BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10334_c0_seq2-m.119 5prime_partial 2-964(+) 321 (+)
         (320 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511005017|gb|EPB86370.1| hypothetical protein HMPREF1544_0681...   246   6e-63   Mucor circinelloides f. circinelloides 1006PhL
gi|299748190|ref|XP_001837530.2| hypothetical protein CC1G_01442...   167   5e-39   Coprinopsis cinerea okayama7#130
gi|406696596|gb|EKC99878.1| ribosome biogenesis-related protein ...   166   7e-39   Trichosporon asahii var. asahii CBS 8904
gi|401881581|gb|EJT45879.1| ribosome biogenesis-related protein ...   166   9e-39   Trichosporon asahii var. asahii CBS 2479
gi|242221362|ref|XP_002476431.1| predicted protein [Postia place...   163   7e-38   Postia placenta Mad-698-R
gi|164659472|ref|XP_001730860.1| hypothetical protein MGL_1859 [...   162   1e-37   Malassezia globosa CBS 7966
gi|472588228|gb|EMS25700.1| ribosomal biogenesis regulatory prot...   159   7e-37   Rhodotorula toruloides NP11
gi|403413739|emb|CCM00439.1| predicted protein [Fibroporia radic...   159   8e-37   Fibroporia radiculosa
gi|260801679|ref|XP_002595723.1| hypothetical protein BRAFLDRAFT...   159   1e-36   Branchiostoma floridae
gi|505757196|gb|EOR01322.1| Regulator of ribosome biosynthesi [W...   159   1e-36   Wallemia ichthyophaga EXF-994
gi|353237099|emb|CCA69080.1| related to RRS1-regulator of riboso...   157   3e-36   Serendipita indica DSM 11827
gi|392568457|gb|EIW61631.1| RRS1-domain-containing protein [Tram...   157   3e-36   Trametes versicolor FP-101664 SS1
gi|388584012|gb|EIM24313.1| RRS1-domain-containing protein [Wall...   156   6e-36   Wallemia mellicola CBS 633.66
gi|340368757|ref|XP_003382917.1| PREDICTED: ribosome biogenesis ...   156   7e-36   Amphimedon queenslandica
gi|409049634|gb|EKM59111.1| hypothetical protein PHACADRAFT_2493...   152   8e-35   Phanerochaete carnosa HHB-10118-sp
gi|443900152|dbj|GAC77479.1| regulator of ribosome synthesis [Ps...   151   3e-34   Moesziomyces antarcticus T-34
gi|465793145|emb|CCU98266.1| unnamed protein product [Malassezia...   150   6e-34   Malassezia sympodialis ATCC 42132
gi|198435348|ref|XP_002125582.1| PREDICTED: ribosome biogenesis ...   149   1e-33   Ciona intestinalis [sea vase]
gi|392579956|gb|EIW73083.1| hypothetical protein TREMEDRAFT_2289...   149   1e-33   Tremella mesenterica DSM 1558
gi|72010693|ref|XP_781111.1| PREDICTED: ribosome biogenesis regu...   147   3e-33   Strongylocentrotus purpuratus [purple urchin]
gi|328770705|gb|EGF80746.1| hypothetical protein BATDEDRAFT_6086...   147   4e-33   Batrachochytrium dendrobatidis JAM81
gi|71021335|ref|XP_760898.1| hypothetical protein UM04751.1 [Ust...   144   2e-32   
gi|501309512|dbj|GAC98336.1| likely ribosome biogenesis regulato...   144   3e-32   Pseudozyma hubeiensis SY62
gi|390601451|gb|EIN10845.1| RRS1-domain-containing protein [Punc...   142   1e-31   Punctularia strigosozonata HHB-11173 SS5
gi|402226300|gb|EJU06360.1| RRS1-domain-containing protein [Dacr...   142   2e-31   Dacryopinax primogenitus
gi|58262216|ref|XP_568518.1| ribosome biogenesis-related protein...   140   4e-31   Cryptococcus neoformans var. neoformans JEC21
gi|471908923|emb|CCO28186.1| Ribosome biogenesis regulatory prot...   140   4e-31   Rhizoctonia solani AG-1 IB
gi|393246467|gb|EJD53976.1| RRS1-domain-containing protein [Auri...   140   6e-31   Auricularia subglabra TFB-10046 SS5
gi|443927102|gb|ELU45633.1| RRS1 domain-containing protein [Rhiz...   139   1e-30   Rhizoctonia solani AG-1 IA
gi|391340812|ref|XP_003744730.1| PREDICTED: ribosome biogenesis ...   138   2e-30   Metaseiulus occidentalis
gi|343426175|emb|CBQ69706.1| related to RRS1-regulator of riboso...   137   3e-30   Sporisorium reilianum SRZ2
gi|302691982|ref|XP_003035670.1| hypothetical protein SCHCODRAFT...   137   5e-30   Schizophyllum commune H4-8
gi|388857200|emb|CCF49213.1| related to RRS1-regulator of riboso...   136   8e-30   Ustilago hordei
gi|395849345|ref|XP_003797289.1| PREDICTED: ribosome biogenesis ...   135   1e-29   Otolemur garnettii
gi|507938408|ref|XP_004679889.1| PREDICTED: ribosome biogenesis ...   135   2e-29   Condylura cristata
gi|195998666|ref|XP_002109201.1| hypothetical protein TRIADDRAFT...   135   2e-29   Trichoplax adhaerens
gi|328858583|gb|EGG07695.1| hypothetical protein MELLADRAFT_6250...   135   2e-29   Melampsora larici-populina 98AG31
gi|358057274|dbj|GAA96883.1| hypothetical protein E5Q_03556 [Mix...   134   3e-29   Mixia osmundae IAM 14324
gi|170044045|ref|XP_001849672.1| regulator of ribosome biosynthe...   134   4e-29   Culex quinquefasciatus
gi|426359826|ref|XP_004047162.1| PREDICTED: ribosome biogenesis ...   133   8e-29   Gorilla gorilla gorilla [lowland gorilla]
gi|471364113|ref|XP_004372607.1| PREDICTED: ribosome biogenesis ...   132   9e-29   Trichechus manatus latirostris
gi|297682996|ref|XP_002819191.1| PREDICTED: ribosome biogenesis ...   132   9e-29   
gi|434779|dbj|BAA04948.1| KIAA0112 [Homo sapiens]                     132   1e-28   
gi|14719402|ref|NP_055984.1| ribosome biogenesis regulatory prot...   132   1e-28   Homo sapiens [man]
gi|348588476|ref|XP_003479992.1| PREDICTED: ribosome biogenesis ...   131   2e-28   Cavia porcellus [guinea pig]
gi|397522742|ref|XP_003831415.1| PREDICTED: ribosome biogenesis ...   131   2e-28   Pan paniscus [bonobo]
gi|431891814|gb|ELK02348.1| Ribosome biogenesis regulatory prote...   131   3e-28   Pteropus alecto
gi|7670442|dbj|BAA95072.1| unnamed protein product [Mus musculus]     131   3e-28   Mus musculus [mouse]
gi|227908779|ref|NP_067486.2| ribosome biogenesis regulatory pro...   131   3e-28   Mus musculus [mouse]
gi|49022822|dbj|BAC65489.2| mKIAA0112 protein [Mus musculus]          131   3e-28   Mus musculus [mouse]
gi|12860310|dbj|BAB31912.1| unnamed protein product [Mus musculus]    131   3e-28   Mus musculus [mouse]
gi|357608815|gb|EHJ66162.1| putative regulator of ribosome biosy...   131   3e-28   Danaus plexippus [American monarch]
gi|440908356|gb|ELR58380.1| Ribosome biogenesis regulatory prote...   130   3e-28   Bos mutus
gi|443689971|gb|ELT92238.1| hypothetical protein CAPTEDRAFT_1714...   130   3e-28   Capitella teleta
gi|470644583|ref|XP_004326595.1| PREDICTED: LOW QUALITY PROTEIN:...   130   3e-28   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|466034379|ref|XP_004275011.1| PREDICTED: ribosome biogenesis ...   130   3e-28   Orcinus orca [Orca]
gi|311253771|ref|XP_003125652.1| PREDICTED: ribosome biogenesis ...   130   4e-28   Sus scrofa [pigs]
gi|344273133|ref|XP_003408381.1| PREDICTED: ribosome biogenesis ...   130   4e-28   Loxodonta africana [African bush elephant]
gi|403164650|ref|XP_003324729.2| hypothetical protein PGTG_06266...   130   5e-28   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|507538708|ref|XP_004653370.1| PREDICTED: ribosome biogenesis ...   130   5e-28   Jaculus jaculus
gi|170090662|ref|XP_001876553.1| predicted protein [Laccaria bic...   130   5e-28   Laccaria bicolor S238N-H82
gi|512818753|ref|XP_004878921.1| PREDICTED: ribosome biogenesis ...   130   6e-28   
gi|321463110|gb|EFX74128.1| hypothetical protein DAPPUDRAFT_3074...   130   6e-28   Daphnia pulex
gi|296226606|ref|XP_002759025.1| PREDICTED: ribosome biogenesis ...   130   7e-28   
gi|488584946|ref|XP_004477844.1| PREDICTED: ribosome biogenesis ...   129   7e-28   Dasypus novemcinctus
gi|149721357|ref|XP_001494863.1| PREDICTED: ribosome biogenesis ...   129   7e-28   Equus caballus [domestic horse]
gi|336373761|gb|EGO02099.1| hypothetical protein SERLA73DRAFT_13...   129   9e-28   Serpula lacrymans var. lacrymans S7.3
gi|432927905|ref|XP_004081085.1| PREDICTED: ribosome biogenesis ...   129   1e-27   Oryzias latipes [Japanese rice fish]
gi|478523202|ref|XP_004435804.1| PREDICTED: ribosome biogenesis ...   129   1e-27   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|472365593|ref|XP_004402349.1| PREDICTED: ribosome biogenesis ...   129   1e-27   Odobenus rosmarus divergens
gi|296480600|tpg|DAA22715.1| TPA: ribosome biogenesis regulatory...   129   1e-27   Bos taurus [bovine]
gi|511907155|ref|XP_004773029.1| PREDICTED: ribosome biogenesis ...   129   2e-27   Mustela putorius furo [black ferret]
gi|291388062|ref|XP_002710493.1| PREDICTED: homolog of yeast rib...   128   2e-27   Oryctolagus cuniculus [European rabbit]
gi|109086632|ref|XP_001100635.1| PREDICTED: ribosome biogenesis ...   128   2e-27   
gi|410987225|ref|XP_003999905.1| PREDICTED: ribosome biogenesis ...   128   2e-27   Felis catus [cat]
gi|115497948|ref|NP_001068949.1| ribosome biogenesis regulatory ...   128   2e-27   Bos taurus [bovine]
gi|119226200|ref|NP_001073167.1| ribosome biogenesis regulatory ...   128   2e-27   Rattus norvegicus [brown rat]
gi|301761996|ref|XP_002916418.1| PREDICTED: ribosome biogenesis ...   128   2e-27   Ailuropoda melanoleuca
gi|157131695|ref|XP_001662293.1| ribosome biogenesis regulatory ...   128   2e-27   Aedes aegypti
gi|12845436|dbj|BAB26750.1| unnamed protein product [Mus musculus]    128   3e-27   Mus musculus [mouse]
gi|507669887|ref|XP_004649132.1| PREDICTED: LOW QUALITY PROTEIN:...   127   3e-27   Octodon degus
gi|355779729|gb|EHH64205.1| Ribosome biogenesis regulatory prote...   127   3e-27   Macaca fascicularis [crab eating macaque]
gi|478250752|gb|ENN71244.1| hypothetical protein YQE_12171, part...   127   3e-27   Dendroctonus ponderosae
gi|355697994|gb|EHH28542.1| Ribosome biogenesis regulatory prote...   127   3e-27   Macaca mulatta [rhesus macaque]
gi|344304506|gb|EGW34738.1| hypothetical protein SPAPADRAFT_5780...   127   4e-27   Spathaspora passalidarum NRRL Y-27907
gi|57107921|ref|XP_544107.1| PREDICTED: ribosome biogenesis regu...   127   4e-27   
gi|504151475|ref|XP_004588076.1| PREDICTED: ribosome biogenesis ...   127   6e-27   Ochotona princeps [southern American pika]
gi|409079540|gb|EKM79901.1| hypothetical protein AGABI1DRAFT_113...   126   7e-27   Agaricus bisporus var. burnettii JB137-S8
gi|164448678|ref|NP_001088404.1| RRS1 ribosome biogenesis regula...   126   9e-27   Xenopus laevis [clawed frog]
gi|405978850|gb|EKC43211.1| Ribosome biogenesis regulatory-like ...   125   1e-26   Crassostrea gigas
gi|459367862|gb|EMG46764.1| Ribosome biogenesis [nuclear export]...   125   1e-26   Candida maltosa Xu316
gi|426192508|gb|EKV42444.1| hypothetical protein AGABI2DRAFT_195...   125   1e-26   Agaricus bisporus var. bisporus H97
gi|444318922|ref|XP_004180118.1| hypothetical protein TBLA_0D009...   125   2e-26   Tetrapisispora blattae CBS 6284
gi|126321316|ref|XP_001379079.1| PREDICTED: ribosome biogenesis ...   125   2e-26   Monodelphis domestica
gi|312371076|gb|EFR19340.1| hypothetical protein AND_22646 [Anop...   124   3e-26   
gi|189230132|ref|NP_001121390.1| uncharacterized protein LOC1001...   124   3e-26   
gi|348512152|ref|XP_003443607.1| PREDICTED: ribosome biogenesis ...   124   3e-26   
gi|326426829|gb|EGD72399.1| ribosome biogenesis protein Rrs1 [Sa...   124   4e-26   Salpingoeca rosetta
gi|498967615|ref|XP_004546707.1| PREDICTED: ribosome biogenesis ...   124   5e-26   Maylandia zebra
gi|238879409|gb|EEQ43047.1| regulator of ribosome biosynthesis [...   123   5e-26   Candida albicans WO-1
gi|198463129|ref|XP_001352703.2| GA16881 [Drosophila pseudoobscu...   123   6e-26   Drosophila pseudoobscura pseudoobscura
gi|167536855|ref|XP_001750098.1| hypothetical protein [Monosiga ...   123   6e-26   Monosiga brevicollis MX1
gi|325183780|emb|CCA18239.1| ribosome biogenesis regulatory prot...   122   1e-25   Albugo laibachii Nc14
gi|148232006|ref|NP_001085071.1| RRS1 ribosome biogenesis regula...   122   2e-25   Xenopus laevis [clawed frog]
gi|241948079|ref|XP_002416762.1| ribosome biogenesis [nuclear ex...   121   2e-25   Candida dubliniensis CD36
gi|126137852|ref|XP_001385449.1| hypothetical protein PICST_6158...   121   3e-25   Scheffersomyces stipitis CBS 6054
gi|513030416|gb|AGO10441.1| AaceriABL014Cp [Saccharomycetaceae s...   121   3e-25   Saccharomycetaceae sp. 'Ashbya aceri'
gi|156847608|ref|XP_001646688.1| hypothetical protein Kpol_1028p...   121   3e-25   Vanderwaltozyma polyspora DSM 70294
gi|254565237|ref|XP_002489729.1| Essential protein that binds ri...   120   4e-25   Komagataella phaffii GS115
gi|68473955|ref|XP_718874.1| likely ribosome biogenesis regulato...   120   4e-25   Candida albicans SC5314
gi|50424407|ref|XP_460790.1| DEHA2F09834p [Debaryomyces hansenii...   120   4e-25   Debaryomyces hansenii CBS767
gi|68473746|ref|XP_718976.1| likely ribosome biogenesis regulato...   120   5e-25   Candida albicans SC5314
gi|410076388|ref|XP_003955776.1| hypothetical protein KAFR_0B034...   120   6e-25   Kazachstania africana CBS 2517
gi|302306524|ref|NP_982933.2| ABL014Cp [Ashbya gossypii ATCC 108...   120   7e-25   Eremothecium gossypii ATCC 10895
gi|348668179|gb|EGZ08003.1| hypothetical protein PHYSODRAFT_5261...   120   7e-25   Phytophthora sojae
gi|323331594|gb|EGA73009.1| Rrs1p [Saccharomyces cerevisiae AWRI...   119   1e-24   Saccharomyces cerevisiae AWRI796
gi|449549471|gb|EMD40436.1| hypothetical protein CERSUDRAFT_1484...   119   1e-24   Gelatoporia subvermispora B
gi|6324868|ref|NP_014937.1| Rrs1p [Saccharomyces cerevisiae S288...   119   1e-24   Saccharomyces cerevisiae S288c
gi|207340921|gb|EDZ69122.1| YOR294Wp-like protein [Saccharomyces...   119   1e-24   Saccharomyces cerevisiae AWRI1631
gi|470319881|gb|EMR11491.1| hypothetical protein PNEG_00505 [Pne...   119   1e-24   Pneumocystis murina B123
gi|505776368|ref|XP_004602476.1| PREDICTED: ribosome biogenesis ...   117   4e-24   Sorex araneus [Eurasian shrew]
gi|512887748|ref|XP_004921974.1| PREDICTED: ribosome biogenesis ...   116   7e-24   Bombyx mori [silk moth]
gi|50304325|ref|XP_452112.1| hypothetical protein [Kluyveromyces...   116   8e-24   Kluyveromyces lactis NRRL Y-1140
gi|255730343|ref|XP_002550096.1| regulator of ribosome biosynthe...   116   1e-23   Candida tropicalis MYA-3404
gi|323346464|gb|EGA80752.1| Rrs1p [Saccharomyces cerevisiae Lalv...   115   2e-23   Saccharomyces cerevisiae Lalvin QA23
gi|443429412|gb|AGC92697.1| ribosome biogenesis regulatory prote...   115   2e-23   Heliconius erato
gi|323335347|gb|EGA76634.1| Rrs1p [Saccharomyces cerevisiae Vin13]    114   2e-23   Saccharomyces cerevisiae Vin13
gi|45709905|gb|AAH67632.1| Rrs1 protein, partial [Danio rerio]        114   3e-23   Danio rerio [leopard danio]
gi|41056045|ref|NP_956356.1| ribosome biogenesis regulatory prot...   114   3e-23   Danio rerio [leopard danio]
gi|344233092|gb|EGV64965.1| ribosomal biogenesis regulatory prot...   114   3e-23   Candida tenuis ATCC 10573
gi|363749573|ref|XP_003645004.1| hypothetical protein Ecym_2460 ...   114   3e-23   Eremothecium cymbalariae DBVPG#7215
gi|301116573|ref|XP_002906015.1| ribosome biogenesis regulatory ...   114   4e-23   Phytophthora infestans T30-4
gi|261335954|emb|CBH09287.1| putative regulator of ribosome bios...   114   5e-23   Heliconius melpomene [common postman]
gi|54650780|gb|AAV36969.1| LD45683p [Drosophila melanogaster]         113   5e-23   Drosophila melanogaster
gi|21483408|gb|AAM52679.1| LD24586p [Drosophila melanogaster]         113   6e-23   Drosophila melanogaster
gi|270012854|gb|EFA09302.1| hypothetical protein TcasGA2_TC03059...   113   7e-23   
gi|221330901|ref|NP_729108.2| CG32409 [Drosophila melanogaster] ...   113   7e-23   Drosophila melanogaster
gi|389746674|gb|EIM87853.1| RRS1-domain-containing protein [Ster...   113   8e-23   Stereum hirsutum FP-91666 SS1
gi|448520202|ref|XP_003868248.1| Rrs1 ribosome biogenesis and nu...   112   1e-22   Candida orthopsilosis Co 90-125
gi|405123744|gb|AFR98507.1| Rrs1 protein [Cryptococcus neoforman...   112   1e-22   Cryptococcus neoformans var. grubii H99
gi|194867287|ref|XP_001972038.1| GG15298 [Drosophila erecta] >gi...   112   1e-22   Drosophila erecta
gi|195337755|ref|XP_002035491.1| GM14731 [Drosophila sechellia] ...   112   1e-22   Drosophila sechellia
gi|195492113|ref|XP_002093850.1| GE21520 [Drosophila yakuba] >gi...   112   1e-22   Drosophila yakuba
gi|195588066|ref|XP_002083779.1| GD13910 [Drosophila simulans] >...   112   2e-22   Drosophila simulans
gi|410909081|ref|XP_003968019.1| PREDICTED: ribosome biogenesis ...   112   2e-22   Takifugu rubripes [tiger puffer]
gi|470267951|ref|XP_004362209.1| ribosome biogenesis regulatory ...   111   2e-22   Dictyostelium fasciculatum
gi|213513147|ref|NP_001134869.1| ribosome biogenesis regulatory ...   111   3e-22   Salmo salar
gi|498968006|ref|XP_004526203.1| PREDICTED: ribosome biogenesis ...   109   9e-22   Ceratitis capitata
gi|339241523|ref|XP_003376687.1| ribosome biogenesis regulatory ...   108   2e-21   Trichinella spiralis
gi|470293505|ref|XP_004343908.1| Rrs1 protein [Capsaspora owczar...   107   4e-21   Capsaspora owczarzaki ATCC 30864
gi|485638458|gb|EOD32863.1| hypothetical protein EMIHUDRAFT_3642...   107   5e-21   Emiliania huxleyi CCMP1516
gi|156381110|ref|XP_001632109.1| predicted protein [Nematostella...   107   5e-21   Nematostella vectensis
gi|195428745|ref|XP_002062426.1| GK16661 [Drosophila willistoni]...   106   7e-21   Drosophila willistoni
gi|512199294|gb|EPE28128.1| hypothetical protein GLAREA_04919 [G...   106   1e-20   Glarea lozoyensis ATCC 20868
gi|254586181|ref|XP_002498658.1| ZYRO0G15598p [Zygosaccharomyces...   105   1e-20   Zygosaccharomyces rouxii CBS 732
gi|345316560|ref|XP_001509960.2| PREDICTED: ribosome biogenesis ...   105   1e-20   
gi|242005813|ref|XP_002423755.1| ribosome biogenesis regulatory ...   105   2e-20   Pediculus humanus corporis [human body lice]
gi|47207991|emb|CAF91693.1| unnamed protein product [Tetraodon n...   105   2e-20   Tetraodon nigroviridis
gi|406862481|gb|EKD15531.1| ribosome biogenesis regulatory prote...   105   2e-20   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|345568148|gb|EGX51049.1| hypothetical protein AOL_s00054g785 ...   105   2e-20   Arthrobotrys oligospora ATCC 24927
gi|195127223|ref|XP_002008068.1| GI13300 [Drosophila mojavensis]...   105   2e-20   Drosophila mojavensis
gi|195020101|ref|XP_001985121.1| GH14686 [Drosophila grimshawi] ...   104   4e-20   Drosophila grimshawi
gi|440639714|gb|ELR09633.1| hypothetical protein GMDG_04124 [Geo...   104   4e-20   Pseudogymnoascus destructans 20631-21
gi|154314321|ref|XP_001556485.1| hypothetical protein BC1G_05254...   104   4e-20   Botrytis cinerea B05.10
gi|260947418|ref|XP_002618006.1| hypothetical protein CLUG_01465...   103   6e-20   Clavispora lusitaniae ATCC 42720
gi|195376833|ref|XP_002047197.1| GJ12069 [Drosophila virilis] >g...   103   7e-20   Drosophila virilis
gi|320581208|gb|EFW95429.1| ribosome biogenesis regulatory prote...   102   2e-19   
gi|146412013|ref|XP_001481978.1| hypothetical protein PGUG_05741...   101   3e-19   Meyerozyma guilliermondii ATCC 6260
gi|158286807|ref|XP_308939.3| AGAP006808-PA [Anopheles gambiae s...   100   4e-19   Anopheles gambiae str. PEST
gi|396478553|ref|XP_003840559.1| hypothetical protein LEMA_P1021...    99   1e-18   Leptosphaeria maculans JN3
gi|321265488|ref|XP_003197460.1| ribosome biogenesis-related pro...    99   1e-18   Cryptococcus gattii WM276
gi|268559672|ref|XP_002637827.1| Hypothetical protein CBG04617 [...    99   2e-18   Caenorhabditis briggsae
gi|330802790|ref|XP_003289396.1| hypothetical protein DICPUDRAFT...    99   2e-18   Dictyostelium purpureum
gi|451848526|gb|EMD61831.1| hypothetical protein COCSADRAFT_1469...    98   3e-18   Bipolaris sorokiniana ND90Pr
gi|308500300|ref|XP_003112335.1| CRE-RRBS-1 protein [Caenorhabdi...    98   3e-18   Caenorhabditis remanei
gi|451992617|gb|EMD85097.1| hypothetical protein COCHEDRAFT_1149...    98   4e-18   Bipolaris maydis C5
gi|317419902|emb|CBN81938.1| Ribosome biogenesis regulatory prot...    97   4e-18   Dicentrarchus labrax [European sea bass]
gi|393912353|gb|EJD76693.1| hypothetical protein LOAG_16371 [Loa...    97   7e-18   Loa loa
gi|441647489|ref|XP_003274825.2| PREDICTED: ribosome biogenesis ...    96   9e-18   Nomascus leucogenys [White-cheeked Gibbon]
gi|212535770|ref|XP_002148041.1| ribosome biogenesis protein (Rr...    95   2e-17   Talaromyces marneffei ATCC 18224
gi|341878072|gb|EGT34007.1| hypothetical protein CAEBREN_03804 [...    95   3e-17   Caenorhabditis brenneri
gi|148906982|gb|ABR16635.1| unknown [Picea sitchensis]                 95   3e-17   Picea sitchensis
gi|448089567|ref|XP_004196841.1| Piso0_004067 [Millerozyma farin...    94   5e-17   Millerozyma farinosa CBS 7064
gi|384499057|gb|EIE89548.1| hypothetical protein RO3G_14259 [Rhi...    94   7e-17   Rhizopus delemar RA 99-880
gi|17558012|ref|NP_506573.1| Protein RRBS-1 [Caenorhabditis eleg...    93   8e-17   Caenorhabditis elegans [roundworm]
gi|110758413|ref|XP_394666.3| PREDICTED: ribosome biogenesis reg...    93   9e-17   Apis mellifera [European honey bee]
gi|507115176|emb|CDF38667.1| ribosome biogenesis regulatory prot...    93   1e-16   Chondrus crispus [Irish moss]
gi|494830191|gb|EON66757.1| hypothetical protein W97_06003 [Coni...    91   4e-16   Coniosporium apollinis CBS 100218
gi|449683816|ref|XP_002164297.2| PREDICTED: ribosome biogenesis ...    91   4e-16   Hydra vulgaris
gi|294942683|ref|XP_002783644.1| ribosome biogenesis regulatory ...    91   6e-16   Perkinsus marinus ATCC 50983
gi|302802770|ref|XP_002983139.1| hypothetical protein SELMODRAFT...    91   6e-16   Selaginella moellendorffii
gi|225714086|gb|ACO12889.1| Ribosome biogenesis regulatory prote...    90   1e-15   Lepeophtheirus salmonis
gi|169601654|ref|XP_001794249.1| hypothetical protein SNOG_03697...    87   8e-15   Parastagonospora nodorum SN15
gi|224082902|ref|XP_002306885.1| predicted protein [Populus tric...    87   8e-15   
gi|307202400|gb|EFN81820.1| Ribosome biogenesis regulatory prote...    85   2e-14   Harpegnathos saltator
gi|482803592|gb|EOA80717.1| hypothetical protein SETTUDRAFT_4462...    84   5e-14   Setosphaeria turcica Et28A
gi|361130206|gb|EHL02060.1| putative Regulator of ribosome biosy...    84   5e-14   Glarea lozoyensis 74030
gi|294888421|ref|XP_002772457.1| ribosome biogenesis regulatory ...    84   6e-14   Perkinsus marinus ATCC 50983
gi|470101771|ref|XP_004287342.1| PREDICTED: ribosome biogenesis ...    84   7e-14   Fragaria vesca subsp. vesca
gi|256081805|ref|XP_002577158.1| ribosome biogenesis regulatory ...    82   2e-13   
gi|256081807|ref|XP_002577159.1| ribosome biogenesis regulatory ...    82   2e-13   
gi|302764948|ref|XP_002965895.1| hypothetical protein SELMODRAFT...    82   2e-13   Selaginella moellendorffii
gi|380018284|ref|XP_003693062.1| PREDICTED: ribosome biogenesis ...    82   3e-13   Apis florea [dwarf honeybee]
gi|290562752|gb|ADD38771.1| Ribosome biogenesis regulatory prote...    81   4e-13   Lepeophtheirus salmonis
gi|56753555|gb|AAW24980.1| SJCHGC02140 protein [Schistosoma japo...    80   5e-13   Schistosoma japonicum
gi|297745415|emb|CBI40495.3| unnamed protein product [Vitis vini...    78   3e-12   Vitis vinifera
gi|357445849|ref|XP_003593202.1| Ribosome biogenesis regulatory ...    78   3e-12   
gi|225454487|ref|XP_002281065.1| PREDICTED: ribosome biogenesis ...    78   3e-12   Vitis vinifera
gi|357445851|ref|XP_003593203.1| Ribosome biogenesis regulatory ...    78   3e-12   
gi|444724065|gb|ELW64686.1| Ribosome biogenesis regulatory prote...    75   2e-11   Tupaia chinensis
gi|147832302|emb|CAN77790.1| hypothetical protein VITISV_033191 ...    74   6e-11   Vitis vinifera
gi|410041938|ref|XP_003311861.2| PREDICTED: LOW QUALITY PROTEIN:...    74   7e-11   


>gi|511005017|gb|EPB86370.1| hypothetical protein HMPREF1544_06812 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 313

 Score =  246 bits (628), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 137/312 (43%), Positives = 180/312 (57%), Gaps = 42/312 (13%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLK--NDTDNYLKEYTRDGTQLL 65
           L+  ++++K ITVE+ +PL +D+ LL+AFDTN LDE  LK  N TD YL + TRD TQL+
Sbjct: 7   LDAHQAQFKPITVEKLVPLDFDINLLSAFDTNTLDEKTLKSKNSTDKYLLDLTRDNTQLI 66

Query: 66  INQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXX 125
           IN++FKLP+ ++D G LA+LP +++V+PREKP         P++  L             
Sbjct: 67  INELFKLPVNSADAGVLAQLPARVSVLPREKP--------LPKDKPL------------- 105

Query: 126 XXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA-- 183
                          TRWEKFAK KGIQ++ +++M+YDE TGE+ PRWGYKG   +GA  
Sbjct: 106 ---------------TRWEKFAKVKGIQNKKRDRMVYDEETGEYTPRWGYKGAKPEGALD 150

Query: 184 NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRK 243
            DWL+PVP + DP EDQ++                 RRN EE  AA    K  D +  +K
Sbjct: 151 QDWLMPVPDHADPMEDQYAKAREEKKGRVEKNTKRQRRNQEEGTAATLAGK-KDIKEFKK 209

Query: 244 GELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSIGDXXXXXXXXXXXXXXXXG 303
            ELQ  IA SK ATAS+GKFD  LKGE K+KGV  +F P+IGD                G
Sbjct: 210 EELQTAIAASKKATASVGKFDNKLKGETKMKGVTHQFSPTIGDVKAEKNSSLDILKKIVG 269

Query: 304 KKGDIVNVRKAI 315
            K DIVN  KA+
Sbjct: 270 -KNDIVNTEKAV 280



>gi|299748190|ref|XP_001837530.2| hypothetical protein CC1G_01442 [Coprinopsis cinerea okayama7#130]
 gi|298407856|gb|EAU84446.2| hypothetical protein CC1G_01442 [Coprinopsis cinerea okayama7#130]
          Length = 308

 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 143/283 (50%), Gaps = 45/283 (15%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S  LE QK+K +S+ VE+  PL  D   L   D N +DE     + + +L+   RDG Q
Sbjct: 3   VSSILEAQKAKERSVLVEKETPLVVDAGHLMVTDLNVIDEESYNENLEEHLQSLARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
            LI  +F LP T+S+ G LA+LP Q   +PR KP      L  P+ +             
Sbjct: 63  ALIGTLFSLPTTSSEEGPLAQLPPQEYQLPRAKP------LPKPKPM------------- 103

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            T+WE+FA AKGIQH+ +++ ++DE   EWV RWG  G N +  
Sbjct: 104 -----------------TKWERFAAAKGIQHKKRDRKVWDEEKQEWVNRWGRDGKNKEAE 146

Query: 184 NDWLIPVPQNDDP-FEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR 242
             W  PVP N D  +  Q                    +N ++    + +  G+ A++ R
Sbjct: 147 EQWATPVPHNADADYNPQLEARKERKARVA--------KNEKQRLQNIARASGSSAQASR 198

Query: 243 KGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSIG 285
           K EL R +A ++++TAS+G+FDK L+GE K++G+KRKFEP+ G
Sbjct: 199 KEELDRTLATTRTSTASMGRFDKKLEGEKKIRGIKRKFEPNEG 241



>gi|406696596|gb|EKC99878.1| ribosome biogenesis-related protein [Trichosporon asahii var.
           asahii CBS 8904]
          Length = 368

 Score =  166 bits (421), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 152/311 (48%), Gaps = 64/311 (20%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S QL    +   +  +ERP P++ D  LLAAFDT  +DE   +++ + ++   T   TQ
Sbjct: 35  VSQQLADYAASKTTQVLERPTPIEVDSGLLAAFDTVPIDEEEYESNREAHILALTLTSTQ 94

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
            L++ +F LP T S+ G +A+LPE IT++PREKP      L  P+ L             
Sbjct: 95  TLVSDLFNLPTTMSENGPIAQLPEPITLLPREKP------LPKPKPL------------- 135

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            T+WE++AKAKGI H  K+K ++DE   EWV RWG  G N +G 
Sbjct: 136 -----------------TKWERYAKAKGISHVKKDKKVWDEEKQEWVNRWGRDGKNREGE 178

Query: 184 NDWLIPVPQND-----------------DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES 226
           + WL  V   +                 DP  D  +                  RN+ ++
Sbjct: 179 DQWLHEVKGGEGEFGLYQLGDVGCKLTADPTVDPRANLRADRKARIAKNEKQRLRNLADA 238

Query: 227 EA-----------ALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKG 275
           +A           A    + + AR +RK EL R + ISK+ATAS+GKFDK ++GE K+KG
Sbjct: 239 QAHISALDKKPSTATTSAEKSTARQIRKAELDRSMLISKTATASMGKFDKKIEGEPKVKG 298

Query: 276 VKRKFEPSIGD 286
           VKRKFE ++GD
Sbjct: 299 VKRKFESNVGD 309



>gi|401881581|gb|EJT45879.1| ribosome biogenesis-related protein [Trichosporon asahii var.
           asahii CBS 2479]
          Length = 336

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 152/311 (48%), Gaps = 64/311 (20%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S QL    +   +  +ERP P++ D  LLAAFDT  +DE   +++ + ++   T   TQ
Sbjct: 3   VSQQLADYAASKTTQVLERPTPIEVDSGLLAAFDTVPIDEEEYESNREAHILALTLTSTQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
            L++ +F LP T S+ G +A+LPE IT++PREKP      L  P+ L             
Sbjct: 63  TLVSDLFNLPTTMSENGPIAQLPEPITLLPREKP------LPKPKPL------------- 103

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            T+WE++AKAKGI H  K+K ++DE   EWV RWG  G N +G 
Sbjct: 104 -----------------TKWERYAKAKGISHVKKDKKVWDEEKQEWVNRWGRDGKNREGE 146

Query: 184 NDWLIPVPQND-----------------DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES 226
           + WL  V   +                 DP  D  +                  RN+ ++
Sbjct: 147 DQWLHEVKGGEGEFGLYQLGDVGCKLTADPTVDPRANLRADRKARIAKNEKQRLRNLADA 206

Query: 227 EA-----------ALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKG 275
           +A           A    + + AR +RK EL R + ISK+ATAS+GKFDK ++GE K+KG
Sbjct: 207 QAHISALDKKPSTATTSAEKSTARQIRKAELDRSMLISKTATASMGKFDKKIEGEPKVKG 266

Query: 276 VKRKFEPSIGD 286
           VKRKFE ++GD
Sbjct: 267 VKRKFESNVGD 277



>gi|242221362|ref|XP_002476431.1| predicted protein [Postia placenta Mad-698-R]
 gi|220724315|gb|EED78367.1| predicted protein [Postia placenta Mad-698-R]
          Length = 315

 Score =  163 bits (412), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 135/282 (47%), Gaps = 36/282 (12%)

Query: 2   IYFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDG 61
           +  SD L     K K++ VE+ IPL+ D   LA  D N +D      D + YL+   RDG
Sbjct: 1   MDVSDILAAHAEKQKAVAVEKDIPLEVDAGFLAVTDLNPVDTESYGEDLEEYLQSTARDG 60

Query: 62  TQLLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVS 121
            Q LIN +F LP T S  G LA+LP   T +PR K        + P+             
Sbjct: 61  VQALINALFALPTTPSADGPLAQLPPPTTQLPRAK--------HLPK------------- 99

