 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 324 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQS 383

Query: 61  VXXXXXXXXXXXXXXX---DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSN 113
           +                  D R+ QR  +  +  ENE SDSE+  EG RR+ R++  +
Sbjct: 384 IPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQHENEYSDSEEEGEGGRRDNRSFKGS 441



>gi|397503309|ref|XP_003822268.1| PREDICTED: histone deacetylase 2 isoform 1 [Pan paniscus]
 gi|397503311|ref|XP_003822269.1| PREDICTED: histone deacetylase 2 isoform 2 [Pan paniscus]
 gi|426354308|ref|XP_004044608.1| PREDICTED: histone deacetylase 2 isoform 2 [Gorilla gorilla
           gorilla]
 gi|119568637|gb|EAW48252.1| histone deacetylase 2, isoform CRA_a [Homo sapiens]
 gi|119568638|gb|EAW48253.1| histone deacetylase 2, isoform CRA_a [Homo sapiens]
 gi|193787281|dbj|BAG52487.1| unnamed protein product [Homo sapiens]
          Length = 458

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 298 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 357

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 358 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 415



>gi|354482575|ref|XP_003503473.1| PREDICTED: histone deacetylase 2-like [Cricetulus griseus]
          Length = 476

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 316 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 375

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 376 DAVHEESGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 433



>gi|332213073|ref|XP_003255643.1| PREDICTED: histone deacetylase 2 isoform 2 [Nomascus leucogenys]
 gi|390461981|ref|XP_003732767.1| PREDICTED: histone deacetylase 2-like [Callithrix jacchus]
 gi|402868498|ref|XP_003898338.1| PREDICTED: histone deacetylase 2 isoform 2 [Papio anubis]
 gi|441601510|ref|XP_004087680.1| PREDICTED: histone deacetylase 2 [Nomascus leucogenys]
          Length = 458

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 298 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 357

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 358 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 415



>gi|348561437|ref|XP_003466519.1| PREDICTED: histone deacetylase 2-like [Cavia porcellus]
          Length = 552

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 392 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 451

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 452 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 509



>gi|507643174|ref|XP_004702067.1| PREDICTED: histone deacetylase 2 [Echinops telfairi]
          Length = 458

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 298 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 357

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 358 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 415



>gi|449272245|gb|EMC82256.1| Histone deacetylase 2, partial [Columba livia]
          Length = 477

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 317 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 376

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 377 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 434



>gi|444709097|gb|ELW50129.1| Histone deacetylase 2 [Tupaia chinensis]
          Length = 458

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 298 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 357

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 358 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 415



>gi|388851970|emb|CCF54326.1| probable histone deacetylase [Ustilago hordei]
          Length = 590

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (63%), Gaps = 6/108 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLP+N++++Y+GPEYKL+VP  +MEN+NT  YL +++ KV +NLR +P AP VQMQ+
Sbjct: 327 LDEDLPFNDYIQYFGPEYKLEVPRTSMENLNTREYLENLRIKVIDNLRQLPSAPGVQMQE 386

Query: 61  -----VXXXXXXXXXXXXXXXDIRMSQRQRNTLV-VPENELSDSEDEG 102
                +               D R+SQR R++ V   ++ELS  EDEG
Sbjct: 387 TPRTTLNPADVEVSDDGDSDLDERISQRLRDSHVQHWDDELSGDEDEG 434



>gi|355562127|gb|EHH18759.1| hypothetical protein EGK_15423 [Macaca mulatta]
          Length = 467

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|260799294|ref|XP_002594632.1| hypothetical protein BRAFLDRAFT_217516 [Branchiostoma floridae]
 gi|229279867|gb|EEN50643.1| hypothetical protein BRAFLDRAFT_217516 [Branchiostoma floridae]
          Length = 462

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 69/119 (57%), Gaps = 4/119 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EYYGP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQMQ 
Sbjct: 325 VANELPYNDYFEYYGPDFKLHISPSNMTNQNTPEYLEKIKQRLFENLRMLPHAPGVQMQA 384

Query: 61  VXXXXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
           +                 D R+S R ++  +  + E SDSED  EG RR+  ++    R
Sbjct: 385 IPEDAIDQESEDNEEEDPDKRVSIRAQDKRITCDEEFSDSEDEGEGGRRDHHSHKKRKR 443



>gi|326916047|ref|XP_003204323.1| PREDICTED: histone deacetylase 2-like [Meleagris gallopavo]
          Length = 539

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 379 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 438

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 439 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 496



>gi|512905204|ref|XP_004900565.1| PREDICTED: histone deacetylase 2-like [Heterocephalus glaber]
          Length = 490

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 330 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 389

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 390 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 447



>gi|338710739|ref|XP_001916752.2| PREDICTED: histone deacetylase 2-like [Equus caballus]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|344264495|ref|XP_003404327.1| PREDICTED: LOW QUALITY PROTEIN: histone deacetylase 2-like
           [Loxodonta africana]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|60654411|gb|AAX29896.1| histone deacetylase 2 [synthetic construct]
          Length = 489

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|507706424|ref|XP_004645947.1| PREDICTED: histone deacetylase 2-like [Octodon degus]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|171846760|gb|AAI61939.1| Hdac2 protein [Rattus norvegicus]
          Length = 546

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 386 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 445

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 446 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 503



>gi|301774829|ref|XP_002922834.1| PREDICTED: histone deacetylase 2-like [Ailuropoda melanoleuca]
 gi|471363967|ref|XP_004372537.1| PREDICTED: histone deacetylase 2 [Trichechus manatus latirostris]
 gi|472356774|ref|XP_004398023.1| PREDICTED: histone deacetylase 2 [Odobenus rosmarus divergens]
 gi|511862282|ref|XP_004753600.1| PREDICTED: histone deacetylase 2 [Mustela putorius furo]
 gi|511930629|ref|XP_004784354.1| PREDICTED: histone deacetylase 2 [Mustela putorius furo]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|513015605|ref|XP_004869140.1| PREDICTED: histone deacetylase 2 [Heterocephalus glaber]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|465979268|ref|XP_004264753.1| PREDICTED: histone deacetylase 2 [Orcinus orca]
 gi|478495901|ref|XP_004422291.1| PREDICTED: histone deacetylase 2 [Ceratotherium simum simum]
 gi|507553834|ref|XP_004660703.1| PREDICTED: histone deacetylase 2 [Jaculus jaculus]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|45382275|ref|NP_990162.1| histone deacetylase 2 [Gallus gallus]
 gi|3023931|sp|P56519.1|HDAC2_CHICK RecName: Full=Histone deacetylase 2; Short=HD2
 gi|2791686|gb|AAB96924.1| histone deacetylase-2 [Gallus gallus]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|402868496|ref|XP_003898337.1| PREDICTED: histone deacetylase 2 isoform 1 [Papio anubis]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|335279374|ref|XP_001925353.2| PREDICTED: histone deacetylase 2-like [Sus scrofa]
 gi|507925152|ref|XP_004673842.1| PREDICTED: histone deacetylase 2 [Condylura cristata]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|332027663|gb|EGI67731.1| Histone deacetylase Rpd3 [Acromyrmex echinatior]
          Length = 495

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 69/118 (58%), Gaps = 5/118 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 323 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLDKIKTRLFENLRMLPHAPGVQVQA 382

Query: 61  V---XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSN 113
           +                  D R+ QR  +  +  ENE SDSED  EG RR+ R+Y  +
Sbjct: 383 IPEDGAVIEDSEIEEKMNLDERLPQRDLDKRIQHENEYSDSEDEGEGGRRDNRSYKGS 440



>gi|224048285|ref|XP_002192530.1| PREDICTED: histone deacetylase 2 [Taeniopygia guttata]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|126310452|ref|XP_001368989.1| PREDICTED: histone deacetylase 2-like [Monodelphis domestica]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|115495423|ref|NP_001068614.1| histone deacetylase 2 [Bos taurus]
 gi|111305328|gb|AAI20420.1| Histone deacetylase 2 [Bos taurus]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVTDHKKGAKKA 445



>gi|293336691|ref|NP_001518.3| histone deacetylase 2 [Homo sapiens]
 gi|426354306|ref|XP_004044607.1| PREDICTED: histone deacetylase 2 isoform 1 [Gorilla gorilla
           gorilla]
 gi|68068066|sp|Q92769.2|HDAC2_HUMAN RecName: Full=Histone deacetylase 2; Short=HD2
 gi|119568639|gb|EAW48254.1| histone deacetylase 2, isoform CRA_b [Homo sapiens]
 gi|119568640|gb|EAW48255.1| histone deacetylase 2, isoform CRA_b [Homo sapiens]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|66828287|ref|XP_647498.1| histone deacetylase family protein [Dictyostelium discoideum AX4]
 gi|74859297|sp|Q55FN5.1|HDA11_DICDI RecName: Full=Type-1 histone deacetylase 1; Short=DdHdaA
 gi|60475530|gb|EAL73465.1| histone deacetylase family protein [Dictyostelium discoideum AX4]
          Length = 495

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 5/124 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L ++LPYN++LEYYGPEY+L +  NNMEN NT  YL  +K ++ ENLRN+  AP+     
Sbjct: 319 LKDELPYNDYLEYYGPEYRLHITPNNMENQNTKDYLEKLKIQLLENLRNLNHAPAAAHHD 378

Query: 61  V-XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGNRRNERNYNSNGRESSS 119
           +                D+R+S+  R+  V  + ELSDS++E  RRN     SNG E++S
Sbjct: 379 IPPDSFNYSDDEDDEDPDVRISEADRDKKVHHQGELSDSDEEDGRRNY----SNGLEATS 434

Query: 120 RKSR 123
              R
Sbjct: 435 TSRR 438



>gi|71051977|gb|AAH31055.2| HDAC2 protein, partial [Homo sapiens]
          Length = 571

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 411 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 470

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 471 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 528



>gi|426234509|ref|XP_004011238.1| PREDICTED: histone deacetylase 2 [Ovis aries]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVTDHKKGAKKA 445



>gi|1667394|gb|AAC50814.1| transcriptional regulator homolog RPD3 [Homo sapiens]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|53749670|ref|NP_001005432.1| histone deacetylase 2 [Xenopus (Silurana) tropicalis]
 gi|49257716|gb|AAH74509.1| histone deacetylase 2 [Xenopus (Silurana) tropicalis]
          Length = 488

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVQEDSGDEEGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|74185170|dbj|BAE22585.1| unnamed protein product [Mus musculus]
          Length = 285

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 166 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 225

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 226 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 283



>gi|327261622|ref|XP_003215628.1| PREDICTED: histone deacetylase 2-like [Anolis carolinensis]
          Length = 488

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 69/118 (58%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++  + +++
Sbjct: 388 DAVHEDSGDEDAEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNIADHKKSAKKA 445



>gi|431838729|gb|ELK00659.1| Histone deacetylase 2 [Pteropus alecto]
          Length = 479

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|3023934|sp|P70288.1|HDAC2_MOUSE RecName: Full=Histone deacetylase 2; Short=HD2; AltName: Full=YY1
           transcription factor-binding protein
 gi|1667396|gb|AAC52889.1| transcriptional regulator homolog RPD3 [Mus musculus]
          Length = 488

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|488515061|ref|XP_004449541.1| PREDICTED: histone deacetylase 2 [Dasypus novemcinctus]
          Length = 488

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|89268122|emb|CAJ81536.1| histone deacetylase 2 [Xenopus (Silurana) tropicalis]
          Length = 488

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVQEDSGDEEGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|87162464|ref|NP_032255.2| histone deacetylase 2 [Mus musculus]
 gi|148672950|gb|EDL04897.1| histone deacetylase 2 [Mus musculus]
 gi|187951079|gb|AAI38518.1| Histone deacetylase 2 [Mus musculus]
          Length = 488

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|395534795|ref|XP_003769422.1| PREDICTED: histone deacetylase 2 [Sarcophilus harrisii]
          Length = 484

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 324 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 383

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 384 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 441



>gi|147901906|ref|NP_001084011.1| histone deacetylase 2 [Xenopus laevis]
 gi|51703484|gb|AAH81054.1| Hdac2 protein [Xenopus laevis]
          Length = 488

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVQEDSGDEEGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|208022663|ref|NP_445899.1| histone deacetylase 2 [Rattus norvegicus]
 gi|149032950|gb|EDL87791.1| histone deacetylase 2 [Rattus norvegicus]
          Length = 488

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|148922187|gb|AAI46377.1| Histone deacetylase 2 [synthetic construct]
 gi|151556584|gb|AAI48798.1| Histone deacetylase 2 [synthetic construct]
          Length = 582

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 422 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 481

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 482 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 539



>gi|351710106|gb|EHB13025.1| Histone deacetylase 2 [Heterocephalus glaber]
          Length = 431

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 299 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 358

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 359 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 416



>gi|194384520|dbj|BAG59420.1| unnamed protein product [Homo sapiens]
          Length = 582

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 422 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 481

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 482 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 539



>gi|114608973|ref|XP_518700.2| PREDICTED: histone deacetylase 2 isoform 2 [Pan troglodytes]
          Length = 581

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 421 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 480

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 481 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 538



>gi|332213071|ref|XP_003255642.1| PREDICTED: histone deacetylase 2 isoform 1 [Nomascus leucogenys]
          Length = 579

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 419 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 478

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 479 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 536



>gi|383864165|ref|XP_003707550.1| PREDICTED: histone deacetylase Rpd3-like [Megachile rotundata]
          Length = 492

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 70/118 (59%), Gaps = 5/118 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 324 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQP 383

Query: 61  VXXXXXXXXXXXXXXX---DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSN 113
           +                  D R+ QR  +  +  ENE SDSE+  EG RR+ R++  +
Sbjct: 384 IPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQHENEYSDSEEEGEGGRRDNRSFKGS 441



>gi|149430741|ref|XP_001521848.1| PREDICTED: histone deacetylase 2-like, partial [Ornithorhynchus
           anatinus]
          Length = 455

