BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10334_c0_seq3-m.122 5prime_partial 2-862(+) 287 (+)
         (286 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511005017|gb|EPB86370.1| hypothetical protein HMPREF1544_0681...   253   3e-65   Mucor circinelloides f. circinelloides 1006PhL
gi|299748190|ref|XP_001837530.2| hypothetical protein CC1G_01442...   177   2e-42   Coprinopsis cinerea okayama7#130
gi|242221362|ref|XP_002476431.1| predicted protein [Postia place...   177   4e-42   Postia placenta Mad-698-R
gi|401881581|gb|EJT45879.1| ribosome biogenesis-related protein ...   176   9e-42   Trichosporon asahii var. asahii CBS 2479
gi|406696596|gb|EKC99878.1| ribosome biogenesis-related protein ...   176   9e-42   Trichosporon asahii var. asahii CBS 8904
gi|392568457|gb|EIW61631.1| RRS1-domain-containing protein [Tram...   175   1e-41   Trametes versicolor FP-101664 SS1
gi|164659472|ref|XP_001730860.1| hypothetical protein MGL_1859 [...   171   1e-40   Malassezia globosa CBS 7966
gi|260801679|ref|XP_002595723.1| hypothetical protein BRAFLDRAFT...   169   6e-40   Branchiostoma floridae
gi|505757196|gb|EOR01322.1| Regulator of ribosome biosynthesi [W...   169   8e-40   Wallemia ichthyophaga EXF-994
gi|403413739|emb|CCM00439.1| predicted protein [Fibroporia radic...   169   9e-40   Fibroporia radiculosa
gi|340368757|ref|XP_003382917.1| PREDICTED: ribosome biogenesis ...   166   4e-39   Amphimedon queenslandica
gi|409049634|gb|EKM59111.1| hypothetical protein PHACADRAFT_2493...   166   6e-39   Phanerochaete carnosa HHB-10118-sp
gi|388584012|gb|EIM24313.1| RRS1-domain-containing protein [Wall...   166   7e-39   Wallemia mellicola CBS 633.66
gi|353237099|emb|CCA69080.1| related to RRS1-regulator of riboso...   166   8e-39   Serendipita indica DSM 11827
gi|443900152|dbj|GAC77479.1| regulator of ribosome synthesis [Ps...   165   2e-38   Moesziomyces antarcticus T-34
gi|72010693|ref|XP_781111.1| PREDICTED: ribosome biogenesis regu...   163   6e-38   Strongylocentrotus purpuratus [purple urchin]
gi|390601451|gb|EIN10845.1| RRS1-domain-containing protein [Punc...   160   5e-37   Punctularia strigosozonata HHB-11173 SS5
gi|198435348|ref|XP_002125582.1| PREDICTED: ribosome biogenesis ...   160   5e-37   Ciona intestinalis [sea vase]
gi|501309512|dbj|GAC98336.1| likely ribosome biogenesis regulato...   159   7e-37   Pseudozyma hubeiensis SY62
gi|392579956|gb|EIW73083.1| hypothetical protein TREMEDRAFT_2289...   159   7e-37   Tremella mesenterica DSM 1558
gi|472588228|gb|EMS25700.1| ribosomal biogenesis regulatory prot...   159   9e-37   Rhodotorula toruloides NP11
gi|402226300|gb|EJU06360.1| RRS1-domain-containing protein [Dacr...   159   1e-36   Dacryopinax primogenitus
gi|465793145|emb|CCU98266.1| unnamed protein product [Malassezia...   159   1e-36   Malassezia sympodialis ATCC 42132
gi|71021335|ref|XP_760898.1| hypothetical protein UM04751.1 [Ust...   158   1e-36   
gi|328770705|gb|EGF80746.1| hypothetical protein BATDEDRAFT_6086...   158   2e-36   Batrachochytrium dendrobatidis JAM81
gi|471908923|emb|CCO28186.1| Ribosome biogenesis regulatory prot...   158   2e-36   Rhizoctonia solani AG-1 IB
gi|393246467|gb|EJD53976.1| RRS1-domain-containing protein [Auri...   157   2e-36   Auricularia subglabra TFB-10046 SS5
gi|443927102|gb|ELU45633.1| RRS1 domain-containing protein [Rhiz...   155   9e-36   Rhizoctonia solani AG-1 IA
gi|195998666|ref|XP_002109201.1| hypothetical protein TRIADDRAFT...   153   6e-35   Trichoplax adhaerens
gi|58262216|ref|XP_568518.1| ribosome biogenesis-related protein...   152   8e-35   Cryptococcus neoformans var. neoformans JEC21
gi|343426175|emb|CBQ69706.1| related to RRS1-regulator of riboso...   152   1e-34   Sporisorium reilianum SRZ2
gi|388857200|emb|CCF49213.1| related to RRS1-regulator of riboso...   150   3e-34   Ustilago hordei
gi|391340812|ref|XP_003744730.1| PREDICTED: ribosome biogenesis ...   150   5e-34   Metaseiulus occidentalis
gi|358057274|dbj|GAA96883.1| hypothetical protein E5Q_03556 [Mix...   149   7e-34   Mixia osmundae IAM 14324
gi|302691982|ref|XP_003035670.1| hypothetical protein SCHCODRAFT...   149   1e-33   Schizophyllum commune H4-8
gi|170090662|ref|XP_001876553.1| predicted protein [Laccaria bic...   148   2e-33   Laccaria bicolor S238N-H82
gi|170044045|ref|XP_001849672.1| regulator of ribosome biosynthe...   147   2e-33   Culex quinquefasciatus
gi|336373761|gb|EGO02099.1| hypothetical protein SERLA73DRAFT_13...   147   3e-33   Serpula lacrymans var. lacrymans S7.3
gi|432927905|ref|XP_004081085.1| PREDICTED: ribosome biogenesis ...   147   3e-33   Oryzias latipes [Japanese rice fish]
gi|395849345|ref|XP_003797289.1| PREDICTED: ribosome biogenesis ...   145   1e-32   Otolemur garnettii
gi|507938408|ref|XP_004679889.1| PREDICTED: ribosome biogenesis ...   145   2e-32   Condylura cristata
gi|328858583|gb|EGG07695.1| hypothetical protein MELLADRAFT_6250...   145   2e-32   Melampsora larici-populina 98AG31
gi|403164650|ref|XP_003324729.2| hypothetical protein PGTG_06266...   144   3e-32   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|426359826|ref|XP_004047162.1| PREDICTED: ribosome biogenesis ...   144   4e-32   Gorilla gorilla gorilla [lowland gorilla]
gi|297682996|ref|XP_002819191.1| PREDICTED: ribosome biogenesis ...   142   7e-32   
gi|14719402|ref|NP_055984.1| ribosome biogenesis regulatory prot...   142   8e-32   Homo sapiens [man]
gi|434779|dbj|BAA04948.1| KIAA0112 [Homo sapiens]                     142   9e-32   
gi|344304506|gb|EGW34738.1| hypothetical protein SPAPADRAFT_5780...   142   9e-32   Spathaspora passalidarum NRRL Y-27907
gi|189230132|ref|NP_001121390.1| uncharacterized protein LOC1001...   142   9e-32   
gi|471364113|ref|XP_004372607.1| PREDICTED: ribosome biogenesis ...   142   1e-31   Trichechus manatus latirostris
gi|321463110|gb|EFX74128.1| hypothetical protein DAPPUDRAFT_3074...   142   1e-31   Daphnia pulex
gi|157131695|ref|XP_001662293.1| ribosome biogenesis regulatory ...   142   1e-31   Aedes aegypti
gi|397522742|ref|XP_003831415.1| PREDICTED: ribosome biogenesis ...   142   1e-31   Pan paniscus [bonobo]
gi|227908779|ref|NP_067486.2| ribosome biogenesis regulatory pro...   142   1e-31   Mus musculus [mouse]
gi|7670442|dbj|BAA95072.1| unnamed protein product [Mus musculus]     141   2e-31   Mus musculus [mouse]
gi|357608815|gb|EHJ66162.1| putative regulator of ribosome biosy...   141   2e-31   Danaus plexippus [American monarch]
gi|49022822|dbj|BAC65489.2| mKIAA0112 protein [Mus musculus]          141   2e-31   Mus musculus [mouse]
gi|348588476|ref|XP_003479992.1| PREDICTED: ribosome biogenesis ...   141   2e-31   Cavia porcellus [guinea pig]
gi|12860310|dbj|BAB31912.1| unnamed protein product [Mus musculus]    141   2e-31   Mus musculus [mouse]
gi|431891814|gb|ELK02348.1| Ribosome biogenesis regulatory prote...   140   3e-31   Pteropus alecto
gi|507538708|ref|XP_004653370.1| PREDICTED: ribosome biogenesis ...   140   3e-31   Jaculus jaculus
gi|440908356|gb|ELR58380.1| Ribosome biogenesis regulatory prote...   140   3e-31   Bos mutus
gi|443689971|gb|ELT92238.1| hypothetical protein CAPTEDRAFT_1714...   140   3e-31   Capitella teleta
gi|296226606|ref|XP_002759025.1| PREDICTED: ribosome biogenesis ...   140   3e-31   
gi|344273133|ref|XP_003408381.1| PREDICTED: ribosome biogenesis ...   140   4e-31   Loxodonta africana [African bush elephant]
gi|470644583|ref|XP_004326595.1| PREDICTED: LOW QUALITY PROTEIN:...   140   4e-31   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|466034379|ref|XP_004275011.1| PREDICTED: ribosome biogenesis ...   140   4e-31   Orcinus orca [Orca]
gi|512818753|ref|XP_004878921.1| PREDICTED: ribosome biogenesis ...   140   4e-31   
gi|311253771|ref|XP_003125652.1| PREDICTED: ribosome biogenesis ...   140   5e-31   Sus scrofa [pigs]
gi|348512152|ref|XP_003443607.1| PREDICTED: ribosome biogenesis ...   140   5e-31   
gi|498967615|ref|XP_004546707.1| PREDICTED: ribosome biogenesis ...   139   6e-31   Maylandia zebra
gi|149721357|ref|XP_001494863.1| PREDICTED: ribosome biogenesis ...   139   6e-31   Equus caballus [domestic horse]
gi|488584946|ref|XP_004477844.1| PREDICTED: ribosome biogenesis ...   139   7e-31   Dasypus novemcinctus
gi|109086632|ref|XP_001100635.1| PREDICTED: ribosome biogenesis ...   139   1e-30   
gi|472365593|ref|XP_004402349.1| PREDICTED: ribosome biogenesis ...   139   1e-30   Odobenus rosmarus divergens
gi|296480600|tpg|DAA22715.1| TPA: ribosome biogenesis regulatory...   139   1e-30   Bos taurus [bovine]
gi|12845436|dbj|BAB26750.1| unnamed protein product [Mus musculus]    139   1e-30   Mus musculus [mouse]
gi|478523202|ref|XP_004435804.1| PREDICTED: ribosome biogenesis ...   139   1e-30   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|119226200|ref|NP_001073167.1| ribosome biogenesis regulatory ...   139   1e-30   Rattus norvegicus [brown rat]
gi|312371076|gb|EFR19340.1| hypothetical protein AND_22646 [Anop...   138   1e-30   
gi|355697994|gb|EHH28542.1| Ribosome biogenesis regulatory prote...   138   2e-30   Macaca mulatta [rhesus macaque]
gi|355779729|gb|EHH64205.1| Ribosome biogenesis regulatory prote...   138   2e-30   Macaca fascicularis [crab eating macaque]
gi|405978850|gb|EKC43211.1| Ribosome biogenesis regulatory-like ...   138   2e-30   Crassostrea gigas
gi|291388062|ref|XP_002710493.1| PREDICTED: homolog of yeast rib...   138   2e-30   Oryctolagus cuniculus [European rabbit]
gi|115497948|ref|NP_001068949.1| ribosome biogenesis regulatory ...   138   2e-30   Bos taurus [bovine]
gi|478250752|gb|ENN71244.1| hypothetical protein YQE_12171, part...   138   2e-30   Dendroctonus ponderosae
gi|410987225|ref|XP_003999905.1| PREDICTED: ribosome biogenesis ...   138   2e-30   Felis catus [cat]
gi|409079540|gb|EKM79901.1| hypothetical protein AGABI1DRAFT_113...   138   2e-30   Agaricus bisporus var. burnettii JB137-S8
gi|198463129|ref|XP_001352703.2| GA16881 [Drosophila pseudoobscu...   137   2e-30   Drosophila pseudoobscura pseudoobscura
gi|301761996|ref|XP_002916418.1| PREDICTED: ribosome biogenesis ...   137   2e-30   Ailuropoda melanoleuca
gi|507669887|ref|XP_004649132.1| PREDICTED: LOW QUALITY PROTEIN:...   137   3e-30   Octodon degus
gi|511907155|ref|XP_004773029.1| PREDICTED: ribosome biogenesis ...   137   3e-30   Mustela putorius furo [black ferret]
gi|426192508|gb|EKV42444.1| hypothetical protein AGABI2DRAFT_195...   137   4e-30   Agaricus bisporus var. bisporus H97
gi|444318922|ref|XP_004180118.1| hypothetical protein TBLA_0D009...   137   4e-30   Tetrapisispora blattae CBS 6284
gi|126137852|ref|XP_001385449.1| hypothetical protein PICST_6158...   137   5e-30   Scheffersomyces stipitis CBS 6054
gi|57107921|ref|XP_544107.1| PREDICTED: ribosome biogenesis regu...   136   5e-30   
gi|164448678|ref|NP_001088404.1| RRS1 ribosome biogenesis regula...   136   6e-30   Xenopus laevis [clawed frog]
gi|504151475|ref|XP_004588076.1| PREDICTED: ribosome biogenesis ...   136   7e-30   Ochotona princeps [southern American pika]
gi|459367862|gb|EMG46764.1| Ribosome biogenesis [nuclear export]...   135   8e-30   Candida maltosa Xu316
gi|326426829|gb|EGD72399.1| ribosome biogenesis protein Rrs1 [Sa...   135   1e-29   Salpingoeca rosetta
gi|50424407|ref|XP_460790.1| DEHA2F09834p [Debaryomyces hansenii...   135   1e-29   Debaryomyces hansenii CBS767
gi|126321316|ref|XP_001379079.1| PREDICTED: ribosome biogenesis ...   135   1e-29   Monodelphis domestica
gi|254565237|ref|XP_002489729.1| Essential protein that binds ri...   135   1e-29   Komagataella phaffii GS115
gi|325183780|emb|CCA18239.1| ribosome biogenesis regulatory prot...   134   3e-29   Albugo laibachii Nc14
gi|449549471|gb|EMD40436.1| hypothetical protein CERSUDRAFT_1484...   134   4e-29   Gelatoporia subvermispora B
gi|238879409|gb|EEQ43047.1| regulator of ribosome biosynthesis [...   134   4e-29   Candida albicans WO-1
gi|513030416|gb|AGO10441.1| AaceriABL014Cp [Saccharomycetaceae s...   133   4e-29   Saccharomycetaceae sp. 'Ashbya aceri'
gi|156847608|ref|XP_001646688.1| hypothetical protein Kpol_1028p...   133   5e-29   Vanderwaltozyma polyspora DSM 70294
gi|45709905|gb|AAH67632.1| Rrs1 protein, partial [Danio rerio]        133   7e-29   Danio rerio [leopard danio]
gi|41056045|ref|NP_956356.1| ribosome biogenesis regulatory prot...   132   7e-29   Danio rerio [leopard danio]
gi|410076388|ref|XP_003955776.1| hypothetical protein KAFR_0B034...   132   1e-28   Kazachstania africana CBS 2517
gi|148232006|ref|NP_001085071.1| RRS1 ribosome biogenesis regula...   132   1e-28   Xenopus laevis [clawed frog]
gi|302306524|ref|NP_982933.2| ABL014Cp [Ashbya gossypii ATCC 108...   132   1e-28   Eremothecium gossypii ATCC 10895
gi|241948079|ref|XP_002416762.1| ribosome biogenesis [nuclear ex...   132   1e-28   Candida dubliniensis CD36
gi|167536855|ref|XP_001750098.1| hypothetical protein [Monosiga ...   131   2e-28   Monosiga brevicollis MX1
gi|68473955|ref|XP_718874.1| likely ribosome biogenesis regulato...   131   2e-28   Candida albicans SC5314
gi|401623512|gb|EJS41609.1| rrs1p [Saccharomyces arboricola H-6]      131   2e-28   Saccharomyces arboricola H-6
gi|68473746|ref|XP_718976.1| likely ribosome biogenesis regulato...   130   3e-28   Candida albicans SC5314
gi|6324868|ref|NP_014937.1| Rrs1p [Saccharomyces cerevisiae S288...   130   3e-28   Saccharomyces cerevisiae S288c
gi|323331594|gb|EGA73009.1| Rrs1p [Saccharomyces cerevisiae AWRI...   130   3e-28   Saccharomyces cerevisiae AWRI796
gi|207340921|gb|EDZ69122.1| YOR294Wp-like protein [Saccharomyces...   130   3e-28   Saccharomyces cerevisiae AWRI1631
gi|389746674|gb|EIM87853.1| RRS1-domain-containing protein [Ster...   130   4e-28   Stereum hirsutum FP-91666 SS1
gi|348668179|gb|EGZ08003.1| hypothetical protein PHYSODRAFT_5261...   130   4e-28   Phytophthora sojae
gi|470319881|gb|EMR11491.1| hypothetical protein PNEG_00505 [Pne...   130   5e-28   Pneumocystis murina B123
gi|410909081|ref|XP_003968019.1| PREDICTED: ribosome biogenesis ...   129   7e-28   Takifugu rubripes [tiger puffer]
gi|213513147|ref|NP_001134869.1| ribosome biogenesis regulatory ...   129   8e-28   Salmo salar
gi|21483408|gb|AAM52679.1| LD24586p [Drosophila melanogaster]         129   1e-27   Drosophila melanogaster
gi|54650780|gb|AAV36969.1| LD45683p [Drosophila melanogaster]         129   1e-27   Drosophila melanogaster
gi|323307328|gb|EGA60608.1| Rrs1p [Saccharomyces cerevisiae Fost...   128   1e-27   Saccharomyces cerevisiae FostersO
gi|221330901|ref|NP_729108.2| CG32409 [Drosophila melanogaster] ...   128   1e-27   Drosophila melanogaster
gi|344233092|gb|EGV64965.1| ribosomal biogenesis regulatory prot...   128   1e-27   Candida tenuis ATCC 10573
gi|401838812|gb|EJT42256.1| RRS1-like protein [Saccharomyces kud...   128   2e-27   Saccharomyces kudriavzevii IFO 1802
gi|50304325|ref|XP_452112.1| hypothetical protein [Kluyveromyces...   128   2e-27   Kluyveromyces lactis NRRL Y-1140
gi|448520202|ref|XP_003868248.1| Rrs1 ribosome biogenesis and nu...   128   2e-27   Candida orthopsilosis Co 90-125
gi|195492113|ref|XP_002093850.1| GE21520 [Drosophila yakuba] >gi...   127   2e-27   Drosophila yakuba
gi|194867287|ref|XP_001972038.1| GG15298 [Drosophila erecta] >gi...   127   2e-27   Drosophila erecta
gi|505776368|ref|XP_004602476.1| PREDICTED: ribosome biogenesis ...   127   3e-27   Sorex araneus [Eurasian shrew]
gi|195588066|ref|XP_002083779.1| GD13910 [Drosophila simulans] >...   127   3e-27   Drosophila simulans
gi|195337755|ref|XP_002035491.1| GM14731 [Drosophila sechellia] ...   127   3e-27   Drosophila sechellia
gi|255730343|ref|XP_002550096.1| regulator of ribosome biosynthe...   127   3e-27   Candida tropicalis MYA-3404
gi|323346464|gb|EGA80752.1| Rrs1p [Saccharomyces cerevisiae Lalv...   127   5e-27   Saccharomyces cerevisiae Lalvin QA23
gi|323335347|gb|EGA76634.1| Rrs1p [Saccharomyces cerevisiae Vin13]    126   5e-27   Saccharomyces cerevisiae Vin13
gi|363749573|ref|XP_003645004.1| hypothetical protein Ecym_2460 ...   126   8e-27   Eremothecium cymbalariae DBVPG#7215
gi|512887748|ref|XP_004921974.1| PREDICTED: ribosome biogenesis ...   125   9e-27   Bombyx mori [silk moth]
gi|443429412|gb|AGC92697.1| ribosome biogenesis regulatory prote...   125   1e-26   Heliconius erato
gi|498968006|ref|XP_004526203.1| PREDICTED: ribosome biogenesis ...   125   1e-26   Ceratitis capitata
gi|365986595|ref|XP_003670129.1| hypothetical protein NDAI_0E007...   125   2e-26   Naumovozyma dairenensis CBS 421
gi|354544243|emb|CCE40966.1| hypothetical protein CPAR2_110040 [...   125   2e-26   Candida parapsilosis
gi|261335954|emb|CBH09287.1| putative regulator of ribosome bios...   124   2e-26   Heliconius melpomene [common postman]
gi|301116573|ref|XP_002906015.1| ribosome biogenesis regulatory ...   124   3e-26   Phytophthora infestans T30-4
gi|270012854|gb|EFA09302.1| hypothetical protein TcasGA2_TC03059...   124   3e-26   
gi|254586181|ref|XP_002498658.1| ZYRO0G15598p [Zygosaccharomyces...   124   4e-26   Zygosaccharomyces rouxii CBS 732
gi|405123744|gb|AFR98507.1| Rrs1 protein [Cryptococcus neoforman...   123   7e-26   Cryptococcus neoformans var. grubii H99
gi|47207991|emb|CAF91693.1| unnamed protein product [Tetraodon n...   122   7e-26   Tetraodon nigroviridis
gi|340716142|ref|XP_003396560.1| PREDICTED: ribosome biogenesis ...   122   1e-25   Bombus terrestris [large earth bumblebee]
gi|366989527|ref|XP_003674531.1| hypothetical protein NCAS_0B007...   122   1e-25   Naumovozyma castellii CBS 4309
gi|350396634|ref|XP_003484615.1| PREDICTED: ribosome biogenesis ...   121   2e-25   Bombus impatiens
gi|470267951|ref|XP_004362209.1| ribosome biogenesis regulatory ...   121   2e-25   Dictyostelium fasciculatum
gi|195428745|ref|XP_002062426.1| GK16661 [Drosophila willistoni]...   121   2e-25   Drosophila willistoni
gi|367010372|ref|XP_003679687.1| hypothetical protein TDEL_0B034...   121   3e-25   Torulaspora delbrueckii
gi|50288519|ref|XP_446689.1| hypothetical protein [Candida glabr...   120   3e-25   Candida glabrata CBS 138
gi|195127223|ref|XP_002008068.1| GI13300 [Drosophila mojavensis]...   120   4e-25   Drosophila mojavensis
gi|149243924|ref|XP_001526547.1| regulator of ribosome biosynthe...   120   5e-25   Lodderomyces elongisporus NRRL YB-4239
gi|367003329|ref|XP_003686398.1| hypothetical protein TPHA_0G012...   120   6e-25   Tetrapisispora phaffii CBS 4417
gi|242005813|ref|XP_002423755.1| ribosome biogenesis regulatory ...   119   9e-25   Pediculus humanus corporis [human body lice]
gi|242247401|ref|NP_001156275.1| ribosome biogenesis regulatory ...   119   9e-25   Acyrthosiphon pisum
gi|195020101|ref|XP_001985121.1| GH14686 [Drosophila grimshawi] ...   119   9e-25   Drosophila grimshawi
gi|146412013|ref|XP_001481978.1| hypothetical protein PGUG_05741...   119   9e-25   Meyerozyma guilliermondii ATCC 6260
gi|485638458|gb|EOD32863.1| hypothetical protein EMIHUDRAFT_3642...   119   1e-24   Emiliania huxleyi CCMP1516
gi|430811976|emb|CCJ30572.1| unnamed protein product [Pneumocyst...   119   1e-24   Pneumocystis jirovecii
gi|195376833|ref|XP_002047197.1| GJ12069 [Drosophila virilis] >g...   119   1e-24   Drosophila virilis
gi|512199294|gb|EPE28128.1| hypothetical protein GLAREA_04919 [G...   118   1e-24   Glarea lozoyensis ATCC 20868
gi|260947418|ref|XP_002618006.1| hypothetical protein CLUG_01465...   118   2e-24   Clavispora lusitaniae ATCC 42720
gi|339241523|ref|XP_003376687.1| ribosome biogenesis regulatory ...   118   2e-24   Trichinella spiralis
gi|345316560|ref|XP_001509960.2| PREDICTED: ribosome biogenesis ...   118   2e-24   
gi|19112636|ref|NP_595844.1| ribosome biogenesis protein Rrs1 (p...   117   3e-24   Schizosaccharomyces pombe 972h-
gi|320581208|gb|EFW95429.1| ribosome biogenesis regulatory prote...   117   3e-24   
gi|406862481|gb|EKD15531.1| ribosome biogenesis regulatory prote...   117   4e-24   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|255714773|ref|XP_002553668.1| KLTH0E04268p [Lachancea thermot...   117   4e-24   Lachancea thermotolerans CBS 6340
gi|156381110|ref|XP_001632109.1| predicted protein [Nematostella...   117   5e-24   Nematostella vectensis
gi|470293505|ref|XP_004343908.1| Rrs1 protein [Capsaspora owczar...   116   6e-24   Capsaspora owczarzaki ATCC 30864
gi|440639714|gb|ELR09633.1| hypothetical protein GMDG_04124 [Geo...   116   6e-24   Pseudogymnoascus destructans 20631-21
gi|154314321|ref|XP_001556485.1| hypothetical protein BC1G_05254...   115   9e-24   Botrytis cinerea B05.10
gi|345568148|gb|EGX51049.1| hypothetical protein AOL_s00054g785 ...   115   1e-23   Arthrobotrys oligospora ATCC 24927
gi|317419902|emb|CBN81938.1| Ribosome biogenesis regulatory prot...   115   2e-23   Dicentrarchus labrax [European sea bass]
gi|158286807|ref|XP_308939.3| AGAP006808-PA [Anopheles gambiae s...   114   2e-23   Anopheles gambiae str. PEST
gi|403217665|emb|CCK72158.1| hypothetical protein KNAG_0J00750 [...   114   2e-23   Kazachstania naganishii CBS 8797
gi|66821133|ref|XP_644082.1| ribosome biogenesis regulatory prot...   114   4e-23   Dictyostelium discoideum AX4
gi|302841019|ref|XP_002952055.1| hypothetical protein VOLCADRAFT...   114   4e-23   Volvox carteri f. nagariensis
gi|385305615|gb|EIF49576.1| regulator of ribosome biosynthesis [...   113   6e-23   Brettanomyces bruxellensis AWRI1499
gi|327352353|gb|EGE81210.1| ribosome biogenesis protein [Ajellom...   112   1e-22   
gi|268559672|ref|XP_002637827.1| Hypothetical protein CBG04617 [...   112   1e-22   Caenorhabditis briggsae
gi|261190788|ref|XP_002621803.1| ribosome biogenesis protein [Aj...   112   1e-22   Blastomyces gilchristii SLH14081
gi|501756058|emb|CCG80833.1| Ribosome biogenesis regulatory prot...   112   2e-22   Taphrina deformans PYCC 5710
gi|298707303|emb|CBJ25930.1| Ribosome biogenesis regulatory prot...   111   2e-22   Ectocarpus siliculosus
gi|308500300|ref|XP_003112335.1| CRE-RRBS-1 protein [Caenorhabdi...   111   2e-22   Caenorhabditis remanei
gi|296414485|ref|XP_002836930.1| hypothetical protein [Tuber mel...   111   2e-22   Tuber melanosporum Mel28
gi|156036162|ref|XP_001586192.1| hypothetical protein SS1G_12767...   110   3e-22   Sclerotinia sclerotiorum 1980 UF-70
gi|396478553|ref|XP_003840559.1| hypothetical protein LEMA_P1021...   110   3e-22   Leptosphaeria maculans JN3
gi|330802790|ref|XP_003289396.1| hypothetical protein DICPUDRAFT...   110   5e-22   Dictyostelium purpureum
gi|485633376|gb|EOD28251.1| hypothetical protein EMIHUDRAFT_1233...   110   5e-22   Emiliania huxleyi CCMP1516
gi|213406145|ref|XP_002173844.1| ribosome biogenesis protein Rrs...   110   6e-22   Schizosaccharomyces japonicus yFS275
gi|448089567|ref|XP_004196841.1| Piso0_004067 [Millerozyma farin...   110   6e-22   Millerozyma farinosa CBS 7064
gi|365758272|gb|EHN00123.1| Rrs1p [Saccharomyces cerevisiae x Sa...   109   7e-22   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|321265488|ref|XP_003197460.1| ribosome biogenesis-related pro...   109   9e-22   Cryptococcus gattii WM276
gi|325090693|gb|EGC44003.1| ribosome biogenesis protein [Ajellom...   109   9e-22   Histoplasma capsulatum H88
gi|225556114|gb|EEH04404.1| conserved hypothetical protein [Ajel...   109   1e-21   Histoplasma capsulatum G186AR
gi|50543670|ref|XP_500001.1| YALI0A12067p [Yarrowia lipolytica] ...   109   1e-21   Yarrowia lipolytica CLIB122
gi|154275832|ref|XP_001538761.1| conserved hypothetical protein ...   109   1e-21   Histoplasma capsulatum NAm1
gi|302915759|ref|XP_003051690.1| predicted protein [Nectria haem...   108   1e-21   Nectria haematococca mpVI 77-13-4
gi|451848526|gb|EMD61831.1| hypothetical protein COCSADRAFT_1469...   108   1e-21   Bipolaris sorokiniana ND90Pr
gi|242793835|ref|XP_002482246.1| ribosome biogenesis protein (Rr...   108   1e-21   Talaromyces stipitatus ATCC 10500
gi|449683816|ref|XP_002164297.2| PREDICTED: ribosome biogenesis ...   108   1e-21   Hydra vulgaris
gi|451992617|gb|EMD85097.1| hypothetical protein COCHEDRAFT_1149...   108   1e-21   Bipolaris maydis C5
gi|341878072|gb|EGT34007.1| hypothetical protein CAEBREN_03804 [...   108   1e-21   Caenorhabditis brenneri
gi|110758413|ref|XP_394666.3| PREDICTED: ribosome biogenesis reg...   108   2e-21   Apis mellifera [European honey bee]
gi|115395492|ref|XP_001213509.1| conserved hypothetical protein ...   107   3e-21   Aspergillus terreus NIH2624
gi|393912353|gb|EJD76693.1| hypothetical protein LOAG_16371 [Loa...   107   3e-21   Loa loa
gi|169765542|ref|XP_001817242.1| ribosome biogenesis protein (Rr...   107   3e-21   Aspergillus oryzae RIB40
gi|212535770|ref|XP_002148041.1| ribosome biogenesis protein (Rr...   107   3e-21   Talaromyces marneffei ATCC 18224
gi|225709304|gb|ACO10498.1| Ribosome biogenesis regulatory prote...   107   4e-21   Caligus rogercresseyi
gi|17558012|ref|NP_506573.1| Protein RRBS-1 [Caenorhabditis eleg...   107   5e-21   Caenorhabditis elegans [roundworm]
gi|148906982|gb|ABR16635.1| unknown [Picea sitchensis]                107   5e-21   Picea sitchensis
gi|441647489|ref|XP_003274825.2| PREDICTED: ribosome biogenesis ...   107   5e-21   Nomascus leucogenys [White-cheeked Gibbon]
gi|296805571|ref|XP_002843610.1| regulator of ribosome biosynthe...   106   6e-21   Arthroderma otae CBS 113480
gi|494830191|gb|EON66757.1| hypothetical protein W97_06003 [Coni...   106   6e-21   Coniosporium apollinis CBS 100218
gi|358373068|dbj|GAA89668.1| ribosome biogenesis protein [Asperg...   105   9e-21   Aspergillus kawachii IFO 4308
gi|145247983|ref|XP_001396240.1| ribosome biogenesis protein (Rr...   105   1e-20   Aspergillus niger CBS 513.88
gi|407921447|gb|EKG14594.1| Ribosomal biogenesis regulatory prot...   105   1e-20   Macrophomina phaseolina MS6
gi|358377993|gb|EHK15676.1| hypothetical protein TRIVIDRAFT_3854...   105   2e-20   Trichoderma virens Gv29-8
gi|426236119|ref|XP_004012022.1| PREDICTED: ribosome biogenesis ...   105   2e-20   
gi|302498738|ref|XP_003011366.1| hypothetical protein ARB_02425 ...   105   2e-20   Arthroderma benhamiae CBS 112371
gi|258564434|ref|XP_002582962.1| conserved hypothetical protein ...   105   2e-20   Uncinocarpus reesii 1704
gi|500252637|gb|EON96449.1| putative ribosome biogenesis protein...   104   2e-20   Phaeoacremonium minimum UCRPA7
gi|402080331|gb|EJT75476.1| ribosome biogenesis protein [Gaeuman...   104   2e-20   Gaeumannomyces graminis var. tritici R3-111a-1
gi|389624595|ref|XP_003709951.1| ribosome biogenesis protein [Ma...   104   2e-20   Magnaporthe oryzae 70-15
gi|281206150|gb|EFA80339.1| ribosome biogenesis regulatory prote...   104   3e-20   Polysphondylium pallidum PN500
gi|121711335|ref|XP_001273283.1| ribosome biogenesis protein (Rr...   104   3e-20   Aspergillus clavatus NRRL 1
gi|340520244|gb|EGR50481.1| hypothetical protein TRIREDRAFT_5842...   104   3e-20   Trichoderma reesei QM6a
gi|224082902|ref|XP_002306885.1| predicted protein [Populus tric...   104   3e-20   
gi|303316161|ref|XP_003068085.1| Ribosome biogenesis regulatory ...   104   3e-20   Coccidioides posadasii C735 delta SOWgp
gi|406606814|emb|CCH41850.1| Dynamin-binding protein [Wickerhamo...   103   4e-20   Wickerhamomyces ciferrii
gi|320032457|gb|EFW14410.1| ribosome biogenesis protein [Coccidi...   103   4e-20   Coccidioides posadasii str. Silveira
gi|346321818|gb|EGX91417.1| ribosome biogenesis protein [Cordyce...   103   6e-20   Cordyceps militaris CM01
gi|485918572|gb|EOD45213.1| putative ribosome biogenesis regulat...   103   6e-20   Neofusicoccum parvum UCRNP2
gi|507115176|emb|CDF38667.1| ribosome biogenesis regulatory prot...   103   7e-20   Chondrus crispus [Irish moss]
gi|400602699|gb|EJP70301.1| ribosome biogenesis regulatory prote...   103   7e-20   Beauveria bassiana ARSEF 2860
gi|327305643|ref|XP_003237513.1| ribosome biogenesis protein [Tr...   102   8e-20   Trichophyton rubrum CBS 118892
gi|302658728|ref|XP_003021065.1| hypothetical protein TRV_04841 ...   102   9e-20   Trichophyton verrucosum HKI 0517
gi|119177131|ref|XP_001240383.1| hypothetical protein CIMG_07546...   102   9e-20   Coccidioides immitis RS
gi|67526575|ref|XP_661349.1| hypothetical protein AN3745.2 [Aspe...   102   1e-19   Aspergillus nidulans FGSC A4
gi|380490235|emb|CCF36152.1| ribosome biogenesis regulatory prot...   102   1e-19   Colletotrichum higginsianum
gi|383853104|ref|XP_003702064.1| PREDICTED: ribosome biogenesis ...   102   2e-19   
gi|302802770|ref|XP_002983139.1| hypothetical protein SELMODRAFT...   102   2e-19   Selaginella moellendorffii
gi|322706943|gb|EFY98522.1| ribosome biogenesis protein [Metarhi...   101   2e-19   Metarhizium robertsii ARSEF 23
gi|322701084|gb|EFY92835.1| ribosome biogenesis protein [Metarhi...   101   2e-19   Metarhizium acridum CQMa 102
gi|310800381|gb|EFQ35274.1| ribosome biogenesis regulatory prote...   101   3e-19   Colletotrichum graminicola M1.001
gi|315046766|ref|XP_003172758.1| ribosome biosynthesis regulator...   101   3e-19   Microsporum gypseum CBS 118893
gi|226289457|gb|EEH44963.1| regulator of ribosome biosynthesis [...   100   3e-19   Paracoccidioides brasiliensis Pb18
gi|307202400|gb|EFN81820.1| Ribosome biogenesis regulatory prote...   100   4e-19   Harpegnathos saltator
gi|313218076|emb|CBY41401.1| unnamed protein product [Oikopleura...   100   4e-19   Oikopleura dioica
gi|294942683|ref|XP_002783644.1| ribosome biogenesis regulatory ...   100   5e-19   Perkinsus marinus ATCC 50983
gi|425772413|gb|EKV10816.1| Ribosome biogenesis protein (Rrs1), ...   100   5e-19   Penicillium digitatum Pd1
gi|295657083|ref|XP_002789115.1| regulator of ribosome biosynthe...   100   6e-19   Paracoccidioides lutzii Pb01
gi|255954353|ref|XP_002567929.1| Pc21g08900 [Penicillium chrysog...   100   7e-19   Penicillium rubens Wisconsin 54-1255
gi|119482674|ref|XP_001261365.1| ribosome biogenesis protein (Rr...   100   8e-19   Aspergillus fischeri NRRL 181
gi|225680386|gb|EEH18670.1| regulator of ribosome biosynthesis [...   100   8e-19   Paracoccidioides brasiliensis Pb03
gi|336265412|ref|XP_003347477.1| hypothetical protein SMAC_08044...   100   8e-19   Sordaria macrospora k-hell
gi|70987173|ref|XP_749066.1| ribosome biogenesis protein (Rrs1) ...   100   8e-19   Aspergillus fumigatus Af293
gi|470431270|ref|XP_004338382.1| hypothetical protein ACA1_20457...    99   9e-19   Acanthamoeba castellanii str. Neff
gi|225714086|gb|ACO12889.1| Ribosome biogenesis regulatory prote...    99   1e-18   Lepeophtheirus salmonis
gi|116180892|ref|XP_001220295.1| hypothetical protein CHGG_01074...    99   1e-18   Chaetomium globosum CBS 148.51
gi|313242008|emb|CBY34192.1| unnamed protein product [Oikopleura...    99   1e-18   Oikopleura dioica
gi|470319882|gb|EMR11492.1| hypothetical protein, variant [Pneum...    99   1e-18   
gi|384253222|gb|EIE26697.1| RRS1-domain-containing protein [Cocc...    99   1e-18   Coccomyxa subellipsoidea C-169
gi|477537155|gb|ENH88615.1| ribosome biogenesis protein [Colleto...    99   2e-18   Colletotrichum orbiculare MAFF 240422
gi|358391492|gb|EHK40896.1| hypothetical protein TRIATDRAFT_3016...    98   2e-18   Trichoderma atroviride IMI 206040
gi|470101771|ref|XP_004287342.1| PREDICTED: ribosome biogenesis ...    98   2e-18   Fragaria vesca subsp. vesca
gi|225718780|gb|ACO15236.1| Ribosome biogenesis regulatory prote...    98   3e-18   Caligus clemensi
gi|367044192|ref|XP_003652476.1| hypothetical protein THITE_2114...    98   3e-18   
gi|336463178|gb|EGO51418.1| hypothetical protein NEUTE1DRAFT_333...    97   4e-18   
gi|313230699|emb|CBY08097.1| unnamed protein product [Oikopleura...    97   4e-18   
gi|169601654|ref|XP_001794249.1| hypothetical protein SNOG_03697...    97   4e-18   
gi|380018284|ref|XP_003693062.1| PREDICTED: ribosome biogenesis ...    97   5e-18   
gi|256081807|ref|XP_002577159.1| ribosome biogenesis regulatory ...    97   5e-18   
gi|320587341|gb|EFW99821.1| ribosome biogenesis protein [Grosman...    97   5e-18   
gi|256081805|ref|XP_002577158.1| ribosome biogenesis regulatory ...    97   5e-18   
gi|361130206|gb|EHL02060.1| putative Regulator of ribosome biosy...    97   6e-18   
gi|240278391|gb|EER41897.1| ribosome biogenesis protein [Ajellom...    96   8e-18   
gi|482803592|gb|EOA80717.1| hypothetical protein SETTUDRAFT_4462...    96   1e-17   
gi|462397575|gb|EMJ03243.1| hypothetical protein PRUPE_ppa005513...    96   1e-17   
gi|429862186|gb|ELA36844.1| ribosome biogenesis protein [Colleto...    95   2e-17   
gi|56753555|gb|AAW24980.1| SJCHGC02140 protein [Schistosoma japo...    95   2e-17   
gi|294888421|ref|XP_002772457.1| ribosome biogenesis regulatory ...    95   2e-17   
gi|85111319|ref|XP_963880.1| hypothetical protein NCU08121 [Neur...    95   2e-17   
gi|444724065|gb|ELW64686.1| Ribosome biogenesis regulatory prote...    95   2e-17   
gi|156086680|ref|XP_001610749.1| regulator of ribosome biosynthe...    95   2e-17   
gi|367019672|ref|XP_003659121.1| hypothetical protein MYCTH_2295...    94   3e-17   
gi|346979346|gb|EGY22798.1| hypothetical protein VDAG_04236 [Ver...    94   4e-17   
gi|302764948|ref|XP_002965895.1| hypothetical protein SELMODRAFT...    94   5e-17   
gi|399165799|emb|CCE33370.1| related to regulator of ribosome bi...    94   5e-17   
gi|475667459|gb|EMT65248.1| Regulator of ribosome biosynthesis [...    93   6e-17   
gi|384499057|gb|EIE89548.1| hypothetical protein RO3G_14259 [Rhi...    93   7e-17   
gi|297745415|emb|CBI40495.3| unnamed protein product [Vitis vini...    93   8e-17   
gi|225454487|ref|XP_002281065.1| PREDICTED: ribosome biogenesis ...    93   8e-17   
gi|452820215|gb|EME27260.1| ribosome biogenesis regulatory prote...    93   9e-17   
gi|290995468|ref|XP_002680317.1| ribosome biogenesis regulatory ...    93   9e-17   
gi|46125459|ref|XP_387283.1| hypothetical protein FG07107.1 [Fus...    93   9e-17   
gi|307181672|gb|EFN69175.1| Ribosome biogenesis regulatory prote...    93   1e-16   
gi|357445849|ref|XP_003593202.1| Ribosome biogenesis regulatory ...    93   1e-16   
gi|342866492|gb|EGU72153.1| hypothetical protein FOXB_17397 [Fus...    92   1e-16   
gi|297823677|ref|XP_002879721.1| ribosome biogenesis regulatory ...    92   1e-16   
gi|357445851|ref|XP_003593203.1| Ribosome biogenesis regulatory ...    92   1e-16   
gi|502077214|ref|XP_004485584.1| PREDICTED: ribosome biogenesis ...    92   1e-16   
gi|403221306|dbj|BAM39439.1| ribosome biogenesis regulatory prot...    92   1e-16   
gi|302414512|ref|XP_003005088.1| conserved hypothetical protein ...    92   1e-16   
gi|168046922|ref|XP_001775921.1| predicted protein [Physcomitrel...    91   2e-16   
gi|300176122|emb|CBK23433.2| unnamed protein product [Blastocyst...    91   3e-16   
gi|290562752|gb|ADD38771.1| Ribosome biogenesis regulatory prote...    91   3e-16   
gi|171695932|ref|XP_001912890.1| hypothetical protein [Podospora...    91   4e-16   
gi|145353934|ref|XP_001421252.1| predicted protein [Ostreococcus...    91   5e-16   
gi|332021998|gb|EGI62324.1| Ribosome biogenesis regulatory prote...    90   7e-16   
gi|21593609|gb|AAM65576.1| unknown [Arabidopsis thaliana]              89   9e-16   
gi|18404610|ref|NP_565878.1| ribosome biogenesis regulatory prot...    89   1e-15   
gi|147832302|emb|CAN77790.1| hypothetical protein VITISV_033191 ...    89   2e-15   
gi|482563325|gb|EOA27515.1| hypothetical protein CARUB_v10023655...    88   2e-15   
gi|76157785|gb|AAX28602.2| SJCHGC02141 protein [Schistosoma japo...    88   2e-15   
gi|226479812|emb|CAX73202.1| Ribosome biogenesis regulatory prot...    88   3e-15   
gi|388496656|gb|AFK36394.1| unknown [Lotus japonicus]                  88   3e-15   
gi|225453598|ref|XP_002264648.1| PREDICTED: ribosome biogenesis ...    87   4e-15   
gi|189205385|ref|XP_001939027.1| hypothetical protein PTRG_08695...    87   4e-15   
gi|330925022|ref|XP_003300880.1| hypothetical protein PTT_12243 ...    87   5e-15   
gi|156553496|ref|XP_001600166.1| PREDICTED: ribosome biogenesis ...    87   6e-15   
gi|212723658|ref|NP_001131598.1| uncharacterized protein LOC1001...    86   8e-15   
gi|118356857|ref|XP_001011682.1| ribosome biogenesis regulatory ...    86   1e-14   
gi|356548593|ref|XP_003542685.1| PREDICTED: ribosome biogenesis ...    86   1e-14   
gi|512188496|gb|EPE04268.1| ribosome biogenesis protein [Ophiost...    86   1e-14   
gi|312069753|ref|XP_003137829.1| hypothetical protein LOAG_02243...    86   2e-14   
gi|313217869|emb|CBY41266.1| unnamed protein product [Oikopleura...    85   2e-14   
gi|326488977|dbj|BAJ98100.1| predicted protein [Hordeum vulgare ...    85   2e-14   
gi|475578203|gb|EMT18037.1| Ribosome biogenesis regulatory prote...    85   2e-14   
gi|471571321|gb|EMR70167.1| putative ribosome biogenesis protein...    84   3e-14   
gi|449462587|ref|XP_004149022.1| PREDICTED: ribosome biogenesis ...    84   3e-14   
gi|402582296|gb|EJW76242.1| hypothetical protein WUBG_12849, par...    84   5e-14   
gi|307103983|gb|EFN52239.1| hypothetical protein CHLNCDRAFT_1391...    84   5e-14   
gi|90399144|emb|CAJ86168.1| H0913C04.9 [Oryza sativa Indica Group]     84   6e-14   
gi|242056177|ref|XP_002457234.1| hypothetical protein SORBIDRAFT...    83   8e-14   
gi|84998212|ref|XP_953827.1| ribosome biogenesis regulatory prot...    83   1e-13   
gi|115461430|ref|NP_001054315.1| Os04g0685100 [Oryza sativa Japo...    82   1e-13   
gi|303282585|ref|XP_003060584.1| predicted protein [Micromonas p...    82   1e-13   
gi|397624111|gb|EJK67273.1| hypothetical protein THAOC_11720, pa...    82   1e-13   
gi|398395463|ref|XP_003851190.1| hypothetical protein MYCGRDRAFT...    82   1e-13   
gi|209879541|ref|XP_002141211.1| ribosome biogenesis regulatory ...    82   2e-13   
gi|460412354|ref|XP_004251566.1| PREDICTED: ribosome biogenesis ...    82   2e-13   
gi|356563022|ref|XP_003549765.1| PREDICTED: ribosome biogenesis ...    81   3e-13   
gi|253745939|gb|EET01532.1| Hypothetical protein GL50581_1207 [G...    80   4e-13   
gi|378725736|gb|EHY52195.1| hypothetical protein HMPREF1120_0041...    80   4e-13   
gi|255566983|ref|XP_002524474.1| ribosome biogenesis regulatory ...    80   5e-13   
gi|71033651|ref|XP_766467.1| ribosome biogenesis regulatory prot...    79   2e-12   
gi|308812007|ref|XP_003083311.1| OSJNBa0088H09.13 [Oryza sativa ...    78   3e-12   
gi|449019619|dbj|BAM83021.1| similar to regulator for ribosome b...    78   3e-12   
gi|357134869|ref|XP_003569038.1| PREDICTED: ribosome biogenesis ...    78   3e-12   
gi|221504386|gb|EEE30061.1| conserved hypothetical protein [Toxo...    77   4e-12   
gi|237841209|ref|XP_002369902.1| ribosome biogenesis regulatory ...    77   4e-12   
gi|410041938|ref|XP_003311861.2| PREDICTED: LOW QUALITY PROTEIN:...    77   4e-12   
gi|401399427|ref|XP_003880546.1| putative ribosome biogenesis re...    77   5e-12   
gi|413947557|gb|AFW80206.1| hypothetical protein ZEAMMB73_260157...    77   6e-12   
gi|323302998|gb|EGA56802.1| Rrs1p [Saccharomyces cerevisiae Fost...    77   6e-12   
gi|123485256|ref|XP_001324446.1| hypothetical protein [Trichomon...    76   1e-11   
gi|508783776|gb|EOY31032.1| Ribosome biogenesis regulatory prote...    76   1e-11   
gi|340924199|gb|EGS19102.1| putative ribosome biogenesis protein...    75   2e-11   
gi|508783777|gb|EOY31033.1| Ribosome biogenesis regulatory prote...    74   5e-11   
gi|388513869|gb|AFK44996.1| unknown [Medicago truncatula]              74   5e-11   
gi|449295244|gb|EMC91266.1| hypothetical protein BAUCODRAFT_2839...    73   9e-11   