Query: 122 RNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGD 181
                              T+WE+FA+AKGIQ + K+K ++DE   +WV RWG+KG N  
Sbjct: 100 ---------------PKPPTKWEQFARAKGIQKKRKDKKVWDEEKQDWVDRWGWKGANKK 144

Query: 182 GANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSL 241
               WL  V  N D   D                   H++N+  ++ A            
Sbjct: 145 EETQWLSEVRANADVDHDPAKAARDARKEKMAKNERQHQQNLARAQGASASATAPAPPQE 204

Query: 242 RKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 283
           RK ++ R +A ++S+TAS+GKFD+ L+GE KLKGVKRKF+P+
Sbjct: 205 RKKQIDRTLATTRSSTASMGKFDRKLEGEKKLKGVKRKFDPT 246



>gi|164659472|ref|XP_001730860.1| hypothetical protein MGL_1859 [Malassezia globosa CBS 7966]
 gi|159104758|gb|EDP43646.1| hypothetical protein MGL_1859 [Malassezia globosa CBS 7966]
          Length = 307

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 113/316 (35%), Positives = 152/316 (48%), Gaps = 54/316 (17%)

Query: 17  SITVER-PIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           S  VE+  +PLQ D  LLA+ D N +D  +   DT+  L+  TR+ TQ LIN IF+LPI 
Sbjct: 7   STAVEQGEMPLQLDTGLLASVDVNPMDIRKYMKDTEALLQARTRNSTQHLINTIFQLPIE 66

Query: 76  T-SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXX 134
             +  G LA LPE +T +PREKP      L  P+ L                        
Sbjct: 67  RHATYGPLASLPEFVTQLPREKP------LPKPKPL------------------------ 96

Query: 135 XXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN- 193
                 T+WEKFA+AKGI  R K+++++DE   EWVPRWG++G N D  N WL+ VP N 
Sbjct: 97  ------TKWEKFARAKGIVKRKKDRLVFDEERQEWVPRWGFQGKNKDLENQWLVEVPSNA 150

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAAL-----NQTKG--------ADARS 240
           DD F                     H RN+     A        TKG        A   S
Sbjct: 151 DDDFRPD-KAAAKERLDRRKKNEQQHERNLARQSGAAAAIPSGSTKGKSELGSGKASMSS 209

Query: 241 LRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS-IGDXXXXXXXXXXXXX 299
            R+ EL+ +I  ++++TAS+G+FDK L+GE K +GVKR F+P+ I               
Sbjct: 210 RRRAELESEILRARNSTASMGRFDKHLEGETKPRGVKRTFQPNEIDARQERAANLSVLAR 269

Query: 300 XXXGKKGDIVNVRKAI 315
              G     +N+RKAI
Sbjct: 270 LDKGSTDSEMNMRKAI 285



>gi|472588228|gb|EMS25700.1| ribosomal biogenesis regulatory protein [Rhodosporidium toruloides
           NP11]
          Length = 338

 Score =  159 bits (403), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 103/280 (36%), Positives = 139/280 (49%), Gaps = 32/280 (11%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           LE    + K+I VER IP+  DL LLA FD N +D    +ND +  L ++ RDG QLL+N
Sbjct: 7   LEQSSQRQKAIAVEREIPVDIDLGLLAVFDPNPIDLDTYQNDKERALLDHARDGIQLLVN 66

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXX 127
            I+  P    D G +A+LP   T +PREKP          EN+  L     +        
Sbjct: 67  DIWSQPTRVVDDGVIADLPPISTALPREKPARADL-----ENVCQLPKPAAM-------- 113

Query: 128 XXXXXXXXXXXXXTRWEKFAKAKGIQHR-NKNKMIYDEATGEWVPRWGYKGTNGDGANDW 186
                        T+W+ FAKAKGI  +  K+KM+YDE   EWVPRWG+KG N D    W
Sbjct: 114 -------------TKWQAFAKAKGIAPKAKKDKMVYDEEKQEWVPRWGFKGKNRDAEGQW 160

Query: 187 LIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA-ALNQTKGADA----RSL 241
           L  V    D   D  +                   N++ + A A  QT+ +      R  
Sbjct: 161 LHEVKPTADTDFDPRAAARSERKARWLKNESQRLANLQRAAANAAKQTQQSATKQTEREK 220

Query: 242 RKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFE 281
           RKGEL+R +  +K +TAS+G+FD  L+GE + K VKRKF+
Sbjct: 221 RKGELERTLRSTKRSTASLGRFDDKLQGEGREKNVKRKFD 260



>gi|403413739|emb|CCM00439.1| predicted protein [Fibroporia radiculosa]
          Length = 310

 Score =  159 bits (403), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 136/277 (49%), Gaps = 37/277 (13%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S+ L    +K K ITVE+ IPL+ D   L   D N  D        + YL    RDG Q
Sbjct: 3   VSEILAAHVAKQKLITVEKDIPLEIDAGFLTVTDLNPGDAESYDESLEEYLLSTARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
            L++ +F LPIT+S  G LA LP   T +PR KP      L  P+ L             
Sbjct: 63  ALVSSLFALPITSSADGPLARLPSPTTQLPRAKP------LPKPKPL------------- 103

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            T+WEKFAKAKGIQ + K+K ++DE   EWV RWG+KG N    
Sbjct: 104 -----------------TKWEKFAKAKGIQKQRKDKKVWDEEKQEWVDRWGWKGANKREE 146

Query: 184 NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRK 243
             WL  VP N D   D                   H++N+  ++AA   +  +D    +K
Sbjct: 147 TQWLSEVPANADADYDPAKIARGARKEKMAKNERQHQQNLVRAQAANMNSSTSDRFEHKK 206

Query: 244 GELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKF 280
           G + R +A ++++TAS+G+FD+TL GE +LKG+KRKF
Sbjct: 207 G-IDRTLATARTSTASMGRFDRTLDGEKRLKGLKRKF 242



>gi|260801679|ref|XP_002595723.1| hypothetical protein BRAFLDRAFT_200232 [Branchiostoma floridae]
 gi|229280970|gb|EEN51735.1| hypothetical protein BRAFLDRAFT_200232 [Branchiostoma floridae]
          Length = 336

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/282 (36%), Positives = 135/282 (47%), Gaps = 44/282 (15%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQI 69
           +Q SKYK+I V++ I  Q DL  L   D N L+  + + D + YLK   RD TQLL N I
Sbjct: 14  SQASKYKTIEVQKDIEPQLDLGNLLTVDQNPLELKKFRADKEVYLKSQARDNTQLLFNAI 73

Query: 70  FKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXX 129
           +KLP    +     +LPE  TV+PREKP+                               
Sbjct: 74  WKLPTERVEEAICVKLPETTTVLPREKPIP------------------------------ 103

Query: 130 XXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIP 189
                      TRWE++A+ KGIQ R K +M++DE   EW PRWGYK  N D   DW+I 
Sbjct: 104 ------KVKPPTRWEQYAQLKGIQKRKKGRMVWDEELKEWRPRWGYKRAN-DETKDWVIE 156

Query: 190 VPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGA---DARSLRKGEL 246
           VP N DP EDQF                   RNI  + A  ++  G          K E+
Sbjct: 157 VPGNADPNEDQFEKRMKAKKERVAKNELQRLRNI--ARATRSKVPGVGLTPTEKPSKEEV 214

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGD 286
              + ++K +TAS+GKF + L  E + K  G KRKFEP+IGD
Sbjct: 215 GLALHLAKKSTASLGKFTEKLPKEKEAKHVGKKRKFEPAIGD 256



>gi|505757196|gb|EOR01322.1| Regulator of ribosome biosynthesi [Wallemia ichthyophaga EXF-994]
          Length = 306

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 151/331 (45%), Gaps = 52/331 (15%)

Query: 1   PIYFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRD 60
           PI  S  L     +YK   V+R +P+  DL LLAAFDTNAL+   LK D + Y+K  TRD
Sbjct: 4   PIDASQILAEHSKRYKPTQVDREVPITIDLNLLAAFDTNALNADELKVDREEYVKSLTRD 63

Query: 61  GTQLLINQIFKLPITTSDLGKLAELP-EQITVIPREKPVSFYFVLYFPENLFLLNLSHIL 119
           G QLL+N +F+ PIT +  G LA+LP E +  +PREKP      L  P+ L         
Sbjct: 64  GVQLLVNNLFQQPITKTLDGPLAKLPDESVYAVPREKP------LPKPKPL--------- 108

Query: 120 VSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTN 179
                                T+W+KFA  KGI H+ K++M++DE   +WVPRWGY G N
Sbjct: 109 ---------------------TKWQKFANEKGITHKKKDRMVFDEDEQKWVPRWGYGGIN 147

Query: 180 GDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRN--IEES---EAALNQTK 234
               N WL  +    D   +  S                  +N  I +S   +       
Sbjct: 148 KKEENQWLHELKDGQDEDHNPASAIKHARRDRSLKNVKQQLKNEGITKSVQEKQKAEAAA 207

Query: 235 GADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSIGDXXXXXXXX 294
               R+  K EL++ +  S+ +T S+GKFDK + GE  LKG KRKF P            
Sbjct: 208 KRAERAQHKQELEKSLHRSRVSTGSMGKFDKKMSGEPALKGQKRKFNPVTNTTEEHKSNR 267

Query: 295 XXXXXXXXG----KKG------DIVNVRKAI 315
                   G     KG      D+VN R+AI
Sbjct: 268 DILDKVSSGATKLNKGTGGGNKDLVNTRRAI 298



>gi|353237099|emb|CCA69080.1| related to RRS1-regulator of ribosome biogenesis [Piriformospora
           indica DSM 11827]
          Length = 668

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 105/320 (32%), Positives = 154/320 (48%), Gaps = 64/320 (20%)

Query: 13  SKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKL 72
           S  +S  VE+ +PL  D  LLA FD+N +DE   +++ + YL+   RDG Q LIN +F L
Sbjct: 11  STGRSTVVEKDVPLVVDAGLLAVFDSNDIDEESFRSNPEEYLQSTARDGVQALINALFTL 70

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           PI  ++ G LA LP    ++PR KP      L  P+ L                      
Sbjct: 71  PIQKTEDGPLARLPPIEMLLPRAKP------LPKPKPL---------------------- 102

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WE+FA+AKGIQ + ++K I+DE   EWV RWG  G N +    W+  VP 
Sbjct: 103 --------TKWEQFARAKGIQKKVRDKRIWDEQKQEWVARWGRNGKNKEIEEQWITEVPD 154

Query: 193 ND----DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQR 248
           N     DP ++                     +N ++ +A + + +G  ++  RK EL+ 
Sbjct: 155 NAPDDYDPIKEARDVRKARVA-----------KNEKQRQANIARAQGGPSKDERKAELRN 203

Query: 249 QIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSIGDXXXXXXXX------------XX 296
               +K +TAS+GKFDK L+G+ KL+G+KRKFEP+ GD                      
Sbjct: 204 TALQTKISTASMGKFDKKLEGDPKLRGIKRKFEPNEGDVQAEKSNALALLAKLERAGPTS 263

Query: 297 XXXXXXGKKG-DIVNVRKAI 315
                 G+ G D++NVRKA+
Sbjct: 264 KKTKTDGEGGDDVLNVRKAV 283



>gi|392568457|gb|EIW61631.1| RRS1-domain-containing protein [Trametes versicolor FP-101664 SS1]
          Length = 319

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 136/284 (47%), Gaps = 40/284 (14%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            SD L   ++K KS+ VE+ IPL+ D   L   D N +D+   + D + YL    RDG Q
Sbjct: 3   VSDILAAHQAKQKSVVVEKEIPLEVDTGFLTVTDLNPVDQESYEADMEEYLMSTARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
            LI  +F LP T+S  G LA+LP   T++PR KP+                         
Sbjct: 63  TLIASLFSLPTTSSADGPLAQLPTPTTLLPRAKPLPKPKPPTK----------------- 105

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                              WE+FAKAKGIQ   K K I+DE   EWV RWG+KG N    
Sbjct: 106 -------------------WEQFAKAKGIQKTRKEKKIWDEEKQEWVDRWGWKGVNKKEE 146

Query: 184 NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADA----R 239
             WL  V  N D   D                   H++N+  +  +   + G        
Sbjct: 147 TQWLTEVRANADVDHDPSKAARDARKERVAKNERQHQQNVARATQSTGPSTGPSTAPVPN 206

Query: 240 SLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 283
           S+RK E+ R +A+++++TAS+GKFD+ L+GE KLKG+KRKFEP+
Sbjct: 207 SIRKKEIDRTLAVTRASTASMGKFDRKLEGEKKLKGLKRKFEPT 250



>gi|388584012|gb|EIM24313.1| RRS1-domain-containing protein [Wallemia sebi CBS 633.66]
          Length = 306

 Score =  156 bits (395), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 153/330 (46%), Gaps = 52/330 (15%)

Query: 2   IYFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDG 61
           I  S  L     KYK   + R IP++ DL LL AFDTNA++   LK++ +NY+KE +RD 
Sbjct: 5   IDASQILAEHSKKYKPTQISREIPIENDLNLLTAFDTNAINADELKSNRENYVKELSRDS 64

Query: 62  TQLLINQIFKLPITTSDLGKLAELPEQ-ITVIPREKPVSFYFVLYFPENLFLLNLSHILV 120
            Q LIN +F  PIT +  G LA+LPE+ +  +PREKP      L  P+ L          
Sbjct: 65  VQNLINDLFNQPITKTLDGPLAKLPEESVYQLPREKP------LPKPKAL---------- 108

Query: 121 SRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNG 180
                               T+W+KFA  KGI H+ K++M++DE   +WVPRWGY G N 
Sbjct: 109 --------------------TKWQKFANEKGISHKKKDRMVFDEDEQKWVPRWGYNGINK 148

Query: 181 DGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRN--IEES---EAALNQTKG 235
              N WL  + +  D   +  S                  +N  I +S   +        
Sbjct: 149 KEENQWLHELKEGQDEDHNPASAIKGARKERSLKNVKQQLKNEGITKSIQEKQKAEAAAK 208

Query: 236 ADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEP--SIGDXXXXXXX 293
              R+  K EL++ +  SK +TAS+GKFDK L GE  LKG KRKF P  +  D       
Sbjct: 209 RAERAQHKQELEKSLHRSKISTASLGKFDKKLSGEPTLKGQKRKFNPVTNTSDEHKSNRE 268

Query: 294 XXXXXXXXXGK--------KGDIVNVRKAI 315
                    GK          D+VN R+AI
Sbjct: 269 ILDKVATGAGKLNKSTGSGSKDLVNTRRAI 298



>gi|340368757|ref|XP_003382917.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Amphimedon queenslandica]
          Length = 337

 Score =  156 bits (394), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 107/317 (33%), Positives = 147/317 (46%), Gaps = 46/317 (14%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLI 66
           L   +SK+KS  V + + LQ+DL  L A D N ++   LK    D YL    RD TQLLI
Sbjct: 14  LSAHQSKFKSTEVNKEVELQFDLGRLLATDLNEIEAQSLKTKQKDGYLLNLMRDNTQLLI 73

Query: 67  NQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXX 126
           N+I+K P+  +D G   +LP   TV+PREKP+                            
Sbjct: 74  NEIWKFPVENNDGGISVQLPSPKTVLPREKPIP--------------------------- 106

Query: 127 XXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDW 186
                         T+WE+FA+ KGI  + ++KM++DE + EW PRWGYK  N D   DW
Sbjct: 107 ---------KEKEPTKWEQFAQTKGIAKKKRSKMVFDEKSQEWKPRWGYKRIN-DPKEDW 156

Query: 187 LIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKG----ADARSLR 242
           LI VP N DP+ED F                   RNI  ++ +  + K     A A  L 
Sbjct: 157 LIEVPDNADPYEDPFEKKSEDRKERIAKNEYQRLRNIARADKS-GRVKAPLPPAYAAKLN 215

Query: 243 KGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEPSIGDXXXXXXXXXXXXXX 300
           K ++   + +++ +TASIGKF   L  E   K  G K KF P +G               
Sbjct: 216 KHQVTHALGMARKSTASIGKFTPKLSKEPAAKSAGKKSKFRPVVG-KKGEERALNLEILK 274

Query: 301 XXGKKGDIVNVRKAIAK 317
              KK DI++V+KA +K
Sbjct: 275 KMSKKTDILDVKKATSK 291



>gi|409049634|gb|EKM59111.1| hypothetical protein PHACADRAFT_249336 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 310

 Score =  152 bits (385), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 102/278 (36%), Positives = 140/278 (50%), Gaps = 38/278 (13%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S+ L     K ++ITVE+ IPL+ D   L   DTN +DE   K + + Y++   RDG Q
Sbjct: 3   VSEILAEHARKQQAITVEKEIPLEVDAGFLTVTDTNPIDEESYKVNLEEYIQSTARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
           +LI+ +F LP   S  G LA+LP   T +PR K       L  P+ L             
Sbjct: 63  VLISALFSLPTVPSPDGPLAQLPPPTTQLPRAK------SLPKPKPL------------- 103

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            ++WE+FAKAKGI HR K++ ++DE   +WV RWG+KGTN  G 
Sbjct: 104 -----------------SKWEQFAKAKGISHRKKDRKVWDEEKQQWVNRWGWKGTNKAGE 146

Query: 184 NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRK 243
             WL  VPQN D   D                   H +N+  ++ A  Q   +     RK
Sbjct: 147 EQWLTEVPQNADIDHDPAKKAREERKARVSKNEKQHEKNMLRAQRA--QGSSSAPTDQRK 204

Query: 244 GELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFE 281
            E+ R +A ++ +TAS+G+FDK L+GE KLKGVKRKFE
Sbjct: 205 REIDRTLATTRVSTASMGRFDKKLEGEKKLKGVKRKFE 242



>gi|443900152|dbj|GAC77479.1| regulator of ribosome synthesis [Pseudozyma antarctica T-34]
          Length = 338

 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 141/288 (48%), Gaps = 60/288 (20%)

Query: 13  SKYKSITV-ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SKYK  TV E   P Q+DL LL + + N +     ++ + + L+   RDG Q LIN+IF 
Sbjct: 24  SKYKPTTVDEGATPFQFDLGLLTSINPNPV-----RSTSADALRARARDGVQSLINRIFV 78

Query: 72  LPITT-SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXX 130
           LP+T  ++ G LA LP   + +PREK       +  P+ L                    
Sbjct: 79  LPVTRDAEYGPLAALPAFASRLPREK------SMPKPKPL-------------------- 112

Query: 131 XXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                     T+WEKFAK KGIQ R K+KMIYDEATGEWVPRWGYKG N D    W+  +
Sbjct: 113 ----------TKWEKFAKQKGIQSRKKDKMIYDEATGEWVPRWGYKGANKDLEEQWIHEL 162

Query: 191 PQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI-----EESEAALNQTKGA--------- 236
             N +   D                    ++N+       + A  + +KG          
Sbjct: 163 KNNGNTDLDPAKTAKKERLAKQAKNESQRQKNVARAAAASASATASSSKGGLGDANAAKL 222

Query: 237 ---DARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFE 281
                R  RK EL+  +  S+++TAS+G+FDKTLKGE K KG+KRKF+
Sbjct: 223 ARAAQRERRKAELEADVLRSRASTASMGRFDKTLKGESKAKGIKRKFD 270



>gi|465793145|emb|CCU98266.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 296

 Score =  150 bits (378), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 144/299 (48%), Gaps = 44/299 (14%)

Query: 24  IPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT-SDLGKL 82
            PLQ D+ LLA+FD N +     K D +  L+   R+ TQ L+N +F+LPI   +  G L
Sbjct: 14  TPLQLDVGLLASFDFNPISARAFKKDPEGVLQARARNATQHLVNTLFQLPIERHATYGPL 73

Query: 83  AELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTR 142
           A LP   T +PREKPV        P+ L                              T+
Sbjct: 74  ASLPAFETELPREKPVPK------PKPL------------------------------TK 97

Query: 143 WEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFS 202
           WEKFAKAKGI  R K+KMI+DE   EWVPRWGY+G N    + WL+ VP N D       
Sbjct: 98  WEKFAKAKGITKRKKDKMIFDEERQEWVPRWGYQGANKKLEDQWLVEVPTNADDDYRPDR 157

Query: 203 XXXXXXXXXXXXXXXXHRRNIEESEAALNQTKG------ADARSLRKGELQRQIAISKSA 256
                           H+RN+  + AA    KG      A +R+ R+  L+  +  ++ +
Sbjct: 158 EAAKERKARQAKNEAQHQRNLARNAAAPAAPKGELGSGVAPSRARRRAALEADLLRARGS 217

Query: 257 TASIGKFDKTLKGELKLKGVKRKFEPSIGDXXXXXXXXXXXXXXXXGKKGDIVNVRKAI 315
           TAS+G+FDK+L+GE K +GVKR F+P+  D                GK    +N+RKAI
Sbjct: 218 TASLGRFDKSLEGESKPRGVKRTFQPNEID-AGQERAAHLELLAKMGKGEPQMNLRKAI 275



>gi|198435348|ref|XP_002125582.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Ciona
           intestinalis]
          Length = 324

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 136/282 (48%), Gaps = 54/282 (19%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           ++ K  SI V + I +  D   L A D+N +D  +L++D +NYLK   R+GTQLL N+I+
Sbjct: 16  EEEKLLSIQVPKTIDVAIDAGNLLACDSNPIDTKQLRSDKENYLKNLAREGTQLLFNEIW 75

Query: 71  KLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXX 130
           KLPI       +A++P   TVIPREKP+                                
Sbjct: 76  KLPIERVQDAVIAKVPAPTTVIPREKPIP------------------------------- 104

Query: 131 XXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                     T+WE++AK KGI+   K +M++D+ +  W PRWGYK  N D   +W++ V
Sbjct: 105 -----KAKPPTKWEEYAKLKGIRKLKKGRMVWDDESKSWKPRWGYKRAN-DDTKEWVLEV 158

Query: 191 PQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE---------SEAALNQTKGADARSL 241
           P N DP EDQF                   RN+              A+ Q K +     
Sbjct: 159 PANADPNEDQFEKKLKEKKERVAKNELQRLRNVARRTGKKVPGVGRTAVGQEKQS----- 213

Query: 242 RKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFE 281
            K EL+    +SK ATAS+G+F +TLKGE  +K +G KRKFE
Sbjct: 214 -KLELEAAFHVSKQATASLGRFQETLKGEKNVKKRGQKRKFE 254



>gi|392579956|gb|EIW73083.1| hypothetical protein TREMEDRAFT_22893, partial [Tremella
           mesenterica DSM 1558]
          Length = 267

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 137/265 (51%), Gaps = 40/265 (15%)

Query: 26  LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAEL 85
           ++ D  LLAAFD + ++     ++  ++L + T   T  LI+ +F+LP T++  G + +L
Sbjct: 1   VEVDAGLLAAFDNSPVEPEAYSSNLPSHLLDLTLTSTHHLISTLFQLPTTSTASGLMVQL 60

Query: 86  PEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEK 145
           P   T++PREKP      L  P+ L                              T+WE+
Sbjct: 61  PAAKTLLPREKP------LPKPKPL------------------------------TKWER 84

Query: 146 FAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXX 205
           FAK KGI H+ +++M++D+   EWV RWG  G N +    W+  V   +DP  D  +   
Sbjct: 85  FAKEKGISHKQRDRMVFDDERQEWVKRWGRGGKNKEVEEQWIHEVKAGEDPDHDPAASAK 144

Query: 206 XXXXXXXXXXXXXHRRNIEESEAALN----QTKGADARSLRKGELQRQIAISKSATASIG 261
                        H+ N+  + A  +      + ++ RS RK EL+R + ++K++TAS+G
Sbjct: 145 KARKERVAKNEAQHKANLAHATAPTSTRSISAQNSENRSKRKVELERSMLLTKTSTASLG 204

Query: 262 KFDKTLKGELKLKGVKRKFEPSIGD 286
           KFDK ++GE K KGVKRKFEP++G+
Sbjct: 205 KFDKKIEGEPKTKGVKRKFEPNVGE 229



>gi|72010693|ref|XP_781111.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Strongylocentrotus purpuratus]
          Length = 335

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 139/283 (49%), Gaps = 50/283 (17%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           ++ KYKSI V+R + ++ DL  L A D NALD  + + +  +YL    RD TQLL NQ++
Sbjct: 17  EEKKYKSIEVQRDVEVEIDLGNLLACDPNALDLKKYRVNKGDYLSSIARDATQLLFNQLW 76

Query: 71  KLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXX 130
           KLP+   +     +LPE  TV+PREK V        P++                     
Sbjct: 77  KLPVHRVEDAITVKLPEPTTVLPREKRV--------PKD--------------------- 107

Query: 131 XXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                     T+WEK+AK KGI ++ K+  ++ E   +W+PR+GYK  N D   DWL+ V
Sbjct: 108 -------RPATKWEKYAKQKGIMNKKKSTKVWSEEEEKWIPRFGYKSKN-DLKKDWLLEV 159

Query: 191 PQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKG 244
           P N DP EDQFS                  RNI  ++        L  T+  D     K 
Sbjct: 160 PANADPMEDQFSKKKKAKQERVAKNELQRLRNIARAKKRKVPGVGLTPTEKPD-----KT 214

Query: 245 ELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIG 285
            + + I +SK +TASIGKF+  L  E  +K  G +RKFEP +G
Sbjct: 215 MVNKAIHLSKHSTASIGKFENKLPKEPLIKNLGKRRKFEPVMG 257



>gi|328770705|gb|EGF80746.1| hypothetical protein BATDEDRAFT_6086 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 170

 Score =  147 bits (371), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 105/206 (50%), Gaps = 37/206 (17%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           ++VE+P+P+++DL  LAAFD N LDE+ L+ N  DNYLK+++RDG QLLIN IF L   +
Sbjct: 1   VSVEKPVPVEFDLRCLAAFDPNPLDETELRSNKVDNYLKQWSRDGAQLLINAIFGLETNS 60

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
           +D G  A LP  I+ IPR KP+                                      
Sbjct: 61  NDDGYFAILPNLISRIPRAKPIP------------------------------------K 84

Query: 137 XXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDP 196
               TRWEKFA  KGIQ + K++M YDE+T  + PR+GYKG   D   DW+I VP N DP
Sbjct: 85  ENNKTRWEKFAAVKGIQKKKKSRMEYDESTQTYNPRYGYKGGEKDNLKDWIIEVPDNADP 144

Query: 197 FEDQFSXXXXXXXXXXXXXXXXHRRN 222
             DQ+                  RRN
Sbjct: 145 MVDQYQQKREEKKGRVEKNQMQQRRN 170



>gi|71021335|ref|XP_760898.1| hypothetical protein UM04751.1 [Ustilago maydis 521]
 gi|46100994|gb|EAK86227.1| hypothetical protein UM04751.1 [Ustilago maydis 521]
          Length = 341

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 139/295 (47%), Gaps = 62/295 (21%)

Query: 13  SKYKSITVER-PIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SKYK  TV++   P Q+D+ LLA+ + N +        +  +L + TRDG Q L+N+IF 
Sbjct: 24  SKYKPTTVDQGSTPYQFDVGLLASINPNPVTAC-----SAAHLADRTRDGVQSLVNKIFA 78

Query: 72  LPITTS-DLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXX 130
           LPIT   D G LA LP   + +PREK       +  P+ L                    
Sbjct: 79  LPITRDPDHGPLASLPAFTSKLPREK------SMPKPKPL-------------------- 112

Query: 131 XXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                     T+WEKFAK KGIQ R K+KM++DE T EWVPRWG+KG N D    W+  +
Sbjct: 113 ----------TKWEKFAKQKGIQSRKKDKMVFDENTQEWVPRWGFKGANKDLEEQWIHEL 162

Query: 191 PQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------------------SEAALN 231
             N +   D                      N+                      +A   
Sbjct: 163 KNNGNTDMDPAKTAKKERLAKKQKNEKQRLGNLARAAASTAASSAASSSSKGGLGDANPA 222

Query: 232 QTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSIGD 286
           +   A AR  RK EL+  +  S+++TAS+G+FDKTL+GE K KG+KRKF+P+  D
Sbjct: 223 KLARAAAREKRKAELEADVLRSRASTASMGRFDKTLQGEQKQKGLKRKFDPNEKD 277



>gi|501309512|dbj|GAC98336.1| likely ribosome biogenesis regulatory protein [Pseudozyma
           hubeiensis SY62]
          Length = 340

 Score =  144 bits (363), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 140/288 (48%), Gaps = 60/288 (20%)

Query: 13  SKYKSITVER-PIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SKYK+ +V++ P P Q+DL LL + + N L  +     +  YL    RDG Q L+N+IF 
Sbjct: 24  SKYKTTSVDQGPTPYQFDLGLLTSINPNPLTST-----SSPYLLSRARDGVQSLVNKIFA 78

Query: 72  LPITTS-DLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXX 130
           LPIT   + G LA LP   + +PREK       +  P+ +                    
Sbjct: 79  LPITRDPENGPLATLPAFTSKLPREK------SMPKPKPM-------------------- 112

Query: 131 XXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                     T+WEKFAK KGIQ + K+KM++DEAT EWVPRWGYKG N D  + W+  +
Sbjct: 113 ----------TKWEKFAKQKGIQSKKKDKMVFDEATKEWVPRWGYKGANKDAEDQWIHEL 162

Query: 191 PQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI-----EESEAALNQTKGA--------- 236
             N +   D                      N+       + ++ +  KG          
Sbjct: 163 KNNGNTDFDPAKTAKKERLAKQAKNEKQRLGNLARAAAASTASSSSSNKGGLGDANAAKL 222

Query: 237 ---DARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFE 281
               AR  RK EL+  +  S+++TAS+GKFDKTLKGE K KG+KRKF+
Sbjct: 223 ARAAAREKRKAELEADVLRSRASTASMGKFDKTLKGEHKQKGLKRKFD 270



>gi|390601451|gb|EIN10845.1| RRS1-domain-containing protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 309

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 133/282 (47%), Gaps = 43/282 (15%)

Query: 2   IYFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDG 61
           +  SD L +QKSK +S  VE+ +PL  D  LL   D N +D     +  ++YL+   RDG
Sbjct: 1   MDVSDILASQKSKERSTAVEKEVPLDVDAGLLTVTDLNPVDAEDYNSSVEDYLQSVARDG 60

Query: 62  TQLLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVS 121
            Q L+  +F LP ++S  G +A+LP   T +PR KP+                       
Sbjct: 61  VQALLGALFSLPTSSSPDGPVAQLPPATTQLPRAKPLPKPKPPTK--------------- 105

Query: 122 RNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGD 181
                                WE+FAKAKGIQ + K+K+++DE   EWV RWG  G N +
Sbjct: 106 ---------------------WEQFAKAKGIQKKRKDKVVWDEEKQEWVNRWGRDGKNKE 144

Query: 182 GANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSL 241
               W   VP N D   +                     +N+  ++       G   +  
Sbjct: 145 KETQWATEVPANADVEHNPAKVARDARKARVAKNEKQKLQNMARAQ-------GVGEKEK 197

Query: 242 RKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 283
           RK ++ R +A ++ +TAS+G+FDKTL+GE KLKGVKRKF P+
Sbjct: 198 RKVDIDRTLATTRISTASLGRFDKTLEGEKKLKGVKRKFTPT 239



>gi|402226300|gb|EJU06360.1| RRS1-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 311

 Score =  142 bits (357), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 103/324 (31%), Positives = 142/324 (43%), Gaps = 48/324 (14%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            SD L    SK KSI VE+ IPL  D+A L A D N +DE   KN+ + YL    R+  Q
Sbjct: 3   VSDLLRAGASKQKSIQVEKGIPLDIDIAYLTATDPNPMDEEEYKNEREEYLHSMARENAQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
           LLIN +F LP+T+S  G +A+LP   T +PR                             
Sbjct: 63  LLINHLFSLPVTSSPDGPIAQLPPPTTSLPR----------------------------- 93

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            TRWEKFA AKGIQ + +   ++DE    +  RWG  G N +  
Sbjct: 94  -------AKPLPKPKPPTRWEKFAAAKGIQKKRRENKVWDEEKQVFRDRWGRGGKNKELE 146

Query: 184 NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIE---ESEAALNQTKGADARS 240
             WL+ VPQN     D                     +NI+    ++++ +Q      R 
Sbjct: 147 EQWLVEVPQNAPMDYDPVKEARDAKTKRIAKNEGQRLKNIQRAARAKSSTSQLNPGQERE 206

Query: 241 LRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSIGDXXXXXXXXXX---- 296
             K +L R +A ++ +TAS+GKFDK  +GE KL+GVKR+F+P+                 
Sbjct: 207 KLKVQLDRDLAQTRVSTASMGKFDKKFEGEAKLRGVKRQFDPNEKSVEAEKATSLAIMSK 266

Query: 297 -----XXXXXXGKKGDIVNVRKAI 315
                      G   D++NVRKAI
Sbjct: 267 LDTGRPSKRSKGDNDDVLNVRKAI 290



>gi|58262216|ref|XP_568518.1| ribosome biogenesis-related protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134118646|ref|XP_772025.1| hypothetical protein CNBN0080 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50254630|gb|EAL17378.1| hypothetical protein CNBN0080 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57230692|gb|AAW47001.1| ribosome biogenesis-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 313

 Score =  140 bits (354), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 89/270 (32%), Positives = 126/270 (46%), Gaps = 39/270 (14%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           +  + R  P+  D ALLAAFD + LD +    D + +L + T   T  L+  +F LP T 
Sbjct: 16  TAVLPRAAPVHTDPALLAAFDASPLDPAAYA-DRERHLLQLTLTSTHALVAALFALPTTP 74

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
           S  G +   P   T++PREKP+                                      
Sbjct: 75  SSAGPVTAFPPPTTLLPREKPLP------------------------------------T 98

Query: 137 XXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDP 196
               T+WE+FAK KGI HR K K ++DE   EWVPRWG  G N D  + WL  V   D+ 
Sbjct: 99  PKAPTKWERFAKEKGISHRKKEKDVWDEERQEWVPRWGRFGKNKDKEDQWLHEVKPGDEA 158

Query: 197 FEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTK--GADARSLRKGELQRQIAISK 254
            +D                   H  N+  + A++   +   A  R+ RK EL R + ISK
Sbjct: 159 DQDPGKTARGERKARIAQNTKQHSANLAVASASVTAARATAASERAARKEELNRNMLISK 218

Query: 255 SATASIGKFDKTLKGELKLKGVKRKFEPSI 284
           ++TAS+GKFD  ++GE K +G+KRKF+ +I
Sbjct: 219 TSTASLGKFDNKIEGEPKARGMKRKFDANI 248



>gi|471908923|emb|CCO28186.1| Ribosome biogenesis regulatory protein homolog [Rhizoctonia solani
           AG-1 IB]
          Length = 325

 Score =  140 bits (354), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 132/276 (47%), Gaps = 41/276 (14%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           +E + SK K++TVE+ IP+Q D+ LL+A DTN +D      D + +L+   RDG Q+++ 
Sbjct: 7   VEAEASKRKAVTVEKDIPIQIDIGLLSALDTNPVDVDAYNTDLEAHLQAVARDGAQVILG 66

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXX 127
            +F LP   SD G +A LP   T +PR KP+                             
Sbjct: 67  ALFGLPTQPSDDGPIATLPAPTTTLPRAKPLPKPKPPTK--------------------- 105

Query: 128 XXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWL 187
                          WE+FA AKGIQ   +++ ++DE   EWV RWG+ G N D    W+
Sbjct: 106 ---------------WERFAAAKGIQKTVRDRRVWDEERQEWVNRWGWNGKNKDQEEQWI 150

Query: 188 IPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQ 247
             VP N     D                     RN+  + A+  +      R   K +L 
Sbjct: 151 HEVPDNAPDDYDPAMESRKERKARVDKNEKQKERNLTMAAASSQRE-----REEVKSKLN 205

Query: 248 RQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 283
           R +AI++++TAS+G+FDK L G+ KLKG+KR+F P+
Sbjct: 206 RTLAITRTSTASMGRFDKKLDGDTKLKGIKRQFAPN 241



>gi|393246467|gb|EJD53976.1| RRS1-domain-containing protein [Auricularia delicata TFB-10046 SS5]
          Length = 316

 Score =  140 bits (352), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 133/280 (47%), Gaps = 44/280 (15%)

Query: 2   IYFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDG 61
           +  S  ++ Q++K+KS  VE+ IPL+ D+ LL   D N  DE   K + +NYL+   RDG
Sbjct: 1   MDVSSIVKEQQAKFKSTVVEKDIPLEVDVGLLTVTDPNPTDEDAYKANLENYLQSTARDG 60

Query: 62  TQLLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVS 121
            Q L+  +F LP  +S  G LA LP   T +PR KP+                       
Sbjct: 61  VQSLVAALFALPTKSSPDGPLALLPAPTTQLPRAKPLPKPKPPTK--------------- 105

Query: 122 RNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGD 181
                                WE+FA AKGIQH+ +++ ++DE   EWV RWG +G N +
Sbjct: 106 ---------------------WERFAAAKGIQHKTRDRKVFDEEKQEWVNRWGLRGKNKE 144