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 324 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 383

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 384 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 441



>gi|483525083|gb|EOB08826.1| Histone deacetylase 2, partial [Anas platyrhynchos]
          Length = 450

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 319 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 378

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 379 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 436



>gi|241626601|ref|XP_002407932.1| histone deacetylase 1, 2 ,3, putative [Ixodes scapularis]
 gi|215501103|gb|EEC10597.1| histone deacetylase 1, 2 ,3, putative [Ixodes scapularis]
          Length = 484

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 67/114 (58%), Gaps = 4/114 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  ++ ++FENLR +P AP VQMQ 
Sbjct: 288 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIRTRLFENLRMLPHAPGVQMQP 347

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
           +                 D R+S R     V  + E SDSED  EG RR+ R++
Sbjct: 348 IPEDAMDQESEDEDKVNSDERISIRASEKRVACDEEFSDSEDEGEGGRRDNRSH 401



>gi|505754937|gb|EOQ99225.1| Histone deacetylase clr6 [Wallemia ichthyophaga EXF-994]
          Length = 513

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 51/61 (83%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLP+N++L+YYGP YKL+VP  NMEN NT  YL D++ KVF++L ++PFAPSVQM++
Sbjct: 325 LEEDLPFNDYLDYYGPRYKLEVPETNMENHNTREYLDDIQQKVFDHLNHLPFAPSVQMRE 384

Query: 61  V 61
           V
Sbjct: 385 V 385



>gi|465989351|gb|EMP38066.1| Histone deacetylase 2, partial [Chelonia mydas]
          Length = 446

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 316 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 375

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 376 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 433



>gi|281340052|gb|EFB15636.1| hypothetical protein PANDA_011849 [Ailuropoda melanoleuca]
          Length = 551

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 421 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 480

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 481 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 538



>gi|296484177|tpg|DAA26292.1| TPA: histone deacetylase 2 [Bos taurus]
          Length = 458

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 68/118 (57%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVTDHKKGAKKA 445



>gi|291244267|ref|XP_002742021.1| PREDICTED: histone deacetylase 1-like [Saccoglossus kowalevskii]
          Length = 569

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K +++ENLR IP AP VQM  
Sbjct: 326 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLYENLRMIPHAPGVQMHP 385

Query: 61  V----XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGNRRNE 107
           +                   D R+S R  +  +  + E SDSEDEG+ R +
Sbjct: 386 IPEDPIAADSEGEEEEEEDNDKRISIRASDKRIACDEEFSDSEDEGDGRRD 436



>gi|27545221|ref|NP_775343.1| histone deacetylase 1 [Danio rerio]
 gi|21105403|gb|AAM34645.1|AF506201_1 histone deaceytlase 1 [Danio rerio]
          Length = 480

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 63/110 (57%), Gaps = 3/110 (2%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-X 62
           +LPYN++ EY+GP++KL +   NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPFNMTNQNTNDYLEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 63  XXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDE--GNRRNERNY 110
                         D R+S R  +  +  + E SDSEDE  G RRN  NY
Sbjct: 388 DAVQEDSGDEEDDPDKRISIRAHDKRIACDEEFSDSEDEGQGGRRNAANY 437



>gi|358057427|dbj|GAA96776.1| hypothetical protein E5Q_03447 [Mixia osmundae IAM 14324]
          Length = 490

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 73/129 (56%), Gaps = 10/129 (7%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  ++P N + EY+GP Y+LDVPA NME++NT  YL  +KA+VFENLR+   APSVQ   
Sbjct: 328 LGSEIPMNEYYEYFGPTYRLDVPATNMEDLNTREYLEKIKAQVFENLRHTAHAPSVQSHS 387

Query: 61  ---VXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG-------NRRNERNY 110
              +               + R  QR  + +V  +NE  DS+DEG       +R++  N 
Sbjct: 388 TPTMPIDLDDDVDEDLDDPEERKPQRLMDAMVEKDNEFEDSDDEGQGVGPRKDRQSHANG 447

Query: 111 NSNGRESSS 119
           +SNG+ S++
Sbjct: 448 DSNGKPSTT 456



>gi|511009552|gb|EPB90793.1| histone deacetylase clr6 [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 418

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 49/59 (83%)

Query: 3   EDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           E+LPYNN+ EYYGPEYKL+VP+NNM N NT  YL  + +K+ +NLR++PFAPSVQ Q+V
Sbjct: 329 EELPYNNYFEYYGPEYKLEVPSNNMTNHNTREYLDHIISKIVDNLRSMPFAPSVQTQEV 387



>gi|281206669|gb|EFA80855.1| WD40 repeat-containing protein [Polysphondylium pallidum PN500]
          Length = 2068

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (58%), Gaps = 5/126 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           LS++LPYN++LEY+GP+Y+L +  NNMEN N+  YL  +K ++ ENLR++  APS+    
Sbjct: 319 LSDELPYNDYLEYFGPDYRLHITPNNMENQNSKDYLEKLKIQILENLRHLNHAPSIAHHD 378

Query: 61  V-XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGNRRNERNYNSNGRESSS 119
           +                D+R+S+ +R+  V    ELSDSE+E  RRNE     NG E +S
Sbjct: 379 IPPDAFNDSEDEDDEDPDVRISEAERDRRVQNAAELSDSEEEDGRRNEM----NGLEMTS 434

Query: 120 RKSRAS 125
              R S
Sbjct: 435 TSKRRS 440



>gi|213402171|ref|XP_002171858.1| histone deacetylase clr6 [Schizosaccharomyces japonicus yFS275]
 gi|211999905|gb|EEB05565.1| histone deacetylase clr6 [Schizosaccharomyces japonicus yFS275]
          Length = 405

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/61 (65%), Positives = 50/61 (81%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLPYN++L+Y+GP+YKL+V ANNMEN N+  YL  + A+V +NLRNI FAPSVQMQ 
Sbjct: 321 LPEDLPYNDYLQYFGPDYKLNVLANNMENHNSRQYLDSIIAEVVDNLRNISFAPSVQMQD 380

Query: 61  V 61
           V
Sbjct: 381 V 381



>gi|32450592|gb|AAH54208.1| Hdac2 protein, partial [Xenopus laevis]
          Length = 447

 Score = 87.4 bits (215), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (58%), Gaps = 4/107 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRN 106
                          D R+S R  +  +  + E SDSED  EG RRN
Sbjct: 388 DAVQEDSGDEEGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRN 434



>gi|357620335|gb|EHJ72565.1| histone deacetylase Rpd3 [Danaus plexippus]
          Length = 481

 Score = 87.0 bits (214), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 70/118 (59%), Gaps = 6/118 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 322 IANELPYNDYFEYFGPDFKLHISPSNMSNQNTLEYLEKIKNRLFENLRMLPHAPGVQVQA 381

Query: 61  V--XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG----NRRNERNYNS 112
           +                 D R+ Q +++  +  + ELSDSEDEG     RR+ R+Y +
Sbjct: 382 IPEDAVNDESEDEDKVDKDERLPQSEKDKRITNDGELSDSEDEGRDGDGRRDNRSYRA 439



>gi|55716026|gb|AAH85375.1| Histone deacetylase 1 [Danio rerio]
 gi|182892182|gb|AAI65208.1| Hdac1 protein [Danio rerio]
          Length = 480

 Score = 87.0 bits (214), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 64/110 (58%), Gaps = 3/110 (2%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-X 62
           +LPY+++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYSDYFEYFGPDFKLHISPSNMTNQNTNDYLEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 63  XXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDE--GNRRNERNY 110
                         D R+S R  +  +  + E SDSEDE  G RRN  NY
Sbjct: 388 DAVQEDSGDEEDDPDKRISIRAHDKRIACDEEFSDSEDEGQGGRRNAANY 437



>gi|471561598|gb|EMR63332.1| putative histone deacetylase rpd3 protein [Eutypa lata UCREL1]
          Length = 671

 Score = 86.7 bits (213), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 73/140 (52%), Gaps = 18/140 (12%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXXX 64
           LP+N + EYYGP+Y LDV ++NMEN N+P YL  +K ++ ENLR    APSVQMQ V   
Sbjct: 343 LPFNEYYEYYGPDYTLDVRSSNMENANSPEYLEKIKIQLIENLRRTAHAPSVQMQDVPRH 402

Query: 65  XXXXXXXXXXX----------XDIRMSQRQRNTLVVPENELSDSEDEGNRRNERNYNSNG 114
                                 D+RM+QRQ    + PENE  +S+      NE    +NG
Sbjct: 403 SMGAVSDEEDAELDDLDEDENKDVRMTQRQWEQRIEPENEYEESD------NEDMDKANG 456

Query: 115 --RESSSRKSRASHKNSSNE 132
             R  S+R +   ++NS  E
Sbjct: 457 ITRNGSTRPAFHDYRNSDIE 476



>gi|505792365|ref|XP_004606149.1| PREDICTED: histone deacetylase 2-like [Sorex araneus]
          Length = 357

 Score = 86.3 bits (212), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K  +FENLR +P AP VQMQ +  
Sbjct: 197 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQCLFENLRMLPHAPGVQMQAIPE 256

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S    +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 257 DAVHEDSGDEDGEDPDKRISIWASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 314



>gi|342321515|gb|EGU13448.1| Histone deacetylase [Rhodotorula glutinis ATCC 204091]
          Length = 586

 Score = 86.3 bits (212), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (60%), Gaps = 5/92 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +  DLP+N ++EY+GPE+KLDVP+NNM+N N+  YL  + A + E LRN+PFAPS Q+ Q
Sbjct: 349 MQRDLPFNEYIEYFGPEFKLDVPSNNMDNANSREYLDKIVASILEGLRNLPFAPSSQLHQ 408

Query: 61  VXX-----XXXXXXXXXXXXXDIRMSQRQRNT 87
           V                    D+R+S R R+T
Sbjct: 409 VGADLPPLSTDTTDDEADSDLDVRLSSRIRST 440



>gi|505791260|ref|XP_004605841.1| PREDICTED: histone deacetylase 2-like [Sorex araneus]
          Length = 450

 Score = 86.3 bits (212), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 60/101 (59%), Gaps = 2/101 (1%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSEDEG 102
                          D R+S R  +  +  + E SDSEDEG
Sbjct: 388 DAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEG 428



>gi|430811539|emb|CCJ31025.1| unnamed protein product, partial [Pneumocystis jirovecii]
          Length = 300

 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 52/61 (85%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L E++P+N++L+YYGPE+KL+VP+NNMEN N+ AYL ++ +KV +NLRNI  APSVQ+Q 
Sbjct: 228 LDENIPFNSYLDYYGPEFKLNVPSNNMENQNSRAYLENITSKVIDNLRNISHAPSVQIQH 287

Query: 61  V 61
           +
Sbjct: 288 I 288



>gi|443897234|dbj|GAC74575.1| histone deacetylase complex, catalytic component RPD3 [Pseudozyma
           antarctica T-34]
          Length = 612

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 6/106 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLP+N++++Y+GPEYKL+VP  +M+N+NT  YL +++ KV +NLR +P AP VQMQ+
Sbjct: 368 LDEDLPFNDYIQYFGPEYKLEVPPTSMDNLNTREYLDNLRTKVIDNLRQLPSAPGVQMQE 427

Query: 61  VXXXX-----XXXXXXXXXXXDIRMSQRQRNTLVV-PENELSDSED 100
           V                    D R+SQR R+  V    +ELSD ED
Sbjct: 428 VPRTTLNPADVEVSDDEDSDLDERISQRLRDAHVQNWHDELSDDED 473



>gi|313217502|emb|CBY38585.1| unnamed protein product [Oikopleura dioica]
 gi|313225015|emb|CBY20808.1| unnamed protein product [Oikopleura dioica]
          Length = 450

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 71/123 (57%), Gaps = 6/123 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQ- 59
           ++ DLPYN++ EY+GP++KL +  NN EN N+  YL   K K+F+NL+ +P APSVQM  
Sbjct: 324 IANDLPYNDYFEYFGPDFKLHIQPNNSENKNSYEYLDKNKEKLFQNLQALPHAPSVQMHD 383

Query: 60  ---QVXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNG 114
                               DIR+    R+  +  ++E SDSED  EG RRN+ +Y SNG
Sbjct: 384 RLPDGVTVTESIKGRSEGDPDIRIQPGDRDQRIDRDDEFSDSEDEGEGGRRNKEDYKSNG 443

Query: 115 RES 117
            E+
Sbjct: 444 AEA 446



>gi|321253561|ref|XP_003192774.1| histone deacetylase 1-1 (hd1) [Cryptococcus gattii WM276]
 gi|317459243|gb|ADV20987.1| Histone deacetylase 1-1 (hd1), putative [Cryptococcus gattii WM276]
          Length = 614

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 50/61 (81%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           LSEDLP N ++EYYGP YKL+V  +N+E+ NTP YL D+K ++ ++L+N+PFAPS QM+Q
Sbjct: 373 LSEDLPSNQYMEYYGPRYKLEVLPSNVEDFNTPGYLDDLKRQISKHLKNLPFAPSAQMRQ 432

Query: 61  V 61
           V
Sbjct: 433 V 433



>gi|409083086|gb|EKM83443.1| hypothetical protein AGABI1DRAFT_110107 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 577

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 73/126 (57%), Gaps = 7/126 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L+ D+P N + EY+GP+Y+LDV ++N+++MNTPAYL  +K  V ENLR I   PSVQMQ 
Sbjct: 329 LAPDIPVNEYYEYFGPDYRLDVKSSNVDDMNTPAYLERVKRIVMENLRQIGGPPSVQMQD 388

Query: 61  VXXXXXXXXXXXXXXXDI------RMSQRQRNTLVVPENELSDSEDEGN-RRNERNYNSN 113
                           +       R+ QR  ++ + P+ + SDSEDEG+ RR+ R++   
Sbjct: 389 RPTMPIDALMDDLNQDEDEEDPNERLPQRLLDSRIRPDGDYSDSEDEGDGRRDHRSHRER 448