>gi|511005017|gb|EPB86370.1| hypothetical protein HMPREF1544_06812 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 313

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 172/275 (62%), Gaps = 6/275 (2%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLK--NDTDNYLKEYTRDGTQLL 65
           L+  ++++K ITVE+ +PL +D+ LL+AFDTN LDE  LK  N TD YL + TRD TQL+
Sbjct: 7   LDAHQAQFKPITVEKLVPLDFDINLLSAFDTNTLDEKTLKSKNSTDKYLLDLTRDNTQLI 66

Query: 66  INQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMI 125
           IN++FKLP+ ++D G LA+LP +++V+PRE         TRWEKFAK KGIQ++ +++M+
Sbjct: 67  INELFKLPVNSADAGVLAQLPARVSVLPREKPLPKDKPLTRWEKFAKVKGIQNKKRDRMV 126

Query: 126 YDEATGEWVPRWGYKGTNGDGA--NDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
           YDE TGE+ PRWGYKG   +GA   DWL+PVP + DP EDQ++                 
Sbjct: 127 YDEETGEYTPRWGYKGAKPEGALDQDWLMPVPDHADPMEDQYAKAREEKKGRVEKNTKRQ 186

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 243
           RRN EE  AA    K  D +  +K ELQ  IA SK ATAS+GKFD  LKGE K+KGV  +
Sbjct: 187 RRNQEEGTAATLAGK-KDIKEFKKEELQTAIAASKKATASVGKFDNKLKGETKMKGVTHQ 245

Query: 244 FEPSIGDXXXXXXXXXXXXXXXXGKKGDIVNVRKV 278
           F P+IGD                G K DIVN  K 
Sbjct: 246 FSPTIGDVKAEKNSSLDILKKIVG-KNDIVNTEKA 279



>gi|299748190|ref|XP_001837530.2| hypothetical protein CC1G_01442 [Coprinopsis cinerea okayama7#130]
 gi|298407856|gb|EAU84446.2| hypothetical protein CC1G_01442 [Coprinopsis cinerea okayama7#130]
          Length = 308

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/247 (37%), Positives = 137/247 (55%), Gaps = 9/247 (3%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S  LE QK+K +S+ VE+  PL  D   L   D N +DE     + + +L+   RDG Q
Sbjct: 3   VSSILEAQKAKERSVLVEKETPLVVDAGHLMVTDLNVIDEESYNENLEEHLQSLARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            LI  +F LP T+S+ G LA+LP Q   +PR          T+WE+FA AKGIQH+ +++
Sbjct: 63  ALIGTLFSLPTTSSEEGPLAQLPPQEYQLPRAKPLPKPKPMTKWERFAAAKGIQHKKRDR 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDP-FEDQFSXXXXXXXXXXXXXXXX 182
            ++DE   EWV RWG  G N +    W  PVP N D  +  Q                  
Sbjct: 123 KVWDEEKQEWVNRWGRDGKNKEAEEQWATPVPHNADADYNPQLEARKERKARVA------ 176

Query: 183 HRRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKR 242
             +N ++    + +  G+ A++ RK EL R +A ++++TAS+G+FDK L+GE K++G+KR
Sbjct: 177 --KNEKQRLQNIARASGSSAQASRKEELDRTLATTRTSTASMGRFDKKLEGEKKIRGIKR 234

Query: 243 KFEPSIG 249
           KFEP+ G
Sbjct: 235 KFEPNEG 241



>gi|242221362|ref|XP_002476431.1| predicted protein [Postia placenta Mad-698-R]
 gi|220724315|gb|EED78367.1| predicted protein [Postia placenta Mad-698-R]
          Length = 315

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/244 (38%), Positives = 130/244 (53%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            SD L     K K++ VE+ IPL+ D   LA  D N +D      D + YL+   RDG Q
Sbjct: 3   VSDILAAHAEKQKAVAVEKDIPLEVDAGFLAVTDLNPVDTESYGEDLEEYLQSTARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            LIN +F LP T S  G LA+LP   T +PR          T+WE+FA+AKGIQ + K+K
Sbjct: 63  ALINALFALPTTPSADGPLAQLPPPTTQLPRAKHLPKPKPPTKWEQFARAKGIQKKRKDK 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
            ++DE   +WV RWG+KG N      WL  V  N D   D                   H
Sbjct: 123 KVWDEEKQDWVDRWGWKGANKKEETQWLSEVRANADVDHDPAKAARDARKEKMAKNERQH 182

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 243
           ++N+  ++ A            RK ++ R +A ++S+TAS+GKFD+ L+GE KLKGVKRK
Sbjct: 183 QQNLARAQGASASATAPAPPQERKKQIDRTLATTRSSTASMGKFDRKLEGEKKLKGVKRK 242

Query: 244 FEPS 247
           F+P+
Sbjct: 243 FDPT 246



>gi|401881581|gb|EJT45879.1| ribosome biogenesis-related protein [Trichosporon asahii var.
           asahii CBS 2479]
          Length = 336

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 101/275 (36%), Positives = 146/275 (53%), Gaps = 28/275 (10%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S QL    +   +  +ERP P++ D  LLAAFDT  +DE   +++ + ++   T   TQ
Sbjct: 3   VSQQLADYAASKTTQVLERPTPIEVDSGLLAAFDTVPIDEEEYESNREAHILALTLTSTQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            L++ +F LP T S+ G +A+LPE IT++PRE         T+WE++AKAKGI H  K+K
Sbjct: 63  TLVSDLFNLPTTMSENGPIAQLPEPITLLPREKPLPKPKPLTKWERYAKAKGISHVKKDK 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND-----------------DPFEDQFS 166
            ++DE   EWV RWG  G N +G + WL  V   +                 DP  D  +
Sbjct: 123 KVWDEEKQEWVNRWGRDGKNREGEDQWLHEVKGGEGEFGLYQLGDVGCKLTADPTVDPRA 182

Query: 167 XXXXXXXXXXXXXXXXHRRNIEESEA-----------ALNQTKGADARSLRKGELQRQIA 215
                             RN+ +++A           A    + + AR +RK EL R + 
Sbjct: 183 NLRADRKARIAKNEKQRLRNLADAQAHISALDKKPSTATTSAEKSTARQIRKAELDRSML 242

Query: 216 ISKSATASIGKFDKTLKGELKLKGVKRKFEPSIGD 250
           ISK+ATAS+GKFDK ++GE K+KGVKRKFE ++GD
Sbjct: 243 ISKTATASMGKFDKKIEGEPKVKGVKRKFESNVGD 277



>gi|406696596|gb|EKC99878.1| ribosome biogenesis-related protein [Trichosporon asahii var.
           asahii CBS 8904]
          Length = 368

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 101/275 (36%), Positives = 146/275 (53%), Gaps = 28/275 (10%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S QL    +   +  +ERP P++ D  LLAAFDT  +DE   +++ + ++   T   TQ
Sbjct: 35  VSQQLADYAASKTTQVLERPTPIEVDSGLLAAFDTVPIDEEEYESNREAHILALTLTSTQ 94

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            L++ +F LP T S+ G +A+LPE IT++PRE         T+WE++AKAKGI H  K+K
Sbjct: 95  TLVSDLFNLPTTMSENGPIAQLPEPITLLPREKPLPKPKPLTKWERYAKAKGISHVKKDK 154

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND-----------------DPFEDQFS 166
            ++DE   EWV RWG  G N +G + WL  V   +                 DP  D  +
Sbjct: 155 KVWDEEKQEWVNRWGRDGKNREGEDQWLHEVKGGEGEFGLYQLGDVGCKLTADPTVDPRA 214

Query: 167 XXXXXXXXXXXXXXXXHRRNIEESEA-----------ALNQTKGADARSLRKGELQRQIA 215
                             RN+ +++A           A    + + AR +RK EL R + 
Sbjct: 215 NLRADRKARIAKNEKQRLRNLADAQAHISALDKKPSTATTSAEKSTARQIRKAELDRSML 274