Query: 182 GANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSL 241
             + W+  VP N     D                     +N+  ++            + 
Sbjct: 145 TEDQWITEVPANAPADFDPAKEARDKRKERVAKNEKQREQNVARAQGTT--------LAE 196

Query: 242 RKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFE 281
           RK EL+R  A+++S+TAS+GKFDK L+GE KL+G KRKF+
Sbjct: 197 RKKELERSSALARSSTASMGKFDKKLEGEGKLRGQKRKFD 236



>gi|443927102|gb|ELU45633.1| RRS1 domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 314

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 135/276 (48%), Gaps = 51/276 (18%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           +E + SK K++TVE+ IP+Q D+ LL+A DTN +D      D +++L+   RDG Q+++ 
Sbjct: 7   VEAEASKKKAVTVEKDIPIQIDIGLLSALDTNPIDTEAYNTDLESHLQAVARDGAQVILG 66

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXX 127
            +F LP   SD G +A LP   T +PR KP+                             
Sbjct: 67  ALFGLPTQPSDDGPIATLPPPTTALPRAKPLPKPKPPTK--------------------- 105

Query: 128 XXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWL 187
                          WE+FA AKGIQ   +++  +DE   EWV RWG+KG N D    W+
Sbjct: 106 ---------------WERFAAAKGIQKTKRDRREWDEERQEWVNRWGWKGKNKDQEEQWI 150

Query: 188 IPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQ 247
             VP N                           RN+  + AA++  +    R   K +L 
Sbjct: 151 HEVPDN----------ARKERKARVTKNEKQRERNL--NVAAVSSQR---EREETKSKLN 195

Query: 248 RQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 283
           R +A+++++TAS+G+FDK L+G+ KLKG+KR+F P+
Sbjct: 196 RTLAVTRTSTASMGRFDKKLEGDTKLKGIKRQFAPN 231



>gi|391340812|ref|XP_003744730.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Metaseiulus occidentalis]
          Length = 341

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 137/277 (49%), Gaps = 45/277 (16%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPI 74
           +K+I VE+P+  ++D+  L   D NA++E + K +  +Y+   +RD  QLLIN++FK+P 
Sbjct: 19  FKTINVEKPLDCEFDIGELLVVDPNAIEEYKFKQNETDYVDNLSRDNVQLLINELFKIPT 78

Query: 75  TTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXX 134
              +   + +LP+ +T IPREKP         P+ L                        
Sbjct: 79  EVKEDTVVFQLPKPVTRIPREKPCPK------PKPL------------------------ 108

Query: 135 XXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND 194
                 T+WE++ K KG++   K K+++DEA+ EW PR+G K  N +    W IPVP+  
Sbjct: 109 ------TKWEEYRKKKGLRPAKKEKLVWDEASKEWKPRYGMKRINSE-KEVWAIPVPETA 161

Query: 195 DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA----ALNQTKGADARSLRKGELQRQI 250
           DP  DQF                   RNI+ +      A++     D  +     + +  
Sbjct: 162 DPMVDQFKLMREKKKERIAKNEFQRLRNIQRAHKIDKFAVSSVMPTDKPT--PELMSKAA 219

Query: 251 AISKSATASIGKFDK--TLKGELKLKGVKRKFEPSIG 285
           A++K +TAS+GKFD+   L+ E K+KG KRKF  +IG
Sbjct: 220 AVAKGSTASLGKFDRKLALEKEAKIKGKKRKFVDNIG 256



>gi|343426175|emb|CBQ69706.1| related to RRS1-regulator of ribosome biogenesis [Sporisorium
           reilianum SRZ2]
          Length = 340

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 138/294 (46%), Gaps = 61/294 (20%)

Query: 13  SKYKSITV-ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SKYK   V E   P Q+DL LL + + N +  +     T   L E  RDG Q L+N+IF 
Sbjct: 24  SKYKPTLVDEGATPYQFDLGLLTSINPNPVSST-----TSAALLERARDGVQSLVNRIFA 78

Query: 72  LPITT-SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXX 130
           LP+T  ++ G LA LP     +PREK       +  P+ L                    
Sbjct: 79  LPVTRDAEHGPLATLPPFTARLPREK------SMPKPKPL-------------------- 112

Query: 131 XXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                     T+WEKFAK KGIQ R K+KM++DEAT EWVPRWG+KG N D    W+  +
Sbjct: 113 ----------TKWEKFAKQKGIQSRKKDKMVFDEATQEWVPRWGFKGANKDLEQQWIHEL 162

Query: 191 PQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI------EESEAALNQTKGA-------- 236
             N +   D                      NI        S AA + +KG         
Sbjct: 163 KNNGNTDMDPAKTAKKERLAKQAKNEKQRLGNIARAAASTASSAAASSSKGGLGDANAAK 222

Query: 237 ----DARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSIGD 286
                AR  RK +L+  +  S+++TAS+G+FDKTL GE K KG+KRKF+P+  D
Sbjct: 223 LARAAAREQRKAQLEADVLRSRASTASMGRFDKTLAGESKPKGIKRKFDPNEKD 276



>gi|302691982|ref|XP_003035670.1| hypothetical protein SCHCODRAFT_73958 [Schizophyllum commune H4-8]
 gi|300109366|gb|EFJ00768.1| hypothetical protein SCHCODRAFT_73958 [Schizophyllum commune H4-8]
          Length = 306

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 129/286 (45%), Gaps = 62/286 (21%)

Query: 2   IYFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDG 61
           +  S+ L  + +K+ S+ VE+ +PL+ D  LL   D N +DE       + Y    +RDG
Sbjct: 1   MDVSNLLAAEAAKFASVNVEKEVPLEVDAGLLTVTDLNLIDE-------EAYKCVPSRDG 53

Query: 62  TQLLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVS 121
            Q+LI  +F LP  +S  G +A+LP  +T +PR KP+                       
Sbjct: 54  VQVLIQSLFSLPTQSSPDGPIAQLPPPVTQLPRAKPLP---------------------- 91

Query: 122 RNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGD 181
                              T+WE FA AKGIQ R K K ++DE   EWV  WG  G N  
Sbjct: 92  --------------KPKAPTKWEAFAAAKGIQKRRKEKKVWDEERQEWVNSWGRDGKNRQ 137

Query: 182 GANDWLIPVPQND----DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGAD 237
             + W+  VP N     DP                       +  I ++E         D
Sbjct: 138 VEDQWIHEVPANAPVDFDP---------------RKAARDERKERIAKNEKQRLANTARD 182

Query: 238 ARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 283
             + RK EL + +A ++ +TAS+GKFDKTL GE KL+G+KRKF P+
Sbjct: 183 QGTSRKAELDKTLATTRLSTASMGKFDKTLDGEKKLRGIKRKFAPN 228



>gi|388857200|emb|CCF49213.1| related to RRS1-regulator of ribosome biogenesis [Ustilago hordei]
          Length = 353

 Score =  136 bits (343), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 137/298 (45%), Gaps = 69/298 (23%)

Query: 13  SKYKSITV-ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SK+K  +V E P   Q+DL LL + + N L  S L   T   L   TRDG Q L+N+IF 
Sbjct: 24  SKFKPTSVDESPTAFQFDLGLLTSINPNPLPSSPL---TPEILLSRTRDGVQSLVNRIFT 80

Query: 72  LPITTS-DLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXX 130
           LPIT   + G LA LP+  + +PREK       +  P+ L                    
Sbjct: 81  LPITRDPENGPLAVLPQFTSKLPREK------SMPKPKPL-------------------- 114

Query: 131 XXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                     T+WEKFAK KGIQ + K+KMIYDE T EW+PRWGYKG N D  + W+  +
Sbjct: 115 ----------TKWEKFAKQKGIQSKKKDKMIYDENTNEWLPRWGYKGANKDLEDQWIHEL 164

Query: 191 PQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI--EESEAALNQTKGADA---------- 238
             N +   D                      N+    + ++ +  KG  +          
Sbjct: 165 KNNANTDIDPAKTAKKERLAKKEKNEKQRMGNLARAAAASSASAVKGGKSGGLGDANASA 224

Query: 239 ----------------RSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKF 280
                           R  RK EL+  +  S+++TAS+G+FDKTLKGE K KG+KRKF
Sbjct: 225 NANANANAAKLARAAAREKRKAELEADVLRSRASTASMGRFDKTLKGEQKQKGIKRKF 282



>gi|395849345|ref|XP_003797289.1| PREDICTED: ribosome biogenesis regulatory protein homolog isoform 1
           [Otolemur garnettii]
 gi|395849347|ref|XP_003797290.1| PREDICTED: ribosome biogenesis regulatory protein homolog isoform 2
           [Otolemur garnettii]
          Length = 365

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 133/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + I L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKEIELEFDLGNLLAADRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEAVVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+   GD   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRA-GDNTKEWLIEVPD 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI-------EESEAALNQTKGADARSLRKGE 245
           + DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 SADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQHPSAAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQENLPKEKAPRGSGKKRKFQPLFGD 260



>gi|507938408|ref|XP_004679889.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Condylura cristata]
          Length = 366

 Score =  135 bits (340), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 132/278 (47%), Gaps = 42/278 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N   E R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLALDRNPPTELRRAGPTPETELRSLARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A+LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVAQLPEPTTRLPREKPVPKPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DNTKEWLIEVPD 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-EAALNQTKGADARSLR-KGELQRQI 250
             DP EDQF+                  RN+  + +  L  + G      + K EL R +
Sbjct: 163 RADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSSAGMHPTGHQSKEELGRAM 222

Query: 251 AISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 223 QVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|195998666|ref|XP_002109201.1| hypothetical protein TRIADDRAFT_52982 [Trichoplax adhaerens]
 gi|190587325|gb|EDV27367.1| hypothetical protein TRIADDRAFT_52982 [Trichoplax adhaerens]
          Length = 348

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 93/286 (32%), Positives = 136/286 (47%), Gaps = 44/286 (15%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           L+ Q  +YKS  V + I  + DL  L   D   +D   L++D +  L++  RD TQ LIN
Sbjct: 22  LQAQSRRYKSTEVSKNILPEVDLGNLLLIDRQPVDPQELQSDIEISLQQLARDNTQWLIN 81

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXX 127
           +I+KLP    +   L +LPE  T++ REKP+                             
Sbjct: 82  EIWKLPTQQMEDALLVQLPEPTTIVAREKPIPKPKPPTK--------------------- 120

Query: 128 XXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWL 187
                          WE++AKAKGIQ R + KM +DE T  +  RWGYK    D +NDW+
Sbjct: 121 ---------------WEQYAKAKGIQKRKRGKMTFDEKTQTYKRRWGYKSVT-DDSNDWV 164

Query: 188 IPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA-LNQTKGADARSLR---- 242
             VP+N DP+EDQF                   RNIE  +    N+ + +  +S +    
Sbjct: 165 KEVPENADPYEDQFEVAREAKKERIAKNELQRLRNIERRQKGFFNKFEASKGKSTKTKAA 224

Query: 243 KGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGD 286
           + E+ + I  ++S+TAS G F K L  E +L+  GV+RK  P++GD
Sbjct: 225 QEEVTKAIKDAQSSTASHGVFTKILPQEKRLRKAGVRRKLPPNLGD 270



>gi|328858583|gb|EGG07695.1| hypothetical protein MELLADRAFT_62505 [Melampsora larici-populina
           98AG31]
          Length = 375

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 102/324 (31%), Positives = 138/324 (42%), Gaps = 83/324 (25%)

Query: 7   QLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLI 66
            L   K++ KSI V R +P+  D+ LLA FD N +D S    + + YL+  TRDG Q L+
Sbjct: 6   HLLASKNQKKSIIVHREVPIDLDIGLLACFDPNPIDSSDYNTNREEYLQSVTRDGIQTLV 65

Query: 67  NQIFKLPITTSDLGKLAELPEQ--ITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNX 124
           N +F LP  +++ G LA LP     T++PR KP+     L                    
Sbjct: 66  NALFALPTISTNDGVLATLPHSGPSTLLPRAKPLPKAAPL-------------------- 105

Query: 125 XXXXXXXXXXXXXXXXTRWEKFAKAKGIQ-HRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                           T+W+KFAK KGI   + + KM++DE   EWV RWG+KG N D  
Sbjct: 106 ----------------TKWQKFAKDKGIAPKQQREKMVFDEDKQEWVNRWGWKGKNKDEE 149

Query: 184 NDWLIPVPQNDDPFEDQF-------SXXXXXXXXXXXXXXXXHRRNIEESEAAL------ 230
             W+  V   +D  E          +                 R N E S+++       
Sbjct: 150 TAWIREVKAGEDQEEGALERNVGKRARKERTIKNQKQQLKNIQRANAETSKSSTTAILES 209

Query: 231 ---NQT------KGADARSL----------------------RKGELQRQIAISKSATAS 259
              NQT        AD R+                       RK EL+  I  SK +TAS
Sbjct: 210 STSNQTVSTTIRNKADVRAAKIAANTEKTRAEGMARREEQQKRKSELEGLIQTSKKSTAS 269

Query: 260 IGKFDKTLKGELKLKGVKRKFEPS 283
           +GKFDK    E K KG+KRKFEP+
Sbjct: 270 LGKFDKKFASEPKPKGIKRKFEPA 293



>gi|358057274|dbj|GAA96883.1| hypothetical protein E5Q_03556 [Mixia osmundae IAM 14324]
          Length = 500

 Score =  134 bits (338), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 129/283 (45%), Gaps = 58/283 (20%)

Query: 21  ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLG 80
           ER +P+  DL  L   D NALD  +   D +  L+   RDGTQLLIN IF   I +S  G
Sbjct: 180 ERRLPVNLDLGYLMLTDPNALDAQQFSEDREVTLRANARDGTQLLINAIFAQSIQSSSDG 239

Query: 81  KLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXX 140
            LA+LP    ++PREK       L  P+                                
Sbjct: 240 PLAQLPPPALMLPREK------ALPKPK------------------------------PP 263

Query: 141 TRWEKFAKAKGIQHR-NKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFED 199
           T+WEKFA++KGI  +  K+++++DE   +WVP +GYKG N    + W++ VP N DP  D
Sbjct: 264 TKWEKFARSKGITTKAKKDRLVFDEEKQDWVPSYGYKGKNKQTEDQWIVEVPNNADPSFD 323

Query: 200 QFSXXXXXXXXXXXXXXXXHRRNIEE---------------------SEAALNQTKGADA 238
                                RNI                       S+A          
Sbjct: 324 PVKASKDERKARKLKNEQQRLRNITRTATAPTTVAAAAAKEKQAIAASKALAGAKLDRPE 383

Query: 239 RSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFE 281
           ++ RK EL+ ++A +K +TAS+G++D  LKGE K++GVKRKFE
Sbjct: 384 QAARKRELESELATTKKSTASLGRYDTQLKGEGKVRGVKRKFE 426



>gi|170044045|ref|XP_001849672.1| regulator of ribosome biosynthesis [Culex quinquefasciatus]
 gi|167867283|gb|EDS30666.1| regulator of ribosome biosynthesis [Culex quinquefasciatus]
          Length = 352

 Score =  134 bits (337), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 129/268 (48%), Gaps = 45/268 (16%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ + +  D+  L A D N  D+   K D + YL + TRD TQLLIN +++LP
Sbjct: 17  KYKPITVEKHLEVTVDVGHLMATDPNYFDDDSFKKDQEQYLMDLTRDNTQLLINAVWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               +   +A++P   TV+PR +       L  P+ L                       
Sbjct: 77  TEREEEAVVAKMPAPKTVLPRARK------LPVPKPL----------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WE+ AKAKGI+ R ++K +YDE   +WVP +GY+    +   DW++ VPQN
Sbjct: 108 -------TKWEEIAKAKGIKKRVRDKKVYDEVLDKWVPTYGYQRFKAEKEKDWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTK-----GADARSLRKGELQR 248
            DP +D F                   RNI  + A   QT      G DA S R  EL  
Sbjct: 161 ADPNKDMFQEKRDLRIDRIAKNEIARMRNI--ARAKKIQTPRTGFLGPDAASAR--ELVT 216

Query: 249 QIAISKSATASIGKFDKTLKGELKLKGV 276
              ++K++TAS+GKF + L  E + +G+
Sbjct: 217 AANVAKASTASVGKFQEKLTNEKQARGI 244



>gi|426359826|ref|XP_004047162.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Gorilla
           gorilla gorilla]
          Length = 365

 Score =  133 bits (334), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 134/283 (47%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N   + R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTQLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEEAIVARLPEPTTRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           N DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 NADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|471364113|ref|XP_004372607.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Trichechus manatus latirostris]
          Length = 365

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 130/282 (46%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTLEAELRGLARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
           N DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 NADPLEDQFAKRVQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRGTGKKRKFQPLFGD 260



>gi|297682996|ref|XP_002819191.1| PREDICTED: ribosome biogenesis regulatory protein homolog, partial
           [Pongo abelii]
          Length = 399

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 131/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 122 KLQRITVHKELELEFDLGNLLASDRNPPTRLRCAEPTPEAELRALARDNTQLLINQLWQL 181

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 182 PTERVEEAIVARLPEPTTRLPREKP------LPRPRPL---------------------- 213

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 214 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 264

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           N DP EDQF+                  RN+         S A L+ T         K E
Sbjct: 265 NADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQS-----KEE 319

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 320 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 362



>gi|434779|dbj|BAA04948.1| KIAA0112 [Homo sapiens]
          Length = 399

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 131/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + LQ+DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 54  KLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQLWQL 113

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 114 PTERVEEAIVARLPEPTTRLPREKP------LPRPRPL---------------------- 145

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 146 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 196

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           N DP EDQF+                  RN+         S A L+ T         K E
Sbjct: 197 NADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQS-----KEE 251

Query: 246 LQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +  G KRKF+P  GD
Sbjct: 252 LGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGD 294



>gi|14719402|ref|NP_055984.1| ribosome biogenesis regulatory protein homolog [Homo sapiens]
 gi|21431847|sp|Q15050.2|RRS1_HUMAN RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|12804751|gb|AAH01811.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Homo
           sapiens]
 gi|15278392|gb|AAH13043.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Homo
           sapiens]
 gi|119607306|gb|EAW86900.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Homo
           sapiens]
 gi|123984836|gb|ABM83698.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)
           [synthetic construct]
 gi|157928500|gb|ABW03546.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)
           [synthetic construct]
 gi|168274376|dbj|BAG09608.1| ribosome biogenesis regulatory protein homolog [synthetic
           construct]
          Length = 365

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 133/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + LQ+DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEEAIVARLPEPTTRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           N DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 NADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGEL--KLKGVKRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +  G KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGD 260



>gi|348588476|ref|XP_003479992.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Cavia
           porcellus]
          Length = 357

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 131/278 (47%), Gaps = 42/278 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R      +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPAPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEAVVARLPEPTTRLPREKPVPKPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGYK    D   +WLI VP+
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWQRRWGYKRAR-DDTKEWLIEVPE 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-EAALNQTKGADARSLR-KGELQRQI 250
           + DP EDQF+                  RN+  + +  L  T G      + K EL R +
Sbjct: 163 SADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKTQLPSTAGMHPTGHQSKEELGRAM 222

Query: 251 AISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 223 QVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|397522742|ref|XP_003831415.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Pan
           paniscus]
          Length = 365

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 132/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + LQ+DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELQFDLGNLLASDRNPPTRLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEEAIVARLPEPTTRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE + +W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSSQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           N DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 NADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|431891814|gb|ELK02348.1| Ribosome biogenesis regulatory protein like protein [Pteropus
           alecto]
          Length = 371

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 133/282 (47%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R +  T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLALDRNPPTGLRREGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI +P 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEMPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR------KGEL 246
           + DP EDQF+                  RN+  S    ++T+   A  L       K EL
Sbjct: 163 SADPLEDQFAKRIQAKKERVAKNELNRLRNLARS----HKTQLPSAAGLHPTGHQSKEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRALQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|7670442|dbj|BAA95072.1| unnamed protein product [Mus musculus]
          Length = 365

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 134/283 (47%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DEA+G+W  RWGYK    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEASGQWRRRWGYKRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           + DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 SADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHKMQMPSSAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|227908779|ref|NP_067486.2| ribosome biogenesis regulatory protein homolog [Mus musculus]
 gi|21362904|sp|Q9CYH6.1|RRS1_MOUSE RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|12857046|dbj|BAB30871.1| unnamed protein product [Mus musculus]
 gi|13097501|gb|AAH03481.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Mus
           musculus]
 gi|33416756|gb|AAH55925.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Mus
           musculus]
 gi|74206412|dbj|BAE24922.1| unnamed protein product [Mus musculus]
 gi|148682331|gb|EDL14278.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Mus
           musculus]
          Length = 365

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 134/283 (47%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DEA+G+W  RWGYK    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEASGQWRRRWGYKRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           + DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 SADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHKMQMPSSAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|49022822|dbj|BAC65489.2| mKIAA0112 protein [Mus musculus]
          Length = 373

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 134/283 (47%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 28  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 87

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 88  PTERVEEAVVARLPEPATRLPREKP------LPRPRPL---------------------- 119

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DEA+G+W  RWGYK    D   +WLI VP 
Sbjct: 120 --------TRWQQFARLKGIRPKKKTNLVWDEASGQWRRRWGYKRAR-DDTKEWLIEVPG 170

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           + DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 171 SADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHKMQMPSSAGLHPT-GHQS----KEE 225

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 226 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 268



>gi|12860310|dbj|BAB31912.1| unnamed protein product [Mus musculus]
          Length = 365

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 134/283 (47%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DEA+G+W  RWGYK    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEASGQWRRRWGYKRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           + DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 SADPMEDQFAKRTQAKKERVAKGELNRLRNLARAHKMQMPSSAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|357608815|gb|EHJ66162.1| putative regulator of ribosome biosynthesis [Danaus plexippus]
          Length = 353

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 126/266 (47%), Gaps = 40/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           KYK ITVE+ + ++YDL  L  +DTN LD   L  ++  D YL+  +RD TQLL+N+I++
Sbjct: 17  KYKPITVEKHLDVEYDLGTLLVYDTNDLDSKLLNANSNRDEYLQSLSRDNTQLLLNKIWE 76

Query: 72  LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXX 131
           LP    D   +  LP+  TV+PR KPV        P+ L                     
Sbjct: 77  LPTERIDEAIVVRLPQPTTVLPRSKPVPK------PKPL--------------------- 109

Query: 132 XXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVP 191
                    T+W++FAKAKGI  + K+K+ +DE   +WVP +G++    +   DWLI VP
Sbjct: 110 ---------TKWQEFAKAKGITKQKKDKLKWDEQLQKWVPLYGFRKAAAEKEKDWLIEVP 160

Query: 192 QNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQRQIA 251
           Q+ DP  D +                   +NI  S        G    S +    Q   A
Sbjct: 161 QHMDPMTDMYEKKAGEKSEKVAKNELQRLKNIARSRKVKIPRVGLPVTSDKASATQLSTA 220

Query: 252 --ISKSATASIGKFDKTLKGELKLKG 275
             ++K++TAS+GKF   L  E + +G
Sbjct: 221 AVVAKASTASLGKFQDKLPKEQEARG 246



>gi|440908356|gb|ELR58380.1| Ribosome biogenesis regulatory protein-like protein [Bos grunniens
           mutus]
          Length = 365

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 131/282 (46%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV++ + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVQKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPSTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
           N DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 NADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|443689971|gb|ELT92238.1| hypothetical protein CAPTEDRAFT_171414 [Capitella teleta]
          Length = 341

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 131/289 (45%), Gaps = 51/289 (17%)

Query: 7   QLETQK-SKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLL 65
           Q E +K + YKS  V++ I L  D   L A D N ++    ++    YL    RD  Q+L
Sbjct: 10  QAEAEKNASYKSTEVDKAIELDIDEGNLVAVDLNPINGKHYRSKCQTYLNHLARDNAQIL 69

Query: 66  INQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXX 125
            N I++LP    D   +A LPE+ T +PREKPV        P++  +             
Sbjct: 70  FNAIWQLPTKRVDEAIVAVLPEKKTSVPREKPV--------PKDQPM------------- 108

Query: 126 XXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGAND 185
                          TRWE++AK K I  R K  M++D+A  EW PR+GYK   GD   D
Sbjct: 109 ---------------TRWEQYAKLKNIHKRKKETMVWDDAVKEWRPRFGYKKA-GDEKRD 152

Query: 186 WLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADAR 239
           W++ VPQ+ DP+EDQF                   RN+  +         L  T   D  
Sbjct: 153 WMLEVPQSADPYEDQFEKRGKAKNERVAKNELQRLRNVARNMKGKIPGVGLTPTDAPDV- 211

Query: 240 SLRKGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGD 286
                 ++R +A ++ +TAS+G+FD+ L  E   +  G KRK E S  D
Sbjct: 212 ----DHVKRSLAQAQKSTASLGRFDQKLSHEKPARNLGKKRKAELSSTD 256



>gi|470644583|ref|XP_004326595.1| PREDICTED: LOW QUALITY PROTEIN: ribosome biogenesis regulatory
           protein homolog [Tursiops truncatus]
          Length = 365

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 130/282 (46%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTDRVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEGSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
           N DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 NADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHKLRLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + +++ +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAVQVARVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|466034379|ref|XP_004275011.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Orcinus
           orca]
          Length = 365

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 130/282 (46%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTDRVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEGSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
           N DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 NADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHKLRLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + +++ +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAVQVARVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|311253771|ref|XP_003125652.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Sus
           scrofa]
          Length = 365

 Score =  130 bits (328), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 130/282 (46%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRHAGPTKEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEETLVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPS 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
           N DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 NADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|344273133|ref|XP_003408381.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Loxodonta africana]
          Length = 365

 Score =  130 bits (328), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 129/282 (45%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTLEAELRSLARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
             DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 RADPLEDQFAKRVQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|403164650|ref|XP_003324729.2| hypothetical protein PGTG_06266 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375165255|gb|EFP80310.2| hypothetical protein PGTG_06266 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 349

 Score =  130 bits (327), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 143/291 (49%), Gaps = 55/291 (18%)

Query: 12  KSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIF 70
           K+K KS+TV+R IP+  D+ LLAAFD N +D+    +   + YLK+  RD  Q+L+N++F
Sbjct: 11  KTKRKSVTVQREIPIDLDVGLLAAFDPNPIDQPEYNSAGREEYLKQSARDSIQVLVNKLF 70

Query: 71  KLPITTSDLGKLAELPEQ--ITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXX 128
            LP + +D G +A LP     T++PR K       L  P+ L                  
Sbjct: 71  GLPTSLTDDGVVANLPASGLTTILPRSK------RLPKPKPL------------------ 106

Query: 129 XXXXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGTNGDGANDWL 187
                       T+WEKF+K KGI  + K ++M +D    EWV RWG+ G N D  N W+
Sbjct: 107 ------------TKWEKFSKDKGIAPKAKRDRMEFDTEKQEWVNRWGFNGKNKDPENAWI 154

Query: 188 IPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRR--NIEESE---AALNQTKGADARSL- 241
             V  +++                        +R  N+E +    A  N TK  +A +  
Sbjct: 155 REVKPSEELTNPGLEINHAKRARKERTLKNEKQRLKNVERAATEIAKSNSTKVLEASTAP 214

Query: 242 ---RKGELQRQ------IAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 283
              R+ +LQR+      ++ +K +TAS+GKFDK    E K+KG+KRKFEP+
Sbjct: 215 LAKREEQLQRKQEVEGLLSATKKSTASLGKFDKKFANEPKVKGLKRKFEPT 265



>gi|507538708|ref|XP_004653370.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Jaculus
           jaculus]
          Length = 367

 Score =  130 bits (327), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 132/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLIN++++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTTVRHAGATPEAELRALARDNTQLLINELWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEEAVVARLPEPSTRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DEA+G+W  RWGYK    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEASGQWRRRWGYKRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
             DP EDQF+                  +N+         S A L+ T     R   K E
Sbjct: 163 GADPMEDQFAKRIQAKKERVAKNELNRLQNLARAHKMQVPSAAGLHPT-----RPQSKEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|170090662|ref|XP_001876553.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164648046|gb|EDR12289.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 318

 Score =  130 bits (327), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 127/279 (45%), Gaps = 43/279 (15%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S+ L    +K++S+TVE+  PL+ D   L   D N++DE     + + +L+   RDG Q
Sbjct: 3   VSNVLAAHAAKFQSVTVEKDTPLEVDAGYLLVTDLNSIDEETYNENLEEHLQSLARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
            L   +F LP   S  G LA+LP  I  +                               
Sbjct: 63  SLFTTLFNLPTRPSPDGPLAQLPPPIYQL------------------------------- 91

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            T+WE+FA AKGIQ + + K ++DE   EWV RWG  G N +  
Sbjct: 92  -----PRAKPLPKPKPPTKWERFAAAKGIQKKVREKRVWDEEKQEWVNRWGRDGKNKEVE 146

Query: 184 NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRK 243
             W+  VP N D   D                     +N+++    + +  G + R  +K
Sbjct: 147 QAWITEVPLNADVDHDPRKIARDARKERIA-------KNLKQQTQNIARAAGNNPRQEKK 199

Query: 244 GELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEP 282
            E+++ +A ++ +TAS+GKFDK L+GE K++GVKRKFEP
Sbjct: 200 QEIEKTLAAARISTASMGKFDKKLEGEKKVRGVKRKFEP 238



>gi|512818753|ref|XP_004878921.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Heterocephalus glaber]
 gi|512959774|ref|XP_004842172.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Heterocephalus glaber]
 gi|351696434|gb|EHA99352.1| Ribosome biogenesis regulatory protein-like protein [Heterocephalus
           glaber]
          Length = 365

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 128/278 (46%), Gaps = 42/278 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R      +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVSKELELEFDLGNLLASDRNPPTALRQAGPVPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPKPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI  + K  +++DE +G+W  RWGYK    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIHPKKKTNLVWDEVSGQWRRRWGYKRAR-DDTTEWLIEVPD 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-EAALNQTKGADARSLR-KGELQRQI 250
             DP EDQF+                  RN+  + +  L  T G      + K EL R +
Sbjct: 163 GADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKTQLPSTAGMHPTGHQSKEELGRAM 222

Query: 251 AISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 223 QVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|321463110|gb|EFX74128.1| hypothetical protein DAPPUDRAFT_307435 [Daphnia pulex]
          Length = 356

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 90/291 (30%), Positives = 131/291 (45%), Gaps = 47/291 (16%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S   E +  K KSI V++ + L+YD+  L A+D N +D ++ + D + YL   +RD  Q
Sbjct: 10  LSKAAEDEAEKLKSIQVDKVVELEYDVGNLLAYDINDIDVNQFRADKEAYLANLSRDNVQ 69

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
           LLINQIF+LP    D   + +LP   T +PR KP      L                   
Sbjct: 70  LLINQIFQLPTIKVDNEVVIKLPSATTRLPRAKPAPKEKAL------------------- 110

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            ++WEK+AK KGI  R K+K  +DE   +WVPR+G+K    +  
Sbjct: 111 -----------------SKWEKYAKEKGITKRKKSKATWDEELQKWVPRFGFKKALAEKE 153

Query: 184 NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRK 243
            +W++ VP N     D  +                  RNI    A + ++K     SL  
Sbjct: 154 KNWVVEVPGNAKDDVDPIALRKTKKQESVAKNELQRLRNI---SARMQKSKTKAKISLEP 210

Query: 244 GE------LQRQIAISKSATASIGKFDKTLKGELKL--KGVKRKFEPSIGD 286
            E      L R + I+ +ATAS+GKF   LK +  +   G KR F+P +GD
Sbjct: 211 TERPTAEQLNRSVFIAHTATASVGKFQPNLKEQKPVLKSGQKRHFDPLVGD 261



>gi|296226606|ref|XP_002759025.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Callithrix jacchus]
          Length = 527

 Score =  130 bits (326), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 131/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 182 KLQRITVLKELELEFDLGNLLASDRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 241

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 242 PTERVEEAIVARLPEPTTRLPREKP------LPRPRPL---------------------- 273

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 274 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 324

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           N DP EDQF+                  RN+         S A L+ T         K E
Sbjct: 325 NADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQS-----KEE 379

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 380 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 422



>gi|488584946|ref|XP_004477844.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Dasypus
           novemcinctus]
          Length = 365

 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 131/278 (47%), Gaps = 42/278 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPTLEAELRTLARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-EAALNQTKGADARSLR-KGELQRQI 250
           + DP EDQF+                  RN+  + +  L  T G      + K EL R +
Sbjct: 163 SADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHKTQLPSTAGLHPTGHQSKEELGRAM 222

Query: 251 AISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 223 QVAKVSTASVGRFQERLLKEKAPRGPGKKRKFQPVFGD 260



>gi|149721357|ref|XP_001494863.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Equus
           caballus]
          Length = 365

 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 130/282 (46%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-LKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T    L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLATDRNPPTAVRSAGPTPEADLRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR------KGEL 246
             DP EDQF+                  RN+    A  ++T+   A  +       K EL
Sbjct: 163 GADPMEDQFAKRIQAKKERVAKNELNRLRNL----ARAHKTQLPSAAGMHPTGHQSKEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|336373761|gb|EGO02099.1| hypothetical protein SERLA73DRAFT_132892 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 311

 Score =  129 bits (325), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 122/280 (43%), Gaps = 43/280 (15%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S+ L +  +K++SI VE+  PL  D   L   D N +DE     + + YL+   RDG Q
Sbjct: 3   VSNILASHAAKFQSIDVEKETPLDVDTGFLTVTDLNPIDEDSYSTNLEEYLQSTARDGIQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
            LI  ++ LP   S  G LA LP   T++                               
Sbjct: 63  ALIASLYSLPTKPSPDGPLAVLPPPTTLL------------------------------- 91

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            T+WE+FA AKGIQ + + K I+DE   EWV RWG  G N +  
Sbjct: 92  -----PREKPLPKPKPPTKWERFASAKGIQKKVREKKIWDEEKQEWVNRWGRDGKNKEKE 146

Query: 184 NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRK 243
           + W+  VP N       F                  R+ ++     + +T     R  R 
Sbjct: 147 DQWITEVPAN---AAVDFDPVKVARDARKSRVAQNERQRLQN----VARTTAQSERQDRN 199

Query: 244 GELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 283
            E+ R +A ++ +TAS+GKFDK L GE KLKG+KRKFEP+
Sbjct: 200 KEIDRTLATTRLSTASMGKFDKKLDGEKKLKGIKRKFEPT 239



>gi|432927905|ref|XP_004081085.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Oryzias
           latipes]
          Length = 338

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 137/277 (49%), Gaps = 41/277 (14%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKL 72
           K K+I+V++ + L +D+  L A D N ++    K  + +++L+   RD TQLLIN+I+K+
Sbjct: 20  KLKTISVQKELDLDFDVGNLLACDKNRIESRDFKEQNKEDFLRSLARDNTQLLINEIWKV 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A+LPE  T +PREKP                                   
Sbjct: 80  PTERVEEAIVAKLPEPTTRLPREKPPPKPKP----------------------------- 110

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WE+FAK KGIQ + K  +++DE   EW  RWGYK  N D   DWLI VPQ
Sbjct: 111 -------PTKWEQFAKLKGIQKKKKTNLVWDETAKEWRRRWGYKRAN-DDTKDWLIEVPQ 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR-KGELQRQIA 251
             DP EDQF+                  +N+  S+   N   G   R+ + K EL + ++
Sbjct: 163 TSDPNEDQFAKRAHAKKERVAKNEFNRLKNVARSQKIKNPGVGLLPRAKQSKDELSKAVS 222

Query: 252 ISKSATASIGKFDKTLKGEL--KLKGVKRKFEPSIGD 286
           ++K++TAS+G+F   L  E   K  G +RKFEP IGD
Sbjct: 223 VAKTSTASVGRFQDRLPKEKPPKNAGKRRKFEPLIGD 259



>gi|478523202|ref|XP_004435804.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Ceratotherium simum simum]
          Length = 365

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 132/282 (46%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRSAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K+ +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKSNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSL------RKGEL 246
             DP EDQF+                  RN+    A  ++T+   A  +       K EL
Sbjct: 163 GADPLEDQFAKRIQAKKERVAKNELNRLRNL----ARAHKTQLPSAAGMLPTGHQSKEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|472365593|ref|XP_004402349.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Odobenus
           rosmarus divergens]
          Length = 379

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 128/282 (45%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-LKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T    LK   RD TQLLINQ+++L
Sbjct: 34  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPTPEVELKALARDNTQLLINQLWQL 93

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 94  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 125

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 126 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 176

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
             DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 177 GADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEEL 232

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 233 GRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 274



>gi|296480600|tpg|DAA22715.1| TPA: ribosome biogenesis regulatory protein homolog [Bos taurus]
          Length = 365

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 130/282 (46%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVLKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPSTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
           N DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 NADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|511907155|ref|XP_004773029.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Mustela
           putorius furo]
 gi|511992950|ref|XP_004814125.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Mustela
           putorius furo]
          Length = 371