Query: 114 GRESSS 119
           G  S S
Sbjct: 449 GHSSDS 454



>gi|426201863|gb|EKV51786.1| hypothetical protein AGABI2DRAFT_198321 [Agaricus bisporus var.
           bisporus H97]
          Length = 577

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 73/126 (57%), Gaps = 7/126 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L+ D+P N + EY+GP+Y+LDV ++N+++MNTPAYL  +K  V ENLR I   PSVQMQ 
Sbjct: 329 LAPDIPVNEYYEYFGPDYRLDVKSSNVDDMNTPAYLERVKRIVMENLRQIGGPPSVQMQD 388

Query: 61  VXXXXXXXXXXXXXXXDI------RMSQRQRNTLVVPENELSDSEDEGN-RRNERNYNSN 113
                           +       R+ QR  ++ + P+ + SDSEDEG+ RR+ R++   
Sbjct: 389 RPTMPIDALMDDLNQDEDEEDPNERLPQRLLDSRIRPDGDYSDSEDEGDGRRDHRSHRER 448

Query: 114 GRESSS 119
           G  S S
Sbjct: 449 GHSSDS 454



>gi|393247958|gb|EJD55465.1| hypothetical protein AURDEDRAFT_109783 [Auricularia delicata
           TFB-10046 SS5]
          Length = 575

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (60%), Gaps = 6/115 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L++D+P N + EY+GP++KLDV ++NME+MN+  YL  +++ V ENLR I   P VQMQ 
Sbjct: 329 LADDIPVNEYYEYFGPDHKLDVRSSNMEDMNSREYLERVRSIVLENLRKIGGPPGVQMQA 388

Query: 61  V----XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERN 109
           V                   DIR++Q+ R+  V    ELSDSED  EG RRN+R+
Sbjct: 389 VPKLAHDDEDENEDEDMEDSDIRITQKMRDKRVRKTGELSDSEDEGEGKRRNKRD 443



>gi|425876821|gb|AFY07417.1| histone deacetylase 1-like protein [Schmidtea mediterranea]
          Length = 437

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 4/113 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+ P++KL +  +NM N NTP YL  MK K+FENLR+IP APSVQMQ +  
Sbjct: 298 ELPYNDYYEYFTPDFKLHISPSNMANQNTPEYLERMKQKLFENLRSIPHAPSVQMQDIPE 357

Query: 62  -XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG-NRRNERNYNS 112
                           D R+S    +     E +LSDSEDEG NR+N   + S
Sbjct: 358 DAMDIDDGEQMDNADPDKRISILASDKYREHEADLSDSEDEGDNRKNVDCFKS 410



>gi|499031134|ref|XP_004566277.1| PREDICTED: histone deacetylase 2-like [Maylandia zebra]
          Length = 489

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 66/117 (56%), Gaps = 4/117 (3%)

Query: 3   EDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVX 62
           ++LPYN++ EY+GP++KL +  +NM N N+  Y+  +K ++FENLR +P AP VQMQ + 
Sbjct: 328 DELPYNDYFEYFGPDFKLHISPSNMTNQNSQEYMDKIKQRLFENLRMLPHAPGVQMQAIP 387

Query: 63  XXX--XXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                           D R+S R  +  +  + E SDSED  EG RRN  N+    +
Sbjct: 388 GDAVPDDTVDEDTEDPDKRLSIRATDKRIACDEEFSDSEDEGEGGRRNTANHKKGAK 444



>gi|501307976|dbj|GAC96889.1| potential Sin3.Rpd3 histone deacetylase complex component Rpd3p
           [Pseudozyma hubeiensis SY62]
          Length = 580

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 68/108 (62%), Gaps = 5/108 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLP+N++++Y+GPEYKL+VP  +M+N+N+  YL +++AK+ +NLRN+P AP VQMQ+
Sbjct: 327 LDEDLPFNDYIQYFGPEYKLEVPPTSMDNLNSREYLENLRAKIIDNLRNLPSAPGVQMQE 386

Query: 61  -----VXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGN 103
                +               D R+SQR R+  V   ++    E+EG+
Sbjct: 387 TPRTTLNPADVEVSDGEDSDLDERISQRLRDAHVQRWDDELSGEEEGD 434



>gi|348531120|ref|XP_003453058.1| PREDICTED: histone deacetylase 2-like [Oreochromis niloticus]
          Length = 480

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 66/117 (56%), Gaps = 4/117 (3%)

Query: 3   EDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV- 61
           ++LPYN++ EY+GP++KL +  +NM N N+  Y+  +K ++FENLR +P AP VQMQ + 
Sbjct: 328 DELPYNDYFEYFGPDFKLHISPSNMTNQNSQEYMDKIKQRLFENLRMLPHAPGVQMQAIP 387

Query: 62  -XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                           D R+S R  +  +  + E SDSED  EG RRN  N+    +
Sbjct: 388 EDAVPDDTVDEDTEDPDKRLSIRATDKRIACDEEFSDSEDEGEGGRRNTANHKKGAK 444



>gi|358342847|dbj|GAA41197.2| histone deacetylase 1/2 [Clonorchis sinensis]
          Length = 446

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (57%), Gaps = 5/104 (4%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQ---- 59
           DLPYN++ EY+GP++KL +  +NM N NTP YL ++KAK+FENLR IP +PSVQMQ    
Sbjct: 264 DLPYNDYYEYFGPDFKLHISPSNMTNQNTPEYLDNIKAKLFENLRMIPHSPSVQMQDIPN 323

Query: 60  -QVXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG 102
             +               D R+S    +  + P NE  D  +EG
Sbjct: 324 DAIDIEEQEAVARDHADPDRRISIMAADKAIQPNNEFYDEPEEG 367



>gi|148222828|ref|NP_001081491.1| probable histone deacetylase 1-A [Xenopus laevis]
 gi|3023937|sp|Q91695.1|HDA1A_XENLA RecName: Full=Probable histone deacetylase 1-A; Short=HD1-A;
           AltName: Full=AB21; AltName: Full=HDM; AltName:
           Full=Maternally-expressed histone deacetylase
 gi|602098|emb|CAA55211.1| yeast RPD3 homologue [Xenopus laevis]
 gi|51704120|gb|AAH81136.1| AB21 protein [Xenopus laevis]
          Length = 480

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ V  
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAVAE 386

Query: 64  XXXXXXXXXXXXXDI--RMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
                        D   R+S R  +  +  + E SDSED  EG R+N  N+
Sbjct: 387 DSIHDDSGEEDEDDPDKRISIRSSDKRIACDEEFSDSEDEGEGGRKNVANF 437



>gi|472584340|gb|EMS21934.1| histone deacetylase 1/2 [Rhodosporidium toruloides NP11]
          Length = 572

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (59%), Gaps = 5/92 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +  DLP+N ++EY+GPE+KLDVP+NNM+N N+  YL    A + E LRN+PFAPS Q+ Q
Sbjct: 335 MQRDLPFNEYIEYFGPEFKLDVPSNNMDNANSREYLDKTVASILEGLRNLPFAPSSQLHQ 394

Query: 61  VXX-----XXXXXXXXXXXXXDIRMSQRQRNT 87
           V                    D+R+S R R+T
Sbjct: 395 VGADLPPLSTDTTDDEADSDLDVRLSSRIRST 426



>gi|148229549|ref|NP_001079396.1| histone deacetylase 1 [Xenopus laevis]
 gi|27735466|gb|AAH41296.1| MGC53583 protein [Xenopus laevis]
          Length = 480

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 71/135 (52%), Gaps = 4/135 (2%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPE 386

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRESSS 119
                          D R+S R  +  +  + E SDSED  EG RRN  ++    R  + 
Sbjct: 387 DSVHDDSGEEDEEDPDKRISIRSSDKRIACDEEFSDSEDEGEGGRRNMASFKKLKRVKTE 446

Query: 120 RKSRASHKNSSNEHE 134
            +  A  K    E E
Sbjct: 447 EEKEADDKKDVKEEE 461



>gi|470251008|ref|XP_004358601.1| histone deacetylase family protein [Dictyostelium fasciculatum]
 gi|328872384|gb|EGG20751.1| histone deacetylase family protein [Dictyostelium fasciculatum]
          Length = 491

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 67/110 (60%), Gaps = 1/110 (0%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L ++LPYN++LEYYGP+Y+L +  NNMEN N+  YL  +K ++ ENLR++  APS+   +
Sbjct: 341 LPDELPYNDYLEYYGPDYRLHITPNNMENQNSKDYLEKLKIQILENLRHLQHAPSIAHTE 400

Query: 61  V-XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGNRRNERN 109
           +                D+R+S+  R+  V    ELSDS++E  RR+E N
Sbjct: 401 IPPDSYSYSDDEDDEDPDVRISESDRDRRVTNPGELSDSDEEDGRRHEMN 450



>gi|465959399|gb|EMP28416.1| Histone deacetylase 1 [Chelonia mydas]
          Length = 488

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 66/116 (56%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 326 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPE 385

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                          D R+S R  +  +  + E SDSED  EG R+N  N+  + R
Sbjct: 386 DAVQEDSGDEDEEDPDKRISMRSADKRIACDEEFSDSEDEGEGGRKNVANFKKSKR 441



>gi|470318556|gb|EMR10209.1| hypothetical protein PNEG_01482 [Pneumocystis murina B123]
          Length = 390

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 51/61 (83%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L E++P+N++L+YYGPE+KLDVP+NNMEN N+  YL ++ +KV +NLRNI  +PSVQ+Q 
Sbjct: 318 LDENIPFNSYLDYYGPEFKLDVPSNNMENQNSRTYLENITSKVIDNLRNISHSPSVQIQH 377

Query: 61  V 61
           +
Sbjct: 378 I 378



>gi|321263085|ref|XP_003196261.1| histone deacetylase 1 (hd1) [Cryptococcus gattii WM276]
 gi|317462736|gb|ADV24474.1| histone deacetylase 1 (hd1), putative [Cryptococcus gattii WM276]
          Length = 622

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 45/61 (73%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLPYN FLEYYGP YKL+V   N  + N P YL  +K +VFENLRN+PFAPS QM+ 
Sbjct: 385 LPEDLPYNQFLEYYGPRYKLEVLPTNAVDHNPPEYLERIKNQVFENLRNLPFAPSAQMRS 444

Query: 61  V 61
           V
Sbjct: 445 V 445



>gi|58270722|ref|XP_572517.1| histone deacetylase 1 (hd1) [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134115999|ref|XP_773386.1| hypothetical protein CNBI3250 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256010|gb|EAL18739.1| hypothetical protein CNBI3250 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228775|gb|AAW45210.1| histone deacetylase 1 (hd1), putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 621

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L+EDLPYN FLEYYGP YKL+V   N  + N P YL  +K +VFENLR++PFAPS QM+ 
Sbjct: 385 LAEDLPYNQFLEYYGPRYKLEVLPTNAVDHNPPEYLERIKNQVFENLRSLPFAPSAQMRS 444

Query: 61  V 61
           V
Sbjct: 445 V 445



>gi|58265630|ref|XP_569971.1| histone deacetylase 1-1 (hd1) [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57226203|gb|AAW42664.1| histone deacetylase 1-1 (hd1), putative [Cryptococcus neoformans
           var. neoformans JEC21]
          Length = 659

 Score = 84.3 bits (207), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 49/61 (80%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           LSEDLP N ++EYYGP YKL+V  +N+E+ NTP YL D+K ++  +L+N+PFAPS QM+Q
Sbjct: 372 LSEDLPSNQYMEYYGPRYKLEVLPSNVEDFNTPEYLEDLKRQISNHLKNLPFAPSAQMRQ 431

Query: 61  V 61
           +
Sbjct: 432 I 432



>gi|3023928|sp|O42227.1|HDA1B_XENLA RecName: Full=Probable histone deacetylase 1-B; Short=HD1-B;
           AltName: Full=RPD3 homolog
 gi|2444430|gb|AAC60346.1| deacetylase [Xenopus laevis]
          Length = 480

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/111 (40%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPE 386

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
                          D R+S R  +  +  + E SDSED  EG R+N  N+
Sbjct: 387 DSVHDDSGEEDEEDPDKRISIRSSDKRIACDEEFSDSEDEGEGGRKNVANF 437



>gi|226478802|emb|CAX72896.1| histone deacetylase 1/2 [Schistosoma japonicum]
          Length = 537

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 59/105 (56%), Gaps = 5/105 (4%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           DLPYN++ EY+GP++KL +  +NM N NT  YL  +K K+FENLR IP  PSVQMQ +  
Sbjct: 325 DLPYNDYYEYFGPDFKLHISPSNMANQNTAEYLEHIKTKLFENLRMIPHCPSVQMQDIPD 384

Query: 64  XXXXXXXXXXXXXDI-----RMSQRQRNTLVVPENELSDSEDEGN 103
                        D+     R+S    +  V+P NE  D  +EG+
Sbjct: 385 DIVDFDENDSVAKDLADPDKRISIMAADKAVMPNNEFFDDPEEGS 429



>gi|507714112|ref|XP_004648093.1| PREDICTED: histone deacetylase 2-like [Octodon degus]
          Length = 488

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 67/118 (56%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S +  +  +  + E S+SED  EG  RN  ++    +++
Sbjct: 388 DAVHEDSGDKDGEDPDKRISIQASDKRIACDEEFSNSEDEEEGGHRNVADHKKGAKKA 445



>gi|71896231|ref|NP_001025564.1| histone deacetylase 1 [Xenopus (Silurana) tropicalis]
 gi|60688073|gb|AAH90604.1| histone deacetylase 1 [Xenopus (Silurana) tropicalis]
          Length = 480

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 62/107 (57%), Gaps = 4/107 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPE 386