Query: 216 ISKSATASIGKFDKTLKGELKLKGVKRKFEPSIGD 250
           ISK+ATAS+GKFDK ++GE K+KGVKRKFE ++GD
Sbjct: 275 ISKTATASMGKFDKKIEGEPKVKGVKRKFESNVGD 309



>gi|392568457|gb|EIW61631.1| RRS1-domain-containing protein [Trametes versicolor FP-101664 SS1]
          Length = 319

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/248 (39%), Positives = 135/248 (54%), Gaps = 4/248 (1%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            SD L   ++K KS+ VE+ IPL+ D   L   D N +D+   + D + YL    RDG Q
Sbjct: 3   VSDILAAHQAKQKSVVVEKEIPLEVDTGFLTVTDLNPVDQESYEADMEEYLMSTARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            LI  +F LP T+S  G LA+LP   T++PR          T+WE+FAKAKGIQ   K K
Sbjct: 63  TLIASLFSLPTTSSADGPLAQLPTPTTLLPRAKPLPKPKPPTKWEQFAKAKGIQKTRKEK 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
            I+DE   EWV RWG+KG N      WL  V  N D   D                   H
Sbjct: 123 KIWDEEKQEWVDRWGWKGVNKKEETQWLTEVRANADVDHDPSKAARDARKERVAKNERQH 182

Query: 184 RRNIEESEAALNQTKGADA----RSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKG 239
           ++N+  +  +   + G        S+RK E+ R +A+++++TAS+GKFD+ L+GE KLKG
Sbjct: 183 QQNVARATQSTGPSTGPSTAPVPNSIRKKEIDRTLAVTRASTASMGKFDRKLEGEKKLKG 242

Query: 240 VKRKFEPS 247
           +KRKFEP+
Sbjct: 243 LKRKFEPT 250



>gi|164659472|ref|XP_001730860.1| hypothetical protein MGL_1859 [Malassezia globosa CBS 7966]
 gi|159104758|gb|EDP43646.1| hypothetical protein MGL_1859 [Malassezia globosa CBS 7966]
          Length = 307

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 133/239 (55%), Gaps = 16/239 (6%)

Query: 24  IPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT-SDLGKL 82
           +PLQ D  LLA+ D N +D  +   DT+  L+  TR+ TQ LIN IF+LPI   +  G L
Sbjct: 15  MPLQLDTGLLASVDVNPMDIRKYMKDTEALLQARTRNSTQHLINTIFQLPIERHATYGPL 74

Query: 83  AELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGT 142
           A LPE +T +PRE         T+WEKFA+AKGI  R K+++++DE   EWVPRWG++G 
Sbjct: 75  ASLPEFVTQLPREKPLPKPKPLTKWEKFARAKGIVKRKKDRLVFDEERQEWVPRWGFQGK 134

Query: 143 NGDGANDWLIPVPQN-DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAAL-----NQ 196
           N D  N WL+ VP N DD F                     H RN+     A        
Sbjct: 135 NKDLENQWLVEVPSNADDDFRPD-KAAAKERLDRRKKNEQQHERNLARQSGAAAAIPSGS 193

Query: 197 TKG--------ADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 247
           TKG        A   S R+ EL+ +I  ++++TAS+G+FDK L+GE K +GVKR F+P+
Sbjct: 194 TKGKSELGSGKASMSSRRRAELESEILRARNSTASMGRFDKHLEGETKPRGVKRTFQPN 252



>gi|260801679|ref|XP_002595723.1| hypothetical protein BRAFLDRAFT_200232 [Branchiostoma floridae]
 gi|229280970|gb|EEN51735.1| hypothetical protein BRAFLDRAFT_200232 [Branchiostoma floridae]
          Length = 336

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 132/246 (53%), Gaps = 8/246 (3%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQI 69
           +Q SKYK+I V++ I  Q DL  L   D N L+  + + D + YLK   RD TQLL N I
Sbjct: 14  SQASKYKTIEVQKDIEPQLDLGNLLTVDQNPLELKKFRADKEVYLKSQARDNTQLLFNAI 73

Query: 70  FKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEA 129
           +KLP    +     +LPE  TV+PRE         TRWE++A+ KGIQ R K +M++DE 
Sbjct: 74  WKLPTERVEEAICVKLPETTTVLPREKPIPKVKPPTRWEQYAQLKGIQKRKKGRMVWDEE 133

Query: 130 TGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE 189
             EW PRWGYK  N D   DW+I VP N DP EDQF                   RNI  
Sbjct: 134 LKEWRPRWGYKRAN-DETKDWVIEVPGNADPNEDQFEKRMKAKKERVAKNELQRLRNI-- 190

Query: 190 SEAALNQTKGA---DARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKF 244
           + A  ++  G          K E+   + ++K +TAS+GKF + L  E + K  G KRKF
Sbjct: 191 ARATRSKVPGVGLTPTEKPSKEEVGLALHLAKKSTASLGKFTEKLPKEKEAKHVGKKRKF 250

Query: 245 EPSIGD 250
           EP+IGD
Sbjct: 251 EPAIGD 256



>gi|505757196|gb|EOR01322.1| Regulator of ribosome biosynthesi [Wallemia ichthyophaga EXF-994]
          Length = 306

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 134/252 (53%), Gaps = 6/252 (2%)

Query: 1   PIYFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRD 60
           PI  S  L     +YK   V+R +P+  DL LLAAFDTNAL+   LK D + Y+K  TRD
Sbjct: 4   PIDASQILAEHSKRYKPTQVDREVPITIDLNLLAAFDTNALNADELKVDREEYVKSLTRD 63

Query: 61  GTQLLINQIFKLPITTSDLGKLAELP-EQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
           G QLL+N +F+ PIT +  G LA+LP E +  +PRE         T+W+KFA  KGI H+
Sbjct: 64  GVQLLVNNLFQQPITKTLDGPLAKLPDESVYAVPREKPLPKPKPLTKWQKFANEKGITHK 123

Query: 120 NKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXX 179
            K++M++DE   +WVPRWGY G N    N WL  +    D   +  S             
Sbjct: 124 KKDRMVFDEDEQKWVPRWGYGGINKKEENQWLHELKDGQDEDHNPASAIKHARRDRSLKN 183

Query: 180 XXXHRRN--IEES---EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGE 234
                +N  I +S   +           R+  K EL++ +  S+ +T S+GKFDK + GE
Sbjct: 184 VKQQLKNEGITKSVQEKQKAEAAAKRAERAQHKQELEKSLHRSRVSTGSMGKFDKKMSGE 243

Query: 235 LKLKGVKRKFEP 246
             LKG KRKF P
Sbjct: 244 PALKGQKRKFNP 255



>gi|403413739|emb|CCM00439.1| predicted protein [Fibroporia radiculosa]
          Length = 310

 Score =  169 bits (427), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 130/241 (53%), Gaps = 1/241 (0%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S+ L    +K K ITVE+ IPL+ D   L   D N  D        + YL    RDG Q
Sbjct: 3   VSEILAAHVAKQKLITVEKDIPLEIDAGFLTVTDLNPGDAESYDESLEEYLLSTARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            L++ +F LPIT+S  G LA LP   T +PR          T+WEKFAKAKGIQ + K+K
Sbjct: 63  ALVSSLFALPITSSADGPLARLPSPTTQLPRAKPLPKPKPLTKWEKFAKAKGIQKQRKDK 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
            ++DE   EWV RWG+KG N      WL  VP N D   D                   H
Sbjct: 123 KVWDEEKQEWVDRWGWKGANKREETQWLSEVPANADADYDPAKIARGARKEKMAKNERQH 182

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 243
           ++N+  ++AA   +  +D    +KG + R +A ++++TAS+G+FD+TL GE +LKG+KRK
Sbjct: 183 QQNLVRAQAANMNSSTSDRFEHKKG-IDRTLATARTSTASMGRFDRTLDGEKRLKGLKRK 241

Query: 244 F 244
           F
Sbjct: 242 F 242



>gi|340368757|ref|XP_003382917.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Amphimedon queenslandica]
          Length = 337

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 105/281 (37%), Positives = 143/281 (50%), Gaps = 10/281 (3%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLI 66
           L   +SK+KS  V + + LQ+DL  L A D N ++   LK    D YL    RD TQLLI
Sbjct: 14  LSAHQSKFKSTEVNKEVELQFDLGRLLATDLNEIEAQSLKTKQKDGYLLNLMRDNTQLLI 73

Query: 67  NQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIY 126
           N+I+K P+  +D G   +LP   TV+PRE         T+WE+FA+ KGI  + ++KM++
Sbjct: 74  NEIWKFPVENNDGGISVQLPSPKTVLPREKPIPKEKEPTKWEQFAQTKGIAKKKRSKMVF 133

Query: 127 DEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRN 186
           DE + EW PRWGYK  N D   DWLI VP N DP+ED F                   RN
Sbjct: 134 DEKSQEWKPRWGYKRIN-DPKEDWLIEVPDNADPYEDPFEKKSEDRKERIAKNEYQRLRN 192

Query: 187 IEESEAALNQTKG----ADARSLRKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGV 240
           I  ++ +  + K     A A  L K ++   + +++ +TASIGKF   L  E   K  G 
Sbjct: 193 IARADKS-GRVKAPLPPAYAAKLNKHQVTHALGMARKSTASIGKFTPKLSKEPAAKSAGK 251

Query: 241 KRKFEPSIGDXXXXXXXXXXXXXXXXGKKGDIVNVRKVRSK 281
           K KF P +G                  KK DI++V+K  SK
Sbjct: 252 KSKFRPVVG-KKGEERALNLEILKKMSKKTDILDVKKATSK 291



>gi|409049634|gb|EKM59111.1| hypothetical protein PHACADRAFT_249336 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 310

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 135/242 (55%), Gaps = 2/242 (0%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S+ L     K ++ITVE+ IPL+ D   L   DTN +DE   K + + Y++   RDG Q
Sbjct: 3   VSEILAEHARKQQAITVEKEIPLEVDAGFLTVTDTNPIDEESYKVNLEEYIQSTARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
           +LI+ +F LP   S  G LA+LP   T +PR          ++WE+FAKAKGI HR K++
Sbjct: 63  VLISALFSLPTVPSPDGPLAQLPPPTTQLPRAKSLPKPKPLSKWEQFAKAKGISHRKKDR 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
            ++DE   +WV RWG+KGTN  G   WL  VPQN D   D                   H
Sbjct: 123 KVWDEEKQQWVNRWGWKGTNKAGEEQWLTEVPQNADIDHDPAKKAREERKARVSKNEKQH 182

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 243
            +N+  ++ A  Q   +     RK E+ R +A ++ +TAS+G+FDK L+GE KLKGVKRK
Sbjct: 183 EKNMLRAQRA--QGSSSAPTDQRKREIDRTLATTRVSTASMGRFDKKLEGEKKLKGVKRK 240

Query: 244 FE 245
           FE
Sbjct: 241 FE 242



>gi|388584012|gb|EIM24313.1| RRS1-domain-containing protein [Wallemia sebi CBS 633.66]
          Length = 306

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 99/251 (39%), Positives = 135/251 (53%), Gaps = 6/251 (2%)

Query: 2   IYFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDG 61
           I  S  L     KYK   + R IP++ DL LL AFDTNA++   LK++ +NY+KE +RD 
Sbjct: 5   IDASQILAEHSKKYKPTQISREIPIENDLNLLTAFDTNAINADELKSNRENYVKELSRDS 64

Query: 62  TQLLINQIFKLPITTSDLGKLAELPEQ-ITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN 120
            Q LIN +F  PIT +  G LA+LPE+ +  +PRE         T+W+KFA  KGI H+ 
Sbjct: 65  VQNLINDLFNQPITKTLDGPLAKLPEESVYQLPREKPLPKPKALTKWQKFANEKGISHKK 124

Query: 121 KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXX 180
           K++M++DE   +WVPRWGY G N    N WL  + +  D   +  S              
Sbjct: 125 KDRMVFDEDEQKWVPRWGYNGINKKEENQWLHELKEGQDEDHNPASAIKGARKERSLKNV 184

Query: 181 XXHRRN--IEES---EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGEL 235
               +N  I +S   +           R+  K EL++ +  SK +TAS+GKFDK L GE 
Sbjct: 185 KQQLKNEGITKSIQEKQKAEAAAKRAERAQHKQELEKSLHRSKISTASLGKFDKKLSGEP 244

Query: 236 KLKGVKRKFEP 246
            LKG KRKF P
Sbjct: 245 TLKGQKRKFNP 255



>gi|353237099|emb|CCA69080.1| related to RRS1-regulator of ribosome biogenesis [Piriformospora
           indica DSM 11827]
          Length = 668

 Score =  166 bits (419), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 93/247 (37%), Positives = 137/247 (55%), Gaps = 15/247 (6%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           L    S  +S  VE+ +PL  D  LLA FD+N +DE   +++ + YL+   RDG Q LIN
Sbjct: 6   LLASTSTGRSTVVEKDVPLVVDAGLLAVFDSNDIDEESFRSNPEEYLQSTARDGVQALIN 65

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYD 127
            +F LPI  ++ G LA LP    ++PR          T+WE+FA+AKGIQ + ++K I+D
Sbjct: 66  ALFTLPIQKTEDGPLARLPPIEMLLPRAKPLPKPKPLTKWEQFARAKGIQKKVRDKRIWD 125

Query: 128 EATGEWVPRWGYKGTNGDGANDWLIPVPQND----DPFEDQFSXXXXXXXXXXXXXXXXH 183
           E   EWV RWG  G N +    W+  VP N     DP ++                    
Sbjct: 126 EQKQEWVARWGRNGKNKEIEEQWITEVPDNAPDDYDPIKEARDVRKARVA---------- 175

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 243
            +N ++ +A + + +G  ++  RK EL+     +K +TAS+GKFDK L+G+ KL+G+KRK
Sbjct: 176 -KNEKQRQANIARAQGGPSKDERKAELRNTALQTKISTASMGKFDKKLEGDPKLRGIKRK 234

Query: 244 FEPSIGD 250
           FEP+ GD
Sbjct: 235 FEPNEGD 241



>gi|443900152|dbj|GAC77479.1| regulator of ribosome synthesis [Pseudozyma antarctica T-34]
          Length = 338

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 136/252 (53%), Gaps = 24/252 (9%)

Query: 13  SKYKSITV-ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SKYK  TV E   P Q+DL LL + + N +     ++ + + L+   RDG Q LIN+IF 
Sbjct: 24  SKYKPTTVDEGATPFQFDLGLLTSINPNPV-----RSTSADALRARARDGVQSLINRIFV 78

Query: 72  LPITT-SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           LP+T  ++ G LA LP   + +PRE         T+WEKFAK KGIQ R K+KMIYDEAT
Sbjct: 79  LPVTRDAEYGPLAALPAFASRLPREKSMPKPKPLTKWEKFAKQKGIQSRKKDKMIYDEAT 138

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI--- 187
           GEWVPRWGYKG N D    W+  +  N +   D                    ++N+   
Sbjct: 139 GEWVPRWGYKGANKDLEEQWIHELKNNGNTDLDPAKTAKKERLAKQAKNESQRQKNVARA 198

Query: 188 --EESEAALNQTKGA------------DARSLRKGELQRQIAISKSATASIGKFDKTLKG 233
               + A  + +KG               R  RK EL+  +  S+++TAS+G+FDKTLKG
Sbjct: 199 AAASASATASSSKGGLGDANAAKLARAAQRERRKAELEADVLRSRASTASMGRFDKTLKG 258

Query: 234 ELKLKGVKRKFE 245
           E K KG+KRKF+
Sbjct: 259 ESKAKGIKRKFD 270



>gi|72010693|ref|XP_781111.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Strongylocentrotus purpuratus]
          Length = 335

 Score =  163 bits (412), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 96/247 (38%), Positives = 134/247 (54%), Gaps = 14/247 (5%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           ++ KYKSI V+R + ++ DL  L A D NALD  + + +  +YL    RD TQLL NQ++
Sbjct: 17  EEKKYKSIEVQRDVEVEIDLGNLLACDPNALDLKKYRVNKGDYLSSIARDATQLLFNQLW 76

Query: 71  KLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           KLP+   +     +LPE  TV+PRE         T+WEK+AK KGI ++ K+  ++ E  
Sbjct: 77  KLPVHRVEDAITVKLPEPTTVLPREKRVPKDRPATKWEKYAKQKGIMNKKKSTKVWSEEE 136

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES 190
            +W+PR+GYK  N D   DWL+ VP N DP EDQFS                  RNI  +
Sbjct: 137 EKWIPRFGYKSKN-DLKKDWLLEVPANADPMEDQFSKKKKAKQERVAKNELQRLRNIARA 195

Query: 191 E------AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKR 242
           +        L  T+  D     K  + + I +SK +TASIGKF+  L  E  +K  G +R
Sbjct: 196 KKRKVPGVGLTPTEKPD-----KTMVNKAIHLSKHSTASIGKFENKLPKEPLIKNLGKRR 250

Query: 243 KFEPSIG 249
           KFEP +G
Sbjct: 251 KFEPVMG 257



>gi|390601451|gb|EIN10845.1| RRS1-domain-containing protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 309

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 131/244 (53%), Gaps = 7/244 (2%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            SD L +QKSK +S  VE+ +PL  D  LL   D N +D     +  ++YL+   RDG Q
Sbjct: 3   VSDILASQKSKERSTAVEKEVPLDVDAGLLTVTDLNPVDAEDYNSSVEDYLQSVARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            L+  +F LP ++S  G +A+LP   T +PR          T+WE+FAKAKGIQ + K+K
Sbjct: 63  ALLGALFSLPTSSSPDGPVAQLPPATTQLPRAKPLPKPKPPTKWEQFAKAKGIQKKRKDK 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
           +++DE   EWV RWG  G N +    W   VP N D   +                    
Sbjct: 123 VVWDEEKQEWVNRWGRDGKNKEKETQWATEVPANADVEHNPAKVARDARKARVAKNEKQK 182

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 243
            +N+  ++       G   +  RK ++ R +A ++ +TAS+G+FDKTL+GE KLKGVKRK
Sbjct: 183 LQNMARAQ-------GVGEKEKRKVDIDRTLATTRISTASLGRFDKTLEGEKKLKGVKRK 235

Query: 244 FEPS 247
           F P+
Sbjct: 236 FTPT 239



>gi|198435348|ref|XP_002125582.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Ciona
           intestinalis]
          Length = 324

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 95/246 (38%), Positives = 133/246 (54%), Gaps = 18/246 (7%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           ++ K  SI V + I +  D   L A D+N +D  +L++D +NYLK   R+GTQLL N+I+
Sbjct: 16  EEEKLLSIQVPKTIDVAIDAGNLLACDSNPIDTKQLRSDKENYLKNLAREGTQLLFNEIW 75

Query: 71  KLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           KLPI       +A++P   TVIPRE         T+WE++AK KGI+   K +M++D+ +
Sbjct: 76  KLPIERVQDAVIAKVPAPTTVIPREKPIPKAKPPTKWEEYAKLKGIRKLKKGRMVWDDES 135

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE- 189
             W PRWGYK  N D   +W++ VP N DP EDQF                   RN+   
Sbjct: 136 KSWKPRWGYKRAN-DDTKEWVLEVPANADPNEDQFEKKLKEKKERVAKNELQRLRNVARR 194

Query: 190 --------SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGE--LKLKG 239
                      A+ Q K +      K EL+    +SK ATAS+G+F +TLKGE  +K +G
Sbjct: 195 TGKKVPGVGRTAVGQEKQS------KLELEAAFHVSKQATASLGRFQETLKGEKNVKKRG 248

Query: 240 VKRKFE 245
            KRKFE
Sbjct: 249 QKRKFE 254



>gi|501309512|dbj|GAC98336.1| likely ribosome biogenesis regulatory protein [Pseudozyma
           hubeiensis SY62]
          Length = 340

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 135/252 (53%), Gaps = 24/252 (9%)

Query: 13  SKYKSITVER-PIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SKYK+ +V++ P P Q+DL LL + + N L  +     +  YL    RDG Q L+N+IF 
Sbjct: 24  SKYKTTSVDQGPTPYQFDLGLLTSINPNPLTST-----SSPYLLSRARDGVQSLVNKIFA 78

Query: 72  LPITTS-DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           LPIT   + G LA LP   + +PRE         T+WEKFAK KGIQ + K+KM++DEAT
Sbjct: 79  LPITRDPENGPLATLPAFTSKLPREKSMPKPKPMTKWEKFAKQKGIQSKKKDKMVFDEAT 138

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI--- 187
            EWVPRWGYKG N D  + W+  +  N +   D                      N+   
Sbjct: 139 KEWVPRWGYKGANKDAEDQWIHELKNNGNTDFDPAKTAKKERLAKQAKNEKQRLGNLARA 198

Query: 188 --EESEAALNQTKGA------------DARSLRKGELQRQIAISKSATASIGKFDKTLKG 233
               + ++ +  KG              AR  RK EL+  +  S+++TAS+GKFDKTLKG
Sbjct: 199 AAASTASSSSSNKGGLGDANAAKLARAAAREKRKAELEADVLRSRASTASMGKFDKTLKG 258

Query: 234 ELKLKGVKRKFE 245
           E K KG+KRKF+
Sbjct: 259 EHKQKGLKRKFD 270



>gi|392579956|gb|EIW73083.1| hypothetical protein TREMEDRAFT_22893, partial [Tremella
           mesenterica DSM 1558]
          Length = 267

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 80/229 (34%), Positives = 131/229 (57%), Gaps = 4/229 (1%)

Query: 26  LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAEL 85
           ++ D  LLAAFD + ++     ++  ++L + T   T  LI+ +F+LP T++  G + +L
Sbjct: 1   VEVDAGLLAAFDNSPVEPEAYSSNLPSHLLDLTLTSTHHLISTLFQLPTTSTASGLMVQL 60

Query: 86  PEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGD 145
           P   T++PRE         T+WE+FAK KGI H+ +++M++D+   EWV RWG  G N +
Sbjct: 61  PAAKTLLPREKPLPKPKPLTKWERFAKEKGISHKQRDRMVFDDERQEWVKRWGRGGKNKE 120

Query: 146 GANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALN----QTKGAD 201
               W+  V   +DP  D  +                H+ N+  + A  +      + ++
Sbjct: 121 VEEQWIHEVKAGEDPDHDPAASAKKARKERVAKNEAQHKANLAHATAPTSTRSISAQNSE 180

Query: 202 ARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSIGD 250
            RS RK EL+R + ++K++TAS+GKFDK ++GE K KGVKRKFEP++G+
Sbjct: 181 NRSKRKVELERSMLLTKTSTASLGKFDKKIEGEPKTKGVKRKFEPNVGE 229



>gi|472588228|gb|EMS25700.1| ribosomal biogenesis regulatory protein [Rhodosporidium toruloides
           NP11]
          Length = 338

 Score =  159 bits (401), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 132/254 (51%), Gaps = 16/254 (6%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           LE    + K+I VER IP+  DL LLA FD N +D    +ND +  L ++ RDG QLL+N
Sbjct: 7   LEQSSQRQKAIAVEREIPVDIDLGLLAVFDPNPIDLDTYQNDKERALLDHARDGIQLLVN 66

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREXXXXXX----------XXXTRWEKFAKAKGIQ 117
            I+  P    D G +A+LP   T +PRE                   T+W+ FAKAKGI 
Sbjct: 67  DIWSQPTRVVDDGVIADLPPISTALPREKPARADLENVCQLPKPAAMTKWQAFAKAKGIA 126

Query: 118 HR-NKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXX 176
            +  K+KM+YDE   EWVPRWG+KG N D    WL  V    D   D  +          
Sbjct: 127 PKAKKDKMVYDEEKQEWVPRWGFKGKNRDAEGQWLHEVKPTADTDFDPRAAARSERKARW 186

Query: 177 XXXXXXHRRNIEESEA-ALNQTKGADA----RSLRKGELQRQIAISKSATASIGKFDKTL 231
                    N++ + A A  QT+ +      R  RKGEL+R +  +K +TAS+G+FD  L
Sbjct: 187 LKNESQRLANLQRAAANAAKQTQQSATKQTEREKRKGELERTLRSTKRSTASLGRFDDKL 246

Query: 232 KGELKLKGVKRKFE 245
           +GE + K VKRKF+
Sbjct: 247 QGEGREKNVKRKFD 260



>gi|402226300|gb|EJU06360.1| RRS1-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 311

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 132/247 (53%), Gaps = 3/247 (1%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            SD L    SK KSI VE+ IPL  D+A L A D N +DE   KN+ + YL    R+  Q
Sbjct: 3   VSDLLRAGASKQKSIQVEKGIPLDIDIAYLTATDPNPMDEEEYKNEREEYLHSMARENAQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
           LLIN +F LP+T+S  G +A+LP   T +PR          TRWEKFA AKGIQ + +  
Sbjct: 63  LLINHLFSLPVTSSPDGPIAQLPPPTTSLPRAKPLPKPKPPTRWEKFAAAKGIQKKRREN 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
            ++DE    +  RWG  G N +    WL+ VPQN     D                    
Sbjct: 123 KVWDEEKQVFRDRWGRGGKNKELEEQWLVEVPQNAPMDYDPVKEARDAKTKRIAKNEGQR 182

Query: 184 RRNIE---ESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
            +NI+    ++++ +Q      R   K +L R +A ++ +TAS+GKFDK  +GE KL+GV
Sbjct: 183 LKNIQRAARAKSSTSQLNPGQEREKLKVQLDRDLAQTRVSTASMGKFDKKFEGEAKLRGV 242

Query: 241 KRKFEPS 247
           KR+F+P+
Sbjct: 243 KRQFDPN 249



>gi|465793145|emb|CCU98266.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 296

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 128/230 (55%), Gaps = 7/230 (3%)

Query: 25  PLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT-TSDLGKLA 83
           PLQ D+ LLA+FD N +     K D +  L+   R+ TQ L+N +F+LPI   +  G LA
Sbjct: 15  PLQLDVGLLASFDFNPISARAFKKDPEGVLQARARNATQHLVNTLFQLPIERHATYGPLA 74

Query: 84  ELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTN 143
            LP   T +PRE         T+WEKFAKAKGI  R K+KMI+DE   EWVPRWGY+G N
Sbjct: 75  SLPAFETELPREKPVPKPKPLTKWEKFAKAKGITKRKKDKMIFDEERQEWVPRWGYQGAN 134

Query: 144 GDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKG---- 199
               + WL+ VP N D                       H+RN+  + AA    KG    
Sbjct: 135 KKLEDQWLVEVPTNADDDYRPDREAAKERKARQAKNEAQHQRNLARNAAAPAAPKGELGS 194

Query: 200 --ADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 247
             A +R+ R+  L+  +  ++ +TAS+G+FDK+L+GE K +GVKR F+P+
Sbjct: 195 GVAPSRARRRAALEADLLRARGSTASLGRFDKSLEGESKPRGVKRTFQPN 244



>gi|71021335|ref|XP_760898.1| hypothetical protein UM04751.1 [Ustilago maydis 521]
 gi|46100994|gb|EAK86227.1| hypothetical protein UM04751.1 [Ustilago maydis 521]
          Length = 341

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 134/259 (51%), Gaps = 26/259 (10%)

Query: 13  SKYKSITVER-PIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SKYK  TV++   P Q+D+ LLA+ + N +        +  +L + TRDG Q L+N+IF 
Sbjct: 24  SKYKPTTVDQGSTPYQFDVGLLASINPNPVTAC-----SAAHLADRTRDGVQSLVNKIFA 78

Query: 72  LPITTS-DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           LPIT   D G LA LP   + +PRE         T+WEKFAK KGIQ R K+KM++DE T
Sbjct: 79  LPITRDPDHGPLASLPAFTSKLPREKSMPKPKPLTKWEKFAKQKGIQSRKKDKMVFDENT 138

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE- 189
            EWVPRWG+KG N D    W+  +  N +   D                      N+   
Sbjct: 139 QEWVPRWGFKGANKDLEEQWIHELKNNGNTDMDPAKTAKKERLAKKQKNEKQRLGNLARA 198

Query: 190 ------------------SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTL 231
                              +A   +   A AR  RK EL+  +  S+++TAS+G+FDKTL
Sbjct: 199 AASTAASSAASSSSKGGLGDANPAKLARAAAREKRKAELEADVLRSRASTASMGRFDKTL 258

Query: 232 KGELKLKGVKRKFEPSIGD 250
           +GE K KG+KRKF+P+  D
Sbjct: 259 QGEQKQKGLKRKFDPNEKD 277



>gi|328770705|gb|EGF80746.1| hypothetical protein BATDEDRAFT_6086 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 170