 Score =  129 bits (323), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 131/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 26  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGATPEAELQALARDNTQLLINQLWQL 85

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 86  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 117

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 118 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 168

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
             DP EDQF+                  RN+         S A ++ T G  +    K E
Sbjct: 169 GADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQVPSSAGMHPT-GHQS----KEE 223

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 224 LGRAMQVAKVSTASVGRFQERLPKEKNPRGSGKKRKFQPLFGD 266



>gi|291388062|ref|XP_002710493.1| PREDICTED: homolog of yeast ribosome biogenesis regulatory protein
           RRS1 [Oryctolagus cuniculus]
          Length = 369

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 129/278 (46%), Gaps = 42/278 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R      +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPAPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-EAALNQTKGADARSLR-KGELQRQI 250
             DP EDQF+                  RN+  + +  L  T G      + K EL R +
Sbjct: 163 GADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHKTQLPSTAGLHPTGHQSKEELGRAM 222

Query: 251 AISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            I+K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 223 QIAKVSTASLGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|109086632|ref|XP_001100635.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Macaca
           mulatta]
          Length = 530

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 130/283 (45%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 185 KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 244

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 245 PTERVEETIVARLPEPTTRLPREKP------LPRPRPL---------------------- 276

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE + +W  RWGY+    D   +WLI VP 
Sbjct: 277 --------TRWQQFARLKGIRPKKKTNLVWDEVSSQWRRRWGYQRAR-DDTKEWLIEVPG 327

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           N DP EDQF+                  RN+         S A L+ T         K E
Sbjct: 328 NADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQS-----KEE 382

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 383 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 425



>gi|410987225|ref|XP_003999905.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Felis
           catus]
          Length = 365

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 130/278 (46%), Gaps = 42/278 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPSPEAELQALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-EAALNQTKGADARSLR-KGELQRQI 250
             DP EDQF+                  RN+  + +  L  T G      + K EL R +
Sbjct: 163 GADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSTGGMHPTGHQSKEELGRAM 222

Query: 251 AISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 223 QVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|115497948|ref|NP_001068949.1| ribosome biogenesis regulatory protein homolog [Bos taurus]
 gi|122136026|sp|Q2KIH4.1|RRS1_BOVIN RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|86438042|gb|AAI12637.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Bos
           taurus]
          Length = 365

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 129/282 (45%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVLKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPSTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGRWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
           N DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 NADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|119226200|ref|NP_001073167.1| ribosome biogenesis regulatory protein homolog [Rattus norvegicus]
 gi|182676579|sp|A1A5P2.1|RRS1_RAT RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|118763767|gb|AAI28747.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Rattus
           norvegicus]
 gi|149060956|gb|EDM11566.1| rCG30391 [Rattus norvegicus]
          Length = 365

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 133/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLL+NQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLVNQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGYK    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYKRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           + DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 SADPMEDQFAKRIRAKKERVAKNELNRLRNLARAHKMQMPSSAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|301761996|ref|XP_002916418.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Ailuropoda melanoleuca]
 gi|281338756|gb|EFB14340.1| hypothetical protein PANDA_004488 [Ailuropoda melanoleuca]
          Length = 365

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 129/282 (45%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPTPEAELQALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
             DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 GADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|157131695|ref|XP_001662293.1| ribosome biogenesis regulatory protein [Aedes aegypti]
 gi|94469176|gb|ABF18437.1| regulator of ribosome synthesis [Aedes aegypti]
 gi|108871437|gb|EAT35662.1| AAEL012185-PA [Aedes aegypti]
          Length = 347

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 126/273 (46%), Gaps = 40/273 (14%)

Query: 8   LETQK---SKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQL 64
           LE QK    KYK ITV++ +    D   L   D N  D+ + K+D + YL + TRD TQL
Sbjct: 8   LEKQKKDLEKYKPITVQKHLEAVVDEGHLMVTDPNYFDDDKFKSDREQYLLDLTRDNTQL 67

Query: 65  LINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNX 124
           LIN I++LP    +   +A+LP    V+PR +       L  P+ L              
Sbjct: 68  LINSIWELPTEREEESVVAKLPAARMVLPRARK------LPVPKPL-------------- 107

Query: 125 XXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGAN 184
                           T+WE+ AKAKGI+ R ++K +YDE   +WVP +GY+    +   
Sbjct: 108 ----------------TKWEQIAKAKGIKKRTRDKKVYDEVLDKWVPTYGYQRFKAEKEK 151

Query: 185 DWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKG-ADARSLRK 243
           DW+I VPQN DP +D F+                  RNI  ++       G     S   
Sbjct: 152 DWIIEVPQNADPNKDMFAEKRDLRIERIAKNEISRMRNIARAKKIQTPRTGFLGPESASA 211

Query: 244 GELQRQIAISKSATASIGKFDKTLKGELKLKGV 276
            EL     I+K++TAS+G F + L  E + +G+
Sbjct: 212 KELVTAANIAKASTASVGVFQEKLSNEKQARGI 244



>gi|12845436|dbj|BAB26750.1| unnamed protein product [Mus musculus]
          Length = 365

 Score =  128 bits (321), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 133/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++D A+G+W  RWGYK    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDVASGQWRRRWGYKRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           + DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 SADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHKMQMPSSAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|507669887|ref|XP_004649132.1| PREDICTED: LOW QUALITY PROTEIN: RRS1 ribosome biogenesis regulator
           homolog (S. cerevisiae) [Octodon degus]
          Length = 365

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 126/279 (45%), Gaps = 44/279 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R      +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTALRQAGPAPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKPVPKPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTSLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPD 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSL---RKGELQRQ 249
             DP EDQF+                  RN+  +  A  Q   A         K EL R 
Sbjct: 163 GADPLEDQFAKRVQAKKERVAKNELNRLRNLARAHKA-QQPPAAGMHPTGHQSKEELGRA 221

Query: 250 IAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           + ++K +TAS+G+F + L  E    G   KRKF+P  GD
Sbjct: 222 MQVAKVSTASVGRFQERLPKEKAPXGSGKKRKFQPLFGD 260



>gi|355779729|gb|EHH64205.1| Ribosome biogenesis regulatory protein-like protein [Macaca
           fascicularis]
          Length = 359

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 90/276 (32%), Positives = 127/276 (46%), Gaps = 44/276 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE    +PREKP      L  P  L                      
Sbjct: 80  PTERVEETIVARLPEPTPRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE   +W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVRSQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQRQIAI 252
           N DP EDQF+                  RN+  +  A     G  +    K EL R + +
Sbjct: 163 NADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKAGLHPTGHQS----KEELGRAMQV 218

Query: 253 SKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           +K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 219 AKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 254



>gi|478250752|gb|ENN71244.1| hypothetical protein YQE_12171, partial [Dendroctonus ponderosae]
          Length = 288

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 141/287 (49%), Gaps = 51/287 (17%)

Query: 9   ETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQ 68
           + + SKYK ITVE+ I L+YD+A L  +D N  +    + D + YL +  RD TQLLINQ
Sbjct: 12  QEESSKYKPITVEKHIDLEYDVASLLVYDFNQFNAQYFERDANGYLLDLARDNTQLLINQ 71

Query: 69  IFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXX 128
           +++LP    +   +A+LP   TV+PR KPV        P+ L                  
Sbjct: 72  LWELPTERVEEAIVAKLPLPKTVLPRAKPVPK------PKEL------------------ 107

Query: 129 XXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLI 188
                       T+WE+FAK KGIQ + K+K+ +D+   +WVP +G+K +  +   +W++
Sbjct: 108 ------------TKWEQFAKEKGIQKKKKSKLSWDDQLQKWVPLFGFKRSQAEKEKNWVL 155

Query: 189 PVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQR 248
            VPQN DP EDQF+                  RNI +    +   + A A+     +LQ 
Sbjct: 156 EVPQNADPTEDQFAKKTVSKSENVAKNELQRLRNIAKRR-NIKIPRVASAK-----DLQA 209

Query: 249 QIAISKSATASIGKFDKTLKGELKLKGV---------KRKFEPSIGD 286
            + ++K++TAS+GKF   L  E +  GV         KRK  P  GD
Sbjct: 210 AVTVAKASTASLGKFQDRLPKEKEATGVTTITPGASKKRKLPPVSGD 256



>gi|355697994|gb|EHH28542.1| Ribosome biogenesis regulatory protein-like protein [Macaca
           mulatta]
          Length = 365

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 132/283 (46%), Gaps = 52/283 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVEETIVARLPEPTTRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE + +W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSSQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGE 245
           N DP EDQF+                  RN+         S A L+ T G  +    K E
Sbjct: 163 NADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPT-GHQS----KEE 217

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           L R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 218 LGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 260



>gi|344304506|gb|EGW34738.1| hypothetical protein SPAPADRAFT_57806 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 203

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 106/204 (51%), Gaps = 53/204 (25%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTD--NYLKEYTRDGTQLLIN 67
           + +++YK +TV++PIP  YDL  LA FD N LD S+L +D+D   YL   TRD  QLLIN
Sbjct: 2   SNETEYKPVTVDKPIPNTYDLGNLATFDPNPLDNSKLTSDSDREEYLTSVTRDNVQLLIN 61

Query: 68  QIFKLPI-TTSDLG----------KLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLS 116
           QI  LP+ TT+D             L +LPE  T +PREK +                  
Sbjct: 62  QILSLPVKTTTDTHGSSTGQNSTMTLIQLPEPSTQLPREKAIP----------------- 104

Query: 117 HILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGY 175
                                   T+WE+FA  KGI+ + K+ KM+YDEATGEWVP+WGY
Sbjct: 105 -------------------KPKPPTKWEQFAARKGIKAKAKDGKMVYDEATGEWVPKWGY 145

Query: 176 KGTNGDGANDWLIPVPQNDDPFED 199
           KG N +  + WL+ V   DD  +D
Sbjct: 146 KGKNKELDDQWLVEV---DDKVKD 166



>gi|57107921|ref|XP_544107.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Canis
           lupus familiaris]
          Length = 365

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 129/282 (45%), Gaps = 50/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDPNPPAGLRRAGPSPEAELQALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGEL 246
             DP EDQF+                  RN+  +       AA     G  +    K EL
Sbjct: 163 GADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEEL 218

Query: 247 QRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEPSIGD 286
            R + ++K +TAS+G+F + L  E   +  G KRKF+P  GD
Sbjct: 219 GRAMQVAKVSTASVGRFQERLPKEKAPRSSGKKRKFQPLFGD 260



>gi|504151475|ref|XP_004588076.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Ochotona
           princeps]
          Length = 362

 Score =  127 bits (318), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 129/278 (46%), Gaps = 42/278 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNA-LDESRLKNDTDNYLKEYTRDGTQLLINQIFKL 72
           + + ITV + + L++DL  L A D N      R     +  L+   RD TQLLINQ+++L
Sbjct: 20  RLQRITVHKELELEFDLGNLLACDRNPPTGLRRAGAAPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    D   +A LPE  T +PREKPV     L                            
Sbjct: 80  PTERVDEAVVARLPEPSTRLPREKPVPRPRPL---------------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-EAALNQTKGADARSLR-KGELQRQI 250
             DP EDQF+                  RN+  + +A L    G      + K EL R +
Sbjct: 163 GADPMEDQFAKRLQAKKERVAKNELNRLRNLARAHKAQLPSGAGLHPTGHQSKEELGRAM 222

Query: 251 AISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            ++K +TAS+G+F + L  E   +G   KR+F+P  GD
Sbjct: 223 QVAKVSTASLGRFQERLPKEKAPRGPGKKRQFQPLFGD 260



>gi|409079540|gb|EKM79901.1| hypothetical protein AGABI1DRAFT_113150 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 304

 Score =  126 bits (317), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 115/255 (45%), Gaps = 44/255 (17%)

Query: 29  DLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQ 88
           D   L   +T  +D      + +  +++  R+ +Q L+  +F LP T S  G+LA LP  
Sbjct: 27  DAGYLTVTNTTPIDADLYNENIEQSIEQNARESSQKLLGALFHLPSTASADGRLALLPPP 86

Query: 89  ITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAK 148
              +PREKP+                                          T+WE+FA 
Sbjct: 87  TFALPREKPLP------------------------------------KAKEMTKWERFAA 110

Query: 149 AKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXX 208
           AKGIQ + + K I+DE   EWV RWG+KG N +G   WL  VP N D   D         
Sbjct: 111 AKGIQKKKREKKIWDEEKQEWVDRWGWKGKNKEGETQWLHEVPSNADVDHDPRKIARDER 170

Query: 209 XXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLK 268
                       +N+  S           + + RK E++R +A ++ +TASIGKFD+ L+
Sbjct: 171 KARTAKNEKQKLQNLSHS--------TGQSSNDRKQEIERTLATTRVSTASIGKFDRQLE 222

Query: 269 GELKLKGVKRKFEPS 283
           GE K +G+KRKFEP+
Sbjct: 223 GEKKPRGIKRKFEPT 237



>gi|164448678|ref|NP_001088404.1| RRS1 ribosome biogenesis regulator homolog [Xenopus laevis]
 gi|54261637|gb|AAH84301.1| Rrs1 protein [Xenopus laevis]
          Length = 344

 Score =  126 bits (316), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 136/306 (44%), Gaps = 42/306 (13%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIFKL 72
           K K I+V + + L++DL  L A D NA   S  +  + D +L+   RD TQLLINQ++ L
Sbjct: 20  KLKLISVNKELELEFDLGNLLACDPNAPSVSAFRQQNKDEFLRALARDNTQLLINQVWTL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P        +A+LPE  T +PREKPV                                  
Sbjct: 80  PTEKLQEAIVAKLPEPATRLPREKPVP--------------------------------- 106

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRWE+FAK KGIQ + K  +++DE   EW  RWGYK    D   DW+I VP 
Sbjct: 107 ---KPRAPTRWEEFAKLKGIQKKKKTNLMWDEVNKEWRRRWGYKRAK-DDTKDWMIEVPH 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKG-ADARSLRKGELQRQIA 251
             DP EDQF+                  RNI  SE       G        K EL + + 
Sbjct: 163 TADPNEDQFAKRMKAKTERVAKNELNRLRNIARSEKMKVPGVGLTPTDQPTKAELGKPMH 222

Query: 252 ISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGDXXXXXXXXXXXXXXXXGKKGDIV 309
           ++K +TAS+G+F   L  E + +  G KRKF+P IGD                 KK  ++
Sbjct: 223 VAKVSTASVGRFQDKLPKEKEPRNMGKKRKFQPLIGDFAAEKSKQLDILKVMDSKKP-VL 281

Query: 310 NVRKAI 315
           N+ KA+
Sbjct: 282 NMTKAV 287



>gi|405978850|gb|EKC43211.1| Ribosome biogenesis regulatory-like protein [Crassostrea gigas]
          Length = 324

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 131/281 (46%), Gaps = 56/281 (19%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           ++S YK+I V + I L+ D   L   DTN LD ++LK + + YLK   RD TQLLIN ++
Sbjct: 15  RESHYKTIEVHKDIELEIDPGNLLTVDTNPLDATKLKKNREEYLKSLARDNTQLLINTLW 74

Query: 71  KLPITTSDLGKLAELPEQITV-IPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXX 129
           +LP    D        E I V +P++K +                               
Sbjct: 75  QLPTEKVD--------EAIVVKVPKDKAL------------------------------- 95

Query: 130 XXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIP 189
                      T+W+++A+ KGIQ R K++M++D+ + EW PRWGYK  N D   +W I 
Sbjct: 96  -----------TKWQQYAQLKGIQKRKKSRMMWDDQSKEWKPRWGYKRGN-DDTQEWCIE 143

Query: 190 VPQN-DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKG-ADARSLRKGELQ 247
           VP N  DP  D F+                  RNI  S+ +     G     +  K  L 
Sbjct: 144 VPDNAADPNVDLFAKKNKEKKERVAKNELQRLRNIARSQKSKVPGVGLTPTEAPSKDYLG 203

Query: 248 RQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEPSIGD 286
           + +A+++ +TASIGKF   L  E   K  G KRKFEP+ GD
Sbjct: 204 KALALARKSTASIGKFTDKLPTEKPSKHTGKKRKFEPNYGD 244



>gi|459367862|gb|EMG46764.1| Ribosome biogenesis [nuclear export] protein, putative [Candida
           maltosa Xu316]
          Length = 202

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 104/198 (52%), Gaps = 52/198 (26%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT---DNYLKEYTRDGTQL 64
           + ++  +YK +TVE+PIP  YDL  LA FD N LD ++L ND    ++YL   TRD  QL
Sbjct: 1   MSSEDKEYKPVTVEKPIPNTYDLGNLATFDPNPLDNTQL-NDAETKESYLTSVTRDNVQL 59

Query: 65  LINQIFKLPI-TTSDLG----------KLAELPEQITVIPREKPVSFYFVLYFPENLFLL 113
           LINQI  LP+ TT+D             L +LP+  T++PREKP+     L         
Sbjct: 60  LINQILSLPVKTTTDTHGSSTGQNSTMTLIQLPDPTTILPREKPIPKAKPL--------- 110

Query: 114 NLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPR 172
                                      T+W++FA+ KGI+ + K+ KM+YDE  GEWVP+
Sbjct: 111 ---------------------------TKWQEFAQRKGIKAKEKSGKMVYDEEKGEWVPK 143

Query: 173 WGYKGTNGDGANDWLIPV 190
           WGYKG N D  + WL+ V
Sbjct: 144 WGYKGKNKDLDDQWLVEV 161



>gi|426192508|gb|EKV42444.1| hypothetical protein AGABI2DRAFT_195783 [Agaricus bisporus var.
           bisporus H97]
          Length = 304

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 115/255 (45%), Gaps = 44/255 (17%)

Query: 29  DLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQ 88
           D   L   +T  +D      + +  +++  R+ +Q L+  +F LP T S  G+LA LP  
Sbjct: 27  DAGYLTVTNTTPIDADLYDENIEQSIEQNARESSQKLLGALFHLPSTASADGRLALLPPP 86

Query: 89  ITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAK 148
              +PREKP+                                          T+WE+FA 
Sbjct: 87  SFALPREKPLP------------------------------------KAKEMTKWERFAA 110

Query: 149 AKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXX 208
           AKGIQ + + K I+DE   EWV RWG+KG N +G   WL  VP N D   D         
Sbjct: 111 AKGIQKKKREKKIWDEEKQEWVDRWGWKGKNKEGETQWLHEVPSNADVDHDPRKIARDER 170

Query: 209 XXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLK 268
                       +N+  S           + + RK E++R +A ++ +TASIGKFD+ L+
Sbjct: 171 KARTAKNEKQKLQNLSHS--------TGQSSNDRKQEIERTLATTRVSTASIGKFDRQLE 222

Query: 269 GELKLKGVKRKFEPS 283
           GE K +G+KRKFEP+
Sbjct: 223 GEKKPRGIKRKFEPT 237



>gi|444318922|ref|XP_004180118.1| hypothetical protein TBLA_0D00910 [Tetrapisispora blattae CBS 6284]
 gi|387513160|emb|CCH60599.1| hypothetical protein TBLA_0D00910 [Tetrapisispora blattae CBS 6284]
          Length = 203

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 101/202 (50%), Gaps = 59/202 (29%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN-------YLKEYTRD 60
           + T   K + +TVE+PIP+ YDL  LA FD+N LD    KND D+       ++K++TRD
Sbjct: 1   MSTVDYKDRPVTVEKPIPVTYDLGNLAVFDSNVLD----KNDFDSSNGEREKHIKDHTRD 56

Query: 61  GTQLLINQIFKLPITT-----------SDLGKLAELPEQITVIPREKPVSFYFVLYFPEN 109
             QLLINQI  LP+ T           S    L +LPE +T +PREKP+           
Sbjct: 57  NVQLLINQILSLPMKTTTEATGGSSGQSSTMTLIQLPEPLTELPREKPLP---------- 106

Query: 110 LFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGE 168
                                          T+WE+FA  KGIQ + K  KMIYDEA+GE
Sbjct: 107 --------------------------KAKAPTKWEQFAAKKGIQPKAKTGKMIYDEASGE 140

Query: 169 WVPRWGYKGTNGDGANDWLIPV 190
           WVP+WGYKG N    + WL+ V
Sbjct: 141 WVPKWGYKGANKKLDDQWLVEV 162



>gi|126321316|ref|XP_001379079.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Monodelphis domestica]
          Length = 363

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 134/284 (47%), Gaps = 53/284 (18%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           K + ITV + + L++DL  L A D N     R ++    +  L+   RD TQLLIN +++
Sbjct: 20  KLRLITVHKDLELEFDLGNLLAIDPNPPTGLRQQSGRGLEERLQGLARDNTQLLINHLWQ 79

Query: 72  LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXX 131
           LP    +   +A+LPE    +PREKP      L  P  L                     
Sbjct: 80  LPTERVEEAVVAKLPEPSLRLPREKP------LPKPRPL--------------------- 112

Query: 132 XXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVP 191
                    TRW++FA+ KGI+ R K  +++DEA+ +W  RWGY+    D   DWLI VP
Sbjct: 113 ---------TRWQQFAQLKGIRPRKKTSLVWDEASKQWRRRWGYQRAR-DDTKDWLIEVP 162

Query: 192 QNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKG 244
              DP EDQF+                  RNI         S+  ++ T G  +R     
Sbjct: 163 GGADPNEDQFAKRLQAKKERVAKNELNRLRNIARAHKVHLPSQGGMHPT-GHQSRE---- 217

Query: 245 ELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           EL R + ++K +TAS+G+F + L  E   +G   KR+F+P+IGD
Sbjct: 218 ELGRAMQVAKVSTASVGRFQERLPKEKPPRGPGKKRQFQPNIGD 261



>gi|312371076|gb|EFR19340.1| hypothetical protein AND_22646 [Anopheles darlingi]
          Length = 298

 Score =  124 bits (312), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 126/264 (47%), Gaps = 38/264 (14%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+P+    D+  L   D N  DE +LK + + Y+ + TRD  QLLIN +++LP
Sbjct: 17  KYKPITVEKPLEPTVDIGHLLVSDPNYFDEDKLKENREQYVLDVTRDNVQLLINSVWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               +   +A+LP   TV+PR +       L  P+ L                       
Sbjct: 77  TERVEESIVAKLPAPRTVLPRARK------LPVPKPL----------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+W++FA+AKGI+ R ++K +YDE   +WVP +GY+    +   DW++ VPQN
Sbjct: 108 -------TKWQEFAQAKGIKKRTRDKKVYDEVLEKWVPTYGYQRFKAEKERDWVLDVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA-ALNQTKGADARSLRKGELQRQIAI 252
            DP+ D F                   +NI  ++  A  +T      S    +L     +
Sbjct: 161 -DPYRDMFKEKRDLRIERVAKNEVARMKNIARAKKIATPRTGFVGPDSASAKQLITASNV 219

Query: 253 SKSATASIGKFDKTLKGELKLKGV 276
            K++TAS+G F ++L  E + +G+
Sbjct: 220 VKASTASVGVFQESLPNEKQARGI 243



>gi|189230132|ref|NP_001121390.1| uncharacterized protein LOC100158478 [Xenopus (Silurana)
           tropicalis]
 gi|158253555|gb|AAI54207.1| Rrs1 protein [Danio rerio]
 gi|183986130|gb|AAI66088.1| LOC100158478 protein [Xenopus (Silurana) tropicalis]
          Length = 346

 Score =  124 bits (312), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 126/277 (45%), Gaps = 41/277 (14%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKL 72
           K KSITV + + L++D  LL AFD N LD    K N  ++ L+   RD TQLLIN+I+KL
Sbjct: 20  KLKSITVLKELDLEFDPGLLLAFDKNRLDTRDFKGNKREDCLRSLARDNTQLLINEIWKL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    D   +A+LPE  T +                                        
Sbjct: 80  PTERVDEVIVAKLPEPTTKL------------------------------------PREK 103

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+W +FAK KGIQ R K  +++DE   EW  RWGYK    D   +WLI VP 
Sbjct: 104 PAPKPKPPTKWGQFAKLKGIQKRKKTNLVWDEVHKEWKRRWGYKRAK-DDTKEWLIEVPA 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR-KGELQRQIA 251
             DP EDQ +                  +N+  ++       G    S + K EL + ++
Sbjct: 163 TADPNEDQLAKRNKANKERVARNEYNRLKNVARAQKVKVPGTGLLPTSQQTKAELAQAVS 222

Query: 252 ISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGD 286
           ++K +TAS+GKF + L  E   +  G KRKF+P IGD
Sbjct: 223 LAKISTASVGKFQEKLPKEKPARNTGKKRKFQPLIGD 259



>gi|348512152|ref|XP_003443607.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Oreochromis niloticus]
          Length = 344

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 138/278 (49%), Gaps = 46/278 (16%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKLP 73
            KSI+V++ + L++D+  L A D N ++   L+  + +++L+   RD TQLLIN+I+K P
Sbjct: 21  LKSISVQKELDLEFDIGNLLACDKNRIEPRDLREKSKEDFLRALARDNTQLLINEIWKQP 80

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               +   +A+LPE  T +PREK          P                          
Sbjct: 81  TERVEEAIVAKLPEPTTRLPREK---------LP-------------------------- 105

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WE+FAK KGI+ + K  +++DE   EW  RWGYK   GD   +WLI VP++
Sbjct: 106 -PKPRPPTKWEQFAKLKGIKKKKKTNLVWDETAKEWKRRWGYKRA-GDDTKEWLIEVPES 163

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE----AALNQTKGADARSLRKGELQRQ 249
            DP EDQF+                  +NI  S+     A+  T  A   S  K EL R 
Sbjct: 164 ADPNEDQFAKRVKAKKERVAKNELNRLKNIARSQKVKIPAVTLTPKA---SQSKDELARA 220

Query: 250 IAISKSATASIGKF-DKTLKGELKLKGVKRKFEPSIGD 286
            +++K++TAS+G+F D+  K     KG KRKFEP IG+
Sbjct: 221 ESVAKTSTASLGRFQDRLPKENPAKKGKKRKFEPLIGN 258



>gi|326426829|gb|EGD72399.1| ribosome biogenesis protein Rrs1 [Salpingoeca sp. ATCC 50818]
          Length = 262

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 120/261 (45%), Gaps = 42/261 (16%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTD-NYLKEYTRDGTQLLINQIFKLPI 74
           K + V+R      D   +   D   +D  +  ++     +KE  R+  QLL N I+KLP+
Sbjct: 19  KRVQVQRTEEYYVDEGNMFGADPRPVDLHKFNSEAGREEMKETARENVQLLFNAIWKLPM 78

Query: 75  TTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXX 134
              D G+ A LP     +PR+KP         PE                          
Sbjct: 79  ENDDEGRFAVLPPPKMRLPRQKPA--------PEQ------------------------- 105

Query: 135 XXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND 194
                 TRWE+FA+ KGI+   +++M+YDE +GEW PRWGYK  N   A  W I V +  
Sbjct: 106 ---REKTRWERFAELKGIKKTKRSRMLYDEMSGEWRPRWGYKRANDAAAVPW-IEVKEGS 161

Query: 195 DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADA-RSLRKGELQRQIAIS 253
           DP+EDQ+                   +NI    AA  + KG  A R L + EL++ IAI 
Sbjct: 162 DPYEDQYEKLKKDKKARVEKNEQQRLKNI---AAARLKAKGIPANRHLIQKELKKAIAIG 218

Query: 254 KSATASIGKFDKTLKGELKLK 274
           +S+TAS G FDK L GE K+K
Sbjct: 219 RSSTASAGVFDKDLPGEAKIK 239



>gi|498967615|ref|XP_004546707.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Maylandia zebra]
          Length = 344

 Score =  124 bits (310), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 93/278 (33%), Positives = 138/278 (49%), Gaps = 46/278 (16%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKLP 73
            KSI+V++ + L++D+  L A D N ++   L+  + +++L+   RD TQLL+N+I+K P
Sbjct: 21  LKSISVQKELDLEFDIGNLLACDKNRIEPRDLREKSREDFLRALARDNTQLLVNEIWKQP 80

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               +   +A+LPE  T +PREK          P                          
Sbjct: 81  TERVEEAIVAKLPEPTTRLPREK---------LP-------------------------- 105

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WE+FAK KGI+ + K  +++DE   EW  RWGYK   GD   +WLI VP++
Sbjct: 106 -PKPRPPTKWEQFAKLKGIKKKKKTNLVWDETAKEWKRRWGYKRA-GDDTKEWLIEVPES 163

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE----AALNQTKGADARSLRKGELQRQ 249
            DP EDQF+                  +NI  S+     A+  T  A   S  K EL R 
Sbjct: 164 ADPNEDQFAKRVKAKKERVAKNELNRLKNIARSQKVKIPAVTLTPKA---SQSKDELARA 220

Query: 250 IAISKSATASIGKF-DKTLKGELKLKGVKRKFEPSIGD 286
            +++K++TAS+G+F D+  K     KG KRKFEP IG+
Sbjct: 221 ESVAKTSTASLGRFQDRLPKENPAKKGKKRKFEPLIGN 258



>gi|238879409|gb|EEQ43047.1| regulator of ribosome biosynthesis [Candida albicans WO-1]
          Length = 202

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 104/195 (53%), Gaps = 52/195 (26%)

Query: 12  KSKYKSITVERPIPLQYDLALLAAFDTNALDESRL--KNDT--DNYLKEYTRDGTQLLIN 67
           K +YKS+TV++PIP  YDL  LA FD N LD  +L  K+++  +++L+  TRD  QLLIN
Sbjct: 1   KKEYKSVTVDKPIPNTYDLGNLATFDPNPLDNEKLLSKDESIKEDHLQSVTRDNVQLLIN 60

Query: 68  QIFKLPITT------SDLGK-----LAELPEQITVIPREKPVSFYFVLYFPENLFLLNLS 116
           QI  LP+ T      S  G+     L +LPE  T++PREKP+     L            
Sbjct: 61  QILSLPVKTTTETHGSSTGQNSTMTLIQLPEPTTILPREKPIPKAKPL------------ 108

Query: 117 HILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGY 175
                                   T+W++FA  KGI+ + K+ KM+YDE TGEWVP+WGY
Sbjct: 109 ------------------------TKWQQFAARKGIKPKAKDGKMVYDEDTGEWVPKWGY 144

Query: 176 KGTNGDGANDWLIPV 190
           KG N    + WL+ V
Sbjct: 145 KGKNKSIDDQWLVEV 159



>gi|198463129|ref|XP_001352703.2| GA16881 [Drosophila pseudoobscura pseudoobscura]
 gi|198151125|gb|EAL30202.2| GA16881 [Drosophila pseudoobscura pseudoobscura]
          Length = 344

 Score =  123 bits (309), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 122/264 (46%), Gaps = 37/264 (14%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITV++ +  + D+  L   D N  D+  L+++ + YL   TRD TQLL+N I++LP
Sbjct: 17  KYKPITVDKHLECRLDVGTLLITDPNDFDDRELRDNREEYLTALTRDNTQLLLNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  TV+PR + V     L                             
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKVPGPRPL----------------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WE+FAK KGI  + ++K  YD+   +WVP +G+K    + + DW++ VPQN
Sbjct: 108 -------TKWEQFAKEKGITKKKRDKKTYDDTLDKWVPTYGFKHAEAEKSKDWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA-LNQTKGADARSLRKGELQRQIAI 252
            DP  D F                   +NI  +    + ++      +    +L   + +
Sbjct: 161 ADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRARKVDMPRSGYLGPEAASSSQLLTAVTV 220

Query: 253 SKSATASIGKFDKTLKGELKLKGV 276
           +KS+TAS+GKF   L  E + +G+
Sbjct: 221 AKSSTASVGKFQNKLPKEKEARGL 244



>gi|167536855|ref|XP_001750098.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163771427|gb|EDQ85094.1| predicted protein [Monosiga brevicollis MX1]
          Length = 2077

 Score =  123 bits (309), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 85/266 (31%), Positives = 125/266 (46%), Gaps = 44/266 (16%)

Query: 21   ERPI-PLQYDLAL--LAAFDTNALDESRLKNDTD-NYLKEYTRDGTQLLINQIFKLPITT 76
            +RP  P++YD+    +A  D   +   +L   +    L  YTRD  QLL+N I +LP+  
Sbjct: 1683 KRPYHPIEYDIDAGNMAGTDVREVPLGKLLGSSRREALTTYTRDNVQLLLNSIMQLPVDK 1742

Query: 77   SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
            ++ G  A +P   + IPREKP+        PE+                           
Sbjct: 1743 TEEGVFATMPRPASRIPREKPI--------PED--------------------------- 1767

Query: 137  XXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDP 196
                TRWEKFA+ KGIQ   +++M+YDEATGE+ PR+GYK +  D +    + +  N+DP
Sbjct: 1768 -RAQTRWEKFAEMKGIQKSKRSRMVYDEATGEYRPRYGYKRSKQDDSAWPWVELKDNEDP 1826

Query: 197  FEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADAR-SLRKGELQRQIAISKS 255
            + D+F                   +NI    AA  Q  G     +  K EL+  I I ++
Sbjct: 1827 YVDKFQELSDAKKNRVLKNEGQRIKNI---AAARLQASGRKVNPAAIKKELKTAIQIGRT 1883

Query: 256  ATASIGKFDKTLKGELKLKGVKRKFE 281
            +TAS G FD  LKGE KLK   ++ +
Sbjct: 1884 STASAGVFDTDLKGEAKLKRAGKRVQ 1909



>gi|325183780|emb|CCA18239.1| ribosome biogenesis regulatory protein putative [Albugo laibachii
           Nc14]
          Length = 314

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 129/281 (45%), Gaps = 53/281 (18%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           K+  V++   L+YDL  LAAFDT+     +  N+ D  L  +TR+  QLL+N++F LP T
Sbjct: 17  KNSDVKKEDDLEYDLGNLAAFDTHPY---KYTNEKDLAL--FTRENVQLLVNRLFTLPRT 71

Query: 76  TSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXX 135
            +D G LA+LP   T+IPREKP+                                     
Sbjct: 72  ITDAGPLAKLPPPTTIIPREKPLP------------------------------------ 95

Query: 136 XXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDD 195
                T+WEKFAK KGIQ R K++M++DEA  +W P WGYK  N D   DW +     ++
Sbjct: 96  KPNAETKWEKFAKEKGIQKRKKSRMVFDEAAQDWKPNWGYKRAN-DNLQDWAVEAKTGEN 154

Query: 196 PFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGELQR 248
              D ++                   N+         S  A+     +D ++ ++G+   
Sbjct: 155 ALADPWAKRKQAKKARVEKNIKQQAANVGRGGVDKIPSGIAVELAGTSDVKAKQRGKEGT 214

Query: 249 QIAISKS--ATASIGKFDKTLKGEL--KLKGVKRKFEPSIG 285
              + K+  +TAS+GKFD    GE   K KG + +F PS G
Sbjct: 215 MKTLQKAQFSTASMGKFDSMRYGETERKQKGKRNRFLPSTG 255



>gi|148232006|ref|NP_001085071.1| RRS1 ribosome biogenesis regulator homolog [Xenopus laevis]
 gi|47940235|gb|AAH72081.1| MGC78981 protein [Xenopus laevis]
 gi|76780051|gb|AAI06685.1| MGC78981 protein [Xenopus laevis]
          Length = 342

 Score =  122 bits (305), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 135/306 (44%), Gaps = 42/306 (13%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIFKL 72
           K K ITV + + +++DL  L A D NA   S  +  + D +L+   RD TQLLIN+++ L
Sbjct: 19  KLKLITVNKELDVEFDLGNLLACDPNATSVSAFRQQNKDEFLRALARDNTQLLINRMWTL 78

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P        +A+LPE  T +PREKPV                                  
Sbjct: 79  PTEKLQEAIVAKLPEPATRLPREKPVP--------------------------------- 105

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRWE+FAK KGIQ + K  + +D+   EW  RWGYK    D   DW+I VP 
Sbjct: 106 ---KPRAPTRWEEFAKLKGIQKKKKTNLAWDDVNKEWRRRWGYKRAK-DDTKDWMIEVPH 161

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKG-ADARSLRKGELQRQIA 251
             DP EDQF+                  RNI  SE       G        K EL + + 
Sbjct: 162 TADPNEDQFAKRMKAKKERVAKNELNRLRNIARSEKMKVPGVGLTPTDQPTKAELGKAMH 221

Query: 252 ISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGDXXXXXXXXXXXXXXXXGKKGDIV 309
           ++K +TAS+G+F   L  E + +  G KRKF+P IGD                 KK  ++
Sbjct: 222 VAKVSTASVGRFQDKLPKEKEPRNMGKKRKFQPLIGDFSAEKSKQLDILKVMDSKKP-VL 280

Query: 310 NVRKAI 315
           N+ KA+
Sbjct: 281 NMTKAV 286



>gi|241948079|ref|XP_002416762.1| ribosome biogenesis [nuclear export] protein, putative [Candida
           dubliniensis CD36]
 gi|223640100|emb|CAX44346.1| ribosome biogenesis [nuclear export] protein, putative [Candida
           dubliniensis CD36]
          Length = 205