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRN 106
                          D R+S R  +  +  + E SDSED  EG RRN
Sbjct: 387 DSVHDDSGEEDEEDPDKRISIRSSDKRIACDEEFSDSEDEGEGGRRN 433



>gi|19112125|ref|NP_595333.1| histone deacetylase (class I) Clr6 [Schizosaccharomyces pombe
           972h-]
 gi|33300910|sp|O59702.1|CLR6_SCHPO RecName: Full=Histone deacetylase clr6; AltName: Full=Cryptic loci
           regulator 6
 gi|3135992|emb|CAA19053.1| histone deacetylase (class I) Clr6 [Schizosaccharomyces pombe]
 gi|4159997|gb|AAD05211.1| putative histone deacetylase [Schizosaccharomyces pombe]
          Length = 405

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (81%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L E+LPYN++L+YYGP+YKL+V +NNMEN NT  YL  + +++ ENLRN+ FAPSVQM +
Sbjct: 321 LDENLPYNDYLQYYGPDYKLNVLSNNMENHNTRQYLDSITSEIIENLRNLSFAPSVQMHK 380



>gi|256071317|ref|XP_002571987.1| histone deacetylase [Schistosoma mansoni]
 gi|353229514|emb|CCD75685.1| histone deacetylase 1 [Schistosoma mansoni]
          Length = 469

 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 5/105 (4%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           DLPYN++ EY+GP++KL +  +NM N NT  YL  +K K+FENLR IP  PSVQMQ +  
Sbjct: 277 DLPYNDYYEYFGPDFKLHISPSNMANQNTNEYLEHIKTKLFENLRMIPHCPSVQMQDIPD 336

Query: 64  XXXXXXXXXXXXXDI-----RMSQRQRNTLVVPENELSDSEDEGN 103
                        D+     R+S    +  ++P NE  D  +EG+
Sbjct: 337 DIVDFDENDAVAKDLADPDKRISIMAADKAIMPNNEFFDDPEEGS 381



>gi|209154478|gb|ACI33471.1| Probable histone deacetylase 1-B [Salmo salar]
          Length = 498

 Score = 83.2 bits (204), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNDYLEKIKQRLFENLRMLPHAPGVQMQAIPE 387

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDE-----GNRRNERNYNSNGR 115
                          + R+S R  +  +  + E SDSEDE     G RRN  ++    R
Sbjct: 388 DAVQEDSGDEEEEDPNKRISIRAHDKRIACDEEFSDSEDEAEGQGGGRRNAASFKKAKR 446



>gi|71005666|ref|XP_757499.1| hypothetical protein UM01352.1 [Ustilago maydis 521]
 gi|46096622|gb|EAK81855.1| hypothetical protein UM01352.1 [Ustilago maydis 521]
          Length = 559

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 50/60 (83%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLP+N++++Y+GPEYKL+VP  +M+N+N+  YL +++ K+ +NLRN+P AP VQMQ+
Sbjct: 301 LDEDLPFNDYIQYFGPEYKLEVPPTSMDNLNSREYLDNLRTKIIDNLRNLPSAPGVQMQE 360



>gi|449488911|ref|XP_002194370.2| PREDICTED: histone deacetylase 1, partial [Taeniopygia guttata]
          Length = 466

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 65/116 (56%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPE 386

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                          + R+S R  N  +  + E SDSED  EG R+N  N+    R
Sbjct: 387 DAVQEDSGDEEEDDPEKRISIRNSNKRISCDEEFSDSEDEGEGGRKNVANFKKAKR 442



>gi|126216326|gb|ABN81193.1| histone deacetylase 1 [Schistosoma mansoni]
          Length = 517

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 5/105 (4%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           DLPYN++ EY+GP++KL +  +NM N NT  YL  +K K+FENLR IP  PSVQMQ +  
Sbjct: 325 DLPYNDYYEYFGPDFKLHISPSNMANQNTNEYLEHIKTKLFENLRMIPHCPSVQMQDIPD 384

Query: 64  XXXXXXXXXXXXXDI-----RMSQRQRNTLVVPENELSDSEDEGN 103
                        D+     R+S    +  ++P NE  D  +EG+
Sbjct: 385 DIVDFDENDAVAKDLADPDKRISIMAADKAIMPNNEFFDDPEEGS 429



>gi|11967857|emb|CAC19454.1| histone deacetylase [Ustilago maydis]
          Length = 566

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 50/60 (83%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLP+N++++Y+GPEYKL+VP  +M+N+N+  YL +++ K+ +NLRN+P AP VQMQ+
Sbjct: 308 LDEDLPFNDYIQYFGPEYKLEVPPTSMDNLNSREYLDNLRTKIIDNLRNLPSAPGVQMQE 367



>gi|19070647|gb|AAL83942.1|AF352394_1 putative histone deacetylase [Physarum polycephalum]
          Length = 579

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 70/126 (55%), Gaps = 2/126 (1%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L ++LPYN++LEY+GP+Y+L    NNMEN N   YL   K K+ ENLR++  AP V M +
Sbjct: 321 LDDELPYNDYLEYFGPDYRLHYTPNNMENQNGREYLEKCKNKILENLRHLQNAPGVAMHE 380

Query: 61  V-XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGNRRNERNYNSNGRESSS 119
           V                D R +QR  +  V  E+ LSDS++E  RRN  +   NG  SSS
Sbjct: 381 VPPDAMDDSDDSDDDDPDSRQNQRDLDRRVSHEDNLSDSDEEDGRRNMED-EPNGGYSSS 439

Query: 120 RKSRAS 125
              RAS
Sbjct: 440 NSHRAS 445



>gi|343427236|emb|CBQ70764.1| probable Hda2-Histone deacetylase [Sporisorium reilianum SRZ2]
          Length = 585

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 48/59 (81%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQ 59
           L EDLP+N++++Y+GPEYKLDVP  +M+N+N+  YL +++ K+  NLRN+P AP VQMQ
Sbjct: 327 LDEDLPFNDYIQYFGPEYKLDVPPTSMDNLNSREYLDNLRTKIIGNLRNLPSAPGVQMQ 385



>gi|327288082|ref|XP_003228757.1| PREDICTED: histone deacetylase 1-like [Anolis carolinensis]
          Length = 480

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 65/116 (56%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPE 386

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                          D R+S R  +  +  + E SDSED  EG R+N  N+    R
Sbjct: 387 DAVPEDSADEDEEDPDKRISIRSSDKRIACDEEFSDSEDEGEGGRKNVANFKKAKR 442



>gi|134109825|ref|XP_776462.1| hypothetical protein CNBC5170 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259138|gb|EAL21815.1| hypothetical protein CNBC5170 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 356

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 48/61 (78%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           LSEDLP N ++EYYGP YKL V  +N+E+ NTP YL D+K ++  +L+N+PFAPS QM+Q
Sbjct: 264 LSEDLPSNQYMEYYGPRYKLQVLPSNVEDFNTPEYLEDLKRQISNHLKNLPFAPSAQMRQ 323

Query: 61  V 61
           +
Sbjct: 324 I 324



>gi|430811164|emb|CCJ31339.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 513

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 78/144 (54%), Gaps = 19/144 (13%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           ++P+N++ EYYGP Y+L+VPA+NM+NMN+  YL  +K +V +NL    FAPSVQMQ V  
Sbjct: 319 EMPFNDYYEYYGPTYELNVPASNMQNMNSKEYLEKIKVEVLKNLSRTKFAPSVQMQDVPR 378

Query: 64  XXXXXXXXXXXXXDIR----MSQRQRNTLVVPENELSDSED--EGNRRN-----ERNYNS 112
                        D R     ++ QR+      +E SDSED  EGNRRN       N +S
Sbjct: 379 DRDNNCEDQEDNYDKRKIFLWNKPQRS------DEFSDSEDEGEGNRRNITISESLNTSS 432

Query: 113 NGRESSSRKSRASHKNSSN--EHE 134
           N  E  SR   +  K   N  EH+
Sbjct: 433 NSSEDFSRALNSESKELENNLEHD 456



>gi|410911136|ref|XP_003969046.1| PREDICTED: probable histone deacetylase 1-B-like [Takifugu
           rubripes]
          Length = 474

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 7/114 (6%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPE 386

Query: 64  XXXX--XXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDE-----GNRRNERNY 110
                          D  +S R  +  +  + E SDSEDE     G RRN  N+
Sbjct: 387 DAPHPDSGDEDEEDPDKHVSIRAHDKRIACDEEFSDSEDEAEGQGGGRRNSANH 440



>gi|358056605|dbj|GAA97574.1| hypothetical protein E5Q_04252 [Mixia osmundae IAM 14324]
          Length = 509

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 61/103 (59%), Gaps = 2/103 (1%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSV-QMQ 59
           ++EDLP+N+++EYYGP +KLDVP NNM+N+N+P YL  +K  + E L+ +PFAPS   M 
Sbjct: 323 MNEDLPFNDYIEYYGPAFKLDVPNNNMDNLNSPQYLESIKVTIMETLKQMPFAPSAPNMP 382

Query: 60  QVXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENE-LSDSEDE 101
                            D R+SQ+ R+       + LSD ED+
Sbjct: 383 VPREVRLEEDLDSDLELDTRISQKTRDAFTERYGDTLSDDEDD 425



>gi|157837995|ref|NP_989487.1| histone deacetylase 1 [Gallus gallus]
 gi|3023929|sp|P56517.1|HDAC1_CHICK RecName: Full=Histone deacetylase 1; Short=HD1
 gi|2791684|gb|AAB96923.1| histone deacetylase-1 [Gallus gallus]
 gi|2829214|gb|AAC00504.1| erythrocyte histone deacetylase [Gallus gallus]
          Length = 480

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 65/116 (56%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPE 386

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                          + R+S R  +  +  + E SDSED  EG R+N  N+    R
Sbjct: 387 DAVQEDSGDEEEEDPEKRISIRNSDKRISCDEEFSDSEDEGEGGRKNVANFKKAKR 442



>gi|326933089|ref|XP_003212642.1| PREDICTED: histone deacetylase 1-like [Meleagris gallopavo]
          Length = 451

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 298 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPE 357

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
                          + R+S R  +  +  + E SDSED  EG R+N  N+
Sbjct: 358 DAVQEDSGDEEEEDPEKRISIRNSDKRISCDEEFSDSEDEGEGGRKNVANF 408



>gi|2827430|gb|AAB99850.1| histone deacetylase 1 [Gallus gallus]
          Length = 480

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 65/116 (56%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPE 386

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                          + R+S R  +  +  + E SDSED  EG R+N  N+    R
Sbjct: 387 DAVQEDSGDEEEEDPEKRISIRNSDKRISCDEEFSDSEDEGEGGRKNVANFKKAKR 442



>gi|449273084|gb|EMC82692.1| Histone deacetylase 1, partial [Columba livia]
          Length = 464

 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 65/116 (56%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 311 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPE 370

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                          + R+S R  +  +  + E SDSED  EG R+N  N+    R
Sbjct: 371 DAVQEDSGDEEEEDPEKRISIRNSDKRISCDEEFSDSEDEGEGGRKNVANFKKAKR 426



>gi|483512076|gb|EOB00696.1| Histone deacetylase 1, partial [Anas platyrhynchos]
          Length = 446

 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 65/116 (56%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +  
Sbjct: 301 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPE 360

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                          + R+S R  +  +  + E SDSED  EG R+N  N+    R
Sbjct: 361 DAVQEDSGDEEEEDPEKRISIRNSDKRISCDEEFSDSEDEGEGGRKNVANFKKAKR 416



>gi|47551069|ref|NP_999711.1| histone deacetylase 1 [Strongylocentrotus purpuratus]
 gi|3023930|sp|P56518.1|HDAC1_STRPU RecName: Full=Histone deacetylase 1; Short=HD1
 gi|2654077|gb|AAB87685.1| histone deacetylase [Strongylocentrotus purpuratus]
          Length = 576

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 63/108 (58%), Gaps = 3/108 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NT  YL  +K +++EN+R IP AP VQMQ 
Sbjct: 323 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTGEYLDKIKTRLYENMRMIPHAPGVQMQP 382

Query: 61  VXXXXXXXXXXXXXXX---DIRMSQRQRNTLVVPENELSDSEDEGNRR 105
           +                  D R+S   ++  +  ++E SDSEDEG  R
Sbjct: 383 IPEDAIPDDSDAEDEAENPDKRISIMAQDKRIQRDDEFSDSEDEGETR 430



>gi|402579982|gb|EJW73933.1| hypothetical protein WUBG_15159, partial [Wuchereria bancrofti]
          Length = 141

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 69/135 (51%), Gaps = 8/135 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +S+DLPYN++ EY+GP Y+L +  +N  N NTP +L  ++  V ENLR++P  PSVQMQ 
Sbjct: 3   VSDDLPYNDYFEYFGPHYRLHIDPSNANNENTPEFLRKIQEGVMENLRHLPHVPSVQMQP 62

Query: 61  VXXXXXXXXXXXXXXX-------DIRMSQRQRNTLVVPENELSDSEDEGNR-RNERNYNS 112
           V                      DIR+     +     + E  D+E EG   RNE+++  
Sbjct: 63  VGDESFTAKCLNAEEADRDNANPDIRLHHTMMDASTEDQGEFYDNEKEGGDIRNEQSFKR 122

Query: 113 NGRESSSRKSRASHK 127
            G E+ +  +  + K
Sbjct: 123 CGSETETGDAEIAKK 137



>gi|254566249|ref|XP_002490235.1| Histone deacetylase [Komagataella pastoris GS115]
 gi|238030031|emb|CAY67954.1| Histone deacetylase [Komagataella pastoris GS115]
 gi|328350628|emb|CCA37028.1| histone deacetylase 1/2 [Komagataella pastoris CBS 7435]
          Length = 476