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 102/170 (60%), Gaps = 1/170 (0%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           ++VE+P+P+++DL  LAAFD N LDE+ L+ N  DNYLK+++RDG QLLIN IF L   +
Sbjct: 1   VSVEKPVPVEFDLRCLAAFDPNPLDETELRSNKVDNYLKQWSRDGAQLLINAIFGLETNS 60

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPR 136
           +D G  A LP  I+ IPR          TRWEKFA  KGIQ + K++M YDE+T  + PR
Sbjct: 61  NDDGYFAILPNLISRIPRAKPIPKENNKTRWEKFAAVKGIQKKKKSRMEYDESTQTYNPR 120

Query: 137 WGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRN 186
           +GYKG   D   DW+I VP N DP  DQ+                  RRN
Sbjct: 121 YGYKGGEKDNLKDWIIEVPDNADPMVDQYQQKREEKKGRVEKNQMQQRRN 170



>gi|471908923|emb|CCO28186.1| Ribosome biogenesis regulatory protein homolog [Rhizoctonia solani
           AG-1 IB]
          Length = 325

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/240 (36%), Positives = 131/240 (54%), Gaps = 5/240 (2%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           +E + SK K++TVE+ IP+Q D+ LL+A DTN +D      D + +L+   RDG Q+++ 
Sbjct: 7   VEAEASKRKAVTVEKDIPIQIDIGLLSALDTNPVDVDAYNTDLEAHLQAVARDGAQVILG 66

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYD 127
            +F LP   SD G +A LP   T +PR          T+WE+FA AKGIQ   +++ ++D
Sbjct: 67  ALFGLPTQPSDDGPIATLPAPTTTLPRAKPLPKPKPPTKWERFAAAKGIQKTVRDRRVWD 126

Query: 128 EATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI 187
           E   EWV RWG+ G N D    W+  VP N     D                     RN+
Sbjct: 127 EERQEWVNRWGWNGKNKDQEEQWIHEVPDNAPDDYDPAMESRKERKARVDKNEKQKERNL 186

Query: 188 EESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 247
             + A+  +      R   K +L R +AI++++TAS+G+FDK L G+ KLKG+KR+F P+
Sbjct: 187 TMAAASSQRE-----REEVKSKLNRTLAITRTSTASMGRFDKKLDGDTKLKGIKRQFAPN 241



>gi|393246467|gb|EJD53976.1| RRS1-domain-containing protein [Auricularia delicata TFB-10046 SS5]
          Length = 316

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 131/242 (54%), Gaps = 8/242 (3%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S  ++ Q++K+KS  VE+ IPL+ D+ LL   D N  DE   K + +NYL+   RDG Q
Sbjct: 3   VSSIVKEQQAKFKSTVVEKDIPLEVDVGLLTVTDPNPTDEDAYKANLENYLQSTARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            L+  +F LP  +S  G LA LP   T +PR          T+WE+FA AKGIQH+ +++
Sbjct: 63  SLVAALFALPTKSSPDGPLALLPAPTTQLPRAKPLPKPKPPTKWERFAAAKGIQHKTRDR 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
            ++DE   EWV RWG +G N +  + W+  VP N     D                    
Sbjct: 123 KVFDEEKQEWVNRWGLRGKNKETEDQWITEVPANAPADFDPAKEARDKRKERVAKNEKQR 182

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 243
            +N+  ++            + RK EL+R  A+++S+TAS+GKFDK L+GE KL+G KRK
Sbjct: 183 EQNVARAQGTT--------LAERKKELERSSALARSSTASMGKFDKKLEGEGKLRGQKRK 234

Query: 244 FE 245
           F+
Sbjct: 235 FD 236



>gi|443927102|gb|ELU45633.1| RRS1 domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 314

 Score =  155 bits (393), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 88/240 (36%), Positives = 134/240 (55%), Gaps = 15/240 (6%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           +E + SK K++TVE+ IP+Q D+ LL+A DTN +D      D +++L+   RDG Q+++ 
Sbjct: 7   VEAEASKKKAVTVEKDIPIQIDIGLLSALDTNPIDTEAYNTDLESHLQAVARDGAQVILG 66

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYD 127
            +F LP   SD G +A LP   T +PR          T+WE+FA AKGIQ   +++  +D
Sbjct: 67  ALFGLPTQPSDDGPIATLPPPTTALPRAKPLPKPKPPTKWERFAAAKGIQKTKRDRREWD 126

Query: 128 EATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI 187
           E   EWV RWG+KG N D    W+  VP N                           RN+
Sbjct: 127 EERQEWVNRWGWKGKNKDQEEQWIHEVPDN----------ARKERKARVTKNEKQRERNL 176

Query: 188 EESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 247
             + AA++  +    R   K +L R +A+++++TAS+G+FDK L+G+ KLKG+KR+F P+
Sbjct: 177 --NVAAVSSQR---EREETKSKLNRTLAVTRTSTASMGRFDKKLEGDTKLKGIKRQFAPN 231



>gi|195998666|ref|XP_002109201.1| hypothetical protein TRIADDRAFT_52982 [Trichoplax adhaerens]
 gi|190587325|gb|EDV27367.1| hypothetical protein TRIADDRAFT_52982 [Trichoplax adhaerens]
          Length = 348

 Score =  153 bits (386), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 135/250 (54%), Gaps = 8/250 (3%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           L+ Q  +YKS  V + I  + DL  L   D   +D   L++D +  L++  RD TQ LIN
Sbjct: 22  LQAQSRRYKSTEVSKNILPEVDLGNLLLIDRQPVDPQELQSDIEISLQQLARDNTQWLIN 81

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYD 127
           +I+KLP    +   L +LPE  T++ RE         T+WE++AKAKGIQ R + KM +D
Sbjct: 82  EIWKLPTQQMEDALLVQLPEPTTIVAREKPIPKPKPPTKWEQYAKAKGIQKRKRGKMTFD 141

Query: 128 EATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI 187
           E T  +  RWGYK    D +NDW+  VP+N DP+EDQF                   RNI
Sbjct: 142 EKTQTYKRRWGYKSVT-DDSNDWVKEVPENADPYEDQFEVAREAKKERIAKNELQRLRNI 200

Query: 188 EESEAA-LNQTKGADARSLR----KGELQRQIAISKSATASIGKFDKTLKGELKLK--GV 240
           E  +    N+ + +  +S +    + E+ + I  ++S+TAS G F K L  E +L+  GV
Sbjct: 201 ERRQKGFFNKFEASKGKSTKTKAAQEEVTKAIKDAQSSTASHGVFTKILPQEKRLRKAGV 260

Query: 241 KRKFEPSIGD 250
           +RK  P++GD
Sbjct: 261 RRKLPPNLGD 270



>gi|58262216|ref|XP_568518.1| ribosome biogenesis-related protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134118646|ref|XP_772025.1| hypothetical protein CNBN0080 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50254630|gb|EAL17378.1| hypothetical protein CNBN0080 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57230692|gb|AAW47001.1| ribosome biogenesis-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 313

 Score =  152 bits (385), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 123/234 (52%), Gaps = 3/234 (1%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           +  + R  P+  D ALLAAFD + LD +    D + +L + T   T  L+  +F LP T 
Sbjct: 16  TAVLPRAAPVHTDPALLAAFDASPLDPAAYA-DRERHLLQLTLTSTHALVAALFALPTTP 74

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPR 136
           S  G +   P   T++PRE         T+WE+FAK KGI HR K K ++DE   EWVPR
Sbjct: 75  SSAGPVTAFPPPTTLLPREKPLPTPKAPTKWERFAKEKGISHRKKEKDVWDEERQEWVPR 134

Query: 137 WGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQ 196
           WG  G N D  + WL  V   D+  +D                   H  N+  + A++  
Sbjct: 135 WGRFGKNKDKEDQWLHEVKPGDEADQDPGKTARGERKARIAQNTKQHSANLAVASASVTA 194

Query: 197 TK--GADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSI 248
            +   A  R+ RK EL R + ISK++TAS+GKFD  ++GE K +G+KRKF+ +I
Sbjct: 195 ARATAASERAARKEELNRNMLISKTSTASLGKFDNKIEGEPKARGMKRKFDANI 248



>gi|343426175|emb|CBQ69706.1| related to RRS1-regulator of ribosome biogenesis [Sporisorium
           reilianum SRZ2]
          Length = 340

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 133/258 (51%), Gaps = 25/258 (9%)

Query: 13  SKYKSITV-ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SKYK   V E   P Q+DL LL + + N +  +     T   L E  RDG Q L+N+IF 
Sbjct: 24  SKYKPTLVDEGATPYQFDLGLLTSINPNPVSST-----TSAALLERARDGVQSLVNRIFA 78

Query: 72  LPITT-SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           LP+T  ++ G LA LP     +PRE         T+WEKFAK KGIQ R K+KM++DEAT
Sbjct: 79  LPVTRDAEHGPLATLPPFTARLPREKSMPKPKPLTKWEKFAKQKGIQSRKKDKMVFDEAT 138

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI--- 187
            EWVPRWG+KG N D    W+  +  N +   D                      NI   
Sbjct: 139 QEWVPRWGFKGANKDLEQQWIHELKNNGNTDMDPAKTAKKERLAKQAKNEKQRLGNIARA 198

Query: 188 ---EESEAALNQTKGA------------DARSLRKGELQRQIAISKSATASIGKFDKTLK 232
                S AA + +KG              AR  RK +L+  +  S+++TAS+G+FDKTL 
Sbjct: 199 AASTASSAAASSSKGGLGDANAAKLARAAAREQRKAQLEADVLRSRASTASMGRFDKTLA 258

Query: 233 GELKLKGVKRKFEPSIGD 250
           GE K KG+KRKF+P+  D
Sbjct: 259 GESKPKGIKRKFDPNEKD 276



>gi|388857200|emb|CCF49213.1| related to RRS1-regulator of ribosome biogenesis [Ustilago hordei]
          Length = 353

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/262 (37%), Positives = 132/262 (50%), Gaps = 33/262 (12%)

Query: 13  SKYKSITV-ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           SK+K  +V E P   Q+DL LL + + N L  S L   T   L   TRDG Q L+N+IF 
Sbjct: 24  SKFKPTSVDESPTAFQFDLGLLTSINPNPLPSSPL---TPEILLSRTRDGVQSLVNRIFT 80

Query: 72  LPITTS-DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           LPIT   + G LA LP+  + +PRE         T+WEKFAK KGIQ + K+KMIYDE T
Sbjct: 81  LPITRDPENGPLAVLPQFTSKLPREKSMPKPKPLTKWEKFAKQKGIQSKKKDKMIYDENT 140

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI--E 188
            EW+PRWGYKG N D  + W+  +  N +   D                      N+   
Sbjct: 141 NEWLPRWGYKGANKDLEDQWIHELKNNANTDIDPAKTAKKERLAKKEKNEKQRMGNLARA 200

Query: 189 ESEAALNQTKGADA--------------------------RSLRKGELQRQIAISKSATA 222
            + ++ +  KG  +                          R  RK EL+  +  S+++TA
Sbjct: 201 AAASSASAVKGGKSGGLGDANASANANANANAAKLARAAAREKRKAELEADVLRSRASTA 260

Query: 223 SIGKFDKTLKGELKLKGVKRKF 244
           S+G+FDKTLKGE K KG+KRKF
Sbjct: 261 SMGRFDKTLKGEQKQKGIKRKF 282



>gi|391340812|ref|XP_003744730.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Metaseiulus occidentalis]
          Length = 341

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 132/241 (54%), Gaps = 9/241 (3%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPI 74
           +K+I VE+P+  ++D+  L   D NA++E + K +  +Y+   +RD  QLLIN++FK+P 
Sbjct: 19  FKTINVEKPLDCEFDIGELLVVDPNAIEEYKFKQNETDYVDNLSRDNVQLLINELFKIPT 78

Query: 75  TTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWV 134
              +   + +LP+ +T IPRE         T+WE++ K KG++   K K+++DEA+ EW 
Sbjct: 79  EVKEDTVVFQLPKPVTRIPREKPCPKPKPLTKWEEYRKKKGLRPAKKEKLVWDEASKEWK 138

Query: 135 PRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA-- 192
           PR+G K  N +    W IPVP+  DP  DQF                   RNI+ +    
Sbjct: 139 PRYGMKRINSE-KEVWAIPVPETADPMVDQFKLMREKKKERIAKNEFQRLRNIQRAHKID 197

Query: 193 --ALNQTKGADARSLRKGELQRQIAISKSATASIGKFDK--TLKGELKLKGVKRKFEPSI 248
             A++     D  +     + +  A++K +TAS+GKFD+   L+ E K+KG KRKF  +I
Sbjct: 198 KFAVSSVMPTDKPT--PELMSKAAAVAKGSTASLGKFDRKLALEKEAKIKGKKRKFVDNI 255

Query: 249 G 249
           G
Sbjct: 256 G 256



>gi|358057274|dbj|GAA96883.1| hypothetical protein E5Q_03556 [Mixia osmundae IAM 14324]
          Length = 500

 Score =  149 bits (377), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 125/247 (50%), Gaps = 22/247 (8%)

Query: 21  ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLG 80
           ER +P+  DL  L   D NALD  +   D +  L+   RDGTQLLIN IF   I +S  G
Sbjct: 180 ERRLPVNLDLGYLMLTDPNALDAQQFSEDREVTLRANARDGTQLLINAIFAQSIQSSSDG 239

Query: 81  KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR-NKNKMIYDEATGEWVPRWGY 139
            LA+LP    ++PRE         T+WEKFA++KGI  +  K+++++DE   +WVP +GY
Sbjct: 240 PLAQLPPPALMLPREKALPKPKPPTKWEKFARSKGITTKAKKDRLVFDEEKQDWVPSYGY 299

Query: 140 KGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI------------ 187
           KG N    + W++ VP N DP  D                     RNI            
Sbjct: 300 KGKNKQTEDQWIVEVPNNADPSFDPVKASKDERKARKLKNEQQRLRNITRTATAPTTVAA 359

Query: 188 ---------EESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLK 238
                      S+A          ++ RK EL+ ++A +K +TAS+G++D  LKGE K++
Sbjct: 360 AAAKEKQAIAASKALAGAKLDRPEQAARKRELESELATTKKSTASLGRYDTQLKGEGKVR 419

Query: 239 GVKRKFE 245
           GVKRKFE
Sbjct: 420 GVKRKFE 426



>gi|302691982|ref|XP_003035670.1| hypothetical protein SCHCODRAFT_73958 [Schizophyllum commune H4-8]
 gi|300109366|gb|EFJ00768.1| hypothetical protein SCHCODRAFT_73958 [Schizophyllum commune H4-8]
          Length = 306

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 125/248 (50%), Gaps = 26/248 (10%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S+ L  + +K+ S+ VE+ +PL+ D  LL   D N +DE       + Y    +RDG Q
Sbjct: 3   VSNLLAAEAAKFASVNVEKEVPLEVDAGLLTVTDLNLIDE-------EAYKCVPSRDGVQ 55

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
           +LI  +F LP  +S  G +A+LP  +T +PR          T+WE FA AKGIQ R K K
Sbjct: 56  VLIQSLFSLPTQSSPDGPIAQLPPPVTQLPRAKPLPKPKAPTKWEAFAAAKGIQKRRKEK 115

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND----DPFEDQFSXXXXXXXXXXXXX 179
            ++DE   EWV  WG  G N    + W+  VP N     DP                   
Sbjct: 116 KVWDEERQEWVNSWGRDGKNRQVEDQWIHEVPANAPVDFDP---------------RKAA 160

Query: 180 XXXHRRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKG 239
               +  I ++E         D  + RK EL + +A ++ +TAS+GKFDKTL GE KL+G
Sbjct: 161 RDERKERIAKNEKQRLANTARDQGTSRKAELDKTLATTRLSTASMGKFDKTLDGEKKLRG 220

Query: 240 VKRKFEPS 247
           +KRKF P+
Sbjct: 221 IKRKFAPN 228



>gi|170090662|ref|XP_001876553.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164648046|gb|EDR12289.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 318

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 129/243 (53%), Gaps = 7/243 (2%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S+ L    +K++S+TVE+  PL+ D   L   D N++DE     + + +L+   RDG Q
Sbjct: 3   VSNVLAAHAAKFQSVTVEKDTPLEVDAGYLLVTDLNSIDEETYNENLEEHLQSLARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            L   +F LP   S  G LA+LP  I  +PR          T+WE+FA AKGIQ + + K
Sbjct: 63  SLFTTLFNLPTRPSPDGPLAQLPPPIYQLPRAKPLPKPKPPTKWERFAAAKGIQKKVREK 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
            ++DE   EWV RWG  G N +    W+  VP N D   D                    
Sbjct: 123 RVWDEEKQEWVNRWGRDGKNKEVEQAWITEVPLNADVDHDPRKIARDARKERIA------ 176

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 243
            +N+++    + +  G + R  +K E+++ +A ++ +TAS+GKFDK L+GE K++GVKRK
Sbjct: 177 -KNLKQQTQNIARAAGNNPRQEKKQEIEKTLAAARISTASMGKFDKKLEGEKKVRGVKRK 235

Query: 244 FEP 246
           FEP
Sbjct: 236 FEP 238



>gi|170044045|ref|XP_001849672.1| regulator of ribosome biosynthesis [Culex quinquefasciatus]
 gi|167867283|gb|EDS30666.1| regulator of ribosome biosynthesis [Culex quinquefasciatus]
          Length = 352

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 124/232 (53%), Gaps = 9/232 (3%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ + +  D+  L A D N  D+   K D + YL + TRD TQLLIN +++LP
Sbjct: 17  KYKPITVEKHLEVTVDVGHLMATDPNYFDDDSFKKDQEQYLMDLTRDNTQLLINAVWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               +   +A++P   TV+PR          T+WE+ AKAKGI+ R ++K +YDE   +W
Sbjct: 77  TEREEEAVVAKMPAPKTVLPRARKLPVPKPLTKWEEIAKAKGIKKRVRDKKVYDEVLDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA 193
           VP +GY+    +   DW++ VPQN DP +D F                   RNI  + A 
Sbjct: 137 VPTYGYQRFKAEKEKDWVLEVPQNADPNKDMFQEKRDLRIDRIAKNEIARMRNI--ARAK 194

Query: 194 LNQTK-----GADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
             QT      G DA S R  EL     ++K++TAS+GKF + L  E + +G+
Sbjct: 195 KIQTPRTGFLGPDAASAR--ELVTAANVAKASTASVGKFQEKLTNEKQARGI 244



>gi|336373761|gb|EGO02099.1| hypothetical protein SERLA73DRAFT_132892 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 311

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 90/244 (36%), Positives = 125/244 (51%), Gaps = 7/244 (2%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S+ L +  +K++SI VE+  PL  D   L   D N +DE     + + YL+   RDG Q
Sbjct: 3   VSNILASHAAKFQSIDVEKETPLDVDTGFLTVTDLNPIDEDSYSTNLEEYLQSTARDGIQ 62

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            LI  ++ LP   S  G LA LP   T++PRE         T+WE+FA AKGIQ + + K
Sbjct: 63  ALIASLYSLPTKPSPDGPLAVLPPPTTLLPREKPLPKPKPPTKWERFASAKGIQKKVREK 122

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
            I+DE   EWV RWG  G N +  + W+  VP N       F                  
Sbjct: 123 KIWDEEKQEWVNRWGRDGKNKEKEDQWITEVPAN---AAVDFDPVKVARDARKSRVAQNE 179

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRK 243
           R+ ++     + +T     R  R  E+ R +A ++ +TAS+GKFDK L GE KLKG+KRK
Sbjct: 180 RQRLQN----VARTTAQSERQDRNKEIDRTLATTRLSTASMGKFDKKLDGEKKLKGIKRK 235

Query: 244 FEPS 247
           FEP+
Sbjct: 236 FEPT 239



>gi|432927905|ref|XP_004081085.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Oryzias
           latipes]
          Length = 338

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 135/241 (56%), Gaps = 5/241 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKL 72
           K K+I+V++ + L +D+  L A D N ++    K  + +++L+   RD TQLLIN+I+K+
Sbjct: 20  KLKTISVQKELDLDFDVGNLLACDKNRIESRDFKEQNKEDFLRSLARDNTQLLINEIWKV 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A+LPE  T +PRE         T+WE+FAK KGIQ + K  +++DE   E
Sbjct: 80  PTERVEEAIVAKLPEPTTRLPREKPPPKPKPPTKWEQFAKLKGIQKKKKTNLVWDETAKE 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGYK  N D   DWLI VPQ  DP EDQF+                  +N+  S+ 
Sbjct: 140 WRRRWGYKRAN-DDTKDWLIEVPQTSDPNEDQFAKRAHAKKERVAKNEFNRLKNVARSQK 198

Query: 193 ALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIG 249
             N   G   R+ + K EL + ++++K++TAS+G+F   L  E   K  G +RKFEP IG
Sbjct: 199 IKNPGVGLLPRAKQSKDELSKAVSVAKTSTASVGRFQDRLPKEKPPKNAGKRRKFEPLIG 258

Query: 250 D 250
           D
Sbjct: 259 D 259



>gi|395849345|ref|XP_003797289.1| PREDICTED: ribosome biogenesis regulatory protein homolog isoform 1
           [Otolemur garnettii]
 gi|395849347|ref|XP_003797290.1| PREDICTED: ribosome biogenesis regulatory protein homolog isoform 2
           [Otolemur garnettii]
          Length = 365

 Score =  145 bits (366), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 127/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + I L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKEIELEFDLGNLLAADRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEAVVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI----- 187
           W  RWGY+   GD   +WLI VP + DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYQRA-GDNTKEWLIEVPDSADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 188 --EESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T         K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQHPSAAGLHPTGHQS-----KEELGRAMQVAKVSTASVGRFQENLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|507938408|ref|XP_004679889.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Condylura cristata]
          Length = 366

 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 87/242 (35%), Positives = 128/242 (52%), Gaps = 6/242 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N   E R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLALDRNPPTELRRAGPTPETELRSLARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A+LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVAQLPEPTTRLPREKPVPKPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-E 191
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+  + +
Sbjct: 140 WRRRWGYQRAR-DNTKEWLIEVPDRADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 AALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSI 248
             L  + G      + K EL R + ++K +TAS+G+F + L  E   +G   KRKF+P  
Sbjct: 199 MQLPSSAGMHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLF 258

Query: 249 GD 250
           GD
Sbjct: 259 GD 260



>gi|328858583|gb|EGG07695.1| hypothetical protein MELLADRAFT_62505 [Melampsora larici-populina
           98AG31]
          Length = 375

 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 134/288 (46%), Gaps = 47/288 (16%)

Query: 7   QLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLI 66
            L   K++ KSI V R +P+  D+ LLA FD N +D S    + + YL+  TRDG Q L+
Sbjct: 6   HLLASKNQKKSIIVHREVPIDLDIGLLACFDPNPIDSSDYNTNREEYLQSVTRDGIQTLV 65

Query: 67  NQIFKLPITTSDLGKLAELPEQ--ITVIPREXXXXXXXXXTRWEKFAKAKGIQ-HRNKNK 123
           N +F LP  +++ G LA LP     T++PR          T+W+KFAK KGI   + + K
Sbjct: 66  NALFALPTISTNDGVLATLPHSGPSTLLPRAKPLPKAAPLTKWQKFAKDKGIAPKQQREK 125

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQF-------SXXXXXXXXXX 176
           M++DE   EWV RWG+KG N D    W+  V   +D  E          +          
Sbjct: 126 MVFDEDKQEWVNRWGWKGKNKDEETAWIREVKAGEDQEEGALERNVGKRARKERTIKNQK 185

Query: 177 XXXXXXHRRNIEESEAAL---------NQT------KGADARSL---------------- 205
                  R N E S+++          NQT        AD R+                 
Sbjct: 186 QQLKNIQRANAETSKSSTTAILESSTSNQTVSTTIRNKADVRAAKIAANTEKTRAEGMAR 245

Query: 206 ------RKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 247
                 RK EL+  I  SK +TAS+GKFDK    E K KG+KRKFEP+
Sbjct: 246 REEQQKRKSELEGLIQTSKKSTASLGKFDKKFASEPKPKGIKRKFEPA 293



>gi|403164650|ref|XP_003324729.2| hypothetical protein PGTG_06266 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375165255|gb|EFP80310.2| hypothetical protein PGTG_06266 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 349

 Score =  144 bits (363), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 138/255 (54%), Gaps = 19/255 (7%)

Query: 12  KSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIF 70
           K+K KS+TV+R IP+  D+ LLAAFD N +D+    +   + YLK+  RD  Q+L+N++F
Sbjct: 11  KTKRKSVTVQREIPIDLDVGLLAAFDPNPIDQPEYNSAGREEYLKQSARDSIQVLVNKLF 70

Query: 71  KLPITTSDLGKLAELPEQ--ITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYD 127
            LP + +D G +A LP     T++PR          T+WEKF+K KGI  + K ++M +D
Sbjct: 71  GLPTSLTDDGVVANLPASGLTTILPRSKRLPKPKPLTKWEKFSKDKGIAPKAKRDRMEFD 130

Query: 128 EATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRR-- 185
               EWV RWG+ G N D  N W+  V  +++                        +R  
Sbjct: 131 TEKQEWVNRWGFNGKNKDPENAWIREVKPSEELTNPGLEINHAKRARKERTLKNEKQRLK 190

Query: 186 NIEESE---AALNQTKGADARSL----RKGELQRQ------IAISKSATASIGKFDKTLK 232
           N+E +    A  N TK  +A +     R+ +LQR+      ++ +K +TAS+GKFDK   
Sbjct: 191 NVERAATEIAKSNSTKVLEASTAPLAKREEQLQRKQEVEGLLSATKKSTASLGKFDKKFA 250

Query: 233 GELKLKGVKRKFEPS 247
            E K+KG+KRKFEP+
Sbjct: 251 NEPKVKGLKRKFEPT 265



>gi|426359826|ref|XP_004047162.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Gorilla
           gorilla gorilla]
          Length = 365

 Score =  144 bits (362), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 129/247 (52%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N   + R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTQLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQLPSAAGLHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|297682996|ref|XP_002819191.1| PREDICTED: ribosome biogenesis regulatory protein homolog, partial
           [Pongo abelii]
          Length = 399

 Score =  142 bits (359), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 126/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 122 KLQRITVHKELELEFDLGNLLASDRNPPTRLRCAEPTPEAELRALARDNTQLLINQLWQL 181

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 182 PTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 241

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+     
Sbjct: 242 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 300

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T         K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 301 MQLPSAAGLHPTGHQS-----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 355

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 356 FQPLFGD 362



>gi|14719402|ref|NP_055984.1| ribosome biogenesis regulatory protein homolog [Homo sapiens]
 gi|21431847|sp|Q15050.2|RRS1_HUMAN RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|12804751|gb|AAH01811.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Homo
           sapiens]
 gi|15278392|gb|AAH13043.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Homo
           sapiens]
 gi|119607306|gb|EAW86900.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Homo
           sapiens]
 gi|123984836|gb|ABM83698.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)
           [synthetic construct]
 gi|157928500|gb|ABW03546.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)
           [synthetic construct]
 gi|168274376|dbj|BAG09608.1| ribosome biogenesis regulatory protein homolog [synthetic
           construct]
          Length = 365

 Score =  142 bits (359), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 126/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + LQ+DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRK 243
               S A L+ T         K EL R + ++K +TAS+G+F + L  E   +  G KRK
Sbjct: 199 MQLPSAAGLHPTGHQS-----KEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|434779|dbj|BAA04948.1| KIAA0112 [Homo sapiens]
          Length = 399

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 126/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + LQ+DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 54  KLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQLWQL 113

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 114 PTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 173

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+     
Sbjct: 174 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 232

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRK 243
               S A L+ T         K EL R + ++K +TAS+G+F + L  E   +  G KRK
Sbjct: 233 MQLPSAAGLHPTGHQS-----KEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRK 287

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 288 FQPLFGD 294



>gi|344304506|gb|EGW34738.1| hypothetical protein SPAPADRAFT_57806 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 203

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 76/159 (47%), Positives = 100/159 (62%), Gaps = 14/159 (8%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTD--NYLKEYTRDGTQLLIN 67
           + +++YK +TV++PIP  YDL  LA FD N LD S+L +D+D   YL   TRD  QLLIN
Sbjct: 2   SNETEYKPVTVDKPIPNTYDLGNLATFDPNPLDNSKLTSDSDREEYLTSVTRDNVQLLIN 61