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 115/240 (47%), Gaps = 56/240 (23%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRL--KNDT--DNYLKEYTRDGTQLL 65
           + + +YK +TV++PIP  YDL  LA FD N LD  +L  K+++  +++L+  TRD  QLL
Sbjct: 2   SSEKEYKPVTVDKPIPNTYDLGNLATFDPNPLDNEKLLSKDESIKEDHLQSVTRDNVQLL 61

Query: 66  INQIFKLPITT------SDLGK-----LAELPEQITVIPREKPVSFYFVLYFPENLFLLN 114
           INQI  LP+ T      S  G+     L +LPE  T++PREKP+     L          
Sbjct: 62  INQILSLPVKTTTETHGSSTGQNSTMTLIQLPEPTTILPREKPIPKAKPL---------- 111

Query: 115 LSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRW 173
                                     T+W++FA  KGI+ + K+ KM+YDE TGEWVP+W
Sbjct: 112 --------------------------TKWQQFAARKGIKPKTKDGKMVYDENTGEWVPKW 145

Query: 174 GYKGTNGDGANDWLIP----VPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA 229
           GYKG N    + WL+     V   +D   D  +                H+RN+    AA
Sbjct: 146 GYKGKNKSIDDQWLVEVDDKVKNTEDELIDPRTLKRAERKKLIKKNELQHKRNLRNQGAA 205



>gi|126137852|ref|XP_001385449.1| hypothetical protein PICST_61583 [Scheffersomyces stipitis CBS
           6054]
 gi|126092727|gb|ABN67420.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 200

 Score =  121 bits (304), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 96/190 (50%), Gaps = 50/190 (26%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFKL 72
           YK +TV++ IP  +DL  LA FD N LD  +LK+D+  + YL   TRD  QLLINQI  L
Sbjct: 7   YKPVTVDKLIPNTFDLGNLATFDPNPLDNEKLKDDSQKEQYLASVTRDNVQLLINQILSL 66

Query: 73  PI-TTSDLG----------KLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVS 121
           P+ TT+D             L  LPE  T +PREK +                       
Sbjct: 67  PVKTTTDTHGSSTGQNSTMTLIHLPEPTTPLPREKSIP---------------------- 104

Query: 122 RNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNG 180
                              T+WE+FA  KGI+ + K+ KM+YDEATGEWVP+WGYKG N 
Sbjct: 105 --------------KAKPPTKWEQFAARKGIKAKAKDGKMVYDEATGEWVPKWGYKGKNK 150

Query: 181 DGANDWLIPV 190
           D  + WL+ V
Sbjct: 151 DLDSQWLVEV 160



>gi|513030416|gb|AGO10441.1| AaceriABL014Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 205

 Score =  121 bits (303), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 97/197 (49%), Gaps = 49/197 (24%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN---YLKEYTRDGTQLLINQIFKLPI 74
           +TVE+PIP+ YDL  LA FD+NALD + L +   N   +L+  TRD  QLLINQI  LPI
Sbjct: 13  VTVEKPIPVTYDLGNLAVFDSNALDRNDLDSSNANRETHLRALTRDNVQLLINQILSLPI 72

Query: 75  --TTSDLGK-------LAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXX 125
             TT   G        L +LPE  T +PREKP+                           
Sbjct: 73  KSTTDSTGSGQSSSIALVQLPEPTTELPREKPLP-------------------------- 106

Query: 126 XXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGAN 184
                          T+WE FA  K I+ + K+ KM+YDEA GEWVP+WGYKG+N    +
Sbjct: 107 ----------KPKAPTKWELFAAKKNIKPKEKSGKMVYDEAAGEWVPKWGYKGSNKKLDD 156

Query: 185 DWLIPVPQNDDPFEDQF 201
            WL+ V       ED+ 
Sbjct: 157 QWLVEVDDKVKGTEDEL 173



>gi|156847608|ref|XP_001646688.1| hypothetical protein Kpol_1028p106 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117367|gb|EDO18830.1| hypothetical protein Kpol_1028p106 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 204

 Score =  121 bits (303), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 101/199 (50%), Gaps = 55/199 (27%)

Query: 14  KYKS--ITVERPIPLQYDLALLAAFDTNALDESRLKNDT---DNYLKEYTRDGTQLLINQ 68
           KYK   +TVE+PIP+ YDL  LA FD+N +D + L +     +++L + TR   QLLINQ
Sbjct: 6   KYKDLPVTVEKPIPVTYDLGHLAVFDSNVIDRNDLDSSNAKRESHLYDLTRGNVQLLINQ 65

Query: 69  IFKLPITT-----------SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSH 117
           I  LPI T           S    L +LPE IT +PREKP+                   
Sbjct: 66  ILSLPIKTTTESASGTSGQSSAMTLIQLPEPITELPREKPLP------------------ 107

Query: 118 ILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYK 176
                                  TRWE+FA  KGIQ + K+ KM++DEA+G+WVP+WGYK
Sbjct: 108 ------------------KPKAPTRWEQFAARKGIQSKEKSGKMVFDEASGKWVPKWGYK 149

Query: 177 GTNGDGANDWLIPVPQNDD 195
           G N    + WL+ V  NDD
Sbjct: 150 GINKKLDDQWLVEV--NDD 166



>gi|254565237|ref|XP_002489729.1| Essential protein that binds ribosomal protein L11 [Komagataella
           pastoris GS115]
 gi|238029525|emb|CAY67448.1| Essential protein that binds ribosomal protein L11 [Komagataella
           pastoris GS115]
 gi|328350147|emb|CCA36547.1| Regulator of ribosome biosynthesis [Komagataella pastoris CBS 7435]
          Length = 199

 Score =  120 bits (302), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 75/185 (40%), Positives = 97/185 (52%), Gaps = 48/185 (25%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFKLP 73
           KS TV++PIP+ YDL  LA FD+N L+ ++L + +  + YL++ TRD TQLLINQI   P
Sbjct: 4   KSATVDKPIPVAYDLGNLAVFDSNPLESNKLSDASQVNEYLEQVTRDNTQLLINQILSQP 63

Query: 74  I--TTSDLGK-------LAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNX 124
           +  TT  + +       L  LP+  T +PREK V        P  +              
Sbjct: 64  VRNTTDSVSEGQEASIALITLPDPSTPLPREKSVP------KPREM-------------- 103

Query: 125 XXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGA 183
                           TRWEKFA  KGIQ + K  KMIYDE +GEWVP+WGYKG N    
Sbjct: 104 ----------------TRWEKFAAKKGIQAKGKTGKMIYDEESGEWVPKWGYKGNNKQLD 147

Query: 184 NDWLI 188
           N WL+
Sbjct: 148 NQWLV 152



>gi|68473955|ref|XP_718874.1| likely ribosome biogenesis regulatory protein Rrs1p [Candida
           albicans SC5314]
 gi|46440667|gb|EAK99970.1| likely ribosome biogenesis regulatory protein Rrs1p [Candida
           albicans SC5314]
          Length = 205

 Score =  120 bits (302), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 104/197 (52%), Gaps = 52/197 (26%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRL--KNDT--DNYLKEYTRDGTQLL 65
           + + +YK +TV++PIP  YDL  LA FD N LD  +L  K+++  +++L+  TRD  QLL
Sbjct: 2   SSEKEYKPVTVDKPIPNTYDLGNLATFDPNPLDNEKLLSKDESIKEDHLQSVTRDNVQLL 61

Query: 66  INQIFKLPITT------SDLGK-----LAELPEQITVIPREKPVSFYFVLYFPENLFLLN 114
           INQI  LP+ T      S  G+     L +LPE  T++PREKP+     L          
Sbjct: 62  INQILSLPVKTTTETHGSSTGQNSTMTLIQLPEPTTILPREKPIPKAKPL---------- 111

Query: 115 LSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRW 173
                                     T+W++FA  KGI+ + K+ KM+YDE TGEWVP+W
Sbjct: 112 --------------------------TKWQQFAARKGIKPKAKDGKMVYDEDTGEWVPKW 145

Query: 174 GYKGTNGDGANDWLIPV 190
           GYKG N    + WL+ V
Sbjct: 146 GYKGKNKSIDDQWLVEV 162



>gi|50424407|ref|XP_460790.1| DEHA2F09834p [Debaryomyces hansenii CBS767]
 gi|49656459|emb|CAG89131.1| DEHA2F09834p [Debaryomyces hansenii CBS767]
          Length = 200

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 99/191 (51%), Gaps = 50/191 (26%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           ++K +TV++PIP  YDL  LA FD N LD  +LK+++  + YL   TRD  QLLINQI  
Sbjct: 5   QFKPVTVDKPIPNTYDLGNLATFDPNPLDNDKLKDESQKEEYLTSVTRDNVQLLINQILS 64

Query: 72  LPITT------SDLGK-----LAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILV 120
           LP+ T      S  G+     L +LP+  T +PREK +                      
Sbjct: 65  LPVKTTTDSQGSSTGQNSTMTLIQLPDPTTQLPREKAIP--------------------- 103

Query: 121 SRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTN 179
                               T+WE+FA  KGI+ + K+ KM++DEATGEWVP+WGYKG N
Sbjct: 104 ---------------KTKAPTKWEQFAARKGIKAKAKDGKMVFDEATGEWVPKWGYKGKN 148

Query: 180 GDGANDWLIPV 190
            +  + WL+ V
Sbjct: 149 KELDDQWLVEV 159



>gi|68473746|ref|XP_718976.1| likely ribosome biogenesis regulatory protein Rrs1p [Candida
           albicans SC5314]
 gi|46440773|gb|EAL00075.1| likely ribosome biogenesis regulatory protein Rrs1p [Candida
           albicans SC5314]
          Length = 205

 Score =  120 bits (301), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 103/197 (52%), Gaps = 52/197 (26%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRL--KNDT--DNYLKEYTRDGTQLL 65
           + + +YK +TV++PIP  YDL  LA FD N LD  +L  K+++  +++L+  TRD  QLL
Sbjct: 2   SSEKEYKPVTVDKPIPNTYDLGNLATFDPNPLDNEKLLSKDESIKEDHLQSVTRDNVQLL 61

Query: 66  INQIFKLP--ITTSDLGK---------LAELPEQITVIPREKPVSFYFVLYFPENLFLLN 114
           INQI  LP  ITT   G          L +LPE  T++PREKP+     L          
Sbjct: 62  INQILSLPVKITTETHGSSTGQNSTMTLIQLPEPTTILPREKPIPKAKPL---------- 111

Query: 115 LSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRW 173
                                     T+W++FA  KGI+ + K+ KM+YDE TGEWVP+W
Sbjct: 112 --------------------------TKWQQFAARKGIKPKAKDGKMVYDEDTGEWVPKW 145

Query: 174 GYKGTNGDGANDWLIPV 190
           GYKG N    + WL+ V
Sbjct: 146 GYKGKNKSIDDQWLVEV 162



>gi|410076388|ref|XP_003955776.1| hypothetical protein KAFR_0B03440 [Kazachstania africana CBS 2517]
 gi|372462359|emb|CCF56641.1| hypothetical protein KAFR_0B03440 [Kazachstania africana CBS 2517]
          Length = 201

 Score =  120 bits (300), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 99/196 (50%), Gaps = 60/196 (30%)

Query: 15  YKS--ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN-------YLKEYTRDGTQLL 65
           YKS  +TVE+PIP+ YDL  L+ FD+N LD    +ND D+       +++  TRD  QLL
Sbjct: 6   YKSLPVTVEKPIPVSYDLGNLSVFDSNVLD----RNDFDSSNAAREEHIRNATRDNVQLL 61

Query: 66  INQIFKLPIT-------TSDLGK---LAELPEQITVIPREKPVSFYFVLYFPENLFLLNL 115
           INQ+  LPI        TSD G    L  LPE IT +PREKP+                 
Sbjct: 62  INQLLSLPIKSTTNSSGTSDQGANMTLLRLPEPITELPREKPLP---------------- 105

Query: 116 SHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWG 174
                                    T+WEKFA  KGI+ + K+ KM+YDEA+GEW P+WG
Sbjct: 106 --------------------KPKAPTKWEKFAAKKGIKSKEKSGKMVYDEASGEWAPKWG 145

Query: 175 YKGTNGDGANDWLIPV 190
           YKG N    + WL+ V
Sbjct: 146 YKGINKKLDDQWLVEV 161



>gi|302306524|ref|NP_982933.2| ABL014Cp [Ashbya gossypii ATCC 10895]
 gi|299788557|gb|AAS50757.2| ABL014Cp [Ashbya gossypii ATCC 10895]
 gi|374106136|gb|AEY95046.1| FABL014Cp [Ashbya gossypii FDAG1]
          Length = 205

 Score =  120 bits (300), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 95/197 (48%), Gaps = 49/197 (24%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN---YLKEYTRDGTQLLINQIFKLPI 74
           +TVE+PIP+ YDL  LA FD+NALD + L +   N   +L+  TRD  QLLINQI  LPI
Sbjct: 13  VTVEKPIPVTYDLGNLAVFDSNALDRNDLDSSNANREEHLRALTRDNVQLLINQILSLPI 72

Query: 75  --TTSDLGK-------LAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXX 125
             TT   G        L  LPE  T +PREKP+                           
Sbjct: 73  KSTTDSTGSGQSSSIALVRLPEPTTDLPREKPLP-------------------------- 106

Query: 126 XXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGAN 184
                          T+WE FA  K I+ + K+ KM+YDEA GEWVP+WGYKG N    +
Sbjct: 107 ----------KPKAPTKWELFAAKKNIKPKEKSGKMVYDEAAGEWVPKWGYKGANKKLDD 156

Query: 185 DWLIPVPQNDDPFEDQF 201
            WL+ V       ED+ 
Sbjct: 157 QWLVEVDDKVKGTEDEL 173



>gi|348668179|gb|EGZ08003.1| hypothetical protein PHYSODRAFT_526169 [Phytophthora sojae]
          Length = 323

 Score =  120 bits (300), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 128/285 (44%), Gaps = 62/285 (21%)

Query: 19  TVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSD 78
           +V++   L YDL  LAAFDT+       +N+ +  L  + R+  QLLIN IF+LP   SD
Sbjct: 20  SVQKEDDLVYDLGNLAAFDTHPFT---YQNEKELAL--HARENVQLLINHIFELPREMSD 74

Query: 79  LGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXX 138
           +G LA+LPE  TVIPREKP+    V                                   
Sbjct: 75  MGPLAQLPEPSTVIPREKPLPKPKV----------------------------------- 99

Query: 139 XXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFE 198
             T+WEKFAK KGI+ R K++ ++DE TGEW   WGY+   GD   DW + V + D   E
Sbjct: 100 -ETKWEKFAKEKGIEKRKKSRKVFDENTGEWGHSWGYQRA-GDDMKDWAVEVKEGD--ME 155

Query: 199 DQFSXXXXXXXXXXXXXXXXHRRNIEESEA----------------ALNQTKGADARSLR 242
           D ++                   N+++                    L  T  A A+   
Sbjct: 156 DPWTKRKQEKRARVDKNLRAQANNLKQGRGKQLAGIAGRTPTGIPVELMNTDDAKAKQRG 215

Query: 243 KGELQRQIAISKSATASIGKFDKTLKG--ELKLKGVKRKFEPSIG 285
           K    + +   + +TAS+GKFDK  +G  E K+KG +  F P+ G
Sbjct: 216 KEGTNKTLEKVQFSTASMGKFDKMREGESERKIKGKRNHFLPTTG 260



>gi|323331594|gb|EGA73009.1| Rrs1p [Saccharomyces cerevisiae AWRI796]
          Length = 203

 Score =  119 bits (298), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 96/192 (50%), Gaps = 59/192 (30%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHIL 119
            LP+ T           S +  L +LP+  T +PREKP+     +               
Sbjct: 67  SLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAM--------------- 111

Query: 120 VSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGT 178
                                T+WEKFA  KGI+ + +  KMIYDEA+GEWVP+WGYKG 
Sbjct: 112 ---------------------TKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGA 150

Query: 179 NGDGANDWLIPV 190
           N    + WL+ V
Sbjct: 151 NKKLDDQWLVEV 162



>gi|449549471|gb|EMD40436.1| hypothetical protein CERSUDRAFT_148443 [Ceriporiopsis subvermispora
           B]
          Length = 263

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 119/271 (43%), Gaps = 50/271 (18%)

Query: 58  TRDGTQLLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSH 117
            RDG Q LI  +F LP   S  G LA+LP   T +PR K       L  P+         
Sbjct: 4   ARDGVQALIGALFSLPTAPSPDGPLAQLPPPTTQLPRAK------SLPKPK--------- 48

Query: 118 ILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKG 177
                                  T+WE+FAKAKGIQH+ ++K  +DE   EWV RWG+KG
Sbjct: 49  ---------------------PPTKWEQFAKAKGIQHKQRDKKEWDEERQEWVDRWGWKG 87

Query: 178 TNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGAD 237
            N    + WL  VP+N D   D                      N+  ++ + + +    
Sbjct: 88  ANKQLEDQWLTEVPKNADIDHDPSKVARDERKARVAKNEKQRLANLSRAQQSSSSSTAPA 147

Query: 238 ARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEP-------------SI 284
               RK ++ R +A+++ +TAS+GKFDKTL+GE K KG+KRKF+              +I
Sbjct: 148 PLVERKKQIDRTLAMTRKSTASMGKFDKTLEGEKKPKGMKRKFDATEVSAAQEKSRDLAI 207

Query: 285 GDXXXXXXXXXXXXXXXXGKKGDIVNVRKAI 315
                             G  GD++NVRKAI
Sbjct: 208 LSRLDKEPAAKKSSKSSEG-GGDVLNVRKAI 237



>gi|6324868|ref|NP_014937.1| Rrs1p [Saccharomyces cerevisiae S288c]
 gi|3183481|sp|Q08746.1|RRS1_YEAST RecName: Full=Regulator of ribosome biosynthesis
 gi|1420652|emb|CAA99522.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|151945376|gb|EDN63619.1| regulator of ribosome synthesis [Saccharomyces cerevisiae YJM789]
 gi|190407595|gb|EDV10862.1| regulator of ribosome biosynthesis [Saccharomyces cerevisiae
           RM11-1a]
 gi|256272588|gb|EEU07567.1| Rrs1p [Saccharomyces cerevisiae JAY291]
 gi|285815166|tpg|DAA11059.1| TPA: Rrs1p [Saccharomyces cerevisiae S288c]
 gi|323352201|gb|EGA84738.1| Rrs1p [Saccharomyces cerevisiae VL3]
 gi|349581445|dbj|GAA26603.1| K7_Rrs1p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|365762955|gb|EHN04487.1| Rrs1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392296621|gb|EIW07723.1| Rrs1p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 203

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 96/192 (50%), Gaps = 59/192 (30%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHIL 119
            LP+ T           S +  L +LP+  T +PREKP+     +               
Sbjct: 67  SLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAM--------------- 111

Query: 120 VSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGT 178
                                T+WEKFA  KGI+ + +  KMIYDEA+GEWVP+WGYKG 
Sbjct: 112 ---------------------TKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGA 150

Query: 179 NGDGANDWLIPV 190
           N    + WL+ V
Sbjct: 151 NKKLDDQWLVEV 162



>gi|207340921|gb|EDZ69122.1| YOR294Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|259149769|emb|CAY86573.1| Rrs1p [Saccharomyces cerevisiae EC1118]
          Length = 203

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 96/192 (50%), Gaps = 59/192 (30%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHIL 119
            LP+ T           S +  L +LP+  T +PREKP+     +               
Sbjct: 67  SLPMKTTTESIGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAM--------------- 111

Query: 120 VSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGT 178
                                T+WEKFA  KGI+ + +  KMIYDEA+GEWVP+WGYKG 
Sbjct: 112 ---------------------TKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGA 150

Query: 179 NGDGANDWLIPV 190
           N    + WL+ V
Sbjct: 151 NKKLDDQWLVEV 162



>gi|470319881|gb|EMR11491.1| hypothetical protein PNEG_00505 [Pneumocystis murina B123]
          Length = 191

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 92/176 (52%), Gaps = 38/176 (21%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           S T ++ I L++DL  L+AF+ N+LD   LKN+ + Y+  ++RD  Q+L+N+IF LP   
Sbjct: 9   STTNKKSIHLEFDLGNLSAFNINSLDTYSLKNNKEEYIMSFSRDSIQILVNRIFSLPKII 68

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
           +  G   ELPE I  +PREKP+                                      
Sbjct: 69  TLNGSFIELPEPIISLPREKPIP------------------------------------K 92

Query: 137 XXXXTRWEKFAKAKGIQHRNK--NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
               T+WEKFAKAKGI+ ++K   KM YD+   +WVP+WGYKG N +  N WLI +
Sbjct: 93  PRPETKWEKFAKAKGIKSKSKIDGKMTYDKNKKKWVPKWGYKGKNKNLKNQWLIEI 148



>gi|505776368|ref|XP_004602476.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Sorex
           araneus]
          Length = 364

 Score =  117 bits (293), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 132/278 (47%), Gaps = 42/278 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDE-SRLKNDTDNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N   E  R     +  L+   RD TQLL+NQ+++L
Sbjct: 20  KLQLITVHKELELEFDLGNLLALDRNPPTEVQRAGPALERELRALARDNTQLLLNQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    D   +A LPE  T +PREKP      L  P  L                      
Sbjct: 80  PTERVDETLVARLPEPTTRLPREKP------LPRPRPL---------------------- 111

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGIQ + K  +++DE +G+W  RWGY+    D   +WLI VP 
Sbjct: 112 --------TRWQQFARLKGIQPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVPG 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-EAALNQTKGADARSLR-KGELQRQI 250
           N DP EDQF+                  RN+  + +A L    G      + K EL R +
Sbjct: 163 NADPMEDQFAKRAQAKKERVAKNELNRLRNLARAHKAQLPSAAGLHPTGHQSKEELGRAM 222

Query: 251 AISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 223 QVAKVSTASVGRFQERLPKEKAPRGTGKKRKFQPLFGD 260



>gi|512887748|ref|XP_004921974.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Bombyx
           mori]
          Length = 352

 Score =  116 bits (291), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 88/270 (32%), Positives = 131/270 (48%), Gaps = 39/270 (14%)

Query: 9   ETQKS-KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           E +KS KYK ITVE+ + L++DL  L A DTN LD   LK + D+YL   TRD  QLL+N
Sbjct: 11  EQKKSDKYKPITVEKHLELEFDLGSLLASDTNDLDIKTLKTNKDSYLLALTRDNAQLLLN 70

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXX 127
           ++++LP    +   +  LP+  T++PR KPV        P+ L                 
Sbjct: 71  KVWELPTERIEEAIVVRLPQPTTILPRAKPVPV------PKPL----------------- 107

Query: 128 XXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWL 187
                        T+W++FAKAKGI  + K+K+ +DE   +WVP +G+K T  +   +WL
Sbjct: 108 -------------TKWQEFAKAKGINKKKKDKLQWDEQLQKWVPLYGFKKTAAEKEKNWL 154

Query: 188 IPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQ 247
           I VPQN DP  D +                   +N+  ++       G    S +    Q
Sbjct: 155 IEVPQNLDPMTDMYEKKAGEKSEKVAKNELQRLKNLARAKKVKIPRVGLPVTSDKASATQ 214

Query: 248 RQIA--ISKSATASIGKFDKTLKGELKLKG 275
              A  ++K++TAS+GKF   L  E + +G
Sbjct: 215 LSTAASVAKASTASLGKFQDKLPKEKEARG 244



>gi|50304325|ref|XP_452112.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641244|emb|CAH02505.1| KLLA0B13046p [Kluyveromyces lactis]
          Length = 204

 Score =  116 bits (291), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 98/202 (48%), Gaps = 59/202 (29%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRD 60
           + T K   + +TVE+ IP+ YDL  LA FDTN LD    +ND D+        +K+ TRD
Sbjct: 1   MSTTKYSERPVTVEKAIPVTYDLGNLAVFDTNVLD----RNDFDSSNAARESNIKDLTRD 56

Query: 61  GTQLLINQIFKLPITTS-----------DLGKLAELPEQITVIPREKPVSFYFVLYFPEN 109
             QLLINQI  LPI  +               L +LPE  T +PREKP+           
Sbjct: 57  NVQLLINQILSLPIRATTESAGGSSGQSSSMTLVQLPEPTTELPREKPLP---------- 106

Query: 110 LFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGE 168
                                          T+WE+FA  KGI+ + ++ KMIYDEA GE
Sbjct: 107 --------------------------KPKAPTKWEQFAAKKGIKPKERSGKMIYDEAAGE 140

Query: 169 WVPRWGYKGTNGDGANDWLIPV 190
           WVP+WGYKG+N +  + WL+ V
Sbjct: 141 WVPKWGYKGSNKELDDQWLVEV 162



>gi|255730343|ref|XP_002550096.1| regulator of ribosome biosynthesis [Candida tropicalis MYA-3404]
 gi|240132053|gb|EER31611.1| regulator of ribosome biosynthesis [Candida tropicalis MYA-3404]
          Length = 207

 Score =  116 bits (290), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 96/192 (50%), Gaps = 52/192 (27%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT----DNYLKEYTRDGTQLLINQIF 70
           +K +TV +PIP  YDL  LA FD N LD S L ++     ++YL   TRD  QLLINQI 
Sbjct: 10  FKPVTVNKPIPNTYDLGNLATFDPNPLDNSILTSNNEKEKEDYLTSTTRDNVQLLINQIL 69

Query: 71  KLPITT------SDLGK-----LAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHIL 119
            LP+ T      S  G+     L +LP+  T++PREKP+                     
Sbjct: 70  SLPVKTTTETHGSSTGQNSTMTLIQLPDATTILPREKPIP-------------------- 109

Query: 120 VSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGT 178
                                T+WE+FA  KGI+ + K+ K+++DE +GEWVP+WGYKG 
Sbjct: 110 ----------------KKKPMTKWEQFAARKGIKPKEKSGKLVFDENSGEWVPKWGYKGK 153

Query: 179 NGDGANDWLIPV 190
           N    + WL+ V
Sbjct: 154 NKQIDDQWLVEV 165



>gi|323346464|gb|EGA80752.1| Rrs1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 203

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 95/192 (49%), Gaps = 59/192 (30%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPI-----------TTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHIL 119
            LP+             S +  L +LP+  T +PREKP+     +               
Sbjct: 67  SLPMKTTTESXGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAM--------------- 111

Query: 120 VSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGT 178
                                T+WEKFA  KGI+ + +  KMIYDEA+GEWVP+WGYKG 
Sbjct: 112 ---------------------TKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGA 150

Query: 179 NGDGANDWLIPV 190
           N    + WL+ V
Sbjct: 151 NKKLDDQWLVEV 162



>gi|443429412|gb|AGC92697.1| ribosome biogenesis regulatory protein-like protein [Heliconius
           erato]
          Length = 354

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/274 (31%), Positives = 131/274 (47%), Gaps = 40/274 (14%)

Query: 6   DQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQ 63
           +Q + +  KYK ITVE+ + L +D+  L A DTN LD   LK+D+  D YL+   RD TQ
Sbjct: 9   EQEQKKAEKYKPITVEKHLDLDFDIGTLLAADTNDLDAKSLKSDSQRDIYLQSLARDNTQ 68

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
           LL+N+I++LP    D   + +LP+  TV+PR KPV        P+ L             
Sbjct: 69  LLLNKIWELPTERIDEAIVVKLPQPTTVLPRFKPVP------KPKPL------------- 109

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                            T+W++FAKAKGI  + K+++ +DE   +WVP +G+K    +  
Sbjct: 110 -----------------TKWQEFAKAKGITKKKKDRLEWDEQLQKWVPLYGFKKAAAEKE 152

Query: 184 NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRK 243
            DWLI VPQ+ +P  D +                   +NI  +        G    S + 
Sbjct: 153 KDWLIEVPQHVNPMTDMYEKKAGEKSEKVAKNELQRLKNIARARKVKIPRVGIPVTSDKA 212

Query: 244 GELQRQIA--ISKSATASIGKFDKTLKGELKLKG 275
              Q   A  ++K++TAS+GKF   L  E + +G
Sbjct: 213 SATQLSTAATVAKASTASLGKFQDKLPKEKEARG 246



>gi|323335347|gb|EGA76634.1| Rrs1p [Saccharomyces cerevisiae Vin13]
          Length = 203

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 94/192 (48%), Gaps = 59/192 (30%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPI-----------TTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHIL 119
            LP+             S +  L +LP+  T +PREKP+                     
Sbjct: 67  SLPMKTTTESXGGTGGQSSVMTLLQLPDPTTDLPREKPLP-------------------- 106

Query: 120 VSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGT 178
                                T+WEKFA  KGI+ + +  KMIYDEA+GEWVP+WGYKG 
Sbjct: 107 ----------------KAKAMTKWEKFAAKKGIKPKERAGKMIYDEASGEWVPKWGYKGA 150

Query: 179 NGDGANDWLIPV 190
           N    + WL+ V
Sbjct: 151 NKKLDDQWLVEV 162



>gi|45709905|gb|AAH67632.1| Rrs1 protein, partial [Danio rerio]
          Length = 345

 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 128/277 (46%), Gaps = 41/277 (14%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKL 72
           K KSITV + + L++D  LL AFD N LD    K N  ++ L+   RD TQLLIN+I+KL
Sbjct: 19  KLKSITVLKELDLEFDPGLLLAFDKNRLDTRDFKGNKREDCLRSLARDNTQLLINEIWKL 78

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    D   +A+LPE  T +                                        
Sbjct: 79  PTERVDEVIVAKLPEPTTKL------------------------------------PREK 102

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WE+FAK KGIQ + K  +++DE   EW  RWGYK    D   +WLI VP 
Sbjct: 103 PAPKPKPPTKWEQFAKLKGIQKKKKTNLVWDEVHKEWKRRWGYKRAK-DDTKEWLIEVPA 161

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR-KGELQRQIA 251
             DP EDQF+                  +NI  ++       G    S + K EL + ++
Sbjct: 162 TADPNEDQFAKRNKAKKERVAKNEYNRLKNIARAQKVKVPGTGLLPTSQQTKAELAQAVS 221

Query: 252 ISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGD 286
           ++K +TAS+GKF + L  E   +  G KRKF+P IGD
Sbjct: 222 LAKISTASVGKFQEKLPKEKPARNTGKKRKFQPLIGD 258



>gi|41056045|ref|NP_956356.1| ribosome biogenesis regulatory protein homolog [Danio rerio]
 gi|33585885|gb|AAH55615.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Danio
           rerio]
 gi|182888746|gb|AAI64156.1| Rrs1 protein [Danio rerio]
          Length = 346

 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 128/277 (46%), Gaps = 41/277 (14%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKL 72
           K KSITV + + L++D  LL AFD N LD    K N  ++ L+   RD TQLLIN+I+KL
Sbjct: 20  KLKSITVLKELDLEFDPGLLLAFDKNRLDTRDFKGNKREDCLRSLARDNTQLLINEIWKL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    D   +A+LPE  T +                                        
Sbjct: 80  PTERVDEVIVAKLPEPTTKL------------------------------------PREK 103

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WE+FAK KGIQ + K  +++DE   EW  RWGYK    D   +WLI VP 
Sbjct: 104 PAPKPKPPTKWEQFAKLKGIQKKKKTNLVWDEVHKEWKRRWGYKRAK-DDTKEWLIEVPA 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR-KGELQRQIA 251
             DP EDQF+                  +NI  ++       G    S + K EL + ++
Sbjct: 163 TADPNEDQFAKRNKAKKERVARNEYNRLKNIARAQKVKVPGTGLLPTSQQTKAELAQAVS 222

Query: 252 ISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGD 286
           ++K +TAS+GKF + L  E   +  G KRKF+P IGD
Sbjct: 223 LAKISTASVGKFQEKLPKEKPARNTGKKRKFQPLIGD 259



>gi|344233092|gb|EGV64965.1| ribosomal biogenesis regulatory protein [Candida tenuis ATCC 10573]
          Length = 201

 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 100/191 (52%), Gaps = 50/191 (26%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKN--DTDNYLKEYTRDGTQLLINQIFK 71
           ++K +TV++PIP  +DL  LAAFD N L+  +L N    + YL   TRD  QLLINQI  
Sbjct: 8   EFKPVTVDKPIPDTFDLGNLAAFDPNPLENDKLANAEQKEQYLTAVTRDNVQLLINQILS 67

Query: 72  LPI-TTSDLG----------KLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILV 120
           LP+ TT+D             L +LP+ IT++PREK +        P++  L        
Sbjct: 68  LPLKTTTDTHGSSTGQDSTMTLVQLPQPITLLPREKAI--------PKDKPL-------- 111

Query: 121 SRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTN 179
                               T+W+KFA  KGI+ + ++ KM+YDE TGEW P+WGYKG N
Sbjct: 112 --------------------TKWQKFAVKKGIKPKARDGKMVYDEDTGEWAPKWGYKGKN 151

Query: 180 GDGANDWLIPV 190
               + WL+ +
Sbjct: 152 KSLDDQWLVEI 162



>gi|363749573|ref|XP_003645004.1| hypothetical protein Ecym_2460 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356888637|gb|AET38187.1| Hypothetical protein Ecym_2460 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 208

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 102/228 (44%), Gaps = 55/228 (24%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDT---DNYLKEYTRDGTQLLINQIFKLPI 74
           +TVE+PIP+ YD+  LA FDTN LD++ L +     + +LK  TRD  QL+INQI  LPI
Sbjct: 13  VTVEKPIPVTYDMGNLAVFDTNTLDKNDLDSSNGAREEHLKSLTRDNMQLMINQILSLPI 72

Query: 75  TT-----------SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
            T           S    L +LP+  T +PREKP+                         
Sbjct: 73  KTTTEATGGTSGQSATVTLIQLPQPTTELPREKPLP------------------------ 108

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGTNGDG 182
                            T+WE FA  K I+ + +  KM+YDEA+GEW P+WGYKG N   
Sbjct: 109 ------------KPKAPTKWELFAAKKNIKPKERAGKMVYDEASGEWAPKWGYKGINKKL 156

Query: 183 ANDWLIPVPQ----NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES 226
            + WL+ V       DD   D  +                H+RN++ S
Sbjct: 157 DDQWLVEVDDKVKGTDDELIDPRTLSRAERKKLIKKNELQHKRNLKNS 204



>gi|301116573|ref|XP_002906015.1| ribosome biogenesis regulatory protein [Phytophthora infestans
           T30-4]
 gi|262109315|gb|EEY67367.1| ribosome biogenesis regulatory protein [Phytophthora infestans
           T30-4]
          Length = 308

 Score =  114 bits (285), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 126/284 (44%), Gaps = 62/284 (21%)

Query: 20  VERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDL 79
           V++   L YDL  LAAFDT+       +N+ +  L  + R+  QLLIN IF+LP   SD+
Sbjct: 7   VQKEDDLTYDLGNLAAFDTHPFA---YQNEKELAL--HARENVQLLINHIFELPRQMSDM 61

Query: 80  GKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXX 139
           G LA+LP   TVIPREKP+    V                                    
Sbjct: 62  GPLAQLPVPETVIPREKPLPKPKV------------------------------------ 85

Query: 140 XTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFED 199
            T+WEKFAK KGI  R K++ ++DEATGEW   WGY+   GD   DW + + + D   ED
Sbjct: 86  ETKWEKFAKEKGIDKRKKSRKVFDEATGEWSHTWGYQRA-GDDMKDWAVEMKEGD--RED 142

Query: 200 QFSXXXXXXXXXXXXXXXXHRRNIEESEA----------------ALNQTKGADARSLRK 243
            ++                   N+++                    L  T+   A+   K
Sbjct: 143 PWTKRKQDKRARVDKNLRAQANNLKQGRGKQLAGIAGRTPTGIPVELMNTEDTKAKQRGK 202

Query: 244 GELQRQIAISKSATASIGKFDKTLKG--ELKLKGVKRKFEPSIG 285
               + +   + +TAS+GKFDK  +G  E K+KG +  F P+ G
Sbjct: 203 EGTSKTLEKVQFSTASMGKFDKMREGESERKVKGKRNNFLPTTG 246



>gi|261335954|emb|CBH09287.1| putative regulator of ribosome biosynthesis [Heliconius melpomene]
          Length = 357

 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 125/266 (46%), Gaps = 40/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           KYK ITVE+ + L +D+  L A DTN LD   LK+D+  D YL+   RD TQLL+N+I++
Sbjct: 17  KYKPITVEKHLDLDFDIGTLLAADTNDLDPKSLKSDSQRDIYLQSLARDNTQLLLNKIWE 76

Query: 72  LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXX 131
           LP    D   + +LP+  TV+PR KPV     L                           
Sbjct: 77  LPTERIDEAIVVKLPQPTTVLPRSKPVPKPKPL--------------------------- 109

Query: 132 XXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVP 191
                    T+W++FAKAKGI  + K+K+ +DE   +WVP +G+K    +   DWLI VP
Sbjct: 110 ---------TKWQEFAKAKGITKKKKDKLEWDEQLQKWVPLYGFKKAAAEKEKDWLIEVP 160