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 65/114 (57%), Gaps = 4/114 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EYYGP+Y+LDV  +NM N N+P YL+ + +++F NL N  FAPSVQ+  
Sbjct: 334 LEAELPYNDYYEYYGPDYQLDVRPSNMHNANSPEYLSKIMSQIFSNLENTKFAPSVQLNY 393

Query: 61  V---XXXXXXXXXXXXXXXDIR-MSQRQRNTLVVPENELSDSEDEGNRRNERNY 110
           V                  D +  SQ  R+ ++V +NE  D++D    ++  +Y
Sbjct: 394 VPPDMEEYGDVEEDTEKAKDTKGGSQYARDNIIVGDNEFYDTDDLNKEKDVAHY 447



>gi|328709372|ref|XP_001946324.2| PREDICTED: histone deacetylase Rpd3-like [Acyrthosiphon pisum]
          Length = 491

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 67/122 (54%), Gaps = 10/122 (8%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N N   YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 323 IANELPYNDYFEYFGPDFKLHISPSNMTNTNATEYLEKIKNRLFENLRMLPHAPGVQVQA 382

Query: 61  VXXXXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSEDEG--------NRRNERNY 110
           +                 D R  Q   +  + P+NE SDSEDEG         R++ R+Y
Sbjct: 383 IPEDGVRNESEDEDNVNPDERNPQSITDKRIAPDNEFSDSEDEGMAPGVGGGGRKDNRSY 442

Query: 111 NS 112
            +
Sbjct: 443 KT 444



>gi|403160872|ref|XP_003321297.2| histone deacetylase 1/2 [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|375170431|gb|EFP76878.2| histone deacetylase 1/2 [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 632

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 67/121 (55%), Gaps = 4/121 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  D+P N + EY+GP Y+LDVP +NME+MN   YL   K ++FENLR+    PSV +Q 
Sbjct: 329 LCTDIPMNEYYEYFGPTYRLDVPPSNMEDMNVVKYLEKTKIQIFENLRHTIPVPSVGLQA 388

Query: 61  VXXXXXXXXXXXXXXXDI--RMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +               D   R  QR  + L+  ++E SDSED  EG RR+ +++    R+
Sbjct: 389 IPRLAHDEMDVDEDLDDPNERRPQRLLDGLIQRDDEFSDSEDEGEGGRRDIQSHKRARRQ 448

Query: 117 S 117
           S
Sbjct: 449 S 449



>gi|443689292|gb|ELT91729.1| hypothetical protein CAPTEDRAFT_175897 [Capitella teleta]
          Length = 543

 Score = 80.1 bits (196), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 64/116 (55%), Gaps = 5/116 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EYYGP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQMQ 
Sbjct: 325 IANELPYNDYFEYYGPDFKLHISPSNMANQNTPEYLDKIKIRLFENLRMLPHAPGVQMQD 384

Query: 61  V---XXXXXXXXXXXXXXXDIRMSQRQ--RNTLVVPENELSDSEDEGNRRNERNYN 111
           +                  D R+S R   +      E   S+ E EG RR+ R+Y 
Sbjct: 385 LPEESLNKDESEEEEKANADERISIRASDKGITCEEEFSDSEDEGEGGRRDRRDYG 440



>gi|344235663|gb|EGV91766.1| Histone deacetylase 1 [Cricetulus griseus]
          Length = 188

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 63/116 (54%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ EY+GP++KL    +NM N NT  YL  +K K+FENLR +P AP VQMQ +  
Sbjct: 33  ELPYNDYFEYFGPDFKLHFSPSNMTNQNTNEYLEKIKQKLFENLRMLPHAPGVQMQAIPE 92

Query: 64  XXXXXXXXXXXXXDIR--MSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                        D    +S    +  +V E E SDS++  EG R+N  N+    R
Sbjct: 93  DAIPEESGDEDEEDPDKCISICSSDKRIVCEEEFSDSDEKGEGGRKNSSNFKKAKR 148



>gi|459172185|ref|XP_004225492.1| PREDICTED: LOW QUALITY PROTEIN: histone deacetylase 1-like [Ciona
           intestinalis]
          Length = 569

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  ++ ++FENLR +P AP VQMQ +  
Sbjct: 328 ELPYNDYFEYFGPDFKLHISPSNMSNQNTMEYLQKIRQRLFENLRMLPHAPGVQMQDIPP 387

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNY 110
                          D + S R  +  +   +E SDSED  EG R+NE  +
Sbjct: 388 DAVVSGSDDEAMDDPDKKTSIRASDKRIQRPDEYSDSEDEGEGGRKNEETH 438



>gi|407921727|gb|EKG14866.1| Histone deacetylase superfamily [Macrophomina phaseolina MS6]
          Length = 577

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV--- 61
           LP++++ EYY PEY LDVP +N+ N NTP YL  +++ + E LR +PFAPSVQMQ V   
Sbjct: 324 LPFSDYYEYYCPEYLLDVPQSNISNDNTPEYLEKIRSTIAERLRTLPFAPSVQMQDVPRN 383

Query: 62  ------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENEL--SDSEDE 101
                                D RM++ +R+  +V + E   SD+EDE
Sbjct: 384 GLGSTEEDDDILADMDADENMDFRMTELERDRQIVNDAEFYDSDAEDE 431



>gi|170575666|ref|XP_001893332.1| Histone deacetylase 1 [Brugia malayi]
 gi|158600724|gb|EDP37830.1| Histone deacetylase 1, putative [Brugia malayi]
          Length = 481

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 69/135 (51%), Gaps = 8/135 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +S+DLPYN++ EY+GP Y+L +  +N  N NTP +L  ++  V ENLR++P  PSVQMQ 
Sbjct: 326 VSDDLPYNDYFEYFGPHYRLHIDPSNANNENTPEFLRKIQEGVMENLRHLPHVPSVQMQP 385

Query: 61  VXXXXXXXXXXXXXXX-------DIRMSQRQRNTLVVPENELSDSEDEGNR-RNERNYNS 112
           V                      D+R+     +     + E  D+E EG   RNE+++  
Sbjct: 386 VGDESFVAKCLNAEEADRDNANPDVRLHHTMMDASTEDQGEFYDNEKEGGDIRNEQSFKR 445

Query: 113 NGRESSSRKSRASHK 127
            G E+ +  +  + K
Sbjct: 446 CGSETETGDAETTKK 460



>gi|320582857|gb|EFW97074.1| Histone deacetylase [Ogataea parapolymorpha DL-1]
          Length = 509

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 6/117 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LP+N++ EY+GP+YKLDV  +NM N N+P YL  +  +VF NL N   APSVQMQ+
Sbjct: 334 LDAELPFNDYYEYFGPDYKLDVRPSNMHNANSPEYLNRILTQVFANLENTKHAPSVQMQE 393

Query: 61  V----XXXXXXXXXXXXXXXDIR-MSQRQRNTLVVPENELSDSEDEGNR-RNERNYN 111
           V                   D R  SQ+  +  +VPENE  D +++  R ++  +YN
Sbjct: 394 VPPDLVDFDDDPEEDTKEAIDTRGGSQKAHDERIVPENEFYDKDEDAVRAKDSTDYN 450



>gi|470530821|ref|XP_004368316.1| Type-1 histone deacetylase 1, putative [Acanthamoeba castellanii
           str. Neff]
 gi|440804684|gb|ELR25561.1| Type-1 histone deacetylase 1, putative [Acanthamoeba castellanii
           str. Neff]
          Length = 199

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 67/110 (60%), Gaps = 3/110 (2%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++++LP+N++LEYYGP+++L +  +NMEN+N P YL   K K+ ENLR++  AP V M +
Sbjct: 76  INDELPFNDYLEYYGPDFRLHLSPSNMENLNDPKYLEKTKIKLIENLRSVQGAPGVSMNE 135

Query: 61  V-XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDS--EDEGNRRNE 107
           +                D R+S+R R+  V  + ELSDS  ED G R ++
Sbjct: 136 IPPDTYLGSDDEDEEDPDARISERHRDRRVAHDAELSDSDEEDAGRRFDD 185



>gi|312076531|ref|XP_003140903.1| histone deacetylase 1 [Loa loa]
          Length = 464

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 70/135 (51%), Gaps = 8/135 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +S+DLPYN++ EY+GP Y+L +  +N  N NTP +L  ++  V ENLR++P  PSVQMQ 
Sbjct: 326 VSDDLPYNDYFEYFGPHYRLHIDPSNANNENTPEFLKKIQEGVMENLRHLPHVPSVQMQP 385

Query: 61  VXXXXXXXXXXXXXXX-------DIRMSQRQRNTLVVPENELSDSEDEGNR-RNERNYNS 112
           +                      D+R      +  +  + E  D+E EG   RNE+++  
Sbjct: 386 IGDESFTEKCLNAEEADRDNANPDVRQHHTVLDASIEDQGEFYDNEKEGGDIRNEQSFKR 445

Query: 113 NGRESSSRKSRASHK 127
           +G E+ +  +  + K
Sbjct: 446 SGSETETCDAEVAKK 460



>gi|393908162|gb|EFO23171.2| histone deacetylase 1 [Loa loa]
          Length = 465

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 70/135 (51%), Gaps = 8/135 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +S+DLPYN++ EY+GP Y+L +  +N  N NTP +L  ++  V ENLR++P  PSVQMQ 
Sbjct: 326 VSDDLPYNDYFEYFGPHYRLHIDPSNANNENTPEFLKKIQEGVMENLRHLPHVPSVQMQP 385

Query: 61  VXXXXXXXXXXXXXXX-------DIRMSQRQRNTLVVPENELSDSEDEGNR-RNERNYNS 112
           +                      D+R      +  +  + E  D+E EG   RNE+++  
Sbjct: 386 IGDESFTEKCLNAEEADRDNANPDVRQHHTVLDASIEDQGEFYDNEKEGGDIRNEQSFKR 445

Query: 113 NGRESSSRKSRASHK 127
           +G E+ +  +  + K
Sbjct: 446 SGSETETCDAEVAKK 460



>gi|328853510|gb|EGG02648.1| hypothetical protein MELLADRAFT_38453 [Melampsora larici-populina
           98AG31]
          Length = 293

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 70/127 (55%), Gaps = 5/127 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  ++P N + EY+GP Y LDVPA+NME+MN   YL  +K ++FENLR+    PS++MQ 
Sbjct: 168 LCREIPMNEYYEYFGPTYHLDVPASNMEDMNVNRYLEKVKVQIFENLRHTIPVPSLEMQP 227

Query: 61  VXXXXXXXXXXXXXXXD--IRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRE 116
           +               D   R  QR  + LV  ++E S SED  EG R+N + Y +  + 
Sbjct: 228 MPRLPHDDMEVDEDLDDPNERKPQRLLDALVQGDDEFSASEDEGEGGRKNVQTYKTQ-KN 286

Query: 117 SSSRKSR 123
            + R+ R
Sbjct: 287 WAEREGR 293



>gi|170086091|ref|XP_001874269.1| histone deacetylase complex, catalytic component RPD3 [Laccaria
           bicolor S238N-H82]
 gi|164651821|gb|EDR16061.1| histone deacetylase complex, catalytic component RPD3 [Laccaria
           bicolor S238N-H82]
          Length = 548

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 71/130 (54%), Gaps = 11/130 (8%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  D+P N + EY+GP+Y+LDV ++N ++MNTPAYL  +K  V ENLR++   PSVQM  
Sbjct: 326 LGPDIPVNEYYEYFGPDYELDVKSSNTDDMNTPAYLDRVKRIVLENLRHVGGPPSVQMSD 385

Query: 61  VXXXXXXXXXXXXXXXDIRMSQRQRNTLVV------PENELSDSED--EGNRRN---ERN 109
           +               +  M+   R  + +       + ELSDS+D  EG RRN    R+
Sbjct: 386 IPSMPIDEALDDPNQDEDLMNPNDRRPMRLLDSRRQADGELSDSDDEGEGGRRNHGSHRD 445

Query: 110 YNSNGRESSS 119
            +SNG ES  
Sbjct: 446 PDSNGEESGG 455



>gi|393218816|gb|EJD04304.1| hypothetical protein FOMMEDRAFT_81600 [Fomitiporia mediterranea
           MF3/22]
          Length = 592

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (56%), Gaps = 9/130 (6%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  ++P N + EY+GP+YKLDV ++NME++NT AYL  +K+ V ENLR++   PSVQM  
Sbjct: 325 LGSEIPVNEYYEYFGPDYKLDVRSSNMEDLNTSAYLNRVKSIVMENLRSLGGPPSVQMMD 384

Query: 61  V------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNE-RNYN 111
           +                     D R   R  ++LV  ++E SDSED  EG R+N  R+ +
Sbjct: 385 IPRLPIDDVLDDPSRDEDTVNPDKRRPMRLLDSLVQRDDEFSDSEDEGEGGRKNHARHRD 444

Query: 112 SNGRESSSRK 121
           ++   S SR+
Sbjct: 445 ADSAVSPSRR 454



>gi|156408678|ref|XP_001641983.1| predicted protein [Nematostella vectensis]
 gi|156229124|gb|EDO49920.1| predicted protein [Nematostella vectensis]
          Length = 442

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 46/61 (75%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR IP AP VQMQ 
Sbjct: 325 IANELPYNDYFEYFGPDFKLHISPSNMTNQNTPDYLDKIKQRLFENLRMIPHAPGVQMQP 384

Query: 61  V 61
           +
Sbjct: 385 I 385



>gi|67533353|ref|XP_662097.1| hypothetical protein AN4493.2 [Aspergillus nidulans FGSC A4]
 gi|8886512|gb|AAF80489.1|AF163862_1 histone deacetylase RpdA [Emericella nidulans]
 gi|40741646|gb|EAA60836.1| hypothetical protein AN4493.2 [Aspergillus nidulans FGSC A4]
 gi|259482684|tpe|CBF77396.1| TPA: Histone deacetylase RpdAPutative uncharacterized protein ;
           [Source:UniProtKB/TrEMBL;Acc:Q9P4F5] [Aspergillus
           nidulans FGSC A4]
          Length = 687