Query: 68  QIFKLPI-TTSDLG----------KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI 116
           QI  LP+ TT+D             L +LPE  T +PRE         T+WE+FA  KGI
Sbjct: 62  QILSLPVKTTTDTHGSSTGQNSTMTLIQLPEPSTQLPREKAIPKPKPPTKWEQFAARKGI 121

Query: 117 QHRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           + + K+ KM+YDEATGEWVP+WGYKG N +  + WL+ V
Sbjct: 122 KAKAKDGKMVYDEATGEWVPKWGYKGKNKELDDQWLVEV 160



>gi|189230132|ref|NP_001121390.1| uncharacterized protein LOC100158478 [Xenopus (Silurana)
           tropicalis]
 gi|158253555|gb|AAI54207.1| Rrs1 protein [Danio rerio]
 gi|183986130|gb|AAI66088.1| LOC100158478 protein [Xenopus (Silurana) tropicalis]
          Length = 346

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 129/241 (53%), Gaps = 5/241 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKL 72
           K KSITV + + L++D  LL AFD N LD    K N  ++ L+   RD TQLLIN+I+KL
Sbjct: 20  KLKSITVLKELDLEFDPGLLLAFDKNRLDTRDFKGNKREDCLRSLARDNTQLLINEIWKL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    D   +A+LPE  T +PRE         T+W +FAK KGIQ R K  +++DE   E
Sbjct: 80  PTERVDEVIVAKLPEPTTKLPREKPAPKPKPPTKWGQFAKLKGIQKRKKTNLVWDEVHKE 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGYK    D   +WLI VP   DP EDQ +                  +N+  ++ 
Sbjct: 140 WKRRWGYKRAK-DDTKEWLIEVPATADPNEDQLAKRNKANKERVARNEYNRLKNVARAQK 198

Query: 193 ALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIG 249
                 G    S + K EL + ++++K +TAS+GKF + L  E   +  G KRKF+P IG
Sbjct: 199 VKVPGTGLLPTSQQTKAELAQAVSLAKISTASVGKFQEKLPKEKPARNTGKKRKFQPLIG 258

Query: 250 D 250
           D
Sbjct: 259 D 259



>gi|471364113|ref|XP_004372607.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Trichechus manatus latirostris]
          Length = 365

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/246 (35%), Positives = 126/246 (51%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTLEAELRGLARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRVQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 199 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGTGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|321463110|gb|EFX74128.1| hypothetical protein DAPPUDRAFT_307435 [Daphnia pulex]
          Length = 356

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 87/256 (33%), Positives = 128/256 (50%), Gaps = 11/256 (4%)

Query: 3   YFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGT 62
             S   E +  K KSI V++ + L+YD+  L A+D N +D ++ + D + YL   +RD  
Sbjct: 9   VLSKAAEDEAEKLKSIQVDKVVELEYDVGNLLAYDINDIDVNQFRADKEAYLANLSRDNV 68

Query: 63  QLLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN 122
           QLLINQIF+LP    D   + +LP   T +PR          ++WEK+AK KGI  R K+
Sbjct: 69  QLLINQIFQLPTIKVDNEVVIKLPSATTRLPRAKPAPKEKALSKWEKYAKEKGITKRKKS 128

Query: 123 KMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXX 182
           K  +DE   +WVPR+G+K    +   +W++ VP N     D  +                
Sbjct: 129 KATWDEELQKWVPRFGFKKALAEKEKNWVVEVPGNAKDDVDPIALRKTKKQESVAKNELQ 188

Query: 183 HRRNIEESEAALNQTKGADARSLRKGE------LQRQIAISKSATASIGKFDKTLKGELK 236
             RNI    A + ++K     SL   E      L R + I+ +ATAS+GKF   LK +  
Sbjct: 189 RLRNI---SARMQKSKTKAKISLEPTERPTAEQLNRSVFIAHTATASVGKFQPNLKEQKP 245

Query: 237 L--KGVKRKFEPSIGD 250
           +   G KR F+P +GD
Sbjct: 246 VLKSGQKRHFDPLVGD 261



>gi|157131695|ref|XP_001662293.1| ribosome biogenesis regulatory protein [Aedes aegypti]
 gi|94469176|gb|ABF18437.1| regulator of ribosome synthesis [Aedes aegypti]
 gi|108871437|gb|EAT35662.1| AAEL012185-PA [Aedes aegypti]
          Length = 347

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 121/237 (51%), Gaps = 4/237 (1%)

Query: 8   LETQK---SKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQL 64
           LE QK    KYK ITV++ +    D   L   D N  D+ + K+D + YL + TRD TQL
Sbjct: 8   LEKQKKDLEKYKPITVQKHLEAVVDEGHLMVTDPNYFDDDKFKSDREQYLLDLTRDNTQL 67

Query: 65  LINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKM 124
           LIN I++LP    +   +A+LP    V+PR          T+WE+ AKAKGI+ R ++K 
Sbjct: 68  LINSIWELPTEREEESVVAKLPAARMVLPRARKLPVPKPLTKWEQIAKAKGIKKRTRDKK 127

Query: 125 IYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHR 184
           +YDE   +WVP +GY+    +   DW+I VPQN DP +D F+                  
Sbjct: 128 VYDEVLDKWVPTYGYQRFKAEKEKDWIIEVPQNADPNKDMFAEKRDLRIERIAKNEISRM 187

Query: 185 RNIEESEAALNQTKG-ADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           RNI  ++       G     S    EL     I+K++TAS+G F + L  E + +G+
Sbjct: 188 RNIARAKKIQTPRTGFLGPESASAKELVTAANIAKASTASVGVFQEKLSNEKQARGI 244



>gi|397522742|ref|XP_003831415.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Pan
           paniscus]
          Length = 365

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 127/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + LQ+DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELQFDLGNLLASDRNPPTRLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE + +
Sbjct: 80  PTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSSQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQLPSAAGLHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|227908779|ref|NP_067486.2| ribosome biogenesis regulatory protein homolog [Mus musculus]
 gi|21362904|sp|Q9CYH6.1|RRS1_MOUSE RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|12857046|dbj|BAB30871.1| unnamed protein product [Mus musculus]
 gi|13097501|gb|AAH03481.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Mus
           musculus]
 gi|33416756|gb|AAH55925.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Mus
           musculus]
 gi|74206412|dbj|BAE24922.1| unnamed protein product [Mus musculus]
 gi|148682331|gb|EDL14278.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Mus
           musculus]
          Length = 365

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 129/247 (52%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DEA+G+
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEASGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGYK    D   +WLI VP + DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYKRAR-DDTKEWLIEVPGSADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQMPSSAGLHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|7670442|dbj|BAA95072.1| unnamed protein product [Mus musculus]
          Length = 365

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 129/247 (52%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DEA+G+
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEASGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGYK    D   +WLI VP + DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYKRAR-DDTKEWLIEVPGSADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQMPSSAGLHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|357608815|gb|EHJ66162.1| putative regulator of ribosome biosynthesis [Danaus plexippus]
          Length = 353

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 120/230 (52%), Gaps = 4/230 (1%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           KYK ITVE+ + ++YDL  L  +DTN LD   L  ++  D YL+  +RD TQLL+N+I++
Sbjct: 17  KYKPITVEKHLDVEYDLGTLLVYDTNDLDSKLLNANSNRDEYLQSLSRDNTQLLLNKIWE 76

Query: 72  LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATG 131
           LP    D   +  LP+  TV+PR          T+W++FAKAKGI  + K+K+ +DE   
Sbjct: 77  LPTERIDEAIVVRLPQPTTVLPRSKPVPKPKPLTKWQEFAKAKGITKQKKDKLKWDEQLQ 136

Query: 132 EWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE 191
           +WVP +G++    +   DWLI VPQ+ DP  D +                   +NI  S 
Sbjct: 137 KWVPLYGFRKAAAEKEKDWLIEVPQHMDPMTDMYEKKAGEKSEKVAKNELQRLKNIARSR 196

Query: 192 AALNQTKGADARSLRKGELQRQIA--ISKSATASIGKFDKTLKGELKLKG 239
                  G    S +    Q   A  ++K++TAS+GKF   L  E + +G
Sbjct: 197 KVKIPRVGLPVTSDKASATQLSTAAVVAKASTASLGKFQDKLPKEQEARG 246



>gi|49022822|dbj|BAC65489.2| mKIAA0112 protein [Mus musculus]
          Length = 373

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 129/247 (52%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 28  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 87

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DEA+G+
Sbjct: 88  PTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEASGQ 147

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGYK    D   +WLI VP + DP EDQF+                  RN+     
Sbjct: 148 WRRRWGYKRAR-DDTKEWLIEVPGSADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHK 206

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 207 MQMPSSAGLHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 261

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 262 FQPLFGD 268



>gi|348588476|ref|XP_003479992.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Cavia
           porcellus]
          Length = 357

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/242 (35%), Positives = 127/242 (52%), Gaps = 6/242 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R      +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPAPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEAVVARLPEPTTRLPREKPVPKPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-E 191
           W  RWGYK    D   +WLI VP++ DP EDQF+                  RN+  + +
Sbjct: 140 WQRRWGYKRAR-DDTKEWLIEVPESADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 AALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSI 248
             L  T G      + K EL R + ++K +TAS+G+F + L  E   +G   KRKF+P  
Sbjct: 199 TQLPSTAGMHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLF 258

Query: 249 GD 250
           GD
Sbjct: 259 GD 260



>gi|12860310|dbj|BAB31912.1| unnamed protein product [Mus musculus]
          Length = 365

 Score =  141 bits (356), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/247 (36%), Positives = 129/247 (52%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DEA+G+
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEASGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGYK    D   +WLI VP + DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYKRAR-DDTKEWLIEVPGSADPMEDQFAKRTQAKKERVAKGELNRLRNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQMPSSAGLHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|431891814|gb|ELK02348.1| Ribosome biogenesis regulatory protein like protein [Pteropus
           alecto]
          Length = 371

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 129/246 (52%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R +  T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLALDRNPPTGLRREGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGY+    D   +WLI +P + DP EDQF+                  RN+  S  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEMPGSADPLEDQFAKRIQAKKERVAKNELNRLRNLARS-- 196

Query: 193 ALNQTKGADARSLR------KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
             ++T+   A  L       K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 197 --HKTQLPSAAGLHPTGHQSKEELGRALQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|507538708|ref|XP_004653370.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Jaculus
           jaculus]
          Length = 367

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 127/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLIN++++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTTVRHAGATPEAELRALARDNTQLLINELWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DEA+G+
Sbjct: 80  PTERVEEAVVARLPEPSTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEASGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGYK    D   +WLI VP   DP EDQF+                  +N+     
Sbjct: 140 WRRRWGYKRAR-DDTKEWLIEVPGGADPMEDQFAKRIQAKKERVAKNELNRLQNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T     R   K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQVPSAAGLHPT-----RPQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|440908356|gb|ELR58380.1| Ribosome biogenesis regulatory protein-like protein [Bos grunniens
           mutus]
          Length = 365

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 88/246 (35%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV++ + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVQKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPSTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 199 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|443689971|gb|ELT92238.1| hypothetical protein CAPTEDRAFT_171414 [Capitella teleta]
          Length = 341

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 88/253 (34%), Positives = 124/253 (49%), Gaps = 15/253 (5%)

Query: 7   QLETQK-SKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLL 65
           Q E +K + YKS  V++ I L  D   L A D N ++    ++    YL    RD  Q+L
Sbjct: 10  QAEAEKNASYKSTEVDKAIELDIDEGNLVAVDLNPINGKHYRSKCQTYLNHLARDNAQIL 69

Query: 66  INQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMI 125
            N I++LP    D   +A LPE+ T +PRE         TRWE++AK K I  R K  M+
Sbjct: 70  FNAIWQLPTKRVDEAIVAVLPEKKTSVPREKPVPKDQPMTRWEQYAKLKNIHKRKKETMV 129

Query: 126 YDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRR 185
           +D+A  EW PR+GYK   GD   DW++ VPQ+ DP+EDQF                   R
Sbjct: 130 WDDAVKEWRPRFGYKKA-GDEKRDWMLEVPQSADPYEDQFEKRGKAKNERVAKNELQRLR 188

Query: 186 NIEESE------AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLK- 238
           N+  +         L  T   D        ++R +A ++ +TAS+G+FD+ L  E   + 
Sbjct: 189 NVARNMKGKIPGVGLTPTDAPDV-----DHVKRSLAQAQKSTASLGRFDQKLSHEKPARN 243

Query: 239 -GVKRKFEPSIGD 250
            G KRK E S  D
Sbjct: 244 LGKKRKAELSSTD 256



>gi|296226606|ref|XP_002759025.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Callithrix jacchus]
          Length = 527

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 126/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 182 KLQRITVLKELELEFDLGNLLASDRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 241

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 242 PTERVEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 301

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+     
Sbjct: 302 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 360

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T         K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 361 MQLPSAAGLHPTGHQS-----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 415

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 416 FQPLFGD 422



>gi|344273133|ref|XP_003408381.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Loxodonta africana]
          Length = 365

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 125/246 (50%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTLEAELRSLARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGRADPLEDQFAKRVQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 199 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|470644583|ref|XP_004326595.1| PREDICTED: LOW QUALITY PROTEIN: ribosome biogenesis regulatory
           protein homolog [Tursiops truncatus]
          Length = 365

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 126/246 (51%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTDRVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEGSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + +++ +TAS+G+F + L  E   +G   KRKF
Sbjct: 199 LRLPSAAGMHPTGHQS----KEELGRAVQVARVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|466034379|ref|XP_004275011.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Orcinus
           orca]
          Length = 365

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 126/246 (51%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTDRVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEGSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + +++ +TAS+G+F + L  E   +G   KRKF
Sbjct: 199 LRLPSAAGMHPTGHQS----KEELGRAVQVARVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|512818753|ref|XP_004878921.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Heterocephalus glaber]
 gi|512959774|ref|XP_004842172.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Heterocephalus glaber]
 gi|351696434|gb|EHA99352.1| Ribosome biogenesis regulatory protein-like protein [Heterocephalus
           glaber]
          Length = 365

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 87/242 (35%), Positives = 124/242 (51%), Gaps = 6/242 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R      +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVSKELELEFDLGNLLASDRNPPTALRQAGPVPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI  + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPKPRPLTRWQQFARLKGIHPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-E 191
           W  RWGYK    D   +WLI VP   DP EDQF+                  RN+  + +
Sbjct: 140 WRRRWGYKRAR-DDTTEWLIEVPDGADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 AALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSI 248
             L  T G      + K EL R + ++K +TAS+G+F + L  E   +G   KRKF+P  
Sbjct: 199 TQLPSTAGMHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLF 258

Query: 249 GD 250
           GD
Sbjct: 259 GD 260



>gi|311253771|ref|XP_003125652.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Sus
           scrofa]
          Length = 365

 Score =  140 bits (352), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 88/246 (35%), Positives = 126/246 (51%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRHAGPTKEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEETLVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPSNADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 199 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|348512152|ref|XP_003443607.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Oreochromis niloticus]
          Length = 344

 Score =  140 bits (352), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 136/242 (56%), Gaps = 10/242 (4%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKLP 73
            KSI+V++ + L++D+  L A D N ++   L+  + +++L+   RD TQLLIN+I+K P
Sbjct: 21  LKSISVQKELDLEFDIGNLLACDKNRIEPRDLREKSKEDFLRALARDNTQLLINEIWKQP 80

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               +   +A+LPE  T +PRE         T+WE+FAK KGI+ + K  +++DE   EW
Sbjct: 81  TERVEEAIVAKLPEPTTRLPREKLPPKPRPPTKWEQFAKLKGIKKKKKTNLVWDETAKEW 140

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE-- 191
             RWGYK   GD   +WLI VP++ DP EDQF+                  +NI  S+  
Sbjct: 141 KRRWGYKRA-GDDTKEWLIEVPESADPNEDQFAKRVKAKKERVAKNELNRLKNIARSQKV 199

Query: 192 --AALNQTKGADARSLRKGELQRQIAISKSATASIGKF-DKTLKGELKLKGVKRKFEPSI 248
              A+  T  A   S  K EL R  +++K++TAS+G+F D+  K     KG KRKFEP I
Sbjct: 200 KIPAVTLTPKA---SQSKDELARAESVAKTSTASLGRFQDRLPKENPAKKGKKRKFEPLI 256

Query: 249 GD 250
           G+
Sbjct: 257 GN 258



>gi|498967615|ref|XP_004546707.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Maylandia zebra]
          Length = 344

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 136/242 (56%), Gaps = 10/242 (4%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKLP 73
            KSI+V++ + L++D+  L A D N ++   L+  + +++L+   RD TQLL+N+I+K P
Sbjct: 21  LKSISVQKELDLEFDIGNLLACDKNRIEPRDLREKSREDFLRALARDNTQLLVNEIWKQP 80

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               +   +A+LPE  T +PRE         T+WE+FAK KGI+ + K  +++DE   EW
Sbjct: 81  TERVEEAIVAKLPEPTTRLPREKLPPKPRPPTKWEQFAKLKGIKKKKKTNLVWDETAKEW 140

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE-- 191
             RWGYK   GD   +WLI VP++ DP EDQF+                  +NI  S+  
Sbjct: 141 KRRWGYKRA-GDDTKEWLIEVPESADPNEDQFAKRVKAKKERVAKNELNRLKNIARSQKV 199

Query: 192 --AALNQTKGADARSLRKGELQRQIAISKSATASIGKF-DKTLKGELKLKGVKRKFEPSI 248
              A+  T  A   S  K EL R  +++K++TAS+G+F D+  K     KG KRKFEP I
Sbjct: 200 KIPAVTLTPKA---SQSKDELARAESVAKTSTASLGRFQDRLPKENPAKKGKKRKFEPLI 256

Query: 249 GD 250
           G+
Sbjct: 257 GN 258



>gi|149721357|ref|XP_001494863.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Equus
           caballus]
          Length = 365

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 126/246 (51%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-LKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T    L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLATDRNPPTAVRSAGPTPEADLRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+    A
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGGADPMEDQFAKRIQAKKERVAKNELNRLRNL----A 194

Query: 193 ALNQTKGADARSLR------KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
             ++T+   A  +       K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 195 RAHKTQLPSAAGMHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|488584946|ref|XP_004477844.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Dasypus
           novemcinctus]
          Length = 365

 Score =  139 bits (351), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 87/242 (35%), Positives = 127/242 (52%), Gaps = 6/242 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPTLEAELRTLARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-E 191
           W  RWGY+    D   +WLI VP + DP EDQF+                  RN+  + +
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGSADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 AALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSI 248
             L  T G      + K EL R + ++K +TAS+G+F + L  E   +G   KRKF+P  
Sbjct: 199 TQLPSTAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLLKEKAPRGPGKKRKFQPVF 258

Query: 249 GD 250
           GD
Sbjct: 259 GD 260



>gi|109086632|ref|XP_001100635.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Macaca
           mulatta]
          Length = 530

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 125/247 (50%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 185 KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 244

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE + +
Sbjct: 245 PTERVEETIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSSQ 304

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+     
Sbjct: 305 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 363

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T         K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 364 MQLPSAAGLHPTGHQS-----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 418

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 419 FQPLFGD 425



>gi|472365593|ref|XP_004402349.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Odobenus
           rosmarus divergens]
          Length = 379

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/246 (35%), Positives = 124/246 (50%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-LKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T    LK   RD TQLLINQ+++L
Sbjct: 34  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPTPEVELKALARDNTQLLINQLWQL 93

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 94  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 153

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+  +  
Sbjct: 154 WRRRWGYQRAR-DDTKEWLIEVPGGADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 212

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 213 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 268

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 269 QPLFGD 274



>gi|296480600|tpg|DAA22715.1| TPA: ribosome biogenesis regulatory protein homolog [Bos taurus]
          Length = 365

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/246 (35%), Positives = 126/246 (51%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVLKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPSTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 199 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|12845436|dbj|BAB26750.1| unnamed protein product [Mus musculus]
          Length = 365

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 128/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLINQLWRL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++D A+G+
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDVASGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGYK    D   +WLI VP + DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYKRAR-DDTKEWLIEVPGSADPMEDQFAKRTQAKKERVAKNELNRLRNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQMPSSAGLHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|478523202|ref|XP_004435804.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Ceratotherium simum simum]
          Length = 365

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 128/246 (52%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRSAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K+ +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKSNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+    A
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGGADPLEDQFAKRIQAKKERVAKNELNRLRNL----A 194

Query: 193 ALNQTKGADARSL------RKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
             ++T+   A  +       K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 195 RAHKTQLPSAAGMLPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|119226200|ref|NP_001073167.1| ribosome biogenesis regulatory protein homolog [Rattus norvegicus]
 gi|182676579|sp|A1A5P2.1|RRS1_RAT RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|118763767|gb|AAI28747.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Rattus
           norvegicus]
 gi|149060956|gb|EDM11566.1| rCG30391 [Rattus norvegicus]
          Length = 365

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 128/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLL+NQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAELRALARDNTQLLVNQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGYK    D   +WLI VP + DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYKRAR-DDTKEWLIEVPGSADPMEDQFAKRIRAKKERVAKNELNRLRNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQMPSSAGLHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|312371076|gb|EFR19340.1| hypothetical protein AND_22646 [Anopheles darlingi]
          Length = 298

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 121/228 (53%), Gaps = 2/228 (0%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+P+    D+  L   D N  DE +LK + + Y+ + TRD  QLLIN +++LP
Sbjct: 17  KYKPITVEKPLEPTVDIGHLLVSDPNYFDEDKLKENREQYVLDVTRDNVQLLINSVWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               +   +A+LP   TV+PR          T+W++FA+AKGI+ R ++K +YDE   +W
Sbjct: 77  TERVEESIVAKLPAPRTVLPRARKLPVPKPLTKWQEFAQAKGIKKRTRDKKVYDEVLEKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-EA 192
           VP +GY+    +   DW++ VPQN DP+ D F                   +NI  + + 
Sbjct: 137 VPTYGYQRFKAEKERDWVLDVPQN-DPYRDMFKEKRDLRIERVAKNEVARMKNIARAKKI 195

Query: 193 ALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           A  +T      S    +L     + K++TAS+G F ++L  E + +G+
Sbjct: 196 ATPRTGFVGPDSASAKQLITASNVVKASTASVGVFQESLPNEKQARGI 243



>gi|355697994|gb|EHH28542.1| Ribosome biogenesis regulatory protein-like protein [Macaca
           mulatta]
          Length = 365

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 127/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE + +
Sbjct: 80  PTERVEETIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSSQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+     
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A L+ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 199 MQLPSAAGLHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRK 253

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 254 FQPLFGD 260



>gi|355779729|gb|EHH64205.1| Ribosome biogenesis regulatory protein-like protein [Macaca
           fascicularis]
          Length = 359

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 122/240 (50%), Gaps = 8/240 (3%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRCAGPTPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE    +PRE         TRW++FA+ KGI+ + K  +++DE   +
Sbjct: 80  PTERVEETIVARLPEPTPRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVRSQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 193 ALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 250
           A     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF+P  GD
Sbjct: 199 AGLHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLFGD 254



>gi|405978850|gb|EKC43211.1| Ribosome biogenesis regulatory-like protein [Crassostrea gigas]
          Length = 324

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 128/244 (52%), Gaps = 18/244 (7%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           ++S YK+I V + I L+ D   L   DTN LD ++LK + + YLK   RD TQLLIN ++
Sbjct: 15  RESHYKTIEVHKDIELEIDPGNLLTVDTNPLDATKLKKNREEYLKSLARDNTQLLINTLW 74

Query: 71  KLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           +LP    D   + ++P+   +             T+W+++A+ KGIQ R K++M++D+ +
Sbjct: 75  QLPTEKVDEAIVVKVPKDKAL-------------TKWQQYAQLKGIQKRKKSRMMWDDQS 121

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQN-DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE 189
            EW PRWGYK  N D   +W I VP N  DP  D F+                  RNI  
Sbjct: 122 KEWKPRWGYKRGN-DDTQEWCIEVPDNAADPNVDLFAKKNKEKKERVAKNELQRLRNIAR 180

Query: 190 SEAALNQTKG-ADARSLRKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEP 246
           S+ +     G     +  K  L + +A+++ +TASIGKF   L  E   K  G KRKFEP
Sbjct: 181 SQKSKVPGVGLTPTEAPSKDYLGKALALARKSTASIGKFTDKLPTEKPSKHTGKKRKFEP 240

Query: 247 SIGD 250
           + GD
Sbjct: 241 NYGD 244



>gi|291388062|ref|XP_002710493.1| PREDICTED: homolog of yeast ribosome biogenesis regulatory protein
           RRS1 [Oryctolagus cuniculus]
          Length = 369

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/242 (35%), Positives = 125/242 (51%), Gaps = 6/242 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R      +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPAPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-E 191
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+  + +
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGGADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 AALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSI 248
             L  T G      + K EL R + I+K +TAS+G+F + L  E   +G   KRKF+P  
Sbjct: 199 TQLPSTAGLHPTGHQSKEELGRAMQIAKVSTASLGRFQERLPKEKAPRGSGKKRKFQPLF 258

Query: 249 GD 250
           GD
Sbjct: 259 GD 260



>gi|115497948|ref|NP_001068949.1| ribosome biogenesis regulatory protein homolog [Bos taurus]
 gi|122136026|sp|Q2KIH4.1|RRS1_BOVIN RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|86438042|gb|AAI12637.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Bos
           taurus]
          Length = 365

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 88/246 (35%), Positives = 125/246 (50%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVLKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G 
Sbjct: 80  PTERVEEALVARLPEPSTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGR 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 199 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|478250752|gb|ENN71244.1| hypothetical protein YQE_12171, partial [Dendroctonus ponderosae]
          Length = 288

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 135/251 (53%), Gaps = 15/251 (5%)

Query: 9   ETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQ 68
           + + SKYK ITVE+ I L+YD+A L  +D N  +    + D + YL +  RD TQLLINQ
Sbjct: 12  QEESSKYKPITVEKHIDLEYDVASLLVYDFNQFNAQYFERDANGYLLDLARDNTQLLINQ 71

Query: 69  IFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDE 128
           +++LP    +   +A+LP   TV+PR          T+WE+FAK KGIQ + K+K+ +D+
Sbjct: 72  LWELPTERVEEAIVAKLPLPKTVLPRAKPVPKPKELTKWEQFAKEKGIQKKKKSKLSWDD 131

Query: 129 ATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIE 188
              +WVP +G+K +  +   +W++ VPQN DP EDQF+                  RNI 
Sbjct: 132 QLQKWVPLFGFKRSQAEKEKNWVLEVPQNADPTEDQFAKKTVSKSENVAKNELQRLRNIA 191

Query: 189 ESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV-------- 240
           +    +   + A A+     +LQ  + ++K++TAS+GKF   L  E +  GV        
Sbjct: 192 KRR-NIKIPRVASAK-----DLQAAVTVAKASTASLGKFQDRLPKEKEATGVTTITPGAS 245

Query: 241 -KRKFEPSIGD 250
            KRK  P  GD
Sbjct: 246 KKRKLPPVSGD 256



>gi|410987225|ref|XP_003999905.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Felis
           catus]
          Length = 365

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 86/242 (35%), Positives = 126/242 (52%), Gaps = 6/242 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPSPEAELQALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-E 191
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+  + +
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGGADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 AALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSI 248
             L  T G      + K EL R + ++K +TAS+G+F + L  E   +G   KRKF+P  
Sbjct: 199 MQLPSTGGMHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKFQPLF 258

Query: 249 GD 250
           GD
Sbjct: 259 GD 260



>gi|409079540|gb|EKM79901.1| hypothetical protein AGABI1DRAFT_113150 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 304

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 112/219 (51%), Gaps = 8/219 (3%)

Query: 29  DLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQ 88
           D   L   +T  +D      + +  +++  R+ +Q L+  +F LP T S  G+LA LP  
Sbjct: 27  DAGYLTVTNTTPIDADLYNENIEQSIEQNARESSQKLLGALFHLPSTASADGRLALLPPP 86

Query: 89  ITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGAN 148
              +PRE         T+WE+FA AKGIQ + + K I+DE   EWV RWG+KG N +G  
Sbjct: 87  TFALPREKPLPKAKEMTKWERFAAAKGIQKKKREKKIWDEEKQEWVDRWGWKGKNKEGET 146

Query: 149 DWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKG 208
            WL  VP N D   D                     +N+  S           + + RK 
Sbjct: 147 QWLHEVPSNADVDHDPRKIARDERKARTAKNEKQKLQNLSHST--------GQSSNDRKQ 198

Query: 209 ELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 247
           E++R +A ++ +TASIGKFD+ L+GE K +G+KRKFEP+
Sbjct: 199 EIERTLATTRVSTASIGKFDRQLEGEKKPRGIKRKFEPT 237