Query: 192 QNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQRQIA 251
           Q+ +P  D +                   +NI  +        G    S +    Q   A
Sbjct: 161 QHVNPMTDMYEKKAGEKSEKVAKNELQRLKNIARARKVKIPRVGIPVTSDKASATQLSTA 220

Query: 252 --ISKSATASIGKFDKTLKGELKLKG 275
             ++K++TAS+GKF   L  E + +G
Sbjct: 221 ATVAKASTASLGKFQNKLPKEKEARG 246



>gi|54650780|gb|AAV36969.1| LD45683p [Drosophila melanogaster]
          Length = 359

 Score =  113 bits (283), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 125/267 (46%), Gaps = 43/267 (16%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+++ + YL   TR+ TQLL+N I++LP
Sbjct: 27  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRDNKEEYLTALTRENTQLLVNAIWELP 86

Query: 74  ITTSDLGKLAELPEQITVIPR-EKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
               D   +A+LPE  TV+PR  KP         P  L                      
Sbjct: 87  TERVDESIVAKLPEPTTVLPRLRKPPG-------PRPL---------------------- 117

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WEKFAK KGI  + K+K  YDE   +WVP +G+K    + A DW++ VPQ
Sbjct: 118 --------TKWEKFAKEKGISKKKKDKKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQ 169

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQ 249
           N DP  D F                   +NI  +   +   +   G +A S    +L   
Sbjct: 170 NADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKIDMPRSGYLGPEAAS--SSQLLTA 227

Query: 250 IAISKSATASIGKFDKTLKGELKLKGV 276
           + ++KS+TAS+GKF   L  E + +G+
Sbjct: 228 VTVAKSSTASVGKFQNKLPKEKEARGL 254



>gi|21483408|gb|AAM52679.1| LD24586p [Drosophila melanogaster]
          Length = 361

 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 125/267 (46%), Gaps = 43/267 (16%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+++ + YL   TR+ TQLL+N I++LP
Sbjct: 29  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRDNKEEYLTALTRENTQLLVNAIWELP 88

Query: 74  ITTSDLGKLAELPEQITVIPR-EKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
               D   +A+LPE  TV+PR  KP         P  L                      
Sbjct: 89  TERVDESIVAKLPEPTTVLPRLRKPPG-------PRPL---------------------- 119

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WEKFAK KGI  + K+K  YDE   +WVP +G+K    + A DW++ VPQ
Sbjct: 120 --------TKWEKFAKEKGISKKKKDKKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQ 171

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQ 249
           N DP  D F                   +NI  +   +   +   G +A S    +L   
Sbjct: 172 NADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKIDMPRSGYLGPEAAS--SSQLLTA 229

Query: 250 IAISKSATASIGKFDKTLKGELKLKGV 276
           + ++KS+TAS+GKF   L  E + +G+
Sbjct: 230 VTVAKSSTASVGKFQNKLPKEKEARGL 256



>gi|270012854|gb|EFA09302.1| hypothetical protein TcasGA2_TC030596 [Tribolium castaneum]
          Length = 336

 Score =  113 bits (283), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 134/287 (46%), Gaps = 60/287 (20%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYKS+ V + + +  DL  L A D N LD     + T++YL   TRD TQLL NQI++LP
Sbjct: 17  KYKSVEVNKLVSI--DLGALLAEDLNPLDPG--ASSTNDYLLNLTRDNTQLLFNQIWELP 72

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LP+Q   +PR KPV     L                             
Sbjct: 73  TERIDEAIVAKLPKQKFCLPRFKPVPRPRPL----------------------------- 103

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WE+FAKAKGI  + K+K+ +DE   +W+P +G+K +      DWLI VPQN
Sbjct: 104 -------TKWEQFAKAKGIVKKKKSKLSWDEQLQKWIPLYGFKRSAALKEKDWLIEVPQN 156

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA------ALNQTKGADARSLRKGELQ 247
            DP EDQF+                  RN+ +++        L   + + A+     +LQ
Sbjct: 157 ADPLEDQFAKKVEAKSEKVAKNELQRLRNVAKAKNVKVPRFGLTNPEVSSAK-----DLQ 211

Query: 248 RQIAISKSATASIGKFDKTLKGELKLKGV---------KRKFEPSIG 285
             + ++KS+TAS+GKF   L  E + +GV         KRK  P  G
Sbjct: 212 AAVTVAKSSTASLGKFQDKLPKEKEARGVAAITPGATRKRKLPPISG 258



>gi|221330901|ref|NP_729108.2| CG32409 [Drosophila melanogaster]
 gi|220902479|gb|AAN12230.2| CG32409 [Drosophila melanogaster]
          Length = 349

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 124/266 (46%), Gaps = 41/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+++ + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRDNKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  TV+PR         L  P     L                    
Sbjct: 77  TERVDESIVAKLPEPTTVLPR---------LRKPPGPRPL-------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WEKFAK KGI  + K+K  YDE   +WVP +G+K    + A DW++ VPQN
Sbjct: 108 -------TKWEKFAKEKGISKKKKDKKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQI 250
            DP  D F                   +NI  +   +   +   G +A S    +L   +
Sbjct: 161 ADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKIDMPRSGYLGPEAAS--SSQLLTAV 218

Query: 251 AISKSATASIGKFDKTLKGELKLKGV 276
            ++KS+TAS+GKF   L  E + +G+
Sbjct: 219 TVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|389746674|gb|EIM87853.1| RRS1-domain-containing protein [Stereum hirsutum FP-91666 SS1]
          Length = 349

 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 92/292 (31%), Positives = 135/292 (46%), Gaps = 57/292 (19%)

Query: 2   IYFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDG 61
           +  SD L +Q +K++++TVE+ IPL+ D   L   D N  D      D + YL+   RDG
Sbjct: 1   MDVSDILASQAAKHQAVTVEKDIPLEVDAGYLTVTDLNPTDPELYSEDVEAYLQATARDG 60

Query: 62  TQLLINQIFKLPITTSDLGK--LAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHIL 119
            Q+L+  +F LP   S  G   LA+LP   T +                           
Sbjct: 61  VQVLLASLFSLPTLPSPTGDGPLAQLPPPSTQL--------------------------- 93

Query: 120 VSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRN--KNKMIYDEATGEWVPRWGYKG 177
                                T+WE+FA+AKGI +    +++  +DE   +WV RWG+KG
Sbjct: 94  ---------PRSKPLPKPKPPTKWEQFARAKGIGNNKGRRDRKEWDEEKQDWVNRWGWKG 144

Query: 178 TNGDGANDWLIPVPQND----DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQT 233
            N +    W + VP N     DP +D                     +N ++    L + 
Sbjct: 145 KNKELETQWAVEVPANAPADFDPSKDARDARKARVA-----------KNDKQKLGNLARA 193

Query: 234 KGAD--ARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 283
           +GA+   R  RK ++ R +A +++ATAS+GKFDK L GE KLKGVKRKFEP+
Sbjct: 194 QGANKSERDERKQDIDRTLATTRTATASMGKFDKKLDGEKKLKGVKRKFEPA 245



>gi|448520202|ref|XP_003868248.1| Rrs1 ribosome biogenesis and nuclear export protein [Candida
           orthopsilosis Co 90-125]
 gi|380352587|emb|CCG22814.1| Rrs1 ribosome biogenesis and nuclear export protein [Candida
           orthopsilosis]
          Length = 208

 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/195 (36%), Positives = 98/195 (50%), Gaps = 52/195 (26%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNAL--DESRLKNDT--DNYLKEYTRDGTQLL 65
           + + +YK +TVE+PI   YDL  LA FD N L  D+ R KN++  + YL   TRD  QLL
Sbjct: 2   SSEKEYKPVTVEKPIGNTYDLGNLATFDPNPLSNDKLRSKNESEKEQYLSSVTRDNVQLL 61

Query: 66  INQIFKLPI--TTSDLGK---------LAELPEQITVIPREKPVSFYFVLYFPENLFLLN 114
           +NQI  LP+  TT + G          L +LPE  T++PREK +                
Sbjct: 62  VNQILSLPVKTTTDNQGSSTGHSSSMTLIQLPEPTTLLPREKAIP--------------- 106

Query: 115 LSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRW 173
                                     T+WE+FA  KGI+ + K+ K++YDE TGEWVP+W
Sbjct: 107 ---------------------KPKPPTKWEQFAAKKGIKPKAKDGKLVYDEETGEWVPKW 145

Query: 174 GYKGTNGDGANDWLI 188
           GYKG N    + WL+
Sbjct: 146 GYKGKNKSLDDQWLV 160



>gi|405123744|gb|AFR98507.1| Rrs1 protein [Cryptococcus neoformans var. grubii H99]
          Length = 313

 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/270 (32%), Positives = 124/270 (45%), Gaps = 39/270 (14%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           +  + R   +Q D ALLAAFD +  D +    D + +L + T   T  L+  +F LP T 
Sbjct: 16  TAVLPRAAAVQTDPALLAAFDVSPPDPAAYA-DRERHLLQLTLTSTHALLAALFALPTTP 74

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
           S  G +   P   T++PREKP      L  P+ L                          
Sbjct: 75  SPAGPVTAFPPPATLLPREKP------LPKPKPL-------------------------- 102

Query: 137 XXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDP 196
               T+WE+FAK KGI H+ + K ++DE   EWVPRWG  G N D    WL  V   D+ 
Sbjct: 103 ----TKWERFAKEKGISHKTREKDVWDEDRQEWVPRWGRFGKNKDKEAQWLHEVKPGDEA 158

Query: 197 FEDQFSXXXXXXXXXXXXXXXXHRRNI--EESEAALNQTKGADARSLRKGELQRQIAISK 254
            +D                   H  N+    +  +  +   A  R+ RK EL R + ISK
Sbjct: 159 DQDPGKTARGERKARIAKNTKQHSANLATAAASVSAARATAASERAARKEELNRNMLISK 218

Query: 255 SATASIGKFDKTLKGELKLKGVKRKFEPSI 284
           ++TAS+GKFD  + GE K +G+KRKF+ +I
Sbjct: 219 TSTASLGKFDNKIDGEPKARGMKRKFDANI 248



>gi|194867287|ref|XP_001972038.1| GG15298 [Drosophila erecta]
 gi|190653821|gb|EDV51064.1| GG15298 [Drosophila erecta]
          Length = 349

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 123/266 (46%), Gaps = 41/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+ + + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRANKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  TV+PR         L  P     L                    
Sbjct: 77  TERVDESIVAKLPEPTTVLPR---------LRKPPGPRPL-------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WEKFAK KGI  + K+K  YDE   +WVP +G+K    + A DW++ VPQN
Sbjct: 108 -------TKWEKFAKEKGITKKKKDKKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQI 250
            DP  D F                   +NI  +   +   +   G +A S    +L   +
Sbjct: 161 ADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKIDMPRSGYLGPEAAS--SSQLLTAV 218

Query: 251 AISKSATASIGKFDKTLKGELKLKGV 276
            ++KS+TAS+GKF   L  E + +G+
Sbjct: 219 TVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|195337755|ref|XP_002035491.1| GM14731 [Drosophila sechellia]
 gi|194128584|gb|EDW50627.1| GM14731 [Drosophila sechellia]
          Length = 349

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 123/266 (46%), Gaps = 41/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+ + + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRANKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  TV+PR         L  P     L                    
Sbjct: 77  TERVDESIVAKLPEPTTVLPR---------LRKPPGPRPL-------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WEKFAK KGI  + K+K  YDE   +WVP +G+K    + A DW++ VPQN
Sbjct: 108 -------TKWEKFAKEKGISKKKKDKKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQI 250
            DP  D F                   +NI  +   +   +   G +A S    +L   +
Sbjct: 161 ADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKIDMPRSGYLGPEAAS--SSQLLTAV 218

Query: 251 AISKSATASIGKFDKTLKGELKLKGV 276
            ++KS+TAS+GKF   L  E + +G+
Sbjct: 219 TVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|195492113|ref|XP_002093850.1| GE21520 [Drosophila yakuba]
 gi|194179951|gb|EDW93562.1| GE21520 [Drosophila yakuba]
          Length = 349

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 123/266 (46%), Gaps = 41/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+ + + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRANKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  TV+PR         L  P     L                    
Sbjct: 77  TERVDESIVAKLPEPTTVLPR---------LRKPPGPRPL-------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WEKFAK KGI  + K+K  YDE   +WVP +G+K    + A DW++ VPQN
Sbjct: 108 -------TKWEKFAKEKGITKKKKDKKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQI 250
            DP  D F                   +NI  +   +   +   G +A S    +L   +
Sbjct: 161 ADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKIDMPRSGYLGPEAAS--SSQLLTAV 218

Query: 251 AISKSATASIGKFDKTLKGELKLKGV 276
            ++KS+TAS+GKF   L  E + +G+
Sbjct: 219 TVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|195588066|ref|XP_002083779.1| GD13910 [Drosophila simulans]
 gi|194195788|gb|EDX09364.1| GD13910 [Drosophila simulans]
          Length = 349

 Score =  112 bits (280), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 122/266 (45%), Gaps = 41/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+ + + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRANKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  TV+PR         L  P     L                    
Sbjct: 77  TERVDESIVAKLPEPTTVLPR---------LRKPPGPRPL-------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WEKFAK KGI  + K K  YDE   +WVP +G+K    + A DW++ VPQN
Sbjct: 108 -------TKWEKFAKEKGISKKKKEKKTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQI 250
            DP  D F                   +NI  +   +   +   G +A S    +L   +
Sbjct: 161 ADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKIDMPRSGYLGPEAAS--SSQLLTAV 218

Query: 251 AISKSATASIGKFDKTLKGELKLKGV 276
            ++KS+TAS+GKF   L  E + +G+
Sbjct: 219 TVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|410909081|ref|XP_003968019.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Takifugu
           rubripes]
          Length = 339

 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 131/274 (47%), Gaps = 41/274 (14%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIFKLPIT 75
           SITV + + L++D+  L A D N +D   +K+   +++L+   RD TQLLIN+++KLP  
Sbjct: 23  SITVHKDLELEFDVGNLLAVDKNRIDSRDVKSAKKEDFLRALARDNTQLLINEVWKLPTE 82

Query: 76  TSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXX 135
             D   +A LPE  T +PREKP                                      
Sbjct: 83  RVDDAIVATLPEPTTPLPREKPPPKPKPPTK----------------------------- 113

Query: 136 XXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDD 195
                  WE+FAK KGIQ + K  +++DE   EW  RWGYK    D   +W+I VP+  D
Sbjct: 114 -------WEQFAKLKGIQKKKKTNLVWDETAKEWRRRWGYKRAK-DDTKEWMIEVPETAD 165

Query: 196 PFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR-KGELQRQIAISK 254
           P EDQFS                  +NI  ++       G   +  + K EL + ++++K
Sbjct: 166 PNEDQFSKRTTAKKERVARNEYNKLKNIARAQKVKIPGLGLTPKEQQSKNELTKAVSVAK 225

Query: 255 SATASIGKFDKTLKGELKLK--GVKRKFEPSIGD 286
           ++TAS G+F   L  E ++K  G KRKFEP IGD
Sbjct: 226 TSTASAGRFQDRLPKEKRVKNTGKKRKFEPLIGD 259



>gi|470267951|ref|XP_004362209.1| ribosome biogenesis regulatory protein [Dictyostelium fasciculatum]
 gi|328875994|gb|EGG24358.1| ribosome biogenesis regulatory protein [Dictyostelium fasciculatum]
          Length = 327

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 85/277 (30%), Positives = 130/277 (46%), Gaps = 48/277 (17%)

Query: 12  KSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           ++K+ S  VE+   L YDL  L AFD ++L+++    + + Y+ + +RD  QLLI ++F+
Sbjct: 24  QNKFSSHLVEKEDSLLYDLGNLCAFDFSSLNKAEYNENPEEYINKISRDNVQLLITRMFQ 83

Query: 72  LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXX 131
           L     + G LA LP+ +T IPR KP+        PE                       
Sbjct: 84  LDSKVVESGALALLPKPLTPIPRMKPI--------PE----------------------- 112

Query: 132 XXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVP 191
                    TRWE FA  K I+ R K+  ++DE   EW   WGYK  N +G N  +   P
Sbjct: 113 -----AKQQTRWEAFAAIKDIKKRKKDSKVWDETHKEWRHSWGYKRANDEGENFAMYANP 167

Query: 192 QNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE----AALNQTKGADARSLRKGELQ 247
            N  P +D F                  +RN++ES     + +    G D     +G+++
Sbjct: 168 NN--PEQDPFQKLIDDKKERVDKNKRLEQRNLDESHKRSSSMVGSNNGLDFSKENRGQIK 225

Query: 248 RQI----AISKSATASIGKFDKTLKGELKL--KGVKR 278
             +     ++K +TAS+GKFDK L+G+ KL  +GVKR
Sbjct: 226 NDVRNTLNVAKVSTASMGKFDKVLEGDKKLPTRGVKR 262



>gi|213513147|ref|NP_001134869.1| ribosome biogenesis regulatory protein homolog [Salmo salar]
 gi|209736730|gb|ACI69234.1| Ribosome biogenesis regulatory protein homolog [Salmo salar]
          Length = 353

 Score =  111 bits (278), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 129/277 (46%), Gaps = 41/277 (14%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K KSITV++ + L++D+  L A+D N +D  + +    +++L+   RD TQLL+N+I+K 
Sbjct: 20  KLKSITVQKELDLEFDIGNLLAYDKNRIDIRQFREQKKEDFLRSLARDNTQLLVNEIWKH 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   + +LPE  T +                                        
Sbjct: 80  PTERVEEVIVVKLPEPTTSL------------------------------------PREK 103

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WE+FAK KGIQ + K  +++D+   EW  RWGYK  N DG  +WLI VP+
Sbjct: 104 PPPKPRPPTKWEEFAKLKGIQKKKKTNLVWDDVAKEWKRRWGYKRVN-DGTKEWLIEVPE 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR-KGELQRQIA 251
             DP EDQF+                  RNI  ++       G    + + K +L R + 
Sbjct: 163 TADPNEDQFAKRNKAKKEKVAKNELHRLRNIARAQKIKVPGVGLTPTAQQSKTDLVRAVN 222

Query: 252 ISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGD 286
           ++KS+TAS GKF   L  E   +  G KRKF+P IG+
Sbjct: 223 VAKSSTASAGKFQDRLPKEKAPRNTGKKRKFQPVIGN 259



>gi|498968006|ref|XP_004526203.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Ceratitis capitata]
          Length = 348

 Score =  109 bits (273), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 128/267 (47%), Gaps = 43/267 (16%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITV++ + ++ D+  L   D N L++  LKN+ + YL   TRD TQLLIN I+ LP
Sbjct: 17  KYKPITVDKHLEVRLDIGSLLCTDPNDLEDKELKNNKEQYLLNLTRDNTQLLINGIWALP 76

Query: 74  ITTSDLGKLAELPEQITVIPR-EKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
               D   +A+LPE  TV+PR  KP         P+ L                      
Sbjct: 77  TERVDECIVAKLPEPTTVLPRLRKPPG-------PKPL---------------------- 107

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WEK AK KGI+ + ++K  YDE   +WVP +G+K  + +   +W++ VP+
Sbjct: 108 --------TKWEKIAKEKGIKKKKRDKKKYDEVLDKWVPTYGFKRADAEKEKEWVLEVPK 159

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI---EESEAALNQTKGADARSLRKGELQRQ 249
           N DP ED F                   +NI   ++ E       G +  S   G+L   
Sbjct: 160 NADPNEDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKVEVPRGGYFGPEVAS--SGQLLTA 217

Query: 250 IAISKSATASIGKFDKTLKGELKLKGV 276
           + ++KS+TAS+GKF   L  E + +G+
Sbjct: 218 VTVAKSSTASVGKFQSKLPKEKEARGI 244



>gi|339241523|ref|XP_003376687.1| ribosome biogenesis regulatory protein-like protein [Trichinella
           spiralis]
 gi|316974584|gb|EFV58068.1| ribosome biogenesis regulatory protein-like protein [Trichinella
           spiralis]
          Length = 471

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 131/305 (42%), Gaps = 59/305 (19%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTS 77
           + + R +    DL  L   +   +D+  +K +T+  +    R+  QL+ N++++LP    
Sbjct: 10  LNITRAVDPLIDLGNLLVDEQEPVDQHLMKENTEMAVMNKVRESVQLMANKLWELPTQRI 69

Query: 78  DLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXX 137
           +   + ELP   + +PREKP+                                       
Sbjct: 70  EDAIVVELPAPTSRLPREKPIP------------------------------------KK 93

Query: 138 XXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPF 197
              T+WE++AK KGIQ R + +MI+DEA  +W PRWGY   N D   DWLI +P+  DP+
Sbjct: 94  APPTKWEEYAKMKGIQKRKRTRMIWDEAAQDWKPRWGYNRAN-DNTKDWLIEIPRQKDPY 152

Query: 198 EDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQRQIAISKSAT 257
            D F                  R+  ++   A N+ +     S R   +  ++  ++ AT
Sbjct: 153 VDYFG----------------ERKEAKKERIAKNELRRLKNISRR---VAHKVERARLAT 193

Query: 258 ASIGKFDKTLKGEL--KLKGVKRKFEPSIGDXXXXXXXXXXXXXXXXGKKGDIVNVRKAI 315
           AS+GKF + L+GE   K KG K KF P+                     K +I+NV KAI
Sbjct: 194 ASMGKFAEKLRGEKAPKNKGKKNKFLPNEISAQEEKDRYFQTLKAMQS-KTEILNVNKAI 252

Query: 316 AKRGQ 320
             + Q
Sbjct: 253 KMQNQ 257



>gi|470293505|ref|XP_004343908.1| Rrs1 protein [Capsaspora owczarzaki ATCC 30864]
 gi|320165153|gb|EFW42052.1| Rrs1 protein [Capsaspora owczarzaki ATCC 30864]
          Length = 307

 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 129/278 (46%), Gaps = 43/278 (15%)

Query: 13  SKYKSITVERPIPLQYDLALLAAFDTNALDESRL-KNDTDNYLKEYTRDGTQLLINQIFK 71
           +K +++TV+R  P   D   L   DT  L  S L       Y++   RDG Q+L N I++
Sbjct: 16  AKRRAVTVDREQPHDVDAGNLMVVDTVPLLPSELTAARRGEYIRALARDGVQVLFNAIWE 75

Query: 72  LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXX 131
           LP T +D   LA LP     IPREKPV        P+ L                     
Sbjct: 76  LPTTRADEVVLASLPNPTYAIPREKPVPK------PKQL--------------------- 108

Query: 132 XXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                    T+WE+FA  KGI+  +K +  ++D+   E+V R GY+        DW+I +
Sbjct: 109 ---------TKWEQFALKKGIKKNSKRDTRVFDDTKQEFVRRHGYEHRKNQDDKDWIIEL 159

Query: 191 PQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARS--LRKGELQR 248
           P   DPF D F+                  RNI ++   + Q   A + S   +K  L+ 
Sbjct: 160 PDQADPFVDYFAKRNELKKGRVAKNEMQQARNIAKAN-PVKQGLAAPSTSNDAKKQLLKE 218

Query: 249 QIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSI 284
           Q+  +K++TAS+G+FDK++  E K+K  G KR+++ ++
Sbjct: 219 QLKRTKTSTASLGRFDKSIGKEPKIKTPGKKRQYDSAV 256



>gi|485638458|gb|EOD32863.1| hypothetical protein EMIHUDRAFT_364204 [Emiliania huxleyi CCMP1516]
          Length = 383

 Score =  107 bits (267), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 117/285 (41%), Gaps = 59/285 (20%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           SI VE+   L+YDLA LAAFD   L    L  D + +L E  RD  QL+ N+++ + + +
Sbjct: 29  SIEVEKEDDLEYDLAHLAAFDPAPLSAEALSADAEAHLLETARDNAQLMANRLYAI-LAS 87

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
            +   +  LP   T +PREKP+                                      
Sbjct: 88  QESKAVIRLPPPTTQLPREKPLP------------------------------------K 111

Query: 137 XXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTN--GDGANDWLIPVPQND 194
               TRWEKFA  KGI  + ++KM++DEA G+W PR+G+   N   D    WL+P    +
Sbjct: 112 PRPQTRWEKFAAEKGIVKKKRSKMVWDEAAGQWAPRYGFGRANKQDDPLKTWLVPAKPGE 171

Query: 195 DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQT--------------------K 234
           D   D F                   RN  E+  A   T                    +
Sbjct: 172 DGSTDPFEAAAGKRGEARAKQKRQEERNRLEAAHAAGLTSRGKGAAAGAGGSLGSSVIAR 231

Query: 235 GADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 279
              A S +K  L R I  ++ +TAS G+FD+ L+ E   +  KRK
Sbjct: 232 DLGAASEKKEYLSRAIRTTQVSTASAGRFDRQLEHEPSKERGKRK 276



>gi|156381110|ref|XP_001632109.1| predicted protein [Nematostella vectensis]
 gi|156219160|gb|EDO40046.1| predicted protein [Nematostella vectensis]
          Length = 244

 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 85/245 (34%), Positives = 118/245 (48%), Gaps = 51/245 (20%)

Query: 51  DNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENL 110
           +++LK   R+ TQLL N+I+KLP    +   LA+LP   TVIPREKPV        P+ L
Sbjct: 16  EDFLKNLARENTQLLFNEIWKLPTERFEGVILAQLPAPTTVIPREKPVPK------PKPL 69

Query: 111 FLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWV 170
                                         TRWE++AK KGI+ + + + ++DE   +W+
Sbjct: 70  ------------------------------TRWEEYAKLKGIKKKKRERKVWDEEKQKWL 99

Query: 171 PRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAAL 230
           PR+GY+  N D   DWL  VP N DPFEDQF                   RNI    A  
Sbjct: 100 PRYGYERGN-DNTKDWLAVVPDNADPFEDQFEKRLEKKKERIAKNEYQRLRNI----AKH 154

Query: 231 NQTKGADARSLR------KGELQRQIAISKSATASIGKFDKTLKGE---LKLKGVKRKFE 281
            + K AD R+L+      K ++   I  ++ ATAS+GKF + L  E    K +G KRKF+
Sbjct: 155 KKVKVAD-RNLKPSLKQSKDQIMAAIGATRKATASVGKFTEKLAKEKVPKKAEGRKRKFD 213

Query: 282 PSIGD 286
              G+
Sbjct: 214 AVAGE 218



>gi|195428745|ref|XP_002062426.1| GK16661 [Drosophila willistoni]
 gi|194158511|gb|EDW73412.1| GK16661 [Drosophila willistoni]
          Length = 349

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 122/266 (45%), Gaps = 41/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK I+VE+ +  + D+  L   D N  D+ +LK + + YL   TRD TQLL+N I++L 
Sbjct: 17  KYKPISVEKHLECRLDVGTLLITDPNDFDDRQLKENREEYLAALTRDNTQLLVNAIWELS 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  T++PR + V     L                             
Sbjct: 77  TERVDESIVAKLPEPTTILPRLRKVPGPRPL----------------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WEKFAK KGI  + K+K  YDE   +WVP +G+K    +   +W++ VPQN
Sbjct: 108 -------TKWEKFAKEKGIVKKKKDKKTYDETLDKWVPTYGFKRAEAEKEKEWVMEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQI 250
            DP  D F                   +NI  +   +   +   G +A S    +L   +
Sbjct: 161 VDPNTDMFQKKMDLRNEKVAKNEIQRMKNIVRARKIDMPRSGYLGPEAAS--SNQLLTAL 218

Query: 251 AISKSATASIGKFDKTLKGELKLKGV 276
            ++KS+TAS+GKF   L  E + +G+
Sbjct: 219 TVAKSSTASVGKFQDKLPKEKEARGL 244



>gi|512199294|gb|EPE28128.1| hypothetical protein GLAREA_04919 [Glarea lozoyensis ATCC 20868]
          Length = 203

 Score =  106 bits (264), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/177 (36%), Positives = 84/177 (47%), Gaps = 41/177 (23%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           +TV +P P  +DL LL A D N L  +   N  D+ L    RDG Q L+NQ+    P+ +
Sbjct: 17  VTVNKPTPYTFDLGLLLATDPNPLVLTSKANLEDD-LAATARDGAQALLNQLLSTCPVAS 75

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
           +  G L  LP   T +PREKP+                                      
Sbjct: 76  TPNGVLLSLPAIETSLPREKPLP------------------------------------P 99

Query: 137 XXXXTRWEKFAKAKGIQHRN---KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
               T W+KFA  KGI+ +    K KM+YDEATGEWVP+WGYKG N  G NDW++ V
Sbjct: 100 PKAQTTWQKFAAKKGIKPKTAEEKKKMVYDEATGEWVPKWGYKGKNKAGENDWIVEV 156



>gi|254586181|ref|XP_002498658.1| ZYRO0G15598p [Zygosaccharomyces rouxii]
 gi|238941552|emb|CAR29725.1| ZYRO0G15598p [Zygosaccharomyces rouxii]
          Length = 206

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 95/199 (47%), Gaps = 51/199 (25%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDT---DNYLKEYTRDGTQLLINQIFKLPI 74
           +TVE+ IP+ YDL  LA FD N LD++ L +     +N++K  TRD  QLL+NQI  LPI
Sbjct: 11  VTVEKSIPVNYDLGNLAVFDNNVLDKNDLDSSNASRENHIKSLTRDNVQLLVNQILSLPI 70

Query: 75  TT--------SDLGK---LAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRN 123
            T        SD G    L  LPE  + +PREKP+         E               
Sbjct: 71  KTTTESTGGSSDQGATVALLHLPEPTSELPREKPLPKPKPPTKWE--------------- 115

Query: 124 XXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDG 182
                                KFA  KGIQ + K  KM+YDEA+GEWVP+WGYKG N + 
Sbjct: 116 ---------------------KFAAKKGIQPKAKTGKMVYDEASGEWVPKWGYKGKNKNV 154

Query: 183 ANDWLIPVPQNDDPFEDQF 201
              WL+ +  N    ED+ 
Sbjct: 155 DTQWLVEMDDNKKGTEDEL 173



>gi|345316560|ref|XP_001509960.2| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Ornithorhynchus anatinus]
          Length = 474

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 129/282 (45%), Gaps = 49/282 (17%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIFKL 72
           K + I V + + L++DL  L A D N  D  R  +   +  L+   RD TQLL+N++++L
Sbjct: 20  KLRRIAVHKELELEFDLGHLLATDRNPTDALRRSSAGLEPGLRALARDNTQLLVNRLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P T  +   + +LPE  T +PREKP+                                  
Sbjct: 80  PATRVEEALVVQLPEPATRLPREKPLP--------------------------------- 106

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   TRW++FA+ KGI+ R K  +++DEA  EW  RWGY+    D   DWLI VP 
Sbjct: 107 ---KARPPTRWQQFARLKGIRARKKTNLVWDEARREWRRRWGYQRAK-DDTKDWLIEVPH 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR------KGEL 246
             DP +DQF+                  RNI  +   L    G D   +R      + EL
Sbjct: 163 AADPMQDQFALRLRAKKERVARNEFNRLRNIARAH-KLPPPPGRDG--MRPTGHQDREEL 219

Query: 247 QRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
            R   ++K +TAS+G+F + L  E   +G   KR+F+P +GD
Sbjct: 220 GRAERVAKRSTASLGRFQERLPKEKAPRGPGRKRQFQPLLGD 261



>gi|242005813|ref|XP_002423755.1| ribosome biogenesis regulatory protein, putative [Pediculus humanus
           corporis]
 gi|212506957|gb|EEB11017.1| ribosome biogenesis regulatory protein, putative [Pediculus humanus
           corporis]
          Length = 335

 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 124/267 (46%), Gaps = 62/267 (23%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           ++ KYK   V + + L+YDL  L A D N L+  +LK++ D YL    RD TQLLIN+I+
Sbjct: 14  EEKKYKPTKVNKHLELEYDLGTLLAIDENELNNDKLKSNLDTYLHSLARDNTQLLINKIW 73

Query: 71  KLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXX 130
           +LPI   D   +  LP+   ++PR  PV                                
Sbjct: 74  ELPIHIIDDVTMVTLPKSKYLLPRSLPVP------------------------------- 102

Query: 131 XXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                     ++WEKFAK KGI  + K+K+ +D+   +W+P +GYK    +   +W++ V
Sbjct: 103 -----PPRQPSKWEKFAKEKGIVKKKKDKLKWDDELKKWIPLYGYKRAEAEREKNWIMEV 157

Query: 191 PQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKGELQRQI 250
           P N DP+EDQF+                 ++ I       + T GA             +
Sbjct: 158 PDNADPYEDQFTKKP--------------KKKIYIFFQTFSTTLGA------------AV 191

Query: 251 AISKSATASIGKFDKTLKGELKLKGVK 277
            ++K++TAS+GKF K+L  E + K VK
Sbjct: 192 TVAKTSTASLGKFQKSLPKEKESKNVK 218



>gi|47207991|emb|CAF91693.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 334

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 122/274 (44%), Gaps = 41/274 (14%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIFKLPIT 75
           SITV + + L++D+  L A D N +D   ++N   + +L+   RD TQLL+N+I+KL   
Sbjct: 23  SITVHKDLELEFDVGNLLAVDKNRIDSREVRNTKKEEFLRALGRDNTQLLVNEIWKLQTQ 82

Query: 76  TSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXX 135
                 +A LPE  T                                             
Sbjct: 83  RVGDAIVATLPEPTTP------------------------------------LPREKPPP 106

Query: 136 XXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDD 195
                T+WE+FAK KGIQ + K  +++DE   EW  RWGYK    D   +W+I VP   D
Sbjct: 107 KPRPPTKWEQFAKLKGIQKKKKTNLVWDETAKEWRRRWGYKRAK-DDTKEWMIEVPATAD 165

Query: 196 PFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR-KGELQRQIAISK 254
           P EDQF+                  +NI  ++       G   ++ + K EL + ++++K
Sbjct: 166 PDEDQFAKRTNAKKERVARNEYNRLKNIARAQKVKIPGVGLTPKAQQSKSELAKAVSVAK 225

Query: 255 SATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           ++TAS G+F   L  E   KG   KRKF+P IGD
Sbjct: 226 TSTASAGRFQDRLPKEKPAKGTGKKRKFQPLIGD 259



>gi|406862481|gb|EKD15531.1| ribosome biogenesis regulatory protein [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 198

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 86/177 (48%), Gaps = 41/177 (23%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           + V +P P  +DL LL A D N +  +  +N  D+ L    RDG Q L+NQ+    PI +
Sbjct: 13  VEVNKPTPYTFDLGLLLASDPNPVLLTSPENLEDD-LAATARDGAQALLNQLLSTCPIAS 71

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
           +  G L  LPE  T +PREKP+                                      
Sbjct: 72  TPNGVLLSLPEIETRLPREKPLP------------------------------------P 95

Query: 137 XXXXTRWEKFAKAKGIQHRN---KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
               T WEKFA  KGI+ ++   + KM+YD+ATGEWVP+WGYKG N  G NDW++ V
Sbjct: 96  PKAQTTWEKFAAKKGIKAKSAEQRKKMVYDDATGEWVPKWGYKGANKAGENDWIVEV 152



>gi|345568148|gb|EGX51049.1| hypothetical protein AOL_s00054g785 [Arthrobotrys oligospora ATCC
           24927]
          Length = 206

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 96/189 (50%), Gaps = 39/189 (20%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S ++E  + +   +TV +PIPL YDL  L AFD+N L      +  +  L    RD TQ
Sbjct: 1   MSTEMEVDEPQRLPVTVTKPIPLTYDLGHLTAFDSNPL-PPLTPSTLEQTLHSTARDATQ 59

Query: 64  LLINQIFK-LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSR 122
           LLINQI   + + ++  G  A LPE IT +PREKPV     L                  
Sbjct: 60  LLINQILTTVALKSTQDGVYATLPEPITNLPREKPVPKAKEL------------------ 101

Query: 123 NXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGD 181
                             T WEKFAK KGI  + K+ KM+YDEATGEWVP+WGYKG+N  
Sbjct: 102 ------------------TSWEKFAKKKGIAAKAKDGKMVYDEATGEWVPKWGYKGSNKG 143

Query: 182 GANDWLIPV 190
           G +DW + V
Sbjct: 144 GEDDWAVEV 152



>gi|195127223|ref|XP_002008068.1| GI13300 [Drosophila mojavensis]
 gi|193919677|gb|EDW18544.1| GI13300 [Drosophila mojavensis]
          Length = 347

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 124/266 (46%), Gaps = 41/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N LD+ +L ++ + YL   TRD TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRIDVGTLLITDPNDLDDRQLADNKEEYLSALTRDNTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  TV+PR         L  P     L                    
Sbjct: 77  TERVDESIVAKLPEPTTVLPR---------LRKPPGPRPL-------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WEKFAK KGI  + K+K  YD+   +WVP +G+K    +   +W++ VPQN
Sbjct: 108 -------TKWEKFAKEKGITKKKKDKKTYDDVLDKWVPTYGFKRAEAEKDKEWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQI 250
            DP  D F                   +NI  +   E   +   G +A S    +L   +
Sbjct: 161 ADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKIEMPRSGYLGPEAAS--SNQLLTAV 218