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 75/156 (48%), Gaps = 25/156 (16%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N NT  YL  ++ +V ENL+   FAPSVQM  
Sbjct: 341 LGSELPYNDYYEYFAPDYELDVRPSNMDNANTREYLDKIRTQVVENLKRTAFAPSVQMTD 400

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG------- 102
           V                          D R ++R+ +  V    ELSDSEDE        
Sbjct: 401 VPREPLVDGMDDEAEAALDDLDEDENKDKRFTKRRFDQYVEKPGELSDSEDEDENAANGV 460

Query: 103 -------NRRNERNYNSNGRESSSRKSRASHKNSSN 131
                   RRN+ NY  +  +S      A+ +++S+
Sbjct: 461 TRKPAHLKRRNQANYRLDLADSGVESGMATPQDASS 496



>gi|321259966|ref|XP_003194703.1| hypothetical protein CGB_F2490W [Cryptococcus gattii WM276]
 gi|317461175|gb|ADV22916.1| conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 469

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 72/134 (53%), Gaps = 18/134 (13%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  DLP N + EYYGP+Y+LDV ++NM + NTP YL  +K  VFE LR+   APSV +Q 
Sbjct: 328 LGRDLPNNEYWEYYGPDYELDVRSSNMTDQNTPEYLQKVKEAVFEVLRDKNAAPSVPLQS 387

Query: 61  VXXXXXXXXXXXXXXXD--------IRMSQRQRNTLVVPENELSDSEDE--GNRRNERNY 110
           V               +        +R+  R++      E  LSDSEDE  G R++ R+Y
Sbjct: 388 VPKMMHDDDDEDEGEDNEDKDVRRPLRLWAREKQH----ETSLSDSEDEGTGGRKHRRSY 443

Query: 111 NSNGRESSSRKSRA 124
               +ES+ +K R+
Sbjct: 444 ----KESTQKKHRS 453



>gi|170578252|ref|XP_001894336.1| histone deacetylase 1 (HD1) [Brugia malayi]
 gi|158599157|gb|EDP36848.1| histone deacetylase 1 (HD1), putative [Brugia malayi]
          Length = 464

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 47/59 (79%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQ 59
           +S +LPYN++ EYY  ++KL +  +NM N+NTP YL  M++ +FE+LR++P+APSVQMQ
Sbjct: 330 ISNELPYNDYFEYYSNDFKLHIIPSNMTNLNTPDYLQKMQSTIFEHLRHLPYAPSVQMQ 388



>gi|392597105|gb|EIW86427.1| histone deacetylase complex catalytic component RPD3 [Coniophora
           puteana RWD-64-598 SS2]
          Length = 560

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 68/127 (53%), Gaps = 8/127 (6%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  ++P N + EY+GP Y+LDV ++NME+MNTP YL  +K  VFENLR++   PSVQM  
Sbjct: 330 LGPEIPVNEYYEYFGPNYELDVKSSNMEDMNTPEYLDRVKNIVFENLRHLGGPPSVQMSD 389

Query: 61  V------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNS 112
           +                     D R   R  +++   + ELSDSED  EG RR+  ++  
Sbjct: 390 IPKLPIDDAIDDVSRDFDMLPPDERRPMRLLDSMRQADGELSDSEDEGEGGRRDHASHKE 449

Query: 113 NGRESSS 119
             R S S
Sbjct: 450 RKRGSRS 456



>gi|393230311|gb|EJD37919.1| hypothetical protein AURDEDRAFT_116664 [Auricularia delicata
           TFB-10046 SS5]
          Length = 551

 Score = 77.0 bits (188), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 48/59 (81%), Gaps = 1/59 (1%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTP-AYLADMKAKVFENLRNIPFAPSVQMQQV 61
           DLP+N++ E++GP Y+L+VP +NM+++N    YL D+K +V  +LR++PFAPSVQMQ+V
Sbjct: 325 DLPFNDYFEWFGPRYRLEVPCSNMDDLNKKDGYLEDVKVQVERHLRDLPFAPSVQMQEV 383



>gi|390604222|gb|EIN13613.1| histone deacetylase complex catalytic component RPD3 [Punctularia
           strigosozonata HHB-11173 SS5]
          Length = 522

 Score = 77.0 bits (188), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 67/138 (48%), Gaps = 20/138 (14%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  ++P N + +Y+GP Y+LDV  +NME++NT  YL  +K  VFENLR I   PSVQMQ 
Sbjct: 336 LGPNIPVNEYYDYFGPTYELDVKPSNMEDLNTRRYLDRVKGMVFENLRAIGGPPSVQMQD 395

Query: 61  VXXXXXXXXXXXXXXXDIRMS------QRQRNTLVVPENELSDSEDEGNRRNERNYNSNG 114
           +               D  +S      QR  +    PE ELSDS+DEG            
Sbjct: 396 IPRVPIDDHMDDIRADDDLISPDERRPQRLLDYRRQPEGELSDSDDEGE----------- 444

Query: 115 RESSSRKSRASHKNSSNE 132
                R+ R SH+  + E
Sbjct: 445 ---GGRRDRTSHREGNGE 459



>gi|513030729|gb|AGO10754.1| AaceriAGR395Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 433

 Score = 77.0 bits (188), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 45/61 (73%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L E+LPYN++ EYYGP+YKLDV  +NM N+N+P YL  + A +F NL N  +APSVQ+  
Sbjct: 334 LDEELPYNDYYEYYGPDYKLDVRPSNMFNVNSPEYLDKVLASIFSNLENTKYAPSVQLNH 393

Query: 61  V 61
           V
Sbjct: 394 V 394



>gi|225562715|gb|EEH10994.1| histone deacetylase [Ajellomyces capsulatus G186AR]
          Length = 683

 Score = 77.0 bits (188), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 71/144 (49%), Gaps = 26/144 (18%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N N+  YL  ++ +V ENL+   FAPSVQM  
Sbjct: 334 LGTELPYNDYYEYFSPDYELDVRPSNMDNANSKEYLDKIRMQVIENLKRTAFAPSVQMTD 393

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG------- 102
           V                          D R ++R+ +  +  E ELSDSEDE        
Sbjct: 394 VPRGPLIDGIDDEADAILDDLDEDENKDSRFTKRRFDQYIEKEGELSDSEDEDEQAANGI 453

Query: 103 -------NRRNERNY-NSNGRESS 118
                   RRN+ NY N +G +S 
Sbjct: 454 RPQPGIIKRRNQVNYRNLDGGDSG 477



>gi|472585964|gb|EMS23506.1| histone deacetylase 1/2 [Rhodosporidium toruloides NP11]
          Length = 601

 Score = 77.0 bits (188), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 71/129 (55%), Gaps = 6/129 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPF--APSVQM 58
           L  ++P N + EY+GP Y+LDVP +N E+MNT  YL  +KA+VFENLR      APSVQ 
Sbjct: 341 LGVNIPMNEYYEYFGPTYRLDVPQSNTEDMNTSEYLEKIKAQVFENLRQTGGGSAPSVQS 400

Query: 59  QQVXXXXXXXXXXXXXXX---DIRMSQRQRNTLVVPENELSDSEDEGNRRNERNYNSNGR 115
           Q +                  ++R  Q + +  +  ++E SDSEDEG     R+  S+ R
Sbjct: 401 QPIPRTAMDEDDDLEEDERDPNVRRHQAEVDRRIQRDDEFSDSEDEGE-GGRRDRQSHRR 459

Query: 116 ESSSRKSRA 124
           ES   +S++
Sbjct: 460 ESPKARSKS 468



>gi|240279524|gb|EER43029.1| histone deacetylase RpdA [Ajellomyces capsulatus H143]
          Length = 667

 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 71/144 (49%), Gaps = 26/144 (18%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N N+  YL  ++ +V ENL+   FAPSVQM  
Sbjct: 322 LGTELPYNDYYEYFSPDYELDVRPSNMDNANSKEYLDKIRMQVIENLKRTAFAPSVQMTD 381

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG------- 102
           V                          D R ++R+ +  +  E ELSDSEDE        
Sbjct: 382 VPRGPLIDGIDDEADAILDDLDEDENKDSRFTKRRFDQYIEKEGELSDSEDEDEQAANGI 441

Query: 103 -------NRRNERNY-NSNGRESS 118
                   RRN+ NY N +G +S 
Sbjct: 442 RPQPGIIKRRNQVNYRNLDGGDSG 465



>gi|325092651|gb|EGC45961.1| histone deacetylase RpdA [Ajellomyces capsulatus H88]
          Length = 679

 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 71/144 (49%), Gaps = 26/144 (18%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N N+  YL  ++ +V ENL+   FAPSVQM  
Sbjct: 334 LGTELPYNDYYEYFSPDYELDVRPSNMDNANSKEYLDKIRMQVIENLKRTAFAPSVQMTD 393

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG------- 102
           V                          D R ++R+ +  +  E ELSDSEDE        
Sbjct: 394 VPRGPLIDGIDDEADAILDDLDEDENKDSRFTKRRFDQYIEKEGELSDSEDEDEQAANGI 453

Query: 103 -------NRRNERNY-NSNGRESS 118
                   RRN+ NY N +G +S 
Sbjct: 454 RPQPGIIKRRNQVNYRNLDGGDSG 477



>gi|242008175|ref|XP_002424887.1| histone deacetylase RPD3, putative [Pediculus humanus corporis]
 gi|212508452|gb|EEB12149.1| histone deacetylase RPD3, putative [Pediculus humanus corporis]
          Length = 340

 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 46/61 (75%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 224 IANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIKTRLFENLRMLPHAPGVQVQA 283

Query: 61  V 61
           +
Sbjct: 284 I 284



>gi|212543437|ref|XP_002151873.1| histone deacetylase RpdA/Rpd3 [Talaromyces marneffei ATCC 18224]
 gi|210066780|gb|EEA20873.1| histone deacetylase RpdA/Rpd3 [Talaromyces marneffei ATCC 18224]
          Length = 668

 Score = 76.6 bits (187), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 71/145 (48%), Gaps = 25/145 (17%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L   LPYN++ EY+ P+Y+LDV  +NM+N NT  YL  ++ +V ENLR   FAPSVQM  
Sbjct: 335 LDSQLPYNDYYEYFSPDYELDVRPSNMDNANTKEYLDKIRNQVIENLRRTGFAPSVQMTD 394

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDE------GN 103
           V                          D R +QR+ +  V    ELSDSEDE      G 
Sbjct: 395 VPRDPLIEGLDDEADAIMDDLDEDENKDKRYTQRRFDQYVEKPGELSDSEDEEVLAANGV 454

Query: 104 RRNERNYNSNGRESSSRKSRASHKN 128
           RR           ++ R+++ SH+N
Sbjct: 455 RRQPG--------ATRRRNQVSHRN 471



>gi|367019356|ref|XP_003658963.1| histone deacetylase RPD3-like protein [Myceliophthora thermophila
           ATCC 42464]
 gi|347006230|gb|AEO53718.1| histone deacetylase RPD3-like protein [Myceliophthora thermophila
           ATCC 42464]
          Length = 647

 Score = 76.6 bits (187), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 68/133 (51%), Gaps = 9/133 (6%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXXX 64
           LPYN +  YYGP+Y+LDV A+NMEN N+P YL  +K  V ENL+    APSVQMQ V   
Sbjct: 344 LPYNEYYNYYGPDYELDVRASNMENANSPEYLEKIKIAVIENLKKTAHAPSVQMQDVPRQ 403

Query: 65  XXXXXXXXXXXX---------DIRMSQRQRNTLVVPENELSDSEDEGNRRNERNYNSNGR 115
                                D+R++QRQ    V  ++E  +S+DE   R    Y +NGR
Sbjct: 404 SMGMTDEQEAELDDRDEDENPDVRVTQRQWEKRVQRQDEFEESDDEDIARANGVYKANGR 463

Query: 116 ESSSRKSRASHKN 128
                  R + K+
Sbjct: 464 SRQETTFRNTTKD 476



>gi|367053145|ref|XP_003656951.1| histone deacetylase-like protein [Thielavia terrestris NRRL 8126]
 gi|347004216|gb|AEO70615.1| histone deacetylase-like protein [Thielavia terrestris NRRL 8126]
          Length = 643

 Score = 76.6 bits (187), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (73%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           LPYN + EYYGP+Y+LDV A+NMEN N+  YL  +KA V ENL+    APSVQMQ V
Sbjct: 344 LPYNEYYEYYGPDYELDVRASNMENANSYEYLEKIKAAVIENLKRTAHAPSVQMQDV 400



>gi|47213589|emb|CAF93492.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 490

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 5/118 (4%)

Query: 3   EDLPYNNFLEYYGPEYKLDVPAN-NMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           ++LPYN++ EY+GP++K     + NM N NT  Y+  +K ++FENLR +P AP VQMQ +
Sbjct: 328 DELPYNDYFEYFGPDFKAAHSVHRNMTNQNTQEYMDKIKQRLFENLRMLPHAPGVQMQAI 387

Query: 62  XXXXX--XXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGR 115
                            D R+S R  +  +  + E SDSED  EG R+N  N+    +
Sbjct: 388 PEDAVPDDNVDEDTEDPDKRLSIRATDKRIACDEEFSDSEDEGEGGRKNVANHKKGAK 445



>gi|328703842|ref|XP_001946595.2| PREDICTED: histone deacetylase Rpd3-like [Acyrthosiphon pisum]
          Length = 491

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 10/122 (8%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LP N++ EY+GP+YKL +  +NM N N   +L  +K ++F+NLR +P AP VQ+Q 
Sbjct: 323 IANELPNNDYFEYFGPDYKLHISPSNMTNTNATKHLEKVKIRLFKNLRMLPHAPGVQVQA 382