>gi|198463129|ref|XP_001352703.2| GA16881 [Drosophila pseudoobscura pseudoobscura]
 gi|198151125|gb|EAL30202.2| GA16881 [Drosophila pseudoobscura pseudoobscura]
          Length = 344

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 119/228 (52%), Gaps = 1/228 (0%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITV++ +  + D+  L   D N  D+  L+++ + YL   TRD TQLL+N I++LP
Sbjct: 17  KYKPITVDKHLECRLDVGTLLITDPNDFDDRELRDNREEYLTALTRDNTQLLLNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WE+FAK KGI  + ++K  YD+   +W
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKVPGPRPLTKWEQFAKEKGITKKKRDKKTYDDTLDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA 193
           VP +G+K    + + DW++ VPQN DP  D F                   +NI  +   
Sbjct: 137 VPTYGFKHAEAEKSKDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRARKV 196

Query: 194 -LNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
            + ++      +    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 DMPRSGYLGPEAASSSQLLTAVTVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|301761996|ref|XP_002916418.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Ailuropoda melanoleuca]
 gi|281338756|gb|EFB14340.1| hypothetical protein PANDA_004488 [Ailuropoda melanoleuca]
          Length = 365

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 125/246 (50%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGPTPEAELQALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGGADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 199 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|507669887|ref|XP_004649132.1| PREDICTED: LOW QUALITY PROTEIN: RRS1 ribosome biogenesis regulator
           homolog (S. cerevisiae) [Octodon degus]
          Length = 365

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 122/243 (50%), Gaps = 8/243 (3%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R      +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDRNPPTALRQAGPAPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEAVVARLPEPATRLPREKPVPKPRPLTRWQQFARLKGIRPKKKTSLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPDGADPLEDQFAKRVQAKKERVAKNELNRLRNLARAHK 198

Query: 193 ALNQTKGADARSL---RKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPS 247
           A  Q   A         K EL R + ++K +TAS+G+F + L  E    G   KRKF+P 
Sbjct: 199 A-QQPPAAGMHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPXGSGKKRKFQPL 257

Query: 248 IGD 250
            GD
Sbjct: 258 FGD 260



>gi|511907155|ref|XP_004773029.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Mustela
           putorius furo]
 gi|511992950|ref|XP_004814125.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Mustela
           putorius furo]
          Length = 371

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 127/247 (51%), Gaps = 16/247 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 26  KLQRITVHKELELEFDLGNLLASDRNPPTGLRRAGATPEAELQALARDNTQLLINQLWQL 85

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 86  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 145

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE--- 189
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+     
Sbjct: 146 WRRRWGYQRAR-DDTKEWLIEVPGGADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 204

Query: 190 ----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRK 243
               S A ++ T G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRK
Sbjct: 205 MQVPSSAGMHPT-GHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKNPRGSGKKRK 259

Query: 244 FEPSIGD 250
           F+P  GD
Sbjct: 260 FQPLFGD 266



>gi|426192508|gb|EKV42444.1| hypothetical protein AGABI2DRAFT_195783 [Agaricus bisporus var.
           bisporus H97]
          Length = 304

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 112/219 (51%), Gaps = 8/219 (3%)

Query: 29  DLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQ 88
           D   L   +T  +D      + +  +++  R+ +Q L+  +F LP T S  G+LA LP  
Sbjct: 27  DAGYLTVTNTTPIDADLYDENIEQSIEQNARESSQKLLGALFHLPSTASADGRLALLPPP 86

Query: 89  ITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGAN 148
              +PRE         T+WE+FA AKGIQ + + K I+DE   EWV RWG+KG N +G  
Sbjct: 87  SFALPREKPLPKAKEMTKWERFAAAKGIQKKKREKKIWDEEKQEWVDRWGWKGKNKEGET 146

Query: 149 DWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLRKG 208
            WL  VP N D   D                     +N+  S           + + RK 
Sbjct: 147 QWLHEVPSNADVDHDPRKIARDERKARTAKNEKQKLQNLSHS--------TGQSSNDRKQ 198

Query: 209 ELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPS 247
           E++R +A ++ +TASIGKFD+ L+GE K +G+KRKFEP+
Sbjct: 199 EIERTLATTRVSTASIGKFDRQLEGEKKPRGIKRKFEPT 237



>gi|444318922|ref|XP_004180118.1| hypothetical protein TBLA_0D00910 [Tetrapisispora blattae CBS 6284]
 gi|387513160|emb|CCH60599.1| hypothetical protein TBLA_0D00910 [Tetrapisispora blattae CBS 6284]
          Length = 203

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/166 (45%), Positives = 98/166 (59%), Gaps = 23/166 (13%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN-------YLKEYTRD 60
           + T   K + +TVE+PIP+ YDL  LA FD+N LD    KND D+       ++K++TRD
Sbjct: 1   MSTVDYKDRPVTVEKPIPVTYDLGNLAVFDSNVLD----KNDFDSSNGEREKHIKDHTRD 56

Query: 61  GTQLLINQIFKLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEK 109
             QLLINQI  LP+ T           S    L +LPE +T +PRE         T+WE+
Sbjct: 57  NVQLLINQILSLPMKTTTEATGGSSGQSSTMTLIQLPEPLTELPREKPLPKAKAPTKWEQ 116

Query: 110 FAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           FA  KGIQ + K  KMIYDEA+GEWVP+WGYKG N    + WL+ V
Sbjct: 117 FAAKKGIQPKAKTGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEV 162



>gi|126137852|ref|XP_001385449.1| hypothetical protein PICST_61583 [Scheffersomyces stipitis CBS
           6054]
 gi|126092727|gb|ABN67420.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 200

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 94/154 (61%), Gaps = 14/154 (9%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFKL 72
           YK +TV++ IP  +DL  LA FD N LD  +LK+D+  + YL   TRD  QLLINQI  L
Sbjct: 7   YKPVTVDKLIPNTFDLGNLATFDPNPLDNEKLKDDSQKEQYLASVTRDNVQLLINQILSL 66

Query: 73  PI-TTSDLG----------KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK 121
           P+ TT+D             L  LPE  T +PRE         T+WE+FA  KGI+ + K
Sbjct: 67  PVKTTTDTHGSSTGQNSTMTLIHLPEPTTPLPREKSIPKAKPPTKWEQFAARKGIKAKAK 126

Query: 122 N-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           + KM+YDEATGEWVP+WGYKG N D  + WL+ V
Sbjct: 127 DGKMVYDEATGEWVPKWGYKGKNKDLDSQWLVEV 160



>gi|57107921|ref|XP_544107.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Canis
           lupus familiaris]
          Length = 365

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 86/246 (34%), Positives = 125/246 (50%), Gaps = 14/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N     R    + +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVHKELELEFDLGNLLASDPNPPAGLRRAGPSPEAELQALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVEEALVARLPEPTTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+  +  
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGGADPLEDQFAKRIQAKKERVAKNELNRLRNLARAHK 198

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +  G KRKF
Sbjct: 199 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRSSGKKRKF 254

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 255 QPLFGD 260



>gi|164448678|ref|NP_001088404.1| RRS1 ribosome biogenesis regulator homolog [Xenopus laevis]
 gi|54261637|gb|AAH84301.1| Rrs1 protein [Xenopus laevis]
          Length = 344

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 124/241 (51%), Gaps = 5/241 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIFKL 72
           K K I+V + + L++DL  L A D NA   S  +  + D +L+   RD TQLLINQ++ L
Sbjct: 20  KLKLISVNKELELEFDLGNLLACDPNAPSVSAFRQQNKDEFLRALARDNTQLLINQVWTL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P        +A+LPE  T +PRE         TRWE+FAK KGIQ + K  +++DE   E
Sbjct: 80  PTEKLQEAIVAKLPEPATRLPREKPVPKPRAPTRWEEFAKLKGIQKKKKTNLMWDEVNKE 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGYK    D   DW+I VP   DP EDQF+                  RNI  SE 
Sbjct: 140 WRRRWGYKRAK-DDTKDWMIEVPHTADPNEDQFAKRMKAKTERVAKNELNRLRNIARSEK 198

Query: 193 ALNQTKG-ADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIG 249
                 G        K EL + + ++K +TAS+G+F   L  E + +  G KRKF+P IG
Sbjct: 199 MKVPGVGLTPTDQPTKAELGKPMHVAKVSTASVGRFQDKLPKEKEPRNMGKKRKFQPLIG 258

Query: 250 D 250
           D
Sbjct: 259 D 259



>gi|504151475|ref|XP_004588076.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Ochotona
           princeps]
          Length = 362

 Score =  136 bits (342), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 125/242 (51%), Gaps = 6/242 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNA-LDESRLKNDTDNYLKEYTRDGTQLLINQIFKL 72
           + + ITV + + L++DL  L A D N      R     +  L+   RD TQLLINQ+++L
Sbjct: 20  RLQRITVHKELELEFDLGNLLACDRNPPTGLRRAGAAPEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    D   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G+
Sbjct: 80  PTERVDEAVVARLPEPSTRLPREKPVPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-E 191
           W  RWGY+    D   +WLI VP   DP EDQF+                  RN+  + +
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGGADPMEDQFAKRLQAKKERVAKNELNRLRNLARAHK 198

Query: 192 AALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSI 248
           A L    G      + K EL R + ++K +TAS+G+F + L  E   +G   KR+F+P  
Sbjct: 199 AQLPSGAGLHPTGHQSKEELGRAMQVAKVSTASLGRFQERLPKEKAPRGPGKKRQFQPLF 258

Query: 249 GD 250
           GD
Sbjct: 259 GD 260



>gi|459367862|gb|EMG46764.1| Ribosome biogenesis [nuclear export] protein, putative [Candida
           maltosa Xu316]
          Length = 202

 Score =  135 bits (341), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 100/162 (61%), Gaps = 16/162 (9%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTD---NYLKEYTRDGTQL 64
           + ++  +YK +TVE+PIP  YDL  LA FD N LD ++L ND +   +YL   TRD  QL
Sbjct: 1   MSSEDKEYKPVTVEKPIPNTYDLGNLATFDPNPLDNTQL-NDAETKESYLTSVTRDNVQL 59

Query: 65  LINQIFKLPI-TTSDLG----------KLAELPEQITVIPREXXXXXXXXXTRWEKFAKA 113
           LINQI  LP+ TT+D             L +LP+  T++PRE         T+W++FA+ 
Sbjct: 60  LINQILSLPVKTTTDTHGSSTGQNSTMTLIQLPDPTTILPREKPIPKAKPLTKWQEFAQR 119

Query: 114 KGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           KGI+ + K+ KM+YDE  GEWVP+WGYKG N D  + WL+ V
Sbjct: 120 KGIKAKEKSGKMVYDEEKGEWVPKWGYKGKNKDLDDQWLVEV 161



>gi|326426829|gb|EGD72399.1| ribosome biogenesis protein Rrs1 [Salpingoeca sp. ATCC 50818]
          Length = 262

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 116/225 (51%), Gaps = 6/225 (2%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTD-NYLKEYTRDGTQLLINQIFKLPI 74
           K + V+R      D   +   D   +D  +  ++     +KE  R+  QLL N I+KLP+
Sbjct: 19  KRVQVQRTEEYYVDEGNMFGADPRPVDLHKFNSEAGREEMKETARENVQLLFNAIWKLPM 78

Query: 75  TTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWV 134
              D G+ A LP     +PR+         TRWE+FA+ KGI+   +++M+YDE +GEW 
Sbjct: 79  ENDDEGRFAVLPPPKMRLPRQKPAPEQREKTRWERFAELKGIKKTKRSRMLYDEMSGEWR 138

Query: 135 PRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAAL 194
           PRWGYK  N   A  W I V +  DP+EDQ+                   +NI    AA 
Sbjct: 139 PRWGYKRANDAAAVPW-IEVKEGSDPYEDQYEKLKKDKKARVEKNEQQRLKNI---AAAR 194

Query: 195 NQTKGADA-RSLRKGELQRQIAISKSATASIGKFDKTLKGELKLK 238
            + KG  A R L + EL++ IAI +S+TAS G FDK L GE K+K
Sbjct: 195 LKAKGIPANRHLIQKELKKAIAIGRSSTASAGVFDKDLPGEAKIK 239



>gi|50424407|ref|XP_460790.1| DEHA2F09834p [Debaryomyces hansenii CBS767]
 gi|49656459|emb|CAG89131.1| DEHA2F09834p [Debaryomyces hansenii CBS767]
          Length = 200

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/155 (45%), Positives = 97/155 (62%), Gaps = 14/155 (9%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           ++K +TV++PIP  YDL  LA FD N LD  +LK+++  + YL   TRD  QLLINQI  
Sbjct: 5   QFKPVTVDKPIPNTYDLGNLATFDPNPLDNDKLKDESQKEEYLTSVTRDNVQLLINQILS 64

Query: 72  LPITT------SDLGK-----LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN 120
           LP+ T      S  G+     L +LP+  T +PRE         T+WE+FA  KGI+ + 
Sbjct: 65  LPVKTTTDSQGSSTGQNSTMTLIQLPDPTTQLPREKAIPKTKAPTKWEQFAARKGIKAKA 124

Query: 121 KN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           K+ KM++DEATGEWVP+WGYKG N +  + WL+ V
Sbjct: 125 KDGKMVFDEATGEWVPKWGYKGKNKELDDQWLVEV 159



>gi|126321316|ref|XP_001379079.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Monodelphis domestica]
          Length = 363

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/248 (35%), Positives = 129/248 (52%), Gaps = 17/248 (6%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           K + ITV + + L++DL  L A D N     R ++    +  L+   RD TQLLIN +++
Sbjct: 20  KLRLITVHKDLELEFDLGNLLAIDPNPPTGLRQQSGRGLEERLQGLARDNTQLLINHLWQ 79

Query: 72  LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATG 131
           LP    +   +A+LPE    +PRE         TRW++FA+ KGI+ R K  +++DEA+ 
Sbjct: 80  LPTERVEEAVVAKLPEPSLRLPREKPLPKPRPLTRWQQFAQLKGIRPRKKTSLVWDEASK 139

Query: 132 EWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-- 189
           +W  RWGY+    D   DWLI VP   DP EDQF+                  RNI    
Sbjct: 140 QWRRRWGYQRAR-DDTKDWLIEVPGGADPNEDQFAKRLQAKKERVAKNELNRLRNIARAH 198

Query: 190 -----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KR 242
                S+  ++ T G  +R     EL R + ++K +TAS+G+F + L  E   +G   KR
Sbjct: 199 KVHLPSQGGMHPT-GHQSRE----ELGRAMQVAKVSTASVGRFQERLPKEKPPRGPGKKR 253

Query: 243 KFEPSIGD 250
           +F+P+IGD
Sbjct: 254 QFQPNIGD 261



>gi|254565237|ref|XP_002489729.1| Essential protein that binds ribosomal protein L11 [Komagataella
           pastoris GS115]
 gi|238029525|emb|CAY67448.1| Essential protein that binds ribosomal protein L11 [Komagataella
           pastoris GS115]
 gi|328350147|emb|CCA36547.1| Regulator of ribosome biosynthesis [Komagataella pastoris CBS 7435]
          Length = 199

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 12/149 (8%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFKLP 73
           KS TV++PIP+ YDL  LA FD+N L+ ++L + +  + YL++ TRD TQLLINQI   P
Sbjct: 4   KSATVDKPIPVAYDLGNLAVFDSNPLESNKLSDASQVNEYLEQVTRDNTQLLINQILSQP 63

Query: 74  I--TTSDLGK-------LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN-K 123
           +  TT  + +       L  LP+  T +PRE         TRWEKFA  KGIQ + K  K
Sbjct: 64  VRNTTDSVSEGQEASIALITLPDPSTPLPREKSVPKPREMTRWEKFAAKKGIQAKGKTGK 123

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLI 152
           MIYDE +GEWVP+WGYKG N    N WL+
Sbjct: 124 MIYDEESGEWVPKWGYKGNNKQLDNQWLV 152



>gi|325183780|emb|CCA18239.1| ribosome biogenesis regulatory protein putative [Albugo laibachii
           Nc14]
          Length = 314

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 126/245 (51%), Gaps = 17/245 (6%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           K+  V++   L+YDL  LAAFDT+     +  N+ D  L  +TR+  QLL+N++F LP T
Sbjct: 17  KNSDVKKEDDLEYDLGNLAAFDTHPY---KYTNEKDLAL--FTRENVQLLVNRLFTLPRT 71

Query: 76  TSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVP 135
            +D G LA+LP   T+IPRE         T+WEKFAK KGIQ R K++M++DEA  +W P
Sbjct: 72  ITDAGPLAKLPPPTTIIPREKPLPKPNAETKWEKFAKEKGIQKRKKSRMVFDEAAQDWKP 131

Query: 136 RWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE------ 189
            WGYK  N D   DW +     ++   D ++                   N+        
Sbjct: 132 NWGYKRAN-DNLQDWAVEAKTGENALADPWAKRKQAKKARVEKNIKQQAANVGRGGVDKI 190

Query: 190 -SEAALNQTKGADARSLRKGELQRQIAISKS--ATASIGKFDKTLKGEL--KLKGVKRKF 244
            S  A+     +D ++ ++G+      + K+  +TAS+GKFD    GE   K KG + +F
Sbjct: 191 PSGIAVELAGTSDVKAKQRGKEGTMKTLQKAQFSTASMGKFDSMRYGETERKQKGKRNRF 250

Query: 245 EPSIG 249
            PS G
Sbjct: 251 LPSTG 255



>gi|449549471|gb|EMD40436.1| hypothetical protein CERSUDRAFT_148443 [Ceriporiopsis subvermispora
           B]
          Length = 263

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 102/188 (54%)

Query: 58  TRDGTQLLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQ 117
            RDG Q LI  +F LP   S  G LA+LP   T +PR          T+WE+FAKAKGIQ
Sbjct: 4   ARDGVQALIGALFSLPTAPSPDGPLAQLPPPTTQLPRAKSLPKPKPPTKWEQFAKAKGIQ 63

Query: 118 HRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXX 177
           H+ ++K  +DE   EWV RWG+KG N    + WL  VP+N D   D              
Sbjct: 64  HKQRDKKEWDEERQEWVDRWGWKGANKQLEDQWLTEVPKNADIDHDPSKVARDERKARVA 123

Query: 178 XXXXXHRRNIEESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKL 237
                   N+  ++ + + +        RK ++ R +A+++ +TAS+GKFDKTL+GE K 
Sbjct: 124 KNEKQRLANLSRAQQSSSSSTAPAPLVERKKQIDRTLAMTRKSTASMGKFDKTLEGEKKP 183

Query: 238 KGVKRKFE 245
           KG+KRKF+
Sbjct: 184 KGMKRKFD 191



>gi|238879409|gb|EEQ43047.1| regulator of ribosome biosynthesis [Candida albicans WO-1]
          Length = 202

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/159 (45%), Positives = 100/159 (62%), Gaps = 16/159 (10%)

Query: 12  KSKYKSITVERPIPLQYDLALLAAFDTNALDESRL--KNDT--DNYLKEYTRDGTQLLIN 67
           K +YKS+TV++PIP  YDL  LA FD N LD  +L  K+++  +++L+  TRD  QLLIN
Sbjct: 1   KKEYKSVTVDKPIPNTYDLGNLATFDPNPLDNEKLLSKDESIKEDHLQSVTRDNVQLLIN 60

Query: 68  QIFKLPITT------SDLGK-----LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI 116
           QI  LP+ T      S  G+     L +LPE  T++PRE         T+W++FA  KGI
Sbjct: 61  QILSLPVKTTTETHGSSTGQNSTMTLIQLPEPTTILPREKPIPKAKPLTKWQQFAARKGI 120

Query: 117 QHRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           + + K+ KM+YDE TGEWVP+WGYKG N    + WL+ V
Sbjct: 121 KPKAKDGKMVYDEDTGEWVPKWGYKGKNKSIDDQWLVEV 159



>gi|513030416|gb|AGO10441.1| AaceriABL014Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 205

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 91/150 (60%), Gaps = 13/150 (8%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN---YLKEYTRDGTQLLINQIFKLPI 74
           +TVE+PIP+ YDL  LA FD+NALD + L +   N   +L+  TRD  QLLINQI  LPI
Sbjct: 13  VTVEKPIPVTYDLGNLAVFDSNALDRNDLDSSNANRETHLRALTRDNVQLLINQILSLPI 72

Query: 75  --TTSDLGK-------LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN-KM 124
             TT   G        L +LPE  T +PRE         T+WE FA  K I+ + K+ KM
Sbjct: 73  KSTTDSTGSGQSSSIALVQLPEPTTELPREKPLPKPKAPTKWELFAAKKNIKPKEKSGKM 132

Query: 125 IYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           +YDEA GEWVP+WGYKG+N    + WL+ V
Sbjct: 133 VYDEAAGEWVPKWGYKGSNKKLDDQWLVEV 162



>gi|156847608|ref|XP_001646688.1| hypothetical protein Kpol_1028p106 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117367|gb|EDO18830.1| hypothetical protein Kpol_1028p106 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 204

 Score =  133 bits (335), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 98/163 (60%), Gaps = 19/163 (11%)

Query: 14  KYKS--ITVERPIPLQYDLALLAAFDTNALDESRLKNDT---DNYLKEYTRDGTQLLINQ 68
           KYK   +TVE+PIP+ YDL  LA FD+N +D + L +     +++L + TR   QLLINQ
Sbjct: 6   KYKDLPVTVEKPIPVTYDLGHLAVFDSNVIDRNDLDSSNAKRESHLYDLTRGNVQLLINQ 65

Query: 69  IFKLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQ 117
           I  LPI T           S    L +LPE IT +PRE         TRWE+FA  KGIQ
Sbjct: 66  ILSLPIKTTTESASGTSGQSSAMTLIQLPEPITELPREKPLPKPKAPTRWEQFAARKGIQ 125

Query: 118 HRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDD 159
            + K+ KM++DEA+G+WVP+WGYKG N    + WL+ V  NDD
Sbjct: 126 SKEKSGKMVFDEASGKWVPKWGYKGINKKLDDQWLVEV--NDD 166



>gi|45709905|gb|AAH67632.1| Rrs1 protein, partial [Danio rerio]
          Length = 345

 Score =  133 bits (334), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 131/241 (54%), Gaps = 5/241 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKL 72
           K KSITV + + L++D  LL AFD N LD    K N  ++ L+   RD TQLLIN+I+KL
Sbjct: 19  KLKSITVLKELDLEFDPGLLLAFDKNRLDTRDFKGNKREDCLRSLARDNTQLLINEIWKL 78

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    D   +A+LPE  T +PRE         T+WE+FAK KGIQ + K  +++DE   E
Sbjct: 79  PTERVDEVIVAKLPEPTTKLPREKPAPKPKPPTKWEQFAKLKGIQKKKKTNLVWDEVHKE 138

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGYK    D   +WLI VP   DP EDQF+                  +NI  ++ 
Sbjct: 139 WKRRWGYKRAK-DDTKEWLIEVPATADPNEDQFAKRNKAKKERVAKNEYNRLKNIARAQK 197

Query: 193 ALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIG 249
                 G    S + K EL + ++++K +TAS+GKF + L  E   +  G KRKF+P IG
Sbjct: 198 VKVPGTGLLPTSQQTKAELAQAVSLAKISTASVGKFQEKLPKEKPARNTGKKRKFQPLIG 257

Query: 250 D 250
           D
Sbjct: 258 D 258



>gi|41056045|ref|NP_956356.1| ribosome biogenesis regulatory protein homolog [Danio rerio]
 gi|33585885|gb|AAH55615.1| RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) [Danio
           rerio]
 gi|182888746|gb|AAI64156.1| Rrs1 protein [Danio rerio]
          Length = 346

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 131/241 (54%), Gaps = 5/241 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKL 72
           K KSITV + + L++D  LL AFD N LD    K N  ++ L+   RD TQLLIN+I+KL
Sbjct: 20  KLKSITVLKELDLEFDPGLLLAFDKNRLDTRDFKGNKREDCLRSLARDNTQLLINEIWKL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    D   +A+LPE  T +PRE         T+WE+FAK KGIQ + K  +++DE   E
Sbjct: 80  PTERVDEVIVAKLPEPTTKLPREKPAPKPKPPTKWEQFAKLKGIQKKKKTNLVWDEVHKE 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGYK    D   +WLI VP   DP EDQF+                  +NI  ++ 
Sbjct: 140 WKRRWGYKRAK-DDTKEWLIEVPATADPNEDQFAKRNKAKKERVARNEYNRLKNIARAQK 198

Query: 193 ALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIG 249
                 G    S + K EL + ++++K +TAS+GKF + L  E   +  G KRKF+P IG
Sbjct: 199 VKVPGTGLLPTSQQTKAELAQAVSLAKISTASVGKFQEKLPKEKPARNTGKKRKFQPLIG 258

Query: 250 D 250
           D
Sbjct: 259 D 259



>gi|410076388|ref|XP_003955776.1| hypothetical protein KAFR_0B03440 [Kazachstania africana CBS 2517]
 gi|372462359|emb|CCF56641.1| hypothetical protein KAFR_0B03440 [Kazachstania africana CBS 2517]
          Length = 201

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 75/160 (46%), Positives = 96/160 (60%), Gaps = 24/160 (15%)

Query: 15  YKS--ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN-------YLKEYTRDGTQLL 65
           YKS  +TVE+PIP+ YDL  L+ FD+N LD    +ND D+       +++  TRD  QLL
Sbjct: 6   YKSLPVTVEKPIPVSYDLGNLSVFDSNVLD----RNDFDSSNAAREEHIRNATRDNVQLL 61

Query: 66  INQIFKLPIT-------TSDLGK---LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKG 115
           INQ+  LPI        TSD G    L  LPE IT +PRE         T+WEKFA  KG
Sbjct: 62  INQLLSLPIKSTTNSSGTSDQGANMTLLRLPEPITELPREKPLPKPKAPTKWEKFAAKKG 121

Query: 116 IQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           I+ + K+ KM+YDEA+GEW P+WGYKG N    + WL+ V
Sbjct: 122 IKSKEKSGKMVYDEASGEWAPKWGYKGINKKLDDQWLVEV 161



>gi|148232006|ref|NP_001085071.1| RRS1 ribosome biogenesis regulator homolog [Xenopus laevis]
 gi|47940235|gb|AAH72081.1| MGC78981 protein [Xenopus laevis]
 gi|76780051|gb|AAI06685.1| MGC78981 protein [Xenopus laevis]
          Length = 342

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 92/252 (36%), Positives = 127/252 (50%), Gaps = 5/252 (1%)

Query: 3   YFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDG 61
            F+   + +  K K ITV + + +++DL  L A D NA   S  +  + D +L+   RD 
Sbjct: 8   VFARVEKEEAEKLKLITVNKELDVEFDLGNLLACDPNATSVSAFRQQNKDEFLRALARDN 67

Query: 62  TQLLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK 121
           TQLLIN+++ LP        +A+LPE  T +PRE         TRWE+FAK KGIQ + K
Sbjct: 68  TQLLINRMWTLPTEKLQEAIVAKLPEPATRLPREKPVPKPRAPTRWEEFAKLKGIQKKKK 127

Query: 122 NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXX 181
             + +D+   EW  RWGYK    D   DW+I VP   DP EDQF+               
Sbjct: 128 TNLAWDDVNKEWRRRWGYKRAK-DDTKDWMIEVPHTADPNEDQFAKRMKAKKERVAKNEL 186

Query: 182 XHRRNIEESEAALNQTKG-ADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLK-- 238
              RNI  SE       G        K EL + + ++K +TAS+G+F   L  E + +  
Sbjct: 187 NRLRNIARSEKMKVPGVGLTPTDQPTKAELGKAMHVAKVSTASVGRFQDKLPKEKEPRNM 246

Query: 239 GVKRKFEPSIGD 250
           G KRKF+P IGD
Sbjct: 247 GKKRKFQPLIGD 258



>gi|302306524|ref|NP_982933.2| ABL014Cp [Ashbya gossypii ATCC 10895]
 gi|299788557|gb|AAS50757.2| ABL014Cp [Ashbya gossypii ATCC 10895]
 gi|374106136|gb|AEY95046.1| FABL014Cp [Ashbya gossypii FDAG1]
          Length = 205

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 89/150 (59%), Gaps = 13/150 (8%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN---YLKEYTRDGTQLLINQIFKLPI 74
           +TVE+PIP+ YDL  LA FD+NALD + L +   N   +L+  TRD  QLLINQI  LPI
Sbjct: 13  VTVEKPIPVTYDLGNLAVFDSNALDRNDLDSSNANREEHLRALTRDNVQLLINQILSLPI 72