Query: 251 AISKSATASIGKFDKTLKGELKLKGV 276
            ++KS+TAS+GKF   L  E + +G+
Sbjct: 219 TVAKSSTASVGKFQSKLPKEKEARGL 244



>gi|195020101|ref|XP_001985121.1| GH14686 [Drosophila grimshawi]
 gi|193898603|gb|EDV97469.1| GH14686 [Drosophila grimshawi]
          Length = 344

 Score =  104 bits (259), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 126/266 (47%), Gaps = 41/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N L++ ++  + + YL E TRD TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRIDVGTLLITDPNDLEDRQIAKNKEEYLAELTRDNTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  TV+PR         L  P  +  +                    
Sbjct: 77  TERVDESIVAKLPEPTTVLPR---------LRKPPGVRPM-------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WEKFAK KGI  + K+K  YD+   +WVP +G+K    +   +W++ VPQN
Sbjct: 108 -------TKWEKFAKEKGITKKKKDKKTYDDVLDKWVPTYGFKHAEAEKDKEWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNI---EESEAALNQTKGADARSLRKGELQRQI 250
            DP  D F                   +NI   ++ E   +   G +A S    +L   +
Sbjct: 161 ADPNTDMFQKKMDLRNEKVAKNEIQRMKNIVRAKKVEMPRSGYLGPEAAS--SNQLLTAV 218

Query: 251 AISKSATASIGKFDKTLKGELKLKGV 276
            ++K++TAS+GKF   L  E + +G+
Sbjct: 219 TVAKASTASVGKFQNKLPKEKEARGL 244



>gi|440639714|gb|ELR09633.1| hypothetical protein GMDG_04124 [Geomyces destructans 20631-21]
          Length = 196

 Score =  104 bits (259), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 88/186 (47%), Gaps = 42/186 (22%)

Query: 9   ETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQ 68
           E Q+     + V++P P  +DL  L A D N L+ +    + ++ L    RDG Q LINQ
Sbjct: 3   EVQELTRLPVVVDKPTPYIFDLGYLLANDPNPLELN--SENIEDDLSATARDGAQALINQ 60

Query: 69  IF-KLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXX 127
           +    PIT++  G L  LP   T +PREKP+                             
Sbjct: 61  LLGTCPITSAPAGVLLTLPTPSTHLPREKPLP---------------------------- 92

Query: 128 XXXXXXXXXXXXXTRWEKFAKAKGIQHRN---KNKMIYDEATGEWVPRWGYKGTNGDGAN 184
                        T WE+FA+ KGI+ +    + KM YDEATGEWVP+WGYKG N  G N
Sbjct: 93  --------PPKAETTWERFARKKGIKAKTADVRQKMQYDEATGEWVPKWGYKGANKAGEN 144

Query: 185 DWLIPV 190
           DW++ V
Sbjct: 145 DWIVEV 150



>gi|154314321|ref|XP_001556485.1| hypothetical protein BC1G_05254 [Botryotinia fuckeliana B05.10]
 gi|347827405|emb|CCD43102.1| similar to ribosome biogenesis protein (Rrs1) [Botryotinia
           fuckeliana T4]
 gi|472241577|gb|EMR86293.1| putative ribosome biogenesis protein [Botryotinia fuckeliana BcDW1]
          Length = 202

 Score =  104 bits (259), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 88/187 (47%), Gaps = 41/187 (21%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           QK     ITV +P P  +DL LL A D N L  +   N  D+ L    RDG Q L+NQ+ 
Sbjct: 7   QKPSKLPITVNKPTPYTFDLGLLLAEDPNPLLLTTSANLEDD-LAATARDGAQALLNQLL 65

Query: 71  K-LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXX 129
              PI ++  G L  LP   T +PREKP+                               
Sbjct: 66  STCPIASTPNGVLLSLPGIATKLPREKPLPPPVA-------------------------- 99

Query: 130 XXXXXXXXXXXTRWEKFAKAKGIQHRN---KNKMIYDEATGEWVPRWGYKGTNGDGANDW 186
                      T W+KFA  KGI+ +    K K++YDE+TGEWVP+WGYKG N  G +DW
Sbjct: 100 ----------QTTWQKFAAKKGIKPKTAEAKKKLVYDESTGEWVPKWGYKGINKKGEDDW 149

Query: 187 LIPVPQN 193
           ++ V +N
Sbjct: 150 IVEVNEN 156



>gi|260947418|ref|XP_002618006.1| hypothetical protein CLUG_01465 [Clavispora lusitaniae ATCC 42720]
 gi|238847878|gb|EEQ37342.1| hypothetical protein CLUG_01465 [Clavispora lusitaniae ATCC 42720]
          Length = 201

 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 98/189 (51%), Gaps = 50/189 (26%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKN--DTDNYLKEYTRDGTQLLINQIFK 71
           K+K +TV +PIP  +DL  LA FD N LD ++LK+    + YL   TRD  QLLINQ+  
Sbjct: 5   KFKPVTVNKPIPNTFDLGNLATFDPNPLDNAKLKDPEQKEAYLASVTRDNLQLLINQVLS 64

Query: 72  LPI-TTSDLG----------KLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILV 120
           LPI TT+D             L  LPE  T +PREK +        P++  L        
Sbjct: 65  LPIQTTTDTHGSSTGQDSTMTLIRLPEPSTPLPREKSI--------PKDKPL-------- 108

Query: 121 SRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTN 179
                               T+WE+FA  KGI+ + K+ K++YDEATGEWVP+WGYKG N
Sbjct: 109 --------------------TKWEQFAAKKGIKAKAKDGKLVYDEATGEWVPKWGYKGKN 148

Query: 180 GDGANDWLI 188
               + WL+
Sbjct: 149 KALDDQWLV 157



>gi|195376833|ref|XP_002047197.1| GJ12069 [Drosophila virilis]
 gi|194154355|gb|EDW69539.1| GJ12069 [Drosophila virilis]
          Length = 347

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 123/266 (46%), Gaps = 41/266 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+ +L N+ + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRIDVGSLLITDPNDFDDRQLANNKEEYLAALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               D   +A+LPE  TV+PR         L  P     L                    
Sbjct: 77  TERVDESIVAKLPEPTTVLPR---------LRKPPGPRPL-------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WEKFAK KGI  + K+K  YD+   +WVP +G+K    +   DW++ VP+N
Sbjct: 108 -------TKWEKFAKEKGITKKKKDKKTYDDVLDKWVPTYGFKRAEAEKDKDWVLEVPEN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQTKGADARSLRKGELQRQI 250
            DP  D F                   RNI  +   +   +   G +A S    +L   +
Sbjct: 161 ADPNTDMFQKKMDLRNEKVAKNEIQRMRNIVRAKKIDMPRSGYLGPEAAS--SNQLLTAV 218

Query: 251 AISKSATASIGKFDKTLKGELKLKGV 276
            ++KS+TAS+GKF   L  E + +G+
Sbjct: 219 TVAKSSTASVGKFQSKLPKEKEARGL 244



>gi|320581208|gb|EFW95429.1| ribosome biogenesis regulatory protein Rrs1p, putative [Ogataea
           parapolymorpha DL-1]
          Length = 276

 Score =  102 bits (254), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/184 (35%), Positives = 91/184 (49%), Gaps = 47/184 (25%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKND--TDNYLKEYTRDGTQLLINQIFKLP 73
           K +TVE+PIP+ YDL  LA FD N L+ S++ ND   ++YL++ TRD  QLLINQ+  LP
Sbjct: 87  KPVTVEKPIPVNYDLGNLAVFDPNPLEASKITNDKTKNDYLRDVTRDNVQLLINQVLSLP 146

Query: 74  I-TTSD-------LGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXX 125
           +  TSD          L +LP+  T +PREK +                           
Sbjct: 147 LKKTSDNSNGQNSTMTLIQLPDPTTQLPREKSIP-------------------------- 180

Query: 126 XXXXXXXXXXXXXXXTRWEKF-AKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGAN 184
                          T+WE F AK    +     K++YDE TG+WV +WGYKG N +  +
Sbjct: 181 ----------KAKEPTKWELFAAKKGIKKKGKDGKLVYDERTGKWVNKWGYKGKNKEVES 230

Query: 185 DWLI 188
           DWL+
Sbjct: 231 DWLV 234



>gi|146412013|ref|XP_001481978.1| hypothetical protein PGUG_05741 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146393485|gb|EDK41643.1| hypothetical protein PGUG_05741 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 217

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 95/189 (50%), Gaps = 48/189 (25%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           +YK + V++PIP  +DL  LAAFD N LD  +LK + + YL+  TRD  QLL+NQI  LP
Sbjct: 25  EYKPVHVDQPIPTTFDLGNLAAFDPNPLDNEQLKTNKEQYLQSVTRDNVQLLVNQILSLP 84

Query: 74  I-TTSDLG----------KLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSR 122
           + TT+D             LA+LPE  T++                              
Sbjct: 85  MKTTTDTHGSSTGQDSTMTLAQLPEPTTML------------------------------ 114

Query: 123 NXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGD 181
                             T+WE+FA  KGI+ + K+ KM+YDEATG+WVP+WGYKG N +
Sbjct: 115 ------PREKPIPKPKPPTKWEQFAAKKGIKAKAKDGKMVYDEATGQWVPKWGYKGKNKE 168

Query: 182 GANDWLIPV 190
             + WL+ V
Sbjct: 169 LDDQWLVEV 177



>gi|158286807|ref|XP_308939.3| AGAP006808-PA [Anopheles gambiae str. PEST]
 gi|157020644|gb|EAA04194.3| AGAP006808-PA [Anopheles gambiae str. PEST]
          Length = 346

 Score =  100 bits (250), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 121/264 (45%), Gaps = 38/264 (14%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +    D+  +   D N  DE ++K D + Y+ + TRD  QLLIN I++LP
Sbjct: 17  KYKPITVEKALEPTIDVGHMLVSDPNYYDEEQMKADREKYVLDLTRDNVQLLINSIWQLP 76

Query: 74  ITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXX 133
               +   +A+LP     +PR +       L  P+ L                       
Sbjct: 77  TERVEESIVAKLPPPKAPLPRARK------LPVPKPL----------------------- 107

Query: 134 XXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN 193
                  T+WE+FAK KGI+ R ++K ++D    +WVP +GY+    +   DW++ VPQN
Sbjct: 108 -------TKWEEFAKKKGIKKRTRDKKVFDPVLDKWVPTYGYQRYKAEKEKDWVLEVPQN 160

Query: 194 DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA-ALNQTKGADARSLRKGELQRQIAI 252
            DP+ D F                   +NI  ++  A  +T      +    +L     I
Sbjct: 161 -DPYRDMFKEKRDLRLERVAKNEVARMKNIARAKKIATPRTGFVGPETASAKQLITASNI 219

Query: 253 SKSATASIGKFDKTLKGELKLKGV 276
            K++TAS+G F ++L  E + +G+
Sbjct: 220 VKASTASVGVFQESLPNEKQARGL 243



>gi|396478553|ref|XP_003840559.1| hypothetical protein LEMA_P102110.1 [Leptosphaeria maculans JN3]
 gi|312217131|emb|CBX97080.1| hypothetical protein LEMA_P102110.1 [Leptosphaeria maculans JN3]
          Length = 235

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 83/189 (43%), Gaps = 42/189 (22%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            +D   T +  +  ITV +P P  +DL  L A D N +      N  +  L    RD  Q
Sbjct: 42  IADSTATSRLPHSPITVNKPTPFTFDLGNLLANDPNPVP----ANANEEVLTATARDAAQ 97

Query: 64  LLINQIFK-LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSR 122
            LINQ+     I ++  G    LP   T +PREKP+                        
Sbjct: 98  ALINQLLSTCEIKSTTEGVHLVLPAPTTALPREKPIP----------------------- 134

Query: 123 NXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGD 181
                             T+WE+FA  KGI+ + ++ K++YDE  GEWVP+WGYKG N D
Sbjct: 135 -------------AAKEPTKWERFAAKKGIKDKKRDGKLVYDEEKGEWVPKWGYKGKNKD 181

Query: 182 GANDWLIPV 190
           G N WL+ V
Sbjct: 182 GDNQWLVEV 190



>gi|321265488|ref|XP_003197460.1| ribosome biogenesis-related protein [Cryptococcus gattii WM276]
 gi|317463940|gb|ADV25673.1| Ribosome biogenesis-related protein, putative [Cryptococcus gattii
           WM276]
          Length = 314

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/255 (32%), Positives = 117/255 (45%), Gaps = 39/255 (15%)

Query: 32  LLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQITV 91
           LLAAFD +  D +    D + +L + T   T  L+  +F LP T S  G +A  P   T+
Sbjct: 28  LLAAFDASPTDPAAYA-DREPHLLQLTLASTASLLAALFALPTTPSPAGPVAAFPPPTTL 86

Query: 92  IPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKG 151
           +PREKP      L  P+ L                              T+WE+FA  KG
Sbjct: 87  LPREKP------LPKPKPL------------------------------TKWERFANEKG 110

Query: 152 IQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXX 211
           I H+ K K ++D+   EWVPRWG  G N D    WL  V   ++  +D            
Sbjct: 111 ISHKKKEKDVWDDERQEWVPRWGRFGKNKDKEEQWLHEVKPGEEADKDPAKTARGERKAR 170

Query: 212 XXXXXXXHRRNI--EESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKG 269
                  +  NI    +     +   A  R+ RK EL R + ISK++TAS+GKFD  ++G
Sbjct: 171 IAKNTKQNTANIAAASASVTAARATAAAERAARKEELNRNMLISKTSTASLGKFDNKIQG 230

Query: 270 ELKLKGVKRKFEPSI 284
           E K +G+KRKF+ +I
Sbjct: 231 EPKARGMKRKFDANI 245



>gi|268559672|ref|XP_002637827.1| Hypothetical protein CBG04617 [Caenorhabditis briggsae]
 gi|298289231|sp|A8WY26.1|RRS1_CAEBR RecName: Full=Ribosome biogenesis regulatory protein homolog
          Length = 329

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 87/278 (31%), Positives = 119/278 (42%), Gaps = 54/278 (19%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           KS  VE+ I    DL  L   D   L     + D +  L+E  R  TQLL N I++L   
Sbjct: 4   KSTEVEKAIDPIIDLGNLLFIDREPL-----QGDAEEGLEERARKNTQLLFNNIWQLEQK 58

Query: 76  TSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXX 135
             +   +  LP     +PREK          PE                           
Sbjct: 59  RVEEAIIVTLPAATYRLPREK--------KLPEK-------------------------- 84

Query: 136 XXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN-D 194
                T+WEK+AK KGI+ R K+K ++DEAT EW P +GY+  N D   DWLI +P N +
Sbjct: 85  --KEPTKWEKYAKEKGIEKRKKDKKVFDEATKEWKPTYGYRRGN-DNTKDWLIEIPDNAE 141

Query: 195 DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTK---------GADARSLRKGE 245
           DP +D F+                  +N+        +T          G DA+   K +
Sbjct: 142 DPNKDFFAERREKKKERVAKNEMQRMKNLARQMKTTVKTGPSTDKMIGVGIDAKDKSKQD 201

Query: 246 LQRQIAISKSATASIGKFDKTLKGE-LKLK-GVKRKFE 281
           ++  +  +K ATAS GKF + LKGE   +K G KRKFE
Sbjct: 202 VRFAVDRAKLATASAGKFQEGLKGEKANIKTGKKRKFE 239



>gi|330802790|ref|XP_003289396.1| hypothetical protein DICPUDRAFT_35659 [Dictyostelium purpureum]
 gi|325080514|gb|EGC34066.1| hypothetical protein DICPUDRAFT_35659 [Dictyostelium purpureum]
          Length = 316

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 89/305 (29%), Positives = 138/305 (45%), Gaps = 48/305 (15%)

Query: 20  VERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDL 79
           VE    L YDL  L AFD +++D++  K +   Y+ E  R   QLLI+++F+LPI + + 
Sbjct: 20  VEGEDTLLYDLGNLCAFDHSSIDKNEYKENPTKYINELARKNVQLLISRLFQLPIKSIEE 79

Query: 80  GKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXX 139
           G LA LP+  T IPRE+ V        P+                               
Sbjct: 80  GSLALLPKCETKIPRERSV--------PQG----------------------------KQ 103

Query: 140 XTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFED 199
            TRWE FA+ KGI+ + K+KM +DE   E+ P +GYK  N D + +++I   Q+D   +D
Sbjct: 104 KTRWEAFAELKGIKKQKKSKMQWDEKHQEYRPSYGYKKAN-DDSGEYIIEGKQSDKVGDD 162

Query: 200 QFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQ--------TKGADARSLRKGELQRQIA 251
            F                  +RN +  EA++ Q        T   + R   K ++++   
Sbjct: 163 PFQKKEEEKNQKVQKQKKREQRNFD--EASMRQMGNVGKSLTFSQENRPTIKSDMEKVFD 220

Query: 252 ISKSATASIGKFDKTLKGEL-KLKGVKRKFEPSIGDXXXXXXXXXXXXXXXXGKKGDIVN 310
           ++K +TAS+G+FDK ++ E  K K   +K      D                 KK D++N
Sbjct: 221 VAKLSTASLGRFDKKVENEKDKTKRGNKKLAGLGADNVQKESESNQKLVDRMFKKEDVLN 280

Query: 311 VRKAI 315
           V KA+
Sbjct: 281 VDKAV 285



>gi|451848526|gb|EMD61831.1| hypothetical protein COCSADRAFT_146928 [Bipolaris sorokiniana
           ND90Pr]
          Length = 226

 Score = 98.2 bits (243), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 79/176 (44%), Gaps = 44/176 (25%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           ITV++P P  +DL  L A D N +         +  LK   RD  Q LINQ+     + +
Sbjct: 47  ITVDKPTPFTFDLGNLLANDPNPI----AAGADEEALKATARDAAQALINQLLSTCQVKS 102

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
           +  G    LP   T +PREKP+                                      
Sbjct: 103 TSEGVHLVLPAPTTPLPREKPIP------------------------------------S 126

Query: 137 XXXXTRWEKFAKAKGI--QHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
               T+WEKFA  KGI  Q R+ N ++YDE  GEWVP+WGYKG N DG NDWL+ V
Sbjct: 127 AKEPTKWEKFAAKKGIKKQKRDSN-LVYDETKGEWVPKWGYKGKNKDGENDWLVEV 181



>gi|308500300|ref|XP_003112335.1| CRE-RRBS-1 protein [Caenorhabditis remanei]
 gi|308266903|gb|EFP10856.1| CRE-RRBS-1 protein [Caenorhabditis remanei]
          Length = 369

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 120/283 (42%), Gaps = 54/283 (19%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           QK   KS  VE+ I    DL  L       +D   L+ D +  L+E  R  TQLL N I+
Sbjct: 39  QKMADKSTEVEKAIDPIVDLGNLLF-----IDREPLQGDPNEGLEERARKNTQLLFNNIW 93

Query: 71  KLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXX 130
           +L     +      LP     +PREK +        PE                      
Sbjct: 94  QLEQKRVEEAITVTLPVATYRLPREKKM--------PEK--------------------- 124

Query: 131 XXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                     T+WEK+AK KGI+ R K+K ++DEAT EW P +GY+  N D   DWLI +
Sbjct: 125 -------KEPTKWEKYAKEKGIEKRKKDKKVFDEATKEWKPTYGYRRGN-DNTKDWLIEI 176

Query: 191 PQN-DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTK---------GADARS 240
           P N +DP +D F+                  +N+        +T          G DA+ 
Sbjct: 177 PDNAEDPNKDFFAERREKKKERVAKNEMQRMKNLARQMKTTVKTGPSTEKIIGVGIDAKE 236

Query: 241 LRKGELQRQIAISKSATASIGKFDKTLKGELK--LKGVKRKFE 281
             K +++  +  +K ATAS GKF + LKGE      G KRKFE
Sbjct: 237 KSKQQVRFAVDRAKLATASAGKFQEGLKGEKANVKTGKKRKFE 279



>gi|451992617|gb|EMD85097.1| hypothetical protein COCHEDRAFT_1149416 [Bipolaris maydis C5]
 gi|477582126|gb|ENH99239.1| hypothetical protein COCC4DRAFT_54579 [Bipolaris maydis ATCC 48331]
          Length = 226

 Score = 97.8 bits (242), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 79/176 (44%), Gaps = 44/176 (25%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           ITV++P P  +DL  L A D N +         +  LK   RD  Q LINQ+     + +
Sbjct: 47  ITVDKPTPFTFDLGNLLANDPNPIPAGA----DEEALKATARDAAQALINQLLSTCQVKS 102

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
           +  G    LP   T +PREKP+                                      
Sbjct: 103 TSEGVHLVLPAPTTPLPREKPIP------------------------------------S 126

Query: 137 XXXXTRWEKFAKAKGI--QHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
               T+WEKFA  KGI  Q R+ N ++YDE  GEWVP+WGYKG N DG NDWL+ V
Sbjct: 127 AKEPTKWEKFAAKKGIKKQKRDSN-LVYDETKGEWVPKWGYKGKNKDGENDWLVEV 181



>gi|317419902|emb|CBN81938.1| Ribosome biogenesis regulatory protein homolog [Dicentrarchus
           labrax]
          Length = 353

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 124/277 (44%), Gaps = 41/277 (14%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K KSI+V + + L++D+  L A D N ++    +    +++L+   RD TQLLINQI+K 
Sbjct: 20  KLKSISVHKELDLEFDVGNLLACDKNRIEVRGFREQKKEDFLRSLARDNTQLLINQIWKQ 79

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           P    +   + +LPE  T                                          
Sbjct: 80  PTERVEEAIVVKLPESATP------------------------------------LPREK 103

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WE+FAK KGIQ + K  +++DE   EW  RWGYK    D   +WLI VP+
Sbjct: 104 PPPKPKPPTKWEEFAKLKGIQKKKKTNLVWDETAKEWKRRWGYKRAK-DDTKEWLIEVPE 162

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR-KGELQRQIA 251
             DP EDQF+                  +NI  ++       G    + + K +L + ++
Sbjct: 163 TADPNEDQFAKRVKAKKERVAKNEFNRLKNIARAQKIKVPGVGLTPVAQQSKDDLSKAVS 222

Query: 252 ISKSATASIGKFDKTLKGEL--KLKGVKRKFEPSIGD 286
           ++K++TAS G+F   L  E   K  G +RKFEP IG+
Sbjct: 223 VAKTSTASAGRFQDRLPKEKPPKNTGKRRKFEPLIGN 259



>gi|393912353|gb|EJD76693.1| hypothetical protein LOAG_16371 [Loa loa]
          Length = 354

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 110/259 (42%), Gaps = 43/259 (16%)

Query: 32  LLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQITV 91
           LL   +   +DE   K  ++  L    RD  Q L N+I++L     D    A+LP  +  
Sbjct: 26  LLIVDNDPLIDEDSKKKPSEEELSARVRDNAQFLFNKIWELERKRIDEAICAKLPGPLFR 85

Query: 92  IPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKG 151
           +PREKP+     L                                    T+WE++A+ KG
Sbjct: 86  LPREKPLPSERQL------------------------------------TKWEQYAQQKG 109

Query: 152 IQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXX 211
           I+ R K++ ++DE T EW  R+GYK    + A +WLI +P N DP  D F          
Sbjct: 110 IRKRKKDRKVFDEQTQEWKARYGYKSVKDNNAKEWLIEIPDNKDPMVDYFDERRNAKREK 169

Query: 212 XXXXXXXHRRNIEESE--AALNQTK---GADARSLRKGELQRQIAISKSATASIGKFDKT 266
                    RNI   +  ++ N T      D  +  + EL  QI  ++ +TAS G F  +
Sbjct: 170 VNKNEMQRLRNIARLKGISSANATPLGIAVDLNNRSRHELVNQINRARYSTASHGAFQPS 229

Query: 267 LKGELKL--KGVKRKFEPS 283
           +K E KL   G   K++P+
Sbjct: 230 IKNEKKLLKTGKHHKYKPN 248



>gi|441647489|ref|XP_003274825.2| PREDICTED: ribosome biogenesis regulatory protein homolog [Nomascus
           leucogenys]
          Length = 448

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 97/224 (43%), Gaps = 51/224 (22%)

Query: 72  LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXX 131
           LP    +   +A LPE  T +PREKP+     L                           
Sbjct: 162 LPTERGEEAIVARLPEPTTRLPREKPLPRPRPL--------------------------- 194

Query: 132 XXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVP 191
                    TRW++FA+ KGI+ + K  +++DE +G+W  RWGY+    D   +WLI VP
Sbjct: 195 ---------TRWQQFARLKGIRPKKKTNLVWDEVSGQWRRRWGYQRAR-DDTKEWLIEVP 244

Query: 192 QNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKG 244
            N DP EDQF+                  RN+         S A L+ T         K 
Sbjct: 245 GNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQS-----KE 299

Query: 245 ELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           EL R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 300 ELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 343



>gi|212535770|ref|XP_002148041.1| ribosome biogenesis protein (Rrs1), putative [Talaromyces marneffei
           ATCC 18224]
 gi|210070440|gb|EEA24530.1| ribosome biogenesis protein (Rrs1), putative [Talaromyces marneffei
           ATCC 18224]
          Length = 216

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 84/191 (43%), Gaps = 51/191 (26%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTS 77
           I V++  P  +DL  L A D N L   +  N  D+ LK   RDG Q+L+NQ+      TS
Sbjct: 21  IVVQKENPYTFDLGHLLAQDPNPLVIPKSDNVNDS-LKTVARDGAQVLLNQLLTTCPVTS 79

Query: 78  DL--GKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXX 135
           +   G L  LP   T++PR KP+                                     
Sbjct: 80  NAKDGVLLTLPPPNTLLPRFKPLP------------------------------------ 103

Query: 136 XXXXXTRWEKFAKAKGI------------QHRNKNKMIYDEATGEWVPRWGYKGTNGDGA 183
                TRWE FA+ KGI            +   + K++YDEA+GEWVPRWG+KG N  G 
Sbjct: 104 KPKEPTRWELFARKKGIGKYSSKPGAAFAEKERRKKLVYDEASGEWVPRWGFKGANKSGE 163

Query: 184 NDWLIPVPQND 194
           NDW + VP  D
Sbjct: 164 NDWAVEVPDKD 174



>gi|341878072|gb|EGT34007.1| hypothetical protein CAEBREN_03804 [Caenorhabditis brenneri]
 gi|341900129|gb|EGT56064.1| hypothetical protein CAEBREN_25604 [Caenorhabditis brenneri]
          Length = 330

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 115/278 (41%), Gaps = 54/278 (19%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           KS  VE+ I    DL  L   D   +     + D    L+E  R  TQLL N I++L   
Sbjct: 4   KSTEVEKAIDPIIDLGNLLFIDREPI-----QGDASEGLEERARKNTQLLFNNIWQLEQK 58

Query: 76  TSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXX 135
             D      LP     +PREK          PE                           
Sbjct: 59  RVDEAITVTLPAATYRLPREK--------KLPEK-------------------------- 84

Query: 136 XXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN-D 194
                T+WEK+AK KGI+ R K+K ++DEAT EW P +GY+  N D   DWLI +P N +
Sbjct: 85  --KEPTKWEKYAKEKGIEKRKKDKKVFDEATKEWKPTYGYRRGN-DDTKDWLIEIPDNAE 141

Query: 195 DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTK---------GADARSLRKGE 245
           DP +D F+                  +N+        ++          G DA+   K +
Sbjct: 142 DPNKDFFAERKEKKKERIAKNETQRLKNLARQMKTTVKSGPSTEKIIGVGIDAKEKTKQQ 201

Query: 246 LQRQIAISKSATASIGKFDKTLKGELK--LKGVKRKFE 281
           ++  +  +K ATAS GKF + LKGE      G KRKFE
Sbjct: 202 VRFAVDRAKLATASAGKFQEGLKGEKANVKTGKKRKFE 239



>gi|148906982|gb|ABR16635.1| unknown [Picea sitchensis]
          Length = 343

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 116/277 (41%), Gaps = 57/277 (20%)

Query: 27  QYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQL---LINQIFKLPITTSDLGKLA 83
           Q DL  L AFD++    S   ++ +  +KE    GT+L   + +++F LP T    G L 
Sbjct: 13  QIDLGNLTAFDSHDPGASATSSE-EELVKECLEKGTRLVQAIADKLFSLPSTPDKEGPLV 71

Query: 84  ELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRW 143
           +LP   T IPREKP+                                          T+W
Sbjct: 72  QLPTPTTPIPREKPLP------------------------------------KAKPPTKW 95

Query: 144 EKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSX 203
           E FA++KGI+ R ++K +YDE +GEW  R GY    GD  +  +I     D+P ED FS 
Sbjct: 96  EVFAQSKGIKKRKRSKHLYDEPSGEWKRRHGY-NRAGDENDIPIIEAKPTDEPGEDPFSK 154

Query: 204 XXXXXXXXXXXXXXXHRRNIEESE--AALNQTKGADARSLR------------KGELQRQ 249
                             N++++    AL  T    A SL             K +L   
Sbjct: 155 KKTEKKARVQKNEKSQLENLKKAAKVGALPSTVQLAATSLPITGTRDIPKKVGKDDLGHA 214

Query: 250 IAISKSATASIGKFDKTLKGE--LKLKGVKRKFEPSI 284
              + SATAS+GKFD+ L GE   K  G  RKF P +
Sbjct: 215 AGFASSATASVGKFDERLPGEKTPKHPGKHRKFLPVV 251



>gi|448089567|ref|XP_004196841.1| Piso0_004067 [Millerozyma farinosa CBS 7064]
 gi|448093860|ref|XP_004197872.1| Piso0_004067 [Millerozyma farinosa CBS 7064]
 gi|359378263|emb|CCE84522.1| Piso0_004067 [Millerozyma farinosa CBS 7064]
 gi|359379294|emb|CCE83491.1| Piso0_004067 [Millerozyma farinosa CBS 7064]
          Length = 200

 Score = 94.0 bits (232), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 94/180 (52%), Gaps = 28/180 (15%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           ++K +TV++PIP  +DL  LA FD N L+  +LK+D   + YLK  TRD  QLL+NQ+  
Sbjct: 5   EFKPVTVDKPIPNTFDLGNLATFDHNPLENEKLKDDEVREEYLKNITRDNVQLLVNQLLS 64

Query: 72  LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXX 131
           LP+ T+   + +   +  T+           ++  PE    L     L            
Sbjct: 65  LPMKTTTDSQNSAGGQDTTMT----------LIQLPETTTALPREKPLPKP--------- 105

Query: 132 XXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                    T+WE FAK KGI+ + K+ K++YDEA  EWVP+WGYKG N D  N WL+ V
Sbjct: 106 ------KPPTKWELFAKKKGIKPKEKSGKLVYDEAKQEWVPKWGYKGKNKDLDNQWLVEV 159



>gi|384499057|gb|EIE89548.1| hypothetical protein RO3G_14259 [Rhizopus delemar RA 99-880]
          Length = 119

 Score = 93.6 bits (231), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 63/109 (57%), Gaps = 2/109 (1%)

Query: 160 MIYDEATGEWVPRWGYKGTNGDG-ANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXX 218
           M+Y+E TGE+  RWGYK  + D  + DWLIPVP + DP EDQ+                 
Sbjct: 1   MVYNEETGEYEARWGYKPKDKDQLSQDWLIPVPDHGDPMEDQYEKAREAKKANVEKNKKR 60

Query: 219 HRRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTL 267
            RRN EE+ AA    K  D + ++K ELQ  IA SK +TAS+GKFDK L
Sbjct: 61  QRRNQEETTAATIAGK-KDIKEMKKSELQAAIAASKQSTASLGKFDKPL 108



>gi|17558012|ref|NP_506573.1| Protein RRBS-1 [Caenorhabditis elegans]
 gi|21362907|sp|Q9XVT0.1|RRS1_CAEEL RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|3874344|emb|CAB02731.1| Protein RRBS-1 [Caenorhabditis elegans]
          Length = 333

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 117/278 (42%), Gaps = 54/278 (19%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           KS  VE+ I    DL  L   D   +     + D    L+E  R  TQLL N I++L   
Sbjct: 4   KSTEVEKAIDPIIDLGNLLFIDREPI-----QGDASEGLEERARKNTQLLFNNIWQLEQK 58

Query: 76  TSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXX 135
             +   +  LP     +PREK          PE                           
Sbjct: 59  RVEEAIIVTLPPATYRLPREK--------RLPEK-------------------------- 84

Query: 136 XXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQN-D 194
                T+WEK+A  KGI+ R K+K ++DEAT EW P +GY+  N D   DWLI +P N +
Sbjct: 85  --KEPTKWEKYAAEKGIEKRKKDKKVFDEATKEWKPTYGYRRGN-DDTKDWLIEIPDNAE 141

Query: 195 DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTK---------GADARSLRKGE 245
           DP +D F+                  +N+        ++          G DA+   K +
Sbjct: 142 DPNKDFFAERREKKKERVAKNDMQRMKNLARQMKTTVKSGPSTEKMIGVGVDAKEKSKQQ 201

Query: 246 LQRQIAISKSATASIGKFDKTLKGE-LKLK-GVKRKFE 281
           ++  +  +K ATAS GKF + LKGE   +K G KRKFE
Sbjct: 202 VRFAVDRAKLATASAGKFQEGLKGEKANVKTGKKRKFE 239



>gi|110758413|ref|XP_394666.3| PREDICTED: ribosome biogenesis regulatory protein homolog [Apis
           mellifera]
          Length = 339

 Score = 93.2 bits (230), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 123/275 (44%), Gaps = 40/275 (14%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQI 69
           T++   ++  V + I ++ DL  L A D N+LD   +K+  + YLK  TRD  Q+LIN+I
Sbjct: 15  TEEKDTRTTIVNKDIEVETDLGTLLALDYNSLDLKAIKSQPEEYLKNLTRDNVQILINKI 74

Query: 70  FKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXX 129
           ++LP    D   +A+LP+Q  ++PR + +        P+ L                   
Sbjct: 75  WELPTERIDEVIVAKLPKQTFILPRSRQIPK------PKPL------------------- 109

Query: 130 XXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMI--YDEATGEWVPRWGYKGTNGDGANDWL 187
                      T+W++FAK KGI+ + K+K    +DE   +W+P +GYK        +WL
Sbjct: 110 -----------TKWQQFAKEKGIRSKKKSKSKLKWDEVLQKWIPTFGYKRNKAIEQKEWL 158

Query: 188 IPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARS--LRKGE 245
           + V       ED F+                   NI +++       G   +       +
Sbjct: 159 VEVNDEGKAMEDPFTAAKIAKEERKSKNELQRLHNIAKTKNIKIPKVGLPTKEHFSDSQQ 218

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGVKRKF 280
           L + + I++++TAS+GKF   L  E   KG+ ++ 
Sbjct: 219 LSQAVTIARTSTASLGKFQDRLPKEKDAKGIAKQV 253



>gi|507115176|emb|CDF38667.1| ribosome biogenesis regulatory protein (RRS1) family protein
           [Chondrus crispus]
          Length = 261

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 117/277 (42%), Gaps = 59/277 (21%)

Query: 19  TVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSD 78
           T + P   + DL  LAAFD             +    E    G + L++ IF LP+  SD
Sbjct: 3   TFQIPPGYEVDLGNLAAFDKRV--------GIEGTPVEVATQGVEPLVHAIFSLPVLESD 54

Query: 79  LGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXX 138
             KL  LP     +PR KP+     L                                  
Sbjct: 55  EAKLVSLPNGAFHLPRAKPIPKERAL---------------------------------- 80

Query: 139 XXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFE 198
             T+WEKFAK KGIQ R++++++ D+ATGE+VPR+G KG+      D ++P  ++     
Sbjct: 81  --TKWEKFAKEKGIQKRHRDRLVLDDATGEYVPRYG-KGSKNALDRDVILPHKESMGEDY 137

Query: 199 DQFSXXXXXXXXXXXXXXXXHRRNIEES----EAALNQTKGADA--------RSLRKGEL 246
           D F+                H  N+  +     A +N     D         + L K  L
Sbjct: 138 DPFAQKRKEKKQRIKENTKKHNSNLGRAAKGRRAQINPVHALDVGKAGPSGKKFLPKKGL 197

Query: 247 QRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFE 281
           +  +AI++ +TAS G+FD+ +  E   KL+G K+KF+
Sbjct: 198 KDSLAIAQRSTASAGRFDQKVTNEPKAKLQGRKKKFQ 234



>gi|494830191|gb|EON66757.1| hypothetical protein W97_06003 [Coniosporium apollinis CBS 100218]
          Length = 292

 Score = 91.3 bits (225), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 82/179 (45%), Gaps = 42/179 (23%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-L 72
           K  SI V +P P  +DL  L   D N L      N T++ L    RD  Q LINQ+    
Sbjct: 108 KRPSIHVTKPTPYTFDLGHLLCIDPNPL----PPNPTESVLASTARDCAQALINQLLTTC 163