Query: 61  VXXXXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSEDEG--------NRRNERNY 110
           +                 D R  Q   +  + P+NE SDSEDEG         R+N R+Y
Sbjct: 383 IPEDGVRNESDDEDNVNPDERKPQSITDKQIAPDNEYSDSEDEGMAPGVGGGGRKNNRSY 442

Query: 111 NS 112
            +
Sbjct: 443 KT 444



>gi|149016232|gb|EDL75478.1| rCG23915 [Rattus norvegicus]
          Length = 235

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P  P VQMQ +  
Sbjct: 83  ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHTPGVQMQAIPE 142

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENEL--SDSEDEGNRRNERNYNSNGR 115
                          D  +S    +  +  E E   SD E EG R N  N+    R
Sbjct: 143 DAIPEESGDEDEEDPDKPISICSSDKCIACEEEFPDSDEEGEGGRENSSNFKKAKR 198



>gi|14333978|gb|AAK58884.1| reduced potassium dependency 3 Rpd3p [Kluyveromyces lactis]
          Length = 432

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (73%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L E+LPYN++ EYYGP+YKLDV  +NM N+NTP YL  +   +F NL++  +APSVQ+  
Sbjct: 334 LDEELPYNDYYEYYGPDYKLDVRPSNMYNVNTPEYLDKVLLNIFSNLKHTKYAPSVQLNH 393

Query: 61  V 61
           V
Sbjct: 394 V 394



>gi|470317926|gb|EMR09616.1| hypothetical protein PNEG_02199 [Pneumocystis murina B123]
          Length = 526

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 64/113 (56%), Gaps = 13/113 (11%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +  ++P+N++ EYYGP Y L+VPA+NM+NMN+  YL  +K +V +NL    FAPSVQMQ 
Sbjct: 334 IGPEMPFNDYYEYYGPTYDLNVPASNMQNMNSKEYLEKIKTEVLKNLSRTKFAPSVQMQN 393

Query: 61  VXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPEN-----ELSDSEDE--GNRRN 106
           V               D      +R  ++  +N     E SDS+DE  GNRR+
Sbjct: 394 VPLDRNNDSEEEEEDPD------KRKNILWNKNPQRSDEFSDSDDEGDGNRRD 440



>gi|366997625|ref|XP_003683549.1| hypothetical protein TPHA_0A00300 [Tetrapisispora phaffii CBS 4417]
 gi|357521844|emb|CCE61115.1| hypothetical protein TPHA_0A00300 [Tetrapisispora phaffii CBS 4417]
          Length = 433

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLPYN++ EYYGP+YKLDV  +NM N+N+P YL  +   ++ NL N  +APSVQ+  
Sbjct: 334 LDEDLPYNDYYEYYGPDYKLDVRPSNMFNVNSPEYLDKILTSIYSNLENTKYAPSVQLNH 393

Query: 61  V 61
           V
Sbjct: 394 V 394



>gi|12963260|gb|AAK11182.1|AF321129_1 histone deacetylase 1 [Rattus norvegicus]
          Length = 256

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P  P VQMQ +  
Sbjct: 103 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHTPGVQMQAIPE 162

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENEL--SDSEDEGNRRNERNYNSNGR 115
                          D  +S    +  +  E E   SD E EG R N  N+    R
Sbjct: 163 DAIPEESGDEDEEDPDKPISICSSDKCIACEEEFPDSDEEGEGGRENSSNFKKAKR 218



>gi|164661303|ref|XP_001731774.1| hypothetical protein MGL_1042 [Malassezia globosa CBS 7966]
 gi|159105675|gb|EDP44560.1| hypothetical protein MGL_1042 [Malassezia globosa CBS 7966]
          Length = 442

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 69/118 (58%), Gaps = 8/118 (6%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQ--- 57
           LS +LP N + EY+GPEY+LDV  +NMEN+NT  YL  +K +VFENLR+I  APSVQ   
Sbjct: 208 LSSELPVNEYYEYFGPEYRLDVVPSNMENLNTREYLEKVKEQVFENLRHIAPAPSVQGHV 267

Query: 58  ---MQQVXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENEL--SDSEDEGNRRNERNY 110
              +                  DIR +Q Q++  +  E EL  SD E EG+RR+ R++
Sbjct: 268 EPRLAHDMALDDMGAHDDAANPDIRTTQDQKDRRIQRETELDDSDDEGEGDRRDRRSW 325



>gi|328709501|ref|XP_001943175.2| PREDICTED: histone deacetylase Rpd3-like [Acyrthosiphon pisum]
          Length = 482

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 10/122 (8%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +S +LPYN++ EY+ P+ KL +  + M+N N+  YL  +K ++FENLR +P AP VQ+Q 
Sbjct: 323 ISNELPYNDYFEYFLPDSKLHISPSKMKNTNSTKYLEKIKNRIFENLRMLPHAPGVQVQA 382

Query: 61  VXXXXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSEDE--------GNRRNERNY 110
           +                 D R  Q   +  + P+NE SDSEDE        G R++ R+Y
Sbjct: 383 IPEDGIHSESEDEDIVNPDERNPQSITDKQITPDNEFSDSEDEGMAPRVGDGGRKDNRSY 442

Query: 111 NS 112
            +
Sbjct: 443 KT 444



>gi|401884823|gb|EJT48964.1| histone deacetylase 1 (hd1) [Trichosporon asahii var. asahii CBS
           2479]
          Length = 518

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 45/61 (73%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLPYN +LEY+GP YKL+V   N+++ N P YL  +K  + ENLR +P APSVQM++
Sbjct: 300 LPEDLPYNRYLEYFGPRYKLEVMPTNVDDHNPPEYLEALKRTIAENLRELPHAPSVQMRE 359

Query: 61  V 61
           V
Sbjct: 360 V 360



>gi|406694461|gb|EKC97788.1| histone deacetylase 1 (hd1) [Trichosporon asahii var. asahii CBS
           8904]
          Length = 518

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 45/61 (73%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L EDLPYN +LEY+GP YKL+V   N+++ N P YL  +K  + ENLR +P APSVQM++
Sbjct: 300 LPEDLPYNRYLEYFGPRYKLEVMPTNVDDHNPPEYLEALKRTIAENLRELPHAPSVQMRE 359

Query: 61  V 61
           V
Sbjct: 360 V 360



>gi|358368808|dbj|GAA85424.1| histone deacetylase RpdA/Rpd3 [Aspergillus kawachii IFO 4308]
          Length = 686

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 71/148 (47%), Gaps = 30/148 (20%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N NT  YL  ++ +V ENL+   FAPSVQM +
Sbjct: 335 LGAELPYNDYYEYFAPDYELDVRPSNMDNANTKEYLDKIRTQVVENLKRTAFAPSVQMTE 394

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG------- 102
           V                          D R ++R+ +  +    ELSDS+DE        
Sbjct: 395 VPREPLVEGMDDEADAILDDLDEDENKDKRFTKRRFDQYIEKPGELSDSDDEELAGANGV 454

Query: 103 -------NRRNERNY-----NSNGRESS 118
                   RRN+ NY     N +G ES 
Sbjct: 455 RRQPNALKRRNQVNYRNLDVNDSGLESG 482



>gi|505755416|gb|EOQ99633.1| Histone deacetylase RPD3 [Wallemia ichthyophaga EXF-994]
          Length = 414

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 4/110 (3%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           LS  LP   + +Y+ P + LDVPA+NME++NT  YL ++KA +FENLR+I F PSVQ+Q 
Sbjct: 274 LSPHLPITEYHDYFAPSHTLDVPASNMEDLNTKQYLFNLKAAIFENLRDIDFTPSVQLQP 333

Query: 61  VXXXXXXXXXXXXXXX----DIRMSQRQRNTLVVPENELSDSEDEGNRRN 106
           V                   + R  QR  +  V  ++E SDS+ EG   N
Sbjct: 334 VPRMLHDDDDDHVLEDRDDPNSRRPQRLWDRNVQRDDEFSDSDGEGEGEN 383



>gi|45201491|ref|NP_987061.1| AGR395Wp [Ashbya gossypii ATCC 10895]
 gi|44986425|gb|AAS54885.1| AGR395Wp [Ashbya gossypii ATCC 10895]
 gi|374110312|gb|AEY99217.1| FAGR395Wp [Ashbya gossypii FDAG1]
          Length = 433

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 45/61 (73%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L E+LPYN++ EYYGP+YKLDV  +NM N+N+P YL  + A +F NL +  +APSVQ+  
Sbjct: 334 LDEELPYNDYYEYYGPDYKLDVRPSNMFNVNSPEYLDKVLASIFSNLEHTKYAPSVQLNH 393

Query: 61  V 61
           V
Sbjct: 394 V 394



>gi|293337197|ref|NP_001168837.1| uncharacterized protein LOC100382642 [Zea mays]
 gi|223973289|gb|ACN30832.1| unknown [Zea mays]
          Length = 686

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 71/148 (47%), Gaps = 30/148 (20%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N NT  YL  ++ +V ENL+   FAPSVQM +
Sbjct: 335 LGAELPYNDYYEYFAPDYELDVRPSNMDNANTKEYLDKIRTQVVENLKRTAFAPSVQMTE 394

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG------- 102
           V                          D R ++R+ +  +    ELSDS+DE        
Sbjct: 395 VPREPLVEGMDDEADAILDDLDEDENKDKRFTKRRFDQYIEKPGELSDSDDEELAGANGV 454

Query: 103 -------NRRNERNY-----NSNGRESS 118
                   RRN+ NY     N +G ES 
Sbjct: 455 RRQPNALKRRNQVNYRNLDVNDSGLESG 482



>gi|391337144|ref|XP_003742933.1| PREDICTED: histone deacetylase 1-like [Metaseiulus occidentalis]
          Length = 481

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 46/59 (77%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQ 59
           ++ +LPYN++ EY+GP++KL +  +NM N N+P Y+  ++ ++FENLR +P APSVQMQ
Sbjct: 326 IANELPYNDYFEYFGPDFKLHISPSNMANQNSPEYVDKIRTRLFENLRMLPHAPSVQMQ 384



>gi|402581368|gb|EJW75316.1| hypothetical protein WUBG_13778, partial [Wuchereria bancrofti]
          Length = 239

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 46/59 (77%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQ 59
           +S +LPYN++ EYY  ++KL +  +NM N+NTP YL  M++ +FE+LR++P APSVQMQ
Sbjct: 131 ISNELPYNDYFEYYSNDFKLHIIPSNMTNLNTPDYLQKMQSTIFEHLRHLPHAPSVQMQ 189



>gi|367008140|ref|XP_003678570.1| hypothetical protein TDEL_0A00270 [Torulaspora delbrueckii]
 gi|359746227|emb|CCE89359.1| hypothetical protein TDEL_0A00270 [Torulaspora delbrueckii]
          Length = 433

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 44/61 (72%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EYYGP+YKLDV  +NM N+NTP YL  +   +FENL N  +APSVQ+  
Sbjct: 334 LDSELPYNDYYEYYGPDYKLDVRPSNMYNVNTPEYLDKIVRSIFENLENTKYAPSVQLNN 393

Query: 61  V 61
           V
Sbjct: 394 V 394



>gi|145238426|ref|XP_001391860.1| histone deacetylase 1 [Aspergillus niger CBS 513.88]
 gi|134076345|emb|CAK39601.1| unnamed protein product [Aspergillus niger]
 gi|350635842|gb|EHA24203.1| hypothetical protein ASPNIDRAFT_209473 [Aspergillus niger ATCC
           1015]
          Length = 688

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 71/148 (47%), Gaps = 30/148 (20%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N NT  YL  ++ +V ENL+   FAPSVQM +
Sbjct: 335 LGAELPYNDYYEYFAPDYELDVRPSNMDNANTKEYLDKIRTQVVENLKRTAFAPSVQMTE 394

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEG------- 102
           V                          D R ++R+ +  +    ELSDS+DE        
Sbjct: 395 VPREPLVEGMDDEADAILDDLDEDENKDKRFTKRRFDQYIEKPGELSDSDDEELAGANGV 454

Query: 103 -------NRRNERNY-----NSNGRESS 118
                   RRN+ NY     N +G ES 
Sbjct: 455 RRQPNALKRRNQVNYRNLDVNDSGLESG 482



>gi|392571343|gb|EIW64515.1| histone deacetylase [Trametes versicolor FP-101664 SS1]
          Length = 538

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 7/131 (5%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L +++P N + EY+GP+Y+LDV ++NM++MN+P YL  +K  V E+LR++   PSVQMQ 
Sbjct: 329 LGKEIPMNEYYEYFGPDYELDVKSSNMDDMNSPEYLERVKGIVLEHLRHVGGPPSVQMQD 388

Query: 61  -----VXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSN 113
                V               + R   R+ +     + ELSDS+D  EG RRN  ++   
Sbjct: 389 VPRMPVDELVEDDPDEDMDDPNDRRPTRRLDARRQADGELSDSDDEGEGGRRNHASHKDA 448

Query: 114 GRESSSRKSRA 124
              ++ R+  A
Sbjct: 449 DSPTTGRRFGA 459



>gi|331224551|ref|XP_003324947.1| histone deacetylase 1/2 [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|309303937|gb|EFP80528.1| histone deacetylase 1/2 [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 606

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 44/54 (81%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQ 57
           DLPYN ++EY+GP +KL+VP+NNM+N N+  YL  + AKV ++LR++PFAPS Q
Sbjct: 328 DLPYNEYMEYFGPNFKLEVPSNNMDNHNSLDYLNGILAKVVDSLRDLPFAPSTQ 381



>gi|425769279|gb|EKV07776.1| Histone deacetylase RpdA/Rpd3 [Penicillium digitatum Pd1]
 gi|425770877|gb|EKV09337.1| Histone deacetylase RpdA/Rpd3 [Penicillium digitatum PHI26]
          Length = 625