Query: 75  --TTSDLGK-------LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN-KM 124
             TT   G        L  LPE  T +PRE         T+WE FA  K I+ + K+ KM
Sbjct: 73  KSTTDSTGSGQSSSIALVRLPEPTTDLPREKPLPKPKAPTKWELFAAKKNIKPKEKSGKM 132

Query: 125 IYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           +YDEA GEWVP+WGYKG N    + WL+ V
Sbjct: 133 VYDEAAGEWVPKWGYKGANKKLDDQWLVEV 162



>gi|241948079|ref|XP_002416762.1| ribosome biogenesis [nuclear export] protein, putative [Candida
           dubliniensis CD36]
 gi|223640100|emb|CAX44346.1| ribosome biogenesis [nuclear export] protein, putative [Candida
           dubliniensis CD36]
          Length = 205

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 108/199 (54%), Gaps = 20/199 (10%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRL--KNDT--DNYLKEYTRDGTQLLINQIF 70
           YK +TV++PIP  YDL  LA FD N LD  +L  K+++  +++L+  TRD  QLLINQI 
Sbjct: 7   YKPVTVDKPIPNTYDLGNLATFDPNPLDNEKLLSKDESIKEDHLQSVTRDNVQLLINQIL 66

Query: 71  KLPITT------SDLGK-----LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+ T      S  G+     L +LPE  T++PRE         T+W++FA  KGI+ +
Sbjct: 67  SLPVKTTTETHGSSTGQNSTMTLIQLPEPTTILPREKPIPKAKPLTKWQQFAARKGIKPK 126

Query: 120 NKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIP----VPQNDDPFEDQFSXXXXXXXX 174
            K+ KM+YDE TGEWVP+WGYKG N    + WL+     V   +D   D  +        
Sbjct: 127 TKDGKMVYDENTGEWVPKWGYKGKNKSIDDQWLVEVDDKVKNTEDELIDPRTLKRAERKK 186

Query: 175 XXXXXXXXHRRNIEESEAA 193
                   H+RN+    AA
Sbjct: 187 LIKKNELQHKRNLRNQGAA 205



>gi|167536855|ref|XP_001750098.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163771427|gb|EDQ85094.1| predicted protein [Monosiga brevicollis MX1]
          Length = 2077

 Score =  131 bits (329), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 81/230 (35%), Positives = 119/230 (51%), Gaps = 8/230 (3%)

Query: 21   ERPI-PLQYDLAL--LAAFDTNALDESRLKNDTD-NYLKEYTRDGTQLLINQIFKLPITT 76
            +RP  P++YD+    +A  D   +   +L   +    L  YTRD  QLL+N I +LP+  
Sbjct: 1683 KRPYHPIEYDIDAGNMAGTDVREVPLGKLLGSSRREALTTYTRDNVQLLLNSIMQLPVDK 1742

Query: 77   SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPR 136
            ++ G  A +P   + IPRE         TRWEKFA+ KGIQ   +++M+YDEATGE+ PR
Sbjct: 1743 TEEGVFATMPRPASRIPREKPIPEDRAQTRWEKFAEMKGIQKSKRSRMVYDEATGEYRPR 1802

Query: 137  WGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQ 196
            +GYK +  D +    + +  N+DP+ D+F                   +NI    AA  Q
Sbjct: 1803 YGYKRSKQDDSAWPWVELKDNEDPYVDKFQELSDAKKNRVLKNEGQRIKNI---AAARLQ 1859

Query: 197  TKGADAR-SLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFE 245
              G     +  K EL+  I I +++TAS G FD  LKGE KLK   ++ +
Sbjct: 1860 ASGRKVNPAAIKKELKTAIQIGRTSTASAGVFDTDLKGEAKLKRAGKRVQ 1909



>gi|68473955|ref|XP_718874.1| likely ribosome biogenesis regulatory protein Rrs1p [Candida
           albicans SC5314]
 gi|46440667|gb|EAK99970.1| likely ribosome biogenesis regulatory protein Rrs1p [Candida
           albicans SC5314]
          Length = 205

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 97/156 (62%), Gaps = 16/156 (10%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRL--KNDT--DNYLKEYTRDGTQLLINQIF 70
           YK +TV++PIP  YDL  LA FD N LD  +L  K+++  +++L+  TRD  QLLINQI 
Sbjct: 7   YKPVTVDKPIPNTYDLGNLATFDPNPLDNEKLLSKDESIKEDHLQSVTRDNVQLLINQIL 66

Query: 71  KLPITT------SDLGK-----LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+ T      S  G+     L +LPE  T++PRE         T+W++FA  KGI+ +
Sbjct: 67  SLPVKTTTETHGSSTGQNSTMTLIQLPEPTTILPREKPIPKAKPLTKWQQFAARKGIKPK 126

Query: 120 NKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            K+ KM+YDE TGEWVP+WGYKG N    + WL+ V
Sbjct: 127 AKDGKMVYDEDTGEWVPKWGYKGKNKSIDDQWLVEV 162



>gi|401623512|gb|EJS41609.1| rrs1p [Saccharomyces arboricola H-6]
          Length = 203

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 92/156 (58%), Gaps = 23/156 (14%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDFDSSNAKREEKIKNLTRDNVQLLINQLL 66

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+ T           S +  L +LP   T +PRE         T+WEKFA  KGI+ +
Sbjct: 67  SLPMKTTTESAGGTSGQSSVMTLLQLPGATTELPREKPLPKAKAMTKWEKFAAKKGIKPK 126

Query: 120 NK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            +  KM+YDEA+GEWVP+WGYKGTN    + WL+ V
Sbjct: 127 ERAGKMVYDEASGEWVPKWGYKGTNKKLDDQWLVEV 162



>gi|68473746|ref|XP_718976.1| likely ribosome biogenesis regulatory protein Rrs1p [Candida
           albicans SC5314]
 gi|46440773|gb|EAL00075.1| likely ribosome biogenesis regulatory protein Rrs1p [Candida
           albicans SC5314]
          Length = 205

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 96/156 (61%), Gaps = 16/156 (10%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRL--KNDT--DNYLKEYTRDGTQLLINQIF 70
           YK +TV++PIP  YDL  LA FD N LD  +L  K+++  +++L+  TRD  QLLINQI 
Sbjct: 7   YKPVTVDKPIPNTYDLGNLATFDPNPLDNEKLLSKDESIKEDHLQSVTRDNVQLLINQIL 66

Query: 71  KLP--ITTSDLGK---------LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP  ITT   G          L +LPE  T++PRE         T+W++FA  KGI+ +
Sbjct: 67  SLPVKITTETHGSSTGQNSTMTLIQLPEPTTILPREKPIPKAKPLTKWQQFAARKGIKPK 126

Query: 120 NKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            K+ KM+YDE TGEWVP+WGYKG N    + WL+ V
Sbjct: 127 AKDGKMVYDEDTGEWVPKWGYKGKNKSIDDQWLVEV 162



>gi|6324868|ref|NP_014937.1| Rrs1p [Saccharomyces cerevisiae S288c]
 gi|3183481|sp|Q08746.1|RRS1_YEAST RecName: Full=Regulator of ribosome biosynthesis
 gi|1420652|emb|CAA99522.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|151945376|gb|EDN63619.1| regulator of ribosome synthesis [Saccharomyces cerevisiae YJM789]
 gi|190407595|gb|EDV10862.1| regulator of ribosome biosynthesis [Saccharomyces cerevisiae
           RM11-1a]
 gi|256272588|gb|EEU07567.1| Rrs1p [Saccharomyces cerevisiae JAY291]
 gi|285815166|tpg|DAA11059.1| TPA: Rrs1p [Saccharomyces cerevisiae S288c]
 gi|323352201|gb|EGA84738.1| Rrs1p [Saccharomyces cerevisiae VL3]
 gi|349581445|dbj|GAA26603.1| K7_Rrs1p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|365762955|gb|EHN04487.1| Rrs1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392296621|gb|EIW07723.1| Rrs1p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 203

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 92/156 (58%), Gaps = 23/156 (14%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+ T           S +  L +LP+  T +PRE         T+WEKFA  KGI+ +
Sbjct: 67  SLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPK 126

Query: 120 NK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            +  KMIYDEA+GEWVP+WGYKG N    + WL+ V
Sbjct: 127 ERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEV 162



>gi|323331594|gb|EGA73009.1| Rrs1p [Saccharomyces cerevisiae AWRI796]
          Length = 203

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 92/156 (58%), Gaps = 23/156 (14%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+ T           S +  L +LP+  T +PRE         T+WEKFA  KGI+ +
Sbjct: 67  SLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPK 126

Query: 120 NK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            +  KMIYDEA+GEWVP+WGYKG N    + WL+ V
Sbjct: 127 ERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEV 162



>gi|207340921|gb|EDZ69122.1| YOR294Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|259149769|emb|CAY86573.1| Rrs1p [Saccharomyces cerevisiae EC1118]
          Length = 203

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 92/156 (58%), Gaps = 23/156 (14%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+ T           S +  L +LP+  T +PRE         T+WEKFA  KGI+ +
Sbjct: 67  SLPMKTTTESIGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPK 126

Query: 120 NK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            +  KMIYDEA+GEWVP+WGYKG N    + WL+ V
Sbjct: 127 ERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEV 162



>gi|389746674|gb|EIM87853.1| RRS1-domain-containing protein [Stereum hirsutum FP-91666 SS1]
          Length = 349

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 136/254 (53%), Gaps = 21/254 (8%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            SD L +Q +K++++TVE+ IPL+ D   L   D N  D      D + YL+   RDG Q
Sbjct: 3   VSDILASQAAKHQAVTVEKDIPLEVDAGYLTVTDLNPTDPELYSEDVEAYLQATARDGVQ 62

Query: 64  LLINQIFKLPITTSDLGK--LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN- 120
           +L+  +F LP   S  G   LA+LP   T +PR          T+WE+FA+AKGI +   
Sbjct: 63  VLLASLFSLPTLPSPTGDGPLAQLPPPSTQLPRSKPLPKPKPPTKWEQFARAKGIGNNKG 122

Query: 121 -KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND----DPFEDQFSXXXXXXXXX 175
            +++  +DE   +WV RWG+KG N +    W + VP N     DP +D            
Sbjct: 123 RRDRKEWDEEKQDWVNRWGWKGKNKELETQWAVEVPANAPADFDPSKDARDARKARVA-- 180

Query: 176 XXXXXXXHRRNIEESEAALNQTKGAD--ARSLRKGELQRQIAISKSATASIGKFDKTLKG 233
                    +N ++    L + +GA+   R  RK ++ R +A +++ATAS+GKFDK L G
Sbjct: 181 ---------KNDKQKLGNLARAQGANKSERDERKQDIDRTLATTRTATASMGKFDKKLDG 231

Query: 234 ELKLKGVKRKFEPS 247
           E KLKGVKRKFEP+
Sbjct: 232 EKKLKGVKRKFEPA 245



>gi|348668179|gb|EGZ08003.1| hypothetical protein PHYSODRAFT_526169 [Phytophthora sojae]
          Length = 323

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 124/249 (49%), Gaps = 26/249 (10%)

Query: 19  TVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSD 78
           +V++   L YDL  LAAFDT+       +N+ +  L  + R+  QLLIN IF+LP   SD
Sbjct: 20  SVQKEDDLVYDLGNLAAFDTHPFT---YQNEKELAL--HARENVQLLINHIFELPREMSD 74

Query: 79  LGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWG 138
           +G LA+LPE  TVIPRE         T+WEKFAK KGI+ R K++ ++DE TGEW   WG
Sbjct: 75  MGPLAQLPEPSTVIPREKPLPKPKVETKWEKFAKEKGIEKRKKSRKVFDENTGEWGHSWG 134

Query: 139 YKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA------ 192
           Y+   GD   DW + V + D   ED ++                   N+++         
Sbjct: 135 YQRA-GDDMKDWAVEVKEGD--MEDPWTKRKQEKRARVDKNLRAQANNLKQGRGKQLAGI 191

Query: 193 ----------ALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKG--ELKLKGV 240
                      L  T  A A+   K    + +   + +TAS+GKFDK  +G  E K+KG 
Sbjct: 192 AGRTPTGIPVELMNTDDAKAKQRGKEGTNKTLEKVQFSTASMGKFDKMREGESERKIKGK 251

Query: 241 KRKFEPSIG 249
           +  F P+ G
Sbjct: 252 RNHFLPTTG 260



>gi|470319881|gb|EMR11491.1| hypothetical protein PNEG_00505 [Pneumocystis murina B123]
          Length = 191

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 89/140 (63%), Gaps = 2/140 (1%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           S T ++ I L++DL  L+AF+ N+LD   LKN+ + Y+  ++RD  Q+L+N+IF LP   
Sbjct: 9   STTNKKSIHLEFDLGNLSAFNINSLDTYSLKNNKEEYIMSFSRDSIQILVNRIFSLPKII 68

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK--NKMIYDEATGEWV 134
           +  G   ELPE I  +PRE         T+WEKFAKAKGI+ ++K   KM YD+   +WV
Sbjct: 69  TLNGSFIELPEPIISLPREKPIPKPRPETKWEKFAKAKGIKSKSKIDGKMTYDKNKKKWV 128

Query: 135 PRWGYKGTNGDGANDWLIPV 154
           P+WGYKG N +  N WLI +
Sbjct: 129 PKWGYKGKNKNLKNQWLIEI 148



>gi|410909081|ref|XP_003968019.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Takifugu
           rubripes]
          Length = 339

 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 131/238 (55%), Gaps = 5/238 (2%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIFKLPIT 75
           SITV + + L++D+  L A D N +D   +K+   +++L+   RD TQLLIN+++KLP  
Sbjct: 23  SITVHKDLELEFDVGNLLAVDKNRIDSRDVKSAKKEDFLRALARDNTQLLINEVWKLPTE 82

Query: 76  TSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVP 135
             D   +A LPE  T +PRE         T+WE+FAK KGIQ + K  +++DE   EW  
Sbjct: 83  RVDDAIVATLPEPTTPLPREKPPPKPKPPTKWEQFAKLKGIQKKKKTNLVWDETAKEWRR 142

Query: 136 RWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALN 195
           RWGYK    D   +W+I VP+  DP EDQFS                  +NI  ++    
Sbjct: 143 RWGYKRAK-DDTKEWMIEVPETADPNEDQFSKRTTAKKERVARNEYNKLKNIARAQKVKI 201

Query: 196 QTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIGD 250
              G   +  + K EL + ++++K++TAS G+F   L  E ++K  G KRKFEP IGD
Sbjct: 202 PGLGLTPKEQQSKNELTKAVSVAKTSTASAGRFQDRLPKEKRVKNTGKKRKFEPLIGD 259



>gi|213513147|ref|NP_001134869.1| ribosome biogenesis regulatory protein homolog [Salmo salar]
 gi|209736730|gb|ACI69234.1| Ribosome biogenesis regulatory protein homolog [Salmo salar]
          Length = 353

 Score =  129 bits (324), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 132/241 (54%), Gaps = 5/241 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K KSITV++ + L++D+  L A+D N +D  + +    +++L+   RD TQLL+N+I+K 
Sbjct: 20  KLKSITVQKELDLEFDIGNLLAYDKNRIDIRQFREQKKEDFLRSLARDNTQLLVNEIWKH 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   + +LPE  T +PRE         T+WE+FAK KGIQ + K  +++D+   E
Sbjct: 80  PTERVEEVIVVKLPEPTTSLPREKPPPKPRPPTKWEEFAKLKGIQKKKKTNLVWDDVAKE 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGYK  N DG  +WLI VP+  DP EDQF+                  RNI  ++ 
Sbjct: 140 WKRRWGYKRVN-DGTKEWLIEVPETADPNEDQFAKRNKAKKEKVAKNELHRLRNIARAQK 198

Query: 193 ALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIG 249
                 G    + + K +L R + ++KS+TAS GKF   L  E   +  G KRKF+P IG
Sbjct: 199 IKVPGVGLTPTAQQSKTDLVRAVNVAKSSTASAGKFQDRLPKEKAPRNTGKKRKFQPVIG 258

Query: 250 D 250
           +
Sbjct: 259 N 259



>gi|21483408|gb|AAM52679.1| LD24586p [Drosophila melanogaster]
          Length = 361

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 120/228 (52%), Gaps = 1/228 (0%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+++ + YL   TR+ TQLL+N I++LP
Sbjct: 29  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRDNKEEYLTALTRENTQLLVNAIWELP 88

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K+K  YDE   +W
Sbjct: 89  TERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGISKKKKDKKTYDETMDKW 148

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA 193
           VP +G+K    + A DW++ VPQN DP  D F                   +NI  ++  
Sbjct: 149 VPTYGFKRAEAEKAKDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKI 208

Query: 194 -LNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
            + ++      +    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 209 DMPRSGYLGPEAASSSQLLTAVTVAKSSTASVGKFQNKLPKEKEARGL 256



>gi|54650780|gb|AAV36969.1| LD45683p [Drosophila melanogaster]
          Length = 359

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 120/228 (52%), Gaps = 1/228 (0%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+++ + YL   TR+ TQLL+N I++LP
Sbjct: 27  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRDNKEEYLTALTRENTQLLVNAIWELP 86

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K+K  YDE   +W
Sbjct: 87  TERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGISKKKKDKKTYDETMDKW 146

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA 193
           VP +G+K    + A DW++ VPQN DP  D F                   +NI  ++  
Sbjct: 147 VPTYGFKRAEAEKAKDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKI 206

Query: 194 -LNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
            + ++      +    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 207 DMPRSGYLGPEAASSSQLLTAVTVAKSSTASVGKFQNKLPKEKEARGL 254



>gi|323307328|gb|EGA60608.1| Rrs1p [Saccharomyces cerevisiae FostersO]
          Length = 203

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 91/156 (58%), Gaps = 23/156 (14%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+ T           S +  L + P+  T +PRE         T+WEKFA  KGI+ +
Sbjct: 67  SLPMKTTTESVGGTGGQSSVMTLLQXPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPK 126

Query: 120 NK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            +  KMIYDEA+GEWVP+WGYKG N    + WL+ V
Sbjct: 127 ERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEV 162



>gi|221330901|ref|NP_729108.2| CG32409 [Drosophila melanogaster]
 gi|220902479|gb|AAN12230.2| CG32409 [Drosophila melanogaster]
          Length = 349

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 120/228 (52%), Gaps = 1/228 (0%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+++ + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRDNKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K+K  YDE   +W
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGISKKKKDKKTYDETMDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA 193
           VP +G+K    + A DW++ VPQN DP  D F                   +NI  ++  
Sbjct: 137 VPTYGFKRAEAEKAKDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKI 196

Query: 194 -LNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
            + ++      +    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 DMPRSGYLGPEAASSSQLLTAVTVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|344233092|gb|EGV64965.1| ribosomal biogenesis regulatory protein [Candida tenuis ATCC 10573]
          Length = 201

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 14/154 (9%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKN--DTDNYLKEYTRDGTQLLINQIFKL 72
           +K +TV++PIP  +DL  LAAFD N L+  +L N    + YL   TRD  QLLINQI  L
Sbjct: 9   FKPVTVDKPIPDTFDLGNLAAFDPNPLENDKLANAEQKEQYLTAVTRDNVQLLINQILSL 68

Query: 73  PI-TTSDLG----------KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK 121
           P+ TT+D             L +LP+ IT++PRE         T+W+KFA  KGI+ + +
Sbjct: 69  PLKTTTDTHGSSTGQDSTMTLVQLPQPITLLPREKAIPKDKPLTKWQKFAVKKGIKPKAR 128

Query: 122 N-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           + KM+YDE TGEW P+WGYKG N    + WL+ +
Sbjct: 129 DGKMVYDEDTGEWAPKWGYKGKNKSLDDQWLVEI 162



>gi|401838812|gb|EJT42256.1| RRS1-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 235

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 95/171 (55%), Gaps = 23/171 (13%)

Query: 3   YFSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LK 55
           Y    +  +  K   +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K
Sbjct: 28  YLPLSMSAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNILD----KNDLDSSNAKREEKIK 83

Query: 56  EYTRDGTQLLINQIFKLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXX 104
             TRD  QLLINQ+  LP+ +           S +  L +LP   T +PRE         
Sbjct: 84  SLTRDNVQLLINQLLSLPMKSTTESAGGTSGQSSVMTLLQLPNATTELPREKPLPKVKAM 143

Query: 105 TRWEKFAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           T+W+KFA  KGI+ + +  KM+YDEA+GEWVP+WGYKG N    + WL+ V
Sbjct: 144 TKWQKFAAKKGIKPKERAGKMVYDEASGEWVPKWGYKGANKKLDDQWLVEV 194



>gi|50304325|ref|XP_452112.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641244|emb|CAH02505.1| KLLA0B13046p [Kluyveromyces lactis]
          Length = 204

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 95/166 (57%), Gaps = 23/166 (13%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRD 60
           + T K   + +TVE+ IP+ YDL  LA FDTN LD    +ND D+        +K+ TRD
Sbjct: 1   MSTTKYSERPVTVEKAIPVTYDLGNLAVFDTNVLD----RNDFDSSNAARESNIKDLTRD 56

Query: 61  GTQLLINQIFKLPITTS-----------DLGKLAELPEQITVIPREXXXXXXXXXTRWEK 109
             QLLINQI  LPI  +               L +LPE  T +PRE         T+WE+
Sbjct: 57  NVQLLINQILSLPIRATTESAGGSSGQSSSMTLVQLPEPTTELPREKPLPKPKAPTKWEQ 116

Query: 110 FAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           FA  KGI+ + ++ KMIYDEA GEWVP+WGYKG+N +  + WL+ V
Sbjct: 117 FAAKKGIKPKERSGKMIYDEAAGEWVPKWGYKGSNKELDDQWLVEV 162



>gi|448520202|ref|XP_003868248.1| Rrs1 ribosome biogenesis and nuclear export protein [Candida
           orthopsilosis Co 90-125]
 gi|380352587|emb|CCG22814.1| Rrs1 ribosome biogenesis and nuclear export protein [Candida
           orthopsilosis]
          Length = 208

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 16/154 (10%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNAL--DESRLKNDTD--NYLKEYTRDGTQLLINQIF 70
           YK +TVE+PI   YDL  LA FD N L  D+ R KN+++   YL   TRD  QLL+NQI 
Sbjct: 7   YKPVTVEKPIGNTYDLGNLATFDPNPLSNDKLRSKNESEKEQYLSSVTRDNVQLLVNQIL 66

Query: 71  KLPI--TTSDLGK---------LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+  TT + G          L +LPE  T++PRE         T+WE+FA  KGI+ +
Sbjct: 67  SLPVKTTTDNQGSSTGHSSSMTLIQLPEPTTLLPREKAIPKPKPPTKWEQFAAKKGIKPK 126

Query: 120 NKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLI 152
            K+ K++YDE TGEWVP+WGYKG N    + WL+
Sbjct: 127 AKDGKLVYDEETGEWVPKWGYKGKNKSLDDQWLV 160



>gi|195492113|ref|XP_002093850.1| GE21520 [Drosophila yakuba]
 gi|194179951|gb|EDW93562.1| GE21520 [Drosophila yakuba]
          Length = 349

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 119/228 (52%), Gaps = 1/228 (0%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+ + + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRANKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K+K  YDE   +W
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGITKKKKDKKTYDETMDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA 193
           VP +G+K    + A DW++ VPQN DP  D F                   +NI  ++  
Sbjct: 137 VPTYGFKRAEAEKAKDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKI 196

Query: 194 -LNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
            + ++      +    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 DMPRSGYLGPEAASSSQLLTAVTVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|194867287|ref|XP_001972038.1| GG15298 [Drosophila erecta]
 gi|190653821|gb|EDV51064.1| GG15298 [Drosophila erecta]
          Length = 349

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 120/230 (52%), Gaps = 5/230 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+ + + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRANKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K+K  YDE   +W
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGITKKKKDKKTYDETMDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES--- 190
           VP +G+K    + A DW++ VPQN DP  D F                   +NI  +   
Sbjct: 137 VPTYGFKRAEAEKAKDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKI 196

Query: 191 EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           +   +   G +A S    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 DMPRSGYLGPEAAS--SSQLLTAVTVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|505776368|ref|XP_004602476.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Sorex
           araneus]
          Length = 364

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 89/242 (36%), Positives = 127/242 (52%), Gaps = 6/242 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDE-SRLKNDTDNYLKEYTRDGTQLLINQIFKL 72
           K + ITV + + L++DL  L A D N   E  R     +  L+   RD TQLL+NQ+++L
Sbjct: 20  KLQLITVHKELELEFDLGNLLALDRNPPTEVQRAGPALERELRALARDNTQLLLNQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    D   +A LPE  T +PRE         TRW++FA+ KGIQ + K  +++DE +G+
Sbjct: 80  PTERVDETLVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIQPKKKTNLVWDEVSGQ 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-E 191
           W  RWGY+    D   +WLI VP N DP EDQF+                  RN+  + +
Sbjct: 140 WRRRWGYQRAR-DDTKEWLIEVPGNADPMEDQFAKRAQAKKERVAKNELNRLRNLARAHK 198

Query: 192 AALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSI 248
           A L    G      + K EL R + ++K +TAS+G+F + L  E   +G   KRKF+P  
Sbjct: 199 AQLPSAAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKAPRGTGKKRKFQPLF 258

Query: 249 GD 250
           GD
Sbjct: 259 GD 260



>gi|195588066|ref|XP_002083779.1| GD13910 [Drosophila simulans]
 gi|194195788|gb|EDX09364.1| GD13910 [Drosophila simulans]
          Length = 349

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 119/230 (51%), Gaps = 5/230 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+ + + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRANKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K K  YDE   +W
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGISKKKKEKKTYDETMDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES--- 190
           VP +G+K    + A DW++ VPQN DP  D F                   +NI  +   
Sbjct: 137 VPTYGFKRAEAEKAKDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKI 196

Query: 191 EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           +   +   G +A S    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 DMPRSGYLGPEAAS--SSQLLTAVTVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|195337755|ref|XP_002035491.1| GM14731 [Drosophila sechellia]
 gi|194128584|gb|EDW50627.1| GM14731 [Drosophila sechellia]
          Length = 349

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 120/230 (52%), Gaps = 5/230 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+  L+ + + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRLDVGSLLITDPNDFDDRELRANKEEYLTALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K+K  YDE   +W
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGISKKKKDKKTYDETMDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES--- 190
           VP +G+K    + A DW++ VPQN DP  D F                   +NI  +   
Sbjct: 137 VPTYGFKRAEAEKAKDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKI 196

Query: 191 EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           +   +   G +A S    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 DMPRSGYLGPEAAS--SSQLLTAVTVAKSSTASVGKFQNKLPKEKEARGL 244



>gi|255730343|ref|XP_002550096.1| regulator of ribosome biosynthesis [Candida tropicalis MYA-3404]
 gi|240132053|gb|EER31611.1| regulator of ribosome biosynthesis [Candida tropicalis MYA-3404]
          Length = 207

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 93/156 (59%), Gaps = 16/156 (10%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTD----NYLKEYTRDGTQLLINQIF 70
           +K +TV +PIP  YDL  LA FD N LD S L ++ +    +YL   TRD  QLLINQI 
Sbjct: 10  FKPVTVNKPIPNTYDLGNLATFDPNPLDNSILTSNNEKEKEDYLTSTTRDNVQLLINQIL 69

Query: 71  KLPITT------SDLGK-----LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+ T      S  G+     L +LP+  T++PRE         T+WE+FA  KGI+ +
Sbjct: 70  SLPVKTTTETHGSSTGQNSTMTLIQLPDATTILPREKPIPKKKPMTKWEQFAARKGIKPK 129

Query: 120 NKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            K+ K+++DE +GEWVP+WGYKG N    + WL+ V
Sbjct: 130 EKSGKLVFDENSGEWVPKWGYKGKNKQIDDQWLVEV 165



>gi|323346464|gb|EGA80752.1| Rrs1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 203

 Score =  127 bits (318), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 91/156 (58%), Gaps = 23/156 (14%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPI-----------TTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+             S +  L +LP+  T +PRE         T+WEKFA  KGI+ +
Sbjct: 67  SLPMKTTTESXGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPK 126

Query: 120 NK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            +  KMIYDEA+GEWVP+WGYKG N    + WL+ V
Sbjct: 127 ERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEV 162



>gi|323335347|gb|EGA76634.1| Rrs1p [Saccharomyces cerevisiae Vin13]
          Length = 203