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
            IT++  G    LP   T +PREK V                                  
Sbjct: 164 AITSTAEGVHLNLPAPETKLPREKAVPA-------------------------------- 191

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNK-MIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
                   T+WEKFA+ KGI+ + K   ++YDEA+GEWVP+WGYKG N +G NDWL+ V
Sbjct: 192 ----AKEPTKWEKFAQKKGIKDKKKEGKLVYDEASGEWVPKWGYKGKNKEGENDWLVEV 246



>gi|449683816|ref|XP_002164297.2| PREDICTED: ribosome biogenesis regulatory protein homolog [Hydra
           magnipapillata]
          Length = 335

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 125/284 (44%), Gaps = 53/284 (18%)

Query: 13  SKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKL 72
           SK+KSI V + +    DL  L   D   ++   LK+ ++ +L E  RD  QLL NQI+KL
Sbjct: 21  SKFKSIDVFKEVDPVIDLGNLLLLDLQPVNSDELKSKSEQFLIELARDNAQLLFNQIWKL 80

Query: 73  PITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXX 132
           PI   D   LA+LPE  T++                                        
Sbjct: 81  PIERVDNIVLAKLPEPSTLL------------------------------------PREK 104

Query: 133 XXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ 192
                   T+WE +AK KGI+ + +++M++DE +  W PR GYK T  D   +W I VPQ
Sbjct: 105 PIPKPKPPTKWEIYAKKKGIEKKKRSRMLWDEESKTWKPRHGYKRTK-DDTKEWCIEVPQ 163

Query: 193 NDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR--------KG 244
           N DP EDQF                    NI     A N  KG    SL+        K 
Sbjct: 164 NADPNEDQFEKKEIAKKERVAKNEIKRLGNI-----ARNTKKGT-VSSLQFKPTLEKDKT 217

Query: 245 ELQRQIAISKSATASIGKFDKTL--KGELKLKGVKRKFEPSIGD 286
            + ++I ++K +TAS+GKF   L  + E K  G KRKFE   G+
Sbjct: 218 RVSKEIDVAKLSTASMGKFQPKLPHEKENKKTGQKRKFESVSGN 261



>gi|294942683|ref|XP_002783644.1| ribosome biogenesis regulatory protein, putative [Perkinsus marinus
           ATCC 50983]
 gi|239896146|gb|EER15440.1| ribosome biogenesis regulatory protein, putative [Perkinsus marinus
           ATCC 50983]
          Length = 492

 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 86/301 (28%), Positives = 138/301 (45%), Gaps = 65/301 (21%)

Query: 2   IYFSDQLETQKSKYKSITVERPIP-LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRD 60
           +  +++L  Q+    SI +E        +L  LAAFD   +D    K+D    L+E  RD
Sbjct: 170 VTSAEELHCQEPIPHSIRIESGFTGADQNLCDLAAFDIEHIDAK--KDD----LEEIARD 223

Query: 61  GTQLLINQIFKL----------PI--TTSDLGKLAELPEQITV-IPREKPVSFYFVLYFP 107
            TQLLIN+IF L          P+  T  +  +LA  P+ + V +PREKP      L  P
Sbjct: 224 NTQLLINRIFDLRTESAGIAEGPVFATLPEATQLARQPDGLVVRLPREKP------LPKP 277

Query: 108 ENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEAT 166
           + +                              +RWEKFAK KG++ + K ++M++DE +
Sbjct: 278 KPM------------------------------SRWEKFAKEKGLEDKKKRSRMVWDETS 307

Query: 167 GEWVPRWGYKGTNGDGAN-DWLIPVPQN--DDPFEDQFSXXXXXXXXXXXXXXXXHRRNI 223
            +WVPRWG      +    +WL+ V ++  D+P+ED F+                  RN 
Sbjct: 308 KDWVPRWGPNSIKHNQEKMNWLVEVNEDRGDNPYEDPFAKQKAIEKLGQAKQKVREMRNK 367

Query: 224 EES---EAALNQTKGADARSLRKG--ELQRQIAISKSATASIGKFDKTLKGELKLKGVKR 278
            E    +     + G +  S+++G   L+  +A ++ ++AS GKFDK  K E ++   KR
Sbjct: 368 LEGVGKKMPAGISGGPELGSIKRGTINLKESLARAQKSSASSGKFDKRQKNEKEVPVAKR 427

Query: 279 K 279
           +
Sbjct: 428 R 428



>gi|302802770|ref|XP_002983139.1| hypothetical protein SELMODRAFT_179961 [Selaginella moellendorffii]
 gi|300149292|gb|EFJ15948.1| hypothetical protein SELMODRAFT_179961 [Selaginella moellendorffii]
          Length = 314

 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 116/285 (40%), Gaps = 65/285 (22%)

Query: 26  LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGT---QLLINQIFKLPITTSDLGKL 82
           L+ D+  L  FD            +D+Y ++  R G    Q L  ++F +P      G+L
Sbjct: 16  LRMDIGNLLVFDATDPGIEEASTSSDDYDEQCLRKGARAIQALAEKLFNMPSEADKYGRL 75

Query: 83  AELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTR 142
             LP   T +PREKP+                                          T+
Sbjct: 76  VILPPPTTKLPREKPLP------------------------------------KPRPPTK 99

Query: 143 WEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ---NDDPFED 199
           WE+FA++KGI+ R ++K+ +DE  GEW  R+GYK      A++  IPV +    D+P ED
Sbjct: 100 WEQFAQSKGIKKRKRSKLDFDEDAGEWRRRYGYKRV----ADERDIPVIEAKSTDEPGED 155

Query: 200 QFSXXXXXXXXXXXXXXXXHRRNIEE----------------SEAALNQTKGADA-RSLR 242
            FS                  +N++                 S  AL  T  A   + L 
Sbjct: 156 PFSNMKKEKKARIEKQEKNRLQNLKHTLKVAGKSALPSTVQLSTMALPITGSAQVPKKLT 215

Query: 243 KGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEPSIG 285
           K EL      + +ATAS+GKFD+ L+GE   K  G  RKF P +G
Sbjct: 216 KDELGEIAGHASTATASVGKFDRKLEGEKPAKHAGKHRKFLPVVG 260



>gi|225714086|gb|ACO12889.1| Ribosome biogenesis regulatory protein homolog [Lepeophtheirus
           salmonis]
 gi|290462187|gb|ADD24141.1| Ribosome biogenesis regulatory protein homolog [Lepeophtheirus
           salmonis]
          Length = 343

 Score = 89.7 bits (221), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 131/297 (44%), Gaps = 68/297 (22%)

Query: 10  TQKSKYKSITV-ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQ 68
           ++KSK  S+   +RP+    DL  L  F+ N +      N  D+++K  TRD  Q+LIN+
Sbjct: 20  SKKSKGLSVLCPDRPLDQINDLGNLLGFEANEIP----VNPDDDFIKSRTRDNLQILINE 75

Query: 69  IFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXX 128
           ++ L     +   +  LP  I+ IPREKPV     L                        
Sbjct: 76  LWSLETERVEDAIVVALPPPISKIPREKPVPKEKAL------------------------ 111

Query: 129 XXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLI 188
                       T+WE +AK KGI  + K+++++++A  EWVPR+GYK    +    W++
Sbjct: 112 ------------TKWESYAKTKGIVKKKKSRLVWEDAVREWVPRFGYKKAQAEVKKTWVM 159

Query: 189 PV----PQNDDPFEDQFSXXXXXXXXXXXXXXXXHR-RNIEES---------EAALNQTK 234
            +    P ++DPFE                    HR RN+  +         EA L +T 
Sbjct: 160 ELKGNAPDSEDPFE-----KAAEEKRERIAKNEIHRLRNLARAKNVKIPSVREAVLPKTA 214

Query: 235 GADARSLRKGELQRQIAISKSATASIGKFDKTLKGEL-----KLKGVKRKFEPSIGD 286
              AR     EL R   +++ +TAS+GKF + L  ++     K  G KRKF+  + D
Sbjct: 215 ---ARKSSAQELSRAAELAQKSTASLGKFQEKLSSKVEKNVKKTPGKKRKFDALVND 268



>gi|169601654|ref|XP_001794249.1| hypothetical protein SNOG_03697 [Phaeosphaeria nodorum SN15]
 gi|160705985|gb|EAT88902.2| hypothetical protein SNOG_03697 [Phaeosphaeria nodorum SN15]
          Length = 223

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 66/139 (47%), Gaps = 38/139 (27%)

Query: 54  LKEYTRDGTQLLINQIFK-LPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFL 112
           L+   RD  Q L+NQ+     I +S  G    LP   T +PREKP+              
Sbjct: 75  LRSTARDAAQALVNQLLSTCQIKSSAEGVHLVLPSPSTPLPREKPIPAV----------- 123

Query: 113 LNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVP 171
                                       T+WE+FA  KGI+ + ++ K++YD+A+GEWVP
Sbjct: 124 -------------------------KEATKWERFAAKKGIKDKKRDGKLVYDDASGEWVP 158

Query: 172 RWGYKGTNGDGANDWLIPV 190
           +WGYKG N DG NDWL+ V
Sbjct: 159 KWGYKGKNKDGENDWLVEV 177



>gi|224082902|ref|XP_002306885.1| predicted protein [Populus trichocarpa]
 gi|222856334|gb|EEE93881.1| predicted protein [Populus trichocarpa]
          Length = 298

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 117/278 (42%), Gaps = 59/278 (21%)

Query: 27  QYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQL---LINQIFKLPITTSDLGKLA 83
           Q DL  L AFD      S + +     + E   +GT+L   +++ +F LP T    G L 
Sbjct: 2   QVDLGNLMAFDPFHHFTS-IPSARSELVAECLSNGTELVQAIVSGVFNLPSTEDIDGPLV 60

Query: 84  ELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRW 143
           +LP   T +PREK                                            TRW
Sbjct: 61  KLPPPTTKLPREK------------------------------------PLPKPKPPTRW 84

Query: 144 EKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSX 203
           E+FAKAKGI++R K+K+++DE TG W  R+GY   N D A+  +I     D+P  D F+ 
Sbjct: 85  EQFAKAKGIRNRKKDKVVWDEQTGTWKRRYGYDRVN-DDADVPIIEAKMTDEPGVDPFAK 143

Query: 204 XXXXXXXXXXXXXXXHRRNIEESEAA---------------LNQTKGADARSLRKGELQR 248
                            +N++ +  A               +  T+ A  +   K EL  
Sbjct: 144 RVAEKKERVQKNQKNQLQNLKTAAKAGALPSHVQLAATALPITGTQAAK-KKFTKDELGN 202

Query: 249 QIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEPSI 284
              ++ +ATAS GKFDK L+GE  +K +G  RKF P +
Sbjct: 203 VAGLASTATASGGKFDKKLRGEKPVKNQGKHRKFLPVV 240



>gi|307202400|gb|EFN81820.1| Ribosome biogenesis regulatory protein-like protein [Harpegnathos
           saltator]
          Length = 312

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 112/255 (43%), Gaps = 41/255 (16%)

Query: 26  LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAEL 85
           ++ DL  L   D N LDE  LK++ D YLK   R+  QLLIN++++LP    D   + +L
Sbjct: 1   MELDLGTLLVSDYNPLDEKALKSEPD-YLKNLIRNDVQLLINKVWELPRERVDGVVVVKL 59

Query: 86  PEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEK 145
           P+    +PR + +        P+ L                              T+W++
Sbjct: 60  PKPEYTLPRARAIPK------PKPL------------------------------TKWQQ 83

Query: 146 FAKAKGIQ--HRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSX 203
           FAK KGIQ   + K+K+ +DE   +W+P +GYK    +   +WL+ +    D  ++ F+ 
Sbjct: 84  FAKEKGIQTKKKGKSKLKWDEELKKWIPTYGYKRVKAEEQKEWLVEIKSGADANDNSFAK 143

Query: 204 XXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSL--RKGELQRQIAISKSATASIG 261
                            RNI +S+       G   R       +L   + I++++TAS+G
Sbjct: 144 AKEAKQERQSKNELQRLRNIAKSKNIKLPKVGLPTREYLPNSQQLSEALTIARTSTASVG 203

Query: 262 KFDKTLKGELKLKGV 276
           KF   L  E   KG+
Sbjct: 204 KFQPKLPKEKDAKGI 218



>gi|482803592|gb|EOA80717.1| hypothetical protein SETTUDRAFT_44626 [Setosphaeria turcica Et28A]
          Length = 234

 Score = 84.0 bits (206), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 77/176 (43%), Gaps = 44/176 (25%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           +TV +P P  +DL  L A D N +         +  L    RD  Q L+NQ+     + +
Sbjct: 55  VTVNKPTPFTFDLGNLLANDPNPVPAGA----DEETLAATARDAAQALVNQLLSTCQVKS 110

Query: 77  SDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXX 136
           +  G    LP   T +PREKP+                                      
Sbjct: 111 TTEGVHLLLPAPTTPLPREKPIP------------------------------------A 134

Query: 137 XXXXTRWEKFAKAKGI--QHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
               T+WEKFA  KGI  Q R+ N ++YDE  GEWVP+WGYKG N DG NDWL+ V
Sbjct: 135 AKEPTKWEKFAAKKGIKKQKRDSN-LVYDETKGEWVPKWGYKGKNKDGENDWLVEV 189



>gi|361130206|gb|EHL02060.1| putative Regulator of ribosome biosynthesis [Glarea lozoyensis
           74030]
          Length = 188

 Score = 84.0 bits (206), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 75/176 (42%), Gaps = 54/176 (30%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTS 77
           +TV +P P  +DL LL A D N L  +   N  D+ L    RD +              +
Sbjct: 17  VTVNKPTPYTFDLGLLLATDPNPLVLTSKANLEDD-LAATARDAS--------------T 61

Query: 78  DLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXX 137
             G L  LP   T +PREKP+                                       
Sbjct: 62  PNGVLLSLPAIETSLPREKPLP------------------------------------PP 85

Query: 138 XXXTRWEKFAKAKGIQHRN---KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 190
              T W+KFA  KGI+ +    K KM+YDEATGEWVP+WGYKG N  G NDW++ V
Sbjct: 86  KAQTTWQKFAAKKGIKPKTAEEKKKMVYDEATGEWVPKWGYKGKNKAGENDWIVEV 141



>gi|294888421|ref|XP_002772457.1| ribosome biogenesis regulatory protein, putative [Perkinsus marinus
           ATCC 50983]
 gi|239876683|gb|EER04273.1| ribosome biogenesis regulatory protein, putative [Perkinsus marinus
           ATCC 50983]
          Length = 319

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 131/288 (45%), Gaps = 69/288 (23%)

Query: 19  TVERPIP-----LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKL- 72
           T+  P P     L Y L  LAAFD + +D  +      + ++E  RD TQLLIN+IF L 
Sbjct: 5   TLRSPYPSKEDNLSYQLCDLAAFDIDHIDAKK------DDIEEIARDNTQLLINRIFDLR 58

Query: 73  ---------PI--TTSDLGKLAELPEQITV-IPREKPVSFYFVLYFPENLFLLNLSHILV 120
                    P+  T  +  +LA  P+ + V +PREKP      L  P+ +          
Sbjct: 59  TESAGIAEGPVFATLPEATQLARQPDGLVVRLPREKP------LPKPKPM---------- 102

Query: 121 SRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRN-KNKMIYDEATGEWVPRWGYKGTN 179
                               TRWEKFAK KG+  +  +++M++DE + +WVPRWG     
Sbjct: 103 --------------------TRWEKFAKDKGLDDKKKRSRMVWDETSKDWVPRWGPNSIK 142

Query: 180 GDGAN-DWLIPVPQN--DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---EAALNQT 233
            +    +WL+ V ++  D+P+ED F+                  RN  E    +     +
Sbjct: 143 HNQEKMNWLVEVNEDRGDNPYEDPFAKQKAIEKLGHAKQKVREMRNKLEGVGKKMPAGIS 202

Query: 234 KGADARSLRKG--ELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 279
            G +  S+++G   L+  +A ++ ++AS GKFDK  K E ++   KR+
Sbjct: 203 GGPELGSIKRGTINLKESLARAQKSSASSGKFDKRQKNEREVPVTKRR 250



>gi|470101771|ref|XP_004287342.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Fragaria
           vesca subsp. vesca]
          Length = 344

 Score = 83.6 bits (205), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 87/283 (30%), Positives = 115/283 (40%), Gaps = 65/283 (22%)

Query: 26  LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQL---LINQIFKLPITTSDLGKL 82
            Q DL  L A D +    S   +  D  +KE    GT+L   + N +F LP T    G L
Sbjct: 8   FQIDLGNLMAVDLHHQFPSNPSSRED-LVKECIAKGTELVQAIANNLFNLPSTEDIEGTL 66

Query: 83  AELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTR 142
            +LP   T +PREK                    HI   +                  T+
Sbjct: 67  VKLPAPTTRLPREK--------------------HIPKPK----------------PPTK 90

Query: 143 WEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDW----LIPVPQNDDPFE 198
           WE FA+ KGI++R K+K+ YDE +  W  R+GY     D AND     +I     D P E
Sbjct: 91  WEVFAQKKGIKNRKKDKIAYDEPSETWKRRYGY-----DRANDEDDVPIIEAKMTDVPGE 145

Query: 199 DQFSXXXXXXXXXXXXXXXXHRRNIEE--------SEAALNQTK------GADARSLRKG 244
           D F+                  +N+++        S   L  T+       A  + + K 
Sbjct: 146 DPFAKRREAKKNRVEKQDKNRLQNLKQAAKVGALPSHVQLAATRLPITGTQAAPQKVTKD 205

Query: 245 ELQRQIAISKSATASIGKFDKTLKGEL--KLKGVKRKFEPSIG 285
           EL     I+ +ATAS GKFDK L GE   K KG  RKF P IG
Sbjct: 206 ELGSVAGIAATATASGGKFDKKLPGEKPGKHKGKYRKFLPVIG 248



>gi|256081805|ref|XP_002577158.1| ribosome biogenesis regulatory protein [Schistosoma mansoni]
 gi|350645735|emb|CCD59497.1| ribosome biogenesis regulatory protein,putative [Schistosoma
           mansoni]
          Length = 226

 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 98/233 (42%), Gaps = 52/233 (22%)

Query: 39  NALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQITVIPREKPV 98
           N  +E+    D D+Y +  + D T       F+LP   +D   ++ LP+    +PREK +
Sbjct: 24  NQFNEAVSSLDDDHY-RTISLDCTYHFFKLFFELPTELNDSVSVSILPKPTFRLPREKKI 82

Query: 99  SFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKN 158
                                                     TRW++FA+ KGIQ+R K+
Sbjct: 83  P------------------------------------SAKELTRWDRFARLKGIQNRKKS 106

Query: 159 KMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXX 218
           + ++D  +  W PRWG K    D  + W++ VP N DP+EDQF+                
Sbjct: 107 RKVWDPVSESWKPRWG-KDRIDDVKDKWVLEVPDNADPYEDQFAKLIQAKKERRAKNELQ 165

Query: 219 HRRNIEESEAA--------LNQTKGADARSLRKGELQRQIAISKSATASIGKF 263
             RNI  +  A        L +++ +      K EL R  AI++++ AS+G+F
Sbjct: 166 RLRNIARTVKAGQAPPIGVLTESQSS------KTELSRAFAIAQNSDASMGRF 212



>gi|256081807|ref|XP_002577159.1| ribosome biogenesis regulatory protein [Schistosoma mansoni]
 gi|350645734|emb|CCD59496.1| ribosome biogenesis regulatory protein,putative [Schistosoma
           mansoni]
          Length = 268

 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 94/221 (42%), Gaps = 51/221 (23%)

Query: 51  DNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENL 110
           D++ +  + D T       F+LP   +D   ++ LP+    +PREK +     L      
Sbjct: 35  DDHYRTISLDCTYHFFKLFFELPTELNDSVSVSILPKPTFRLPREKKIPSAKEL------ 88

Query: 111 FLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWV 170
                                         TRW++FA+ KGIQ+R K++ ++D  +  W 
Sbjct: 89  ------------------------------TRWDRFARLKGIQNRKKSRKVWDPVSESWK 118

Query: 171 PRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA- 229
           PRWG K    D  + W++ VP N DP+EDQF+                  RNI  +  A 
Sbjct: 119 PRWG-KDRIDDVKDKWVLEVPDNADPYEDQFAKLIQAKKERRAKNELQRLRNIARTVKAG 177

Query: 230 -------LNQTKGADARSLRKGELQRQIAISKSATASIGKF 263
                  L +++ +      K EL R  AI++++ AS+G+F
Sbjct: 178 QAPPIGVLTESQSS------KTELSRAFAIAQNSDASMGRF 212



>gi|302764948|ref|XP_002965895.1| hypothetical protein SELMODRAFT_66767 [Selaginella moellendorffii]
 gi|300166709|gb|EFJ33315.1| hypothetical protein SELMODRAFT_66767 [Selaginella moellendorffii]
          Length = 249

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 98/242 (40%), Gaps = 56/242 (23%)

Query: 63  QLLINQIFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSR 122
           Q L  ++F +P      G+L  LP   T +PREKP+                        
Sbjct: 12  QALAEKLFNMPSEADKYGRLVILPPPTTKLPREKPLP----------------------- 48

Query: 123 NXXXXXXXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDG 182
                             T+WE+FA++KGI+ R ++K+ +DE  GEW  R+GYK    D 
Sbjct: 49  -------------KPRPPTKWEQFAQSKGIKKRKRSKLDFDEDAGEWRRRYGYKRV-ADE 94

Query: 183 ANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE----------------S 226
            +  +I     D+P ED FS                  +N++                 S
Sbjct: 95  RDIPVIEAKSTDEPGEDPFSNMKKEKKARIEKQEKNRLQNLKHTLKVAGKSALPSTVQLS 154

Query: 227 EAALNQTKGADA-RSLRKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEPS 283
             AL  T  A   + L K EL      + +ATAS+GKFD+ L+GE   K  G  RKF P 
Sbjct: 155 TMALPITGSAQVPKKLTKDELGEIAGHASTATASVGKFDRKLEGEKPAKHAGKHRKFLPV 214

Query: 284 IG 285
           +G
Sbjct: 215 VG 216



>gi|380018284|ref|XP_003693062.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Apis
           florea]
          Length = 339

 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 122/275 (44%), Gaps = 40/275 (14%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQI 69
           T++   ++  V + I ++ DL  L A D N LD   +K+  + YLK  TRD  Q+LIN+I
Sbjct: 15  TEEKDTRTTIVNKDIEVETDLGTLLALDYNNLDLKAIKSQPEEYLKSLTRDNVQILINKI 74

Query: 70  FKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXX 129
           ++LP    D   +A+LP+Q  ++PR + +        P+ L                   
Sbjct: 75  WELPTERIDEVIVAKLPKQKFILPRSRQIPK------PKPL------------------- 109

Query: 130 XXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMI--YDEATGEWVPRWGYKGTNGDGANDWL 187
                      T+W++FAK KGI+ + K+K    +DE   +W+P +GYK        +WL
Sbjct: 110 -----------TKWQQFAKEKGIKSKKKSKSKLKWDEELQKWIPTFGYKRNKAIEQKEWL 158

Query: 188 IPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARS--LRKGE 245
           + V       ED F+                   NI +++       G   +       +
Sbjct: 159 VEVNDEGKAMEDPFAAAKMAKEERKSKNELQRLHNIAKAKNIKIPKVGLPTKEHFSDSQQ 218

Query: 246 LQRQIAISKSATASIGKFDKTLKGELKLKGVKRKF 280
           L + + I++++TAS+GKF   L  E   KG+ ++ 
Sbjct: 219 LSQAVTIARTSTASLGKFQDRLPKEKDAKGIAKQV 253



>gi|290562752|gb|ADD38771.1| Ribosome biogenesis regulatory protein homolog [Lepeophtheirus
           salmonis]
          Length = 262

 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 121/279 (43%), Gaps = 54/279 (19%)

Query: 10  TQKSKYKSITV-ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQ 68
           ++KSK  S+   +RP+    DL  L  F+ N +      N  D+++   TRD  Q+LIN+
Sbjct: 20  SKKSKGLSVLCPDRPLDQINDLGNLLGFEANEIP----VNPDDDFIISRTRDNLQILINE 75

Query: 69  IFKLPITTSDLGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXX 128
           ++ L     +   +  LP  I+ IPREKPV     L                        
Sbjct: 76  LWSLETERVEDAIVVVLPPPISKIPREKPVPKEKAL------------------------ 111

Query: 129 XXXXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLI 188
                       T+WE +AK KGI  + K+++++++A  EWVPR+GYK    +    W++
Sbjct: 112 ------------TKWESYAKTKGIVKKKKSRLVWEDAVREWVPRFGYKKAQAEVKKTWVM 159

Query: 189 PVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES---------EAALNQTKGADAR 239
            +  N    ED F                   RN+  +         EA L +T    AR
Sbjct: 160 ELKGNAPDSEDPFEKAAEEKRERIAKNEIHRLRNLARAKNVKIPSVREAVLPKTA---AR 216

Query: 240 SLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKR 278
                EL R   +++ +TAS+GKF + L  +++ K VK+
Sbjct: 217 KSSAQELSRAAELAQKSTASLGKFQEKLSSKVE-KNVKK 254



>gi|56753555|gb|AAW24980.1| SJCHGC02140 protein [Schistosoma japonicum]
          Length = 216

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 71/135 (52%), Gaps = 15/135 (11%)

Query: 141 TRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQ 200
           T+W+KFA+ KGIQ+R K++ ++D  +  W PRWG K    D  + W++ VP N DP+EDQ
Sbjct: 37  TKWDKFARLKGIQNRKKSRKVWDPVSESWKPRWG-KDRVDDVKDKWVLEVPDNADPYEDQ 95

Query: 201 FSXXXXXXXXXXXXXXXXHRRNIEESEAA--------LNQTKGADARSLRKGELQRQIAI 252
           F+                  RNI  +  A        L +++ +      K EL R ++I
Sbjct: 96  FAKLSQAKKERRAKNELQRLRNIARTVKAGQAPPIGVLTESQSS------KAELSRALSI 149

Query: 253 SKSATASIGKFDKTL 267
           ++++ AS+G+F   L
Sbjct: 150 AQNSDASMGRFSTPL 164



>gi|297745415|emb|CBI40495.3| unnamed protein product [Vitis vinifera]
          Length = 328

 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 118/278 (42%), Gaps = 59/278 (21%)

Query: 27  QYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGT---QLLINQIFKLPITTSDLGKLA 83
           Q DL  L AFD      S      +  +KE  + GT   QL+ + +F LP T    G L 
Sbjct: 7   QIDLGHLMAFDPLHHFPSP-PTSREELVKECLQKGTVLVQLIADALFNLPSTEDIDGPLV 65

Query: 84  ELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRW 143
           +LP  +T +PREK        + P+                                T+W
Sbjct: 66  KLPPPMTRLPREK--------HLPK----------------------------PKPPTKW 89

Query: 144 EKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSX 203
           E FAKAKGI++R K+K++YDE TG W  R GY   N D  +  +I     D+P ED F  
Sbjct: 90  ELFAKAKGIKNRKKDKIVYDEQTGTWKRRHGYDRVN-DDKDIPIIEAKMTDEPGEDPFVK 148

Query: 204 XXXXXXXXXXXXXXXHRRNIEESEAA---------------LNQTKGADARSLRKGELQR 248
                            +N++++                  +  T+ A  ++  K ELQ 
Sbjct: 149 RQAEKKKRVEKHEKNRLQNLKQAAKVGALPSHIQLAATALPITGTQAAPKKA-SKNELQD 207

Query: 249 QIAISKSATASIGKFDKTLKGEL--KLKGVKRKFEPSI 284
             +++ +ATAS GKFDK L GE   K KG  RKF P +
Sbjct: 208 IASMAAAATASGGKFDKKLVGEKPEKHKGKYRKFLPVV 245



>gi|357445849|ref|XP_003593202.1| Ribosome biogenesis regulatory protein-like protein [Medicago
           truncatula]
 gi|355482250|gb|AES63453.1| Ribosome biogenesis regulatory protein-like protein [Medicago
           truncatula]
          Length = 327

 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 115/284 (40%), Gaps = 73/284 (25%)

Query: 26  LQYDLALLAAFDTN----ALDESRLKNDTDNYLKEYTRDGTQL---LINQIFKLPITTSD 78
            + DL  L A D++       +SR++      +KE  + GT+L   + + +F LP T   
Sbjct: 8   FEVDLGNLMALDSHHSYYPSQQSRVE-----LVKECLQKGTELVQAIADSLFILPSTQDV 62

Query: 79  LGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXX 138
            G L +LP   T +PREK        + P                               
Sbjct: 63  EGPLVQLPAPSTRLPREK--------HLPR----------------------------PK 86

Query: 139 XXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDW----LIPVPQND 194
             T+W++FAK KGI +RNK+K +YD+ +G W  R GY     D AND     +I     D
Sbjct: 87  PPTKWDEFAKKKGIINRNKDKQVYDDQSGTWKRRHGY-----DRANDEEAIPIIEAKPTD 141

Query: 195 DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE--AALNQTKGADARSL----------- 241
           DP ED F+                  +N++ +    AL       A SL           
Sbjct: 142 DPDEDPFAKRKENKRGRVDKNEKNRIQNLKNAAKFGALPSHVQLAATSLPITGTHVPQKK 201

Query: 242 -RKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEP 282
             K EL      + +ATAS GKFDK L GE   K KG  RKF P
Sbjct: 202 VTKDELGSVAGFASTATASGGKFDKKLPGEKPPKHKGKNRKFLP 245



>gi|225454487|ref|XP_002281065.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Vitis
           vinifera]
          Length = 331

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 118/278 (42%), Gaps = 59/278 (21%)

Query: 27  QYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGT---QLLINQIFKLPITTSDLGKLA 83
           Q DL  L AFD      S      +  +KE  + GT   QL+ + +F LP T    G L 
Sbjct: 10  QIDLGHLMAFDPLHHFPSP-PTSREELVKECLQKGTVLVQLIADALFNLPSTEDIDGPLV 68

Query: 84  ELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRW 143
           +LP  +T +PREK        + P+                                T+W
Sbjct: 69  KLPPPMTRLPREK--------HLPK----------------------------PKPPTKW 92

Query: 144 EKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSX 203
           E FAKAKGI++R K+K++YDE TG W  R GY   N D  +  +I     D+P ED F  
Sbjct: 93  ELFAKAKGIKNRKKDKIVYDEQTGTWKRRHGYDRVN-DDKDIPIIEAKMTDEPGEDPFVK 151

Query: 204 XXXXXXXXXXXXXXXHRRNIEESEAA---------------LNQTKGADARSLRKGELQR 248
                            +N++++                  +  T+ A  ++  K ELQ 
Sbjct: 152 RQAEKKKRVEKHEKNRLQNLKQAAKVGALPSHIQLAATALPITGTQAAPKKA-SKNELQD 210

Query: 249 QIAISKSATASIGKFDKTLKGEL--KLKGVKRKFEPSI 284
             +++ +ATAS GKFDK L GE   K KG  RKF P +
Sbjct: 211 IASMAAAATASGGKFDKKLVGEKPEKHKGKYRKFLPVV 248



>gi|357445851|ref|XP_003593203.1| Ribosome biogenesis regulatory protein-like protein [Medicago
           truncatula]
 gi|355482251|gb|AES63454.1| Ribosome biogenesis regulatory protein-like protein [Medicago
           truncatula]
          Length = 280

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 115/284 (40%), Gaps = 73/284 (25%)

Query: 26  LQYDLALLAAFDTN----ALDESRLKNDTDNYLKEYTRDGTQL---LINQIFKLPITTSD 78
            + DL  L A D++       +SR++      +KE  + GT+L   + + +F LP T   
Sbjct: 8   FEVDLGNLMALDSHHSYYPSQQSRVE-----LVKECLQKGTELVQAIADSLFILPSTQDV 62

Query: 79  LGKLAELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXX 138
            G L +LP   T +PREK        + P                               
Sbjct: 63  EGPLVQLPAPSTRLPREK--------HLPR----------------------------PK 86

Query: 139 XXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDW----LIPVPQND 194
             T+W++FAK KGI +RNK+K +YD+ +G W  R GY     D AND     +I     D
Sbjct: 87  PPTKWDEFAKKKGIINRNKDKQVYDDQSGTWKRRHGY-----DRANDEEAIPIIEAKPTD 141

Query: 195 DPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE--AALNQTKGADARSL----------- 241
           DP ED F+                  +N++ +    AL       A SL           
Sbjct: 142 DPDEDPFAKRKENKRGRVDKNEKNRIQNLKNAAKFGALPSHVQLAATSLPITGTHVPQKK 201

Query: 242 -RKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEP 282
             K EL      + +ATAS GKFDK L GE   K KG  RKF P
Sbjct: 202 VTKDELGSVAGFASTATASGGKFDKKLPGEKPPKHKGKNRKFLP 245



>gi|444724065|gb|ELW64686.1| Ribosome biogenesis regulatory protein like protein [Tupaia
           chinensis]
          Length = 327

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 71/145 (48%), Gaps = 13/145 (8%)

Query: 150 KGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXX 209
           +GI+ + K  +++DE +G+W  RWGY+    D   +WLI VP   DP EDQF+       
Sbjct: 83  RGIRPKKKTNLVWDEESGQWRRRWGYQRAR-DDTKEWLIEVPGGADPMEDQFAKRIQAKK 141

Query: 210 XXXXXXXXXHRRNIEESE------AALNQTKGADARSLRKGELQRQIAISKSATASIGKF 263
                      RN+  +       AA     G  +    K EL R + ++K +TAS+G+F
Sbjct: 142 ERVAKNELNRLRNLARAHKMQLPSAAGMHPTGHQS----KEELGRAMEVAKVSTASVGRF 197

Query: 264 DKTLKGELKLKGV--KRKFEPSIGD 286
            + L  E   +G   KRKF+P  GD
Sbjct: 198 QERLPKEKAPRGSGKKRKFQPLFGD 222



>gi|147832302|emb|CAN77790.1| hypothetical protein VITISV_033191 [Vitis vinifera]
          Length = 327

 Score = 73.9 bits (180), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 116/278 (41%), Gaps = 60/278 (21%)

Query: 27  QYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGT---QLLINQIFKLPITTSDLGKLA 83
           Q DL  L AFD      S      +  +KE  + GT   QL+ + +F LP T    G L 
Sbjct: 7   QIDLGHLMAFDPLHHFPS-PPTSREELVKECLQKGTVLVQLIADALFNLPSTEDIDGPLV 65

Query: 84  ELPEQITVIPREKPVSFYFVLYFPENLFLLNLSHILVSRNXXXXXXXXXXXXXXXXXTRW 143
           +LP  +T +PREK        + P+                                T+W
Sbjct: 66  KLPPPMTRLPREK--------HLPK----------------------------PKPPTKW 89

Query: 144 EKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSX 203
           E FAKAKGI++R K+K++YDE TG W  R GY   N D   D  I   +  D  ED F  
Sbjct: 90  ELFAKAKGIKNRKKDKIVYDEQTGTWKRRHGYDRVNDD--KDJPIIEAKMTDAGEDPFXK 147

Query: 204 XXXXXXXXXXXXXXXHRRNIEESEAA---------------LNQTKGADARSLRKGELQR 248
                            +N++++                  +  T+ A  ++  K ELQ 
Sbjct: 148 RQAEKKKRVEKHEKNRLQNLKQAAKVGALPSHIQLAATALPITGTQAAPKKA-SKNELQD 206

Query: 249 QIAISKSATASIGKFDKTLKGEL--KLKGVKRKFEPSI 284
             +++ +ATAS GKFDK L GE   K KG  RKF P +
Sbjct: 207 IASMAAAATASGGKFDKKLVGEKPEKHKGKYRKFLPVV 244



>gi|410041938|ref|XP_003311861.2| PREDICTED: LOW QUALITY PROTEIN: ribosome biogenesis regulatory
           protein homolog, partial [Pan troglodytes]
          Length = 378

 Score = 73.6 bits (179), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 72/150 (48%), Gaps = 15/150 (10%)

Query: 146 FAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXX 205
           FA+ K I+ + K  ++ D+ + +W  RWGY+    D   +WLI VP N DP EDQF+   
Sbjct: 130 FARLKSIRLKKKTNLVXDDMSSQWRRRWGYQ-CGRDDTKEWLIEVPGNADPLEDQFAKRI 188

Query: 206 XXXXXXXXXXXXXHRRNIEE-------SEAALNQTKGADARSLRKGELQRQIAISKSATA 258
                          RN+         S A L+ T         K EL R + ++K +TA
Sbjct: 189 QAKKERVAKNELNRLRNLARAHKMQLPSAAGLHPTGHQS-----KEELGRAMQVAKVSTA 243

Query: 259 SIGKFDKTLKGELKLKGV--KRKFEPSIGD 286
           S+G++ + L  E   +G   KRKF+P  GD
Sbjct: 244 SVGRYQERLPKEKAPRGSGKKRKFQPLFGD 273