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 64/135 (47%), Gaps = 25/135 (18%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N NT  YL  ++ +V ENL+   FAPSVQM  
Sbjct: 331 LGSELPYNDYYEYFAPDYQLDVRPSNMDNANTREYLDKIRNQVVENLKRTAFAPSVQMTD 390

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGN------ 103
           V                          D R +QR+ +       ELSDSEDE        
Sbjct: 391 VPRNPILDGMDDEADDVMDDLDEDENKDKRFTQRRFDQRTEKAGELSDSEDEAENAANGV 450

Query: 104 --------RRNERNY 110
                   RRN+ NY
Sbjct: 451 RRQPGATRRRNQVNY 465



>gi|478430997|ref|NP_445898.1| histone deacetylase 1-like [Rattus norvegicus]
          Length = 484

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV-- 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P  P VQMQ +  
Sbjct: 329 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHTPGVQMQAIPE 388

Query: 62  XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENEL--SDSEDEGNRRNERNYNSNGR 115
                          D  +S    +  +  E E   SD E EG R N  N+    R
Sbjct: 389 DAIPEESGDEDEEDPDKPISICSSDKCIACEEEFPDSDEEGEGGRENSSNFKKAKR 444



>gi|50308073|ref|XP_454037.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49643172|emb|CAG99124.1| KLLA0E01981p [Kluyveromyces lactis]
          Length = 432

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L E+LPYN++ EYYGP+YKLDV  +NM N+NTP YL  +   +F NL +  +APSVQ+  
Sbjct: 334 LDEELPYNDYYEYYGPDYKLDVRPSNMYNVNTPEYLDKVLLNIFSNLEHTKYAPSVQLNH 393

Query: 61  V 61
           V
Sbjct: 394 V 394



>gi|154321467|ref|XP_001560049.1| hypothetical protein BC1G_01608 [Botryotinia fuckeliana B05.10]
 gi|472244843|gb|EMR89445.1| putative histone deacetylase rpd3 protein [Botryotinia fuckeliana
           BcDW1]
          Length = 633

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 42/57 (73%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           LPYN + EYYGP+Y+LDV A+NMEN N+  YL  +K +V ENL+    APSVQMQ V
Sbjct: 338 LPYNEYYEYYGPDYELDVRASNMENANSKDYLEKIKIQVIENLKRTAHAPSVQMQDV 394



>gi|347830984|emb|CCD46681.1| similar to histone deacetylase RpdA/Rpd3 [Botryotinia fuckeliana
           T4]
          Length = 633

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 42/57 (73%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           LPYN + EYYGP+Y+LDV A+NMEN N+  YL  +K +V ENL+    APSVQMQ V
Sbjct: 338 LPYNEYYEYYGPDYELDVRASNMENANSKDYLEKIKIQVIENLKRTAHAPSVQMQDV 394



>gi|255942905|ref|XP_002562221.1| Pc18g03850 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586954|emb|CAP94609.1| Pc18g03850 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 641

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 75/160 (46%), Gaps = 25/160 (15%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N NT  YL  ++ +V ENL+   FAPSVQM  
Sbjct: 331 LGSELPYNDYYEYFAPDYQLDVRPSNMDNANTKEYLDKIRNQVVENLKRTAFAPSVQMTD 390

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDEGN------ 103
           V                          D R +QR+ +       ELSDSEDE        
Sbjct: 391 VPRNPILDGMDDEADDVMDDLDEDENKDKRFTQRRFDQRTEKAGELSDSEDEDENAANGV 450

Query: 104 --------RRNERNYNSNGRESSSRKSRASHKNSSNEHEG 135
                   RRN+ NY +   +S      A+ ++ S+  +G
Sbjct: 451 RRQPGGMRRRNQVNYRNLEPDSGLDSGMATPQDGSSAADG 490



>gi|432947249|ref|XP_004083964.1| PREDICTED: histone deacetylase 2-like [Oryzias latipes]
          Length = 489

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 44/59 (74%)

Query: 3   EDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           ++LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +
Sbjct: 328 DELPYNDYFEYFGPDFKLHISPSNMTNQNTQEYLDKIKQRLFENLRMLPHAPGVQMQAI 386



>gi|225709884|gb|ACO10788.1| Histone deacetylase 1 [Caligus rogercresseyi]
          Length = 475

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 45/61 (73%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EY+GP++KL +  +NM N NTP Y+  +K ++FENLR +P AP VQM  
Sbjct: 325 IANELPYNDYFEYFGPDFKLHISPSNMGNQNTPEYMDKIKTRLFENLRMLPHAPGVQMAN 384

Query: 61  V 61
           +
Sbjct: 385 I 385



>gi|405121239|gb|AFR96008.1| histone deacetylase 2 [Cryptococcus neoformans var. grubii H99]
          Length = 471

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 67/124 (54%), Gaps = 6/124 (4%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  DLP N + EYYGP+Y+LDV ++NM + NTP YL  +K  VFE LR+   APSV +Q 
Sbjct: 328 LGRDLPNNEYWEYYGPDYELDVRSSNMTDQNTPEYLQKVKEAVFEVLRDKNAAPSVPLQS 387

Query: 61  VXXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENE----LSDSEDE--GNRRNERNYNSNG 114
           V               +     R+   L   E +    LSDSEDE  G RR+ R+Y  + 
Sbjct: 388 VPKMMHDDEDEDEGEDNEDKDIRRPARLWAREKQHETSLSDSEDEGTGGRRHRRSYKESA 447

Query: 115 RESS 118
           ++++
Sbjct: 448 QKNT 451



>gi|343055635|gb|AEL79596.1| Histone deacetylase 1 [Pantholops hodgsonii]
          Length = 482

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (75%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           +LPYN++LEY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +
Sbjct: 327 ELPYNDYLEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAI 384



>gi|510952845|gb|AGN56197.1| histone deacetylase RpdA [Penicillium citrinum]
 gi|510952849|gb|AGN56199.1| histone deacetylase RpdA [Penicillium citrinum]
          Length = 639

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 75/160 (46%), Gaps = 25/160 (15%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EY+ P+Y+LDV  +NM+N NT  YL  ++ +V ENL+   FAPSVQM  
Sbjct: 331 LGSELPYNDYYEYFAPDYQLDVRPSNMDNANTREYLDKIRNQVVENLKRTAFAPSVQMTD 390

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDE-------- 101
           V                          D R +QR+ +       ELSDSEDE        
Sbjct: 391 VPRNPILDGMDDEADDVMDDLDEDENKDKRFTQRRFDQRTEKAGELSDSEDEDENAANGV 450

Query: 102 ------GNRRNERNYNSNGRESSSRKSRASHKNSSNEHEG 135
                   RRN+ NY +   +S      A+ ++ S+  +G
Sbjct: 451 RRQPGASRRRNQVNYRNLEPDSGLDSGMATPQDGSSAADG 490



>gi|50285207|ref|XP_445032.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524335|emb|CAG57932.1| unnamed protein product [Candida glabrata]
          Length = 433

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L ++LPYN + EYYGP+YKLDV  +NM N+NTP YL  +   +F+NL N  +APSVQ+  
Sbjct: 334 LDQELPYNEYYEYYGPDYKLDVRPSNMYNVNTPEYLDKILLGIFQNLENTKYAPSVQLNN 393

Query: 61  V 61
           V
Sbjct: 394 V 394



>gi|407919962|gb|EKG13181.1| Histone deacetylase superfamily [Macrophomina phaseolina MS6]
          Length = 691

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 60/112 (53%), Gaps = 11/112 (9%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L   LPYN++ +Y+ P+++LDV  +NM+N N+P YL  ++ +V EN++   FAPSVQM  
Sbjct: 336 LGPQLPYNDYFDYFAPDFELDVRPSNMDNANSPEYLDKIRTQVIENIKRTAFAPSVQMTD 395

Query: 61  V-----------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDE 101
           V                          D+R +Q + +  V  E ELS+SEDE
Sbjct: 396 VPRSPLMPGMDDEAEDEMNDMDEDENPDVRYTQHRWDKRVEKEGELSESEDE 447



>gi|156053950|ref|XP_001592901.1| hypothetical protein SS1G_05823 [Sclerotinia sclerotiorum 1980]
 gi|154703603|gb|EDO03342.1| hypothetical protein SS1G_05823 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 626

 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 42/57 (73%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           LPYN + EYYGP+Y+LDV A+NMEN N+  YL  +K +V ENL+    APSVQMQ V
Sbjct: 338 LPYNEYYEYYGPDYELDVRASNMENANSKDYLEKIKIQVIENLKRTAHAPSVQMQDV 394



>gi|470632759|ref|XP_004322371.1| PREDICTED: LOW QUALITY PROTEIN: histone deacetylase 2-like
           [Tursiops truncatus]
          Length = 487

 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 64/118 (54%), Gaps = 4/118 (3%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQVXX 63
           +LPYN++ E +GP++KL +  +N+ N NTP Y   +K ++ ENLR +P A  VQMQ +  
Sbjct: 328 ELPYNDYFENFGPDFKLHISPSNVTNQNTPEYTEKIKQRLSENLRMLPHAAGVQMQAIPE 387

Query: 64  XXXXXXXXXXXXX--DIRMSQRQRNTLVVPENELSDSED--EGNRRNERNYNSNGRES 117
                          D R+S R  +  +  + E SDSED  EG RRN  ++    +++
Sbjct: 388 DAVHEDSGDEDREDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKA 445



>gi|432884272|ref|XP_004074465.1| PREDICTED: probable histone deacetylase 1-B-like isoform 1 [Oryzias
           latipes]
          Length = 482

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 43/58 (74%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTTEYLEKIKQRLFENLRMLPHAPGVQMQAI 384



>gi|432884274|ref|XP_004074466.1| PREDICTED: probable histone deacetylase 1-B-like isoform 2 [Oryzias
           latipes]
          Length = 469

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 43/58 (74%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +
Sbjct: 327 ELPYNDYFEYFGPDFKLHISPSNMTNQNTTEYLEKIKQRLFENLRMLPHAPGVQMQAI 384



>gi|403213303|emb|CCK67805.1| hypothetical protein KNAG_0A01160 [Kazachstania naganishii CBS
           8797]
          Length = 433

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 45/61 (73%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           L  +LPYN++ EYYGP+YKLDV  +NM N+NTP YL  + + +++NL N  +APSVQ+  
Sbjct: 334 LDAELPYNDYYEYYGPDYKLDVRPSNMFNVNTPEYLDHILSSIYKNLENTKYAPSVQLNH 393

Query: 61  V 61
           V
Sbjct: 394 V 394



>gi|444707342|gb|ELW48624.1| Histone deacetylase 1 [Tupaia chinensis]
          Length = 509

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 43/58 (74%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +
Sbjct: 355 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAI 412



>gi|301115106|ref|XP_002905282.1| histone deacetylase, putative [Phytophthora infestans T30-4]
 gi|262110071|gb|EEY68123.1| histone deacetylase, putative [Phytophthora infestans T30-4]
          Length = 447

 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 42/52 (80%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSV 56
           +PYN++ EYYGPEY+L +P +NMEN+NTPAYL ++K ++ ENLR I   PSV
Sbjct: 340 MPYNDYFEYYGPEYRLHLPVSNMENLNTPAYLDEIKRQIHENLRQIEPVPSV 391



>gi|358390497|gb|EHK39902.1| hypothetical protein TRIATDRAFT_163610, partial [Trichoderma
           atroviride IMI 206040]
          Length = 672

 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 73/149 (48%), Gaps = 24/149 (16%)

Query: 5   LPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV--- 61
           LPYN + EYY P+++L+V ++NMEN N+  YL  + A V +NLR+   APSVQMQ V   
Sbjct: 339 LPYNEYYEYYAPDFELNVRSSNMENSNSREYLEKITAAVIDNLRHTGPAPSVQMQDVPRK 398

Query: 62  -------XXXXXXXXXXXXXXXDIRMSQRQRNTLVVPENELSDSEDE------------G 102
                                 D+RM+Q + +  V  ENE   S+D+            G
Sbjct: 399 PFGGMTDEEEAELDDMDEDENKDVRMTQHRWDKRVEHENEFEPSDDDEMARANGATRANG 458

Query: 103 NRRNERNYNSNGRESSSRKSRASHKNSSN 131
           N+R   +Y +  +E  S   RAS   ++N
Sbjct: 459 NKRTFNDYRTGDKEDDSE--RASPATATN 485



>gi|405963641|gb|EKC29198.1| Histone deacetylase Rpd3 [Crassostrea gigas]
          Length = 200

 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 44/61 (72%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           ++ +LPYN++ EYYGP++KL +  +NM N NT  Y+  +K ++FENLR +P AP VQM  
Sbjct: 53  IANELPYNDYFEYYGPDFKLHISPSNMANQNTGEYMDKIKTRLFENLRMLPHAPGVQMTA 112

Query: 61  V 61
           +
Sbjct: 113 I 113



>gi|402079504|gb|EJT74769.1| histone deacetylase RPD3 [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 667

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 43/61 (70%)

Query: 1   LSEDLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQ 60
           +S +LPYN + EYYGP+Y+LDV A+NMEN N+  YL  +K  V ENLR     PSVQMQ 
Sbjct: 344 MSRELPYNEYYEYYGPDYELDVRASNMENANSNEYLEKIKISVIENLRKTAPVPSVQMQD 403

Query: 61  V 61
           +
Sbjct: 404 I 404



>gi|507694877|ref|XP_004643035.1| PREDICTED: histone deacetylase 1 [Octodon degus]
          Length = 390

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 43/58 (74%)

Query: 4   DLPYNNFLEYYGPEYKLDVPANNMENMNTPAYLADMKAKVFENLRNIPFAPSVQMQQV 61
           +LPYN++ EY+GP++KL +  +NM N NT  YL  +K ++FENLR +P AP VQMQ +
Sbjct: 235 ELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAI 292