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 91/156 (58%), Gaps = 23/156 (14%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNVLD----KNDLDSSNARREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPI-----------TTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+             S +  L +LP+  T +PRE         T+WEKFA  KGI+ +
Sbjct: 67  SLPMKTTTESXGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPK 126

Query: 120 NK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            +  KMIYDEA+GEWVP+WGYKG N    + WL+ V
Sbjct: 127 ERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEV 162



>gi|363749573|ref|XP_003645004.1| hypothetical protein Ecym_2460 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356888637|gb|AET38187.1| Hypothetical protein Ecym_2460 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 208

 Score =  126 bits (316), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 99/196 (50%), Gaps = 27/196 (13%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN-------YLKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YD+  LA FDTN LD    KND D+       +LK  TRD  QL+INQI 
Sbjct: 13  VTVEKPIPVTYDMGNLAVFDTNTLD----KNDLDSSNGAREEHLKSLTRDNMQLMINQIL 68

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LPI T           S    L +LP+  T +PRE         T+WE FA  K I+ +
Sbjct: 69  SLPIKTTTEATGGTSGQSATVTLIQLPQPTTELPREKPLPKPKAPTKWELFAAKKNIKPK 128

Query: 120 NK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQ----NDDPFEDQFSXXXXXXXX 174
            +  KM+YDEA+GEW P+WGYKG N    + WL+ V       DD   D  +        
Sbjct: 129 ERAGKMVYDEASGEWAPKWGYKGINKKLDDQWLVEVDDKVKGTDDELIDPRTLSRAERKK 188

Query: 175 XXXXXXXXHRRNIEES 190
                   H+RN++ S
Sbjct: 189 LIKKNELQHKRNLKNS 204



>gi|512887748|ref|XP_004921974.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Bombyx
           mori]
          Length = 352

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 125/234 (53%), Gaps = 3/234 (1%)

Query: 9   ETQKS-KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLIN 67
           E +KS KYK ITVE+ + L++DL  L A DTN LD   LK + D+YL   TRD  QLL+N
Sbjct: 11  EQKKSDKYKPITVEKHLELEFDLGSLLASDTNDLDIKTLKTNKDSYLLALTRDNAQLLLN 70

Query: 68  QIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYD 127
           ++++LP    +   +  LP+  T++PR          T+W++FAKAKGI  + K+K+ +D
Sbjct: 71  KVWELPTERIEEAIVVRLPQPTTILPRAKPVPVPKPLTKWQEFAKAKGINKKKKDKLQWD 130

Query: 128 EATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI 187
           E   +WVP +G+K T  +   +WLI VPQN DP  D +                   +N+
Sbjct: 131 EQLQKWVPLYGFKKTAAEKEKNWLIEVPQNLDPMTDMYEKKAGEKSEKVAKNELQRLKNL 190

Query: 188 EESEAALNQTKGADARSLRKGELQRQIA--ISKSATASIGKFDKTLKGELKLKG 239
             ++       G    S +    Q   A  ++K++TAS+GKF   L  E + +G
Sbjct: 191 ARAKKVKIPRVGLPVTSDKASATQLSTAASVAKASTASLGKFQDKLPKEKEARG 244



>gi|443429412|gb|AGC92697.1| ribosome biogenesis regulatory protein-like protein [Heliconius
           erato]
          Length = 354

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 125/238 (52%), Gaps = 4/238 (1%)

Query: 6   DQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQ 63
           +Q + +  KYK ITVE+ + L +D+  L A DTN LD   LK+D+  D YL+   RD TQ
Sbjct: 9   EQEQKKAEKYKPITVEKHLDLDFDIGTLLAADTNDLDAKSLKSDSQRDIYLQSLARDNTQ 68

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
           LL+N+I++LP    D   + +LP+  TV+PR          T+W++FAKAKGI  + K++
Sbjct: 69  LLLNKIWELPTERIDEAIVVKLPQPTTVLPRFKPVPKPKPLTKWQEFAKAKGITKKKKDR 128

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
           + +DE   +WVP +G+K    +   DWLI VPQ+ +P  D +                  
Sbjct: 129 LEWDEQLQKWVPLYGFKKAAAEKEKDWLIEVPQHVNPMTDMYEKKAGEKSEKVAKNELQR 188

Query: 184 RRNIEESEAALNQTKGADARSLRKGELQRQIA--ISKSATASIGKFDKTLKGELKLKG 239
            +NI  +        G    S +    Q   A  ++K++TAS+GKF   L  E + +G
Sbjct: 189 LKNIARARKVKIPRVGIPVTSDKASATQLSTAATVAKASTASLGKFQDKLPKEKEARG 246



>gi|498968006|ref|XP_004526203.1| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Ceratitis capitata]
          Length = 348

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 123/230 (53%), Gaps = 5/230 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITV++ + ++ D+  L   D N L++  LKN+ + YL   TRD TQLLIN I+ LP
Sbjct: 17  KYKPITVDKHLEVRLDIGSLLCTDPNDLEDKELKNNKEQYLLNLTRDNTQLLINGIWALP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEK AK KGI+ + ++K  YDE   +W
Sbjct: 77  TERVDECIVAKLPEPTTVLPRLRKPPGPKPLTKWEKIAKEKGIKKKKRDKKKYDEVLDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI---EES 190
           VP +G+K  + +   +W++ VP+N DP ED F                   +NI   ++ 
Sbjct: 137 VPTYGFKRADAEKEKEWVLEVPKNADPNEDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKV 196

Query: 191 EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           E       G +  S   G+L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 EVPRGGYFGPEVAS--SGQLLTAVTVAKSSTASVGKFQSKLPKEKEARGI 244



>gi|365986595|ref|XP_003670129.1| hypothetical protein NDAI_0E00700 [Naumovozyma dairenensis CBS 421]
 gi|343768899|emb|CCD24886.1| hypothetical protein NDAI_0E00700 [Naumovozyma dairenensis CBS 421]
          Length = 203

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 90/154 (58%), Gaps = 19/154 (12%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN-----YLKEYTRDGTQLLINQIFKL 72
           +TVE+ IP+ YDL  L+ FD+N +D++    DT N      +K  TRD  QLLINQ+  L
Sbjct: 11  VTVEKAIPVNYDLGNLSVFDSNFMDKNDF--DTSNGKREENIKNMTRDNVQLLINQLLSL 68

Query: 73  PI--TTSDLG---------KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK 121
           PI  TT   G          L +LP  IT +PRE         T+WEKFA  KGIQ + K
Sbjct: 69  PIKTTTDSTGGSNGQSSSMTLLQLPAPITELPREKPLPKAKAQTKWEKFAATKGIQPKAK 128

Query: 122 N-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
             KM+YDEA+GEWVP+WGY+G N    + WL+ V
Sbjct: 129 TGKMVYDEASGEWVPKWGYRGNNKKLDDQWLVEV 162



>gi|354544243|emb|CCE40966.1| hypothetical protein CPAR2_110040 [Candida parapsilosis]
          Length = 208

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/154 (42%), Positives = 90/154 (58%), Gaps = 16/154 (10%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDESRLKN----DTDNYLKEYTRDGTQLLINQIF 70
           YK +TVE+PI   +DL  LA FD N L   +L++    + + Y+   TRD  QLLINQI 
Sbjct: 7   YKPVTVEKPIENTFDLGNLATFDPNPLSNEKLRSKNESEKEQYISSVTRDNVQLLINQIL 66

Query: 71  KLPI--TTSDLGK---------LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+  TT + G          L +LPE  T++PRE         T+WE+FA  KGI+ +
Sbjct: 67  SLPVKTTTDNQGSSTGHSSSMTLIQLPEPTTLLPREKAIPKPKPPTKWEQFAAKKGIKAK 126

Query: 120 NKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLI 152
            K+ K++YDE  GEWVP+WGYKG N    + WL+
Sbjct: 127 TKDGKLVYDEEKGEWVPKWGYKGNNKSLDDQWLV 160



>gi|261335954|emb|CBH09287.1| putative regulator of ribosome biosynthesis [Heliconius melpomene]
          Length = 357

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 121/230 (52%), Gaps = 4/230 (1%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           KYK ITVE+ + L +D+  L A DTN LD   LK+D+  D YL+   RD TQLL+N+I++
Sbjct: 17  KYKPITVEKHLDLDFDIGTLLAADTNDLDPKSLKSDSQRDIYLQSLARDNTQLLLNKIWE 76

Query: 72  LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATG 131
           LP    D   + +LP+  TV+PR          T+W++FAKAKGI  + K+K+ +DE   
Sbjct: 77  LPTERIDEAIVVKLPQPTTVLPRSKPVPKPKPLTKWQEFAKAKGITKKKKDKLEWDEQLQ 136

Query: 132 EWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE 191
           +WVP +G+K    +   DWLI VPQ+ +P  D +                   +NI  + 
Sbjct: 137 KWVPLYGFKKAAAEKEKDWLIEVPQHVNPMTDMYEKKAGEKSEKVAKNELQRLKNIARAR 196

Query: 192 AALNQTKGADARSLRKGELQRQIA--ISKSATASIGKFDKTLKGELKLKG 239
                  G    S +    Q   A  ++K++TAS+GKF   L  E + +G
Sbjct: 197 KVKIPRVGIPVTSDKASATQLSTAATVAKASTASLGKFQNKLPKEKEARG 246



>gi|301116573|ref|XP_002906015.1| ribosome biogenesis regulatory protein [Phytophthora infestans
           T30-4]
 gi|262109315|gb|EEY67367.1| ribosome biogenesis regulatory protein [Phytophthora infestans
           T30-4]
          Length = 308

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/248 (34%), Positives = 122/248 (49%), Gaps = 26/248 (10%)

Query: 20  VERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDL 79
           V++   L YDL  LAAFDT+       +N+ +  L  + R+  QLLIN IF+LP   SD+
Sbjct: 7   VQKEDDLTYDLGNLAAFDTHPFA---YQNEKELAL--HARENVQLLINHIFELPRQMSDM 61

Query: 80  GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGY 139
           G LA+LP   TVIPRE         T+WEKFAK KGI  R K++ ++DEATGEW   WGY
Sbjct: 62  GPLAQLPVPETVIPREKPLPKPKVETKWEKFAKEKGIDKRKKSRKVFDEATGEWSHTWGY 121

Query: 140 KGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA------ 193
           +   GD   DW + + + D   ED ++                   N+++          
Sbjct: 122 QRA-GDDMKDWAVEMKEGDR--EDPWTKRKQDKRARVDKNLRAQANNLKQGRGKQLAGIA 178

Query: 194 ----------LNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKG--ELKLKGVK 241
                     L  T+   A+   K    + +   + +TAS+GKFDK  +G  E K+KG +
Sbjct: 179 GRTPTGIPVELMNTEDTKAKQRGKEGTSKTLEKVQFSTASMGKFDKMREGESERKVKGKR 238

Query: 242 RKFEPSIG 249
             F P+ G
Sbjct: 239 NNFLPTTG 246



>gi|270012854|gb|EFA09302.1| hypothetical protein TcasGA2_TC030596 [Tribolium castaneum]
          Length = 336

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 130/251 (51%), Gaps = 24/251 (9%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYKS+ V + + +  DL  L A D N LD     + T++YL   TRD TQLL NQI++LP
Sbjct: 17  KYKSVEVNKLVSI--DLGALLAEDLNPLDPG--ASSTNDYLLNLTRDNTQLLFNQIWELP 72

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LP+Q   +PR          T+WE+FAKAKGI  + K+K+ +DE   +W
Sbjct: 73  TERIDEAIVAKLPKQKFCLPRFKPVPRPRPLTKWEQFAKAKGIVKKKKSKLSWDEQLQKW 132

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA- 192
           +P +G+K +      DWLI VPQN DP EDQF+                  RN+ +++  
Sbjct: 133 IPLYGFKRSAALKEKDWLIEVPQNADPLEDQFAKKVEAKSEKVAKNELQRLRNVAKAKNV 192

Query: 193 -----ALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV------- 240
                 L   + + A+     +LQ  + ++KS+TAS+GKF   L  E + +GV       
Sbjct: 193 KVPRFGLTNPEVSSAK-----DLQAAVTVAKSSTASLGKFQDKLPKEKEARGVAAITPGA 247

Query: 241 --KRKFEPSIG 249
             KRK  P  G
Sbjct: 248 TRKRKLPPISG 258



>gi|254586181|ref|XP_002498658.1| ZYRO0G15598p [Zygosaccharomyces rouxii]
 gi|238941552|emb|CAR29725.1| ZYRO0G15598p [Zygosaccharomyces rouxii]
          Length = 206

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 95/163 (58%), Gaps = 15/163 (9%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDT---DNYLKEYTRDGTQLLINQIFKLPI 74
           +TVE+ IP+ YDL  LA FD N LD++ L +     +N++K  TRD  QLL+NQI  LPI
Sbjct: 11  VTVEKSIPVNYDLGNLAVFDNNVLDKNDLDSSNASRENHIKSLTRDNVQLLVNQILSLPI 70

Query: 75  TT--------SDLGK---LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN- 122
            T        SD G    L  LPE  + +PRE         T+WEKFA  KGIQ + K  
Sbjct: 71  KTTTESTGGSSDQGATVALLHLPEPTSELPREKPLPKPKPPTKWEKFAAKKGIQPKAKTG 130

Query: 123 KMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQF 165
           KM+YDEA+GEWVP+WGYKG N +    WL+ +  N    ED+ 
Sbjct: 131 KMVYDEASGEWVPKWGYKGKNKNVDTQWLVEMDDNKKGTEDEL 173



>gi|405123744|gb|AFR98507.1| Rrs1 protein [Cryptococcus neoformans var. grubii H99]
          Length = 313

 Score =  123 bits (308), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 122/247 (49%), Gaps = 3/247 (1%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S  L+   +   +  + R   +Q D ALLAAFD +  D +    D + +L + T   T 
Sbjct: 3   VSHVLDEYTAASTTAVLPRAAAVQTDPALLAAFDVSPPDPAAYA-DRERHLLQLTLTSTH 61

Query: 64  LLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK 123
            L+  +F LP T S  G +   P   T++PRE         T+WE+FAK KGI H+ + K
Sbjct: 62  ALLAALFALPTTPSPAGPVTAFPPPATLLPREKPLPKPKPLTKWERFAKEKGISHKTREK 121

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXH 183
            ++DE   EWVPRWG  G N D    WL  V   D+  +D                   H
Sbjct: 122 DVWDEDRQEWVPRWGRFGKNKDKEAQWLHEVKPGDEADQDPGKTARGERKARIAKNTKQH 181

Query: 184 RRNI--EESEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVK 241
             N+    +  +  +   A  R+ RK EL R + ISK++TAS+GKFD  + GE K +G+K
Sbjct: 182 SANLATAAASVSAARATAASERAARKEELNRNMLISKTSTASLGKFDNKIDGEPKARGMK 241

Query: 242 RKFEPSI 248
           RKF+ +I
Sbjct: 242 RKFDANI 248



>gi|47207991|emb|CAF91693.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 334

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 126/238 (52%), Gaps = 5/238 (2%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIFKLPIT 75
           SITV + + L++D+  L A D N +D   ++N   + +L+   RD TQLL+N+I+KL   
Sbjct: 23  SITVHKDLELEFDVGNLLAVDKNRIDSREVRNTKKEEFLRALGRDNTQLLVNEIWKLQTQ 82

Query: 76  TSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVP 135
                 +A LPE  T +PRE         T+WE+FAK KGIQ + K  +++DE   EW  
Sbjct: 83  RVGDAIVATLPEPTTPLPREKPPPKPRPPTKWEQFAKLKGIQKKKKTNLVWDETAKEWRR 142

Query: 136 RWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALN 195
           RWGYK    D   +W+I VP   DP EDQF+                  +NI  ++    
Sbjct: 143 RWGYKRAK-DDTKEWMIEVPATADPDEDQFAKRTNAKKERVARNEYNRLKNIARAQKVKI 201

Query: 196 QTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKFEPSIGD 250
              G   ++ + K EL + ++++K++TAS G+F   L  E   KG   KRKF+P IGD
Sbjct: 202 PGVGLTPKAQQSKSELAKAVSVAKTSTASAGRFQDRLPKEKPAKGTGKKRKFQPLIGD 259



>gi|340716142|ref|XP_003396560.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Bombus
           terrestris]
          Length = 339

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 121/238 (50%), Gaps = 4/238 (1%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           +K  +KS  V + + ++ DL  L A D N +D   LK+ T+ YLK  TRD  Q++IN+I+
Sbjct: 14  EKDIHKSTEVNKDVEIETDLGTLLALDYNTVDLKALKSQTEQYLKSLTRDNVQIVINKIW 73

Query: 71  KLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI--QHRNKNKMIYDE 128
           +LPI   D   +A+LP+Q  V+PR          T+W++FAK +GI  + + K+K+ +DE
Sbjct: 74  ELPIERVDEVIVAKLPKQKFVLPRARQIPKPKPLTKWQQFAKERGIKTKRKGKSKLKWDE 133

Query: 129 ATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIE 188
              +W+P +GYK        +WL+ V       ED F+                  RNI 
Sbjct: 134 ELQKWIPTFGYKHNKAIEQKEWLVEVNNEGKAMEDPFAAAKTAKEERKSKNELQRLRNIA 193

Query: 189 ESEAALNQTKGADARSL--RKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKF 244
           +++       G   R       +L + + I++++TAS+GKF   L  E   KG+ ++ 
Sbjct: 194 KAKNIKIPKVGLPTREHFPDSQQLSQAVTIARTSTASLGKFQDRLPKEKDAKGIAKQV 251



>gi|366989527|ref|XP_003674531.1| hypothetical protein NCAS_0B00700 [Naumovozyma castellii CBS 4309]
 gi|342300395|emb|CCC68154.1| hypothetical protein NCAS_0B00700 [Naumovozyma castellii CBS 4309]
          Length = 203

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 93/164 (56%), Gaps = 19/164 (11%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN-----YLKEYTRDGT 62
           +  ++ K   +TVE+PI + YDL  LA FD+N L++     DT N      +K  TRD  
Sbjct: 1   MSAEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDF--DTSNGKREENIKNMTRDNV 58

Query: 63  QLLINQIFKLPITTSDLGK-----------LAELPEQITVIPREXXXXXXXXXTRWEKFA 111
           QLLINQ+  LPI T+               L +LP  IT +PRE         T+WE+FA
Sbjct: 59  QLLINQLLSLPIKTTTDSTGGSTGQNSSMTLLQLPVPITELPREKPLPKPKAPTKWEQFA 118

Query: 112 KAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
             KGIQ + K+ KM+YDEATGEWVP+WGYKG N    + WL+ V
Sbjct: 119 AKKGIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEV 162



>gi|350396634|ref|XP_003484615.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Bombus
           impatiens]
          Length = 339

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 120/238 (50%), Gaps = 4/238 (1%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           +K   KS  V + + ++ DL  L A D N +D   LK+ T+ YLK  TRD  Q++IN+I+
Sbjct: 14  EKDTRKSTEVNKDVEIETDLGTLLALDYNTVDPKALKSQTEQYLKNLTRDNVQVVINKIW 73

Query: 71  KLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI--QHRNKNKMIYDE 128
           +LPI   D   +A+LP+Q  V+PR          T+W++FAK KGI  + + K+K+ +DE
Sbjct: 74  ELPIERVDEVIVAKLPKQKFVLPRARQIPKPKPLTKWQQFAKEKGIKTKRKGKSKLKWDE 133

Query: 129 ATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIE 188
              +W+P +GYK        +WL+ V       ED F+                  RNI 
Sbjct: 134 ELQKWIPTFGYKRNKAIEQKEWLVEVNNEGKAMEDPFAAAKTAKEERKSKNELQRLRNIA 193

Query: 189 ESEAALNQTKGADARSL--RKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKF 244
           +++       G   R       +L + + I++++TAS+GKF   L  E   KG+ ++ 
Sbjct: 194 KAKNIKIPKVGLPTREHFPDSQQLSQAMTIARTSTASLGKFQDRLPKEKDAKGIAKQV 251



>gi|470267951|ref|XP_004362209.1| ribosome biogenesis regulatory protein [Dictyostelium fasciculatum]
 gi|328875994|gb|EGG24358.1| ribosome biogenesis regulatory protein [Dictyostelium fasciculatum]
          Length = 327

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 125/241 (51%), Gaps = 12/241 (4%)

Query: 12  KSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK 71
           ++K+ S  VE+   L YDL  L AFD ++L+++    + + Y+ + +RD  QLLI ++F+
Sbjct: 24  QNKFSSHLVEKEDSLLYDLGNLCAFDFSSLNKAEYNENPEEYINKISRDNVQLLITRMFQ 83

Query: 72  LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATG 131
           L     + G LA LP+ +T IPR          TRWE FA  K I+ R K+  ++DE   
Sbjct: 84  LDSKVVESGALALLPKPLTPIPRMKPIPEAKQQTRWEAFAAIKDIKKRKKDSKVWDETHK 143

Query: 132 EWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE 191
           EW   WGYK  N +G N  +   P N  P +D F                  +RN++ES 
Sbjct: 144 EWRHSWGYKRANDEGENFAMYANPNN--PEQDPFQKLIDDKKERVDKNKRLEQRNLDESH 201

Query: 192 ----AALNQTKGADARSLRKGELQRQI----AISKSATASIGKFDKTLKGELKL--KGVK 241
               + +    G D     +G+++  +     ++K +TAS+GKFDK L+G+ KL  +GVK
Sbjct: 202 KRSSSMVGSNNGLDFSKENRGQIKNDVRNTLNVAKVSTASMGKFDKVLEGDKKLPTRGVK 261

Query: 242 R 242
           R
Sbjct: 262 R 262



>gi|195428745|ref|XP_002062426.1| GK16661 [Drosophila willistoni]
 gi|194158511|gb|EDW73412.1| GK16661 [Drosophila willistoni]
          Length = 349

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 119/230 (51%), Gaps = 5/230 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK I+VE+ +  + D+  L   D N  D+ +LK + + YL   TRD TQLL+N I++L 
Sbjct: 17  KYKPISVEKHLECRLDVGTLLITDPNDFDDRQLKENREEYLAALTRDNTQLLVNAIWELS 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  T++PR          T+WEKFAK KGI  + K+K  YDE   +W
Sbjct: 77  TERVDESIVAKLPEPTTILPRLRKVPGPRPLTKWEKFAKEKGIVKKKKDKKTYDETLDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES--- 190
           VP +G+K    +   +W++ VPQN DP  D F                   +NI  +   
Sbjct: 137 VPTYGFKRAEAEKEKEWVMEVPQNVDPNTDMFQKKMDLRNEKVAKNEIQRMKNIVRARKI 196

Query: 191 EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           +   +   G +A S    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 DMPRSGYLGPEAAS--SNQLLTALTVAKSSTASVGKFQDKLPKEKEARGL 244



>gi|367010372|ref|XP_003679687.1| hypothetical protein TDEL_0B03470 [Torulaspora delbrueckii]
 gi|359747345|emb|CCE90476.1| hypothetical protein TDEL_0B03470 [Torulaspora delbrueckii]
          Length = 206

 Score =  121 bits (303), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 91/166 (54%), Gaps = 23/166 (13%)

Query: 8   LETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRD 60
           + T+  K   +TVE+PIP+ YDL  LA FD+N +D    +ND D+        ++  TRD
Sbjct: 1   MSTKDYKSLPVTVEKPIPVTYDLGNLAVFDSNVVD----RNDVDSSNGKREQNIRSLTRD 56

Query: 61  GTQLLINQIFKLPI--TTSDLG---------KLAELPEQITVIPREXXXXXXXXXTRWEK 109
             QLLINQI  LPI  TT   G          L +LP   T +PRE         T+WE 
Sbjct: 57  NVQLLINQILSLPIKTTTESAGGTGNQSASMTLIQLPGPTTELPREKPLPKPKAPTKWEL 116

Query: 110 FAKAKGIQHRNK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           FA  KGI+ + +  KM+YDE  GEWVP+WGYKG N    + WL+ +
Sbjct: 117 FAAKKGIKPKERAGKMVYDEEAGEWVPKWGYKGANKKLDDQWLVEI 162



>gi|50288519|ref|XP_446689.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525997|emb|CAG59616.1| unnamed protein product [Candida glabrata]
          Length = 203

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 94/163 (57%), Gaps = 25/163 (15%)

Query: 13  SKYKS--ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDN-------YLKEYTRDGTQ 63
           S+YK+  +TVE+PIP+ YDL  L+ FDTN +D    +ND D+        +K  TRD  Q
Sbjct: 2   SEYKNLPVTVEKPIPVTYDLGNLSVFDTNVID----RNDVDSSNAKREEVIKSVTRDNVQ 57

Query: 64  LLINQIFKLPI--TTSDLG---------KLAELPEQITVIPREXXXXXXXXXTRWEKFAK 112
           LLINQ+  LPI  TT   G          L +LPE  + +PRE         T+W+KFA 
Sbjct: 58  LLINQLLSLPIKKTTEHTGGNSGQGATVALLQLPEPSSELPREKPLPKPKALTKWQKFAA 117

Query: 113 AKGIQHRNK-NKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            KGI+ + +  KM++DEATG+W P+WGY G N    + WL+ V
Sbjct: 118 KKGIKPKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEV 160



>gi|195127223|ref|XP_002008068.1| GI13300 [Drosophila mojavensis]
 gi|193919677|gb|EDW18544.1| GI13300 [Drosophila mojavensis]
          Length = 347

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/230 (35%), Positives = 121/230 (52%), Gaps = 5/230 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N LD+ +L ++ + YL   TRD TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRIDVGTLLITDPNDLDDRQLADNKEEYLSALTRDNTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K+K  YD+   +W
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGITKKKKDKKTYDDVLDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES--- 190
           VP +G+K    +   +W++ VPQN DP  D F                   +NI  +   
Sbjct: 137 VPTYGFKRAEAEKDKEWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMKNIVRAKKI 196

Query: 191 EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           E   +   G +A S    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 EMPRSGYLGPEAAS--SNQLLTAVTVAKSSTASVGKFQSKLPKEKEARGL 244



>gi|149243924|ref|XP_001526547.1| regulator of ribosome biosynthesis [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146448941|gb|EDK43197.1| regulator of ribosome biosynthesis [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 211

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 66/154 (42%), Positives = 88/154 (57%), Gaps = 16/154 (10%)

Query: 15  YKSITVERPIPLQYDLALLAAFDTNALDE----SRLKNDTDNYLKEYTRDGTQLLINQIF 70
           YK +TVE+PI   +DL  LA FD N L      S+ +N+ + YL   TRD  QLL+NQI 
Sbjct: 7   YKPVTVEKPIENTFDLGNLATFDPNPLSNELLNSKNENEKEQYLTSVTRDNVQLLVNQIL 66

Query: 71  KLPI--TTSDLGKL---------AELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+  TT + G L          +LPE  T +PRE         T+WE+FA  KGI+ +
Sbjct: 67  SLPLKTTTDNQGSLTGQSSSMTLVQLPEPTTPLPREKAIPKAKPKTKWEEFAARKGIKAK 126

Query: 120 NKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLI 152
            K+ K++YDE  GEWV +WGYKG N    + WL+
Sbjct: 127 TKDGKLVYDEEKGEWVSKWGYKGNNKKLDDQWLV 160



>gi|367003329|ref|XP_003686398.1| hypothetical protein TPHA_0G01270 [Tetrapisispora phaffii CBS 4417]
 gi|357524699|emb|CCE63964.1| hypothetical protein TPHA_0G01270 [Tetrapisispora phaffii CBS 4417]
          Length = 203

 Score =  120 bits (300), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 90/158 (56%), Gaps = 23/158 (14%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQ 68
           + + VE+ IP+ YDL  L+ FD+N LD    KND D+        +K  TRD  QLLINQ
Sbjct: 9   RPVKVEKDIPVTYDLGNLSVFDSNVLD----KNDFDSSNGKREENIKALTRDNVQLLINQ 64

Query: 69  IFKLPITTSD-----------LGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQ 117
           I  LP+ T+            +  L +LPE  T +PRE         TRWEKFA  KGI+
Sbjct: 65  ILSLPMKTTTEATGGTSGQGAMMTLIKLPEPSTELPREKPLPKPKAPTRWEKFAARKGIR 124

Query: 118 HRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            + ++ KM+YDEATG+W P+WGY+G N    + WL+ V
Sbjct: 125 SKERSGKMVYDEATGKWAPKWGYQGMNKKLDDQWLVEV 162



>gi|242005813|ref|XP_002423755.1| ribosome biogenesis regulatory protein, putative [Pediculus humanus
           corporis]
 gi|212506957|gb|EEB11017.1| ribosome biogenesis regulatory protein, putative [Pediculus humanus
           corporis]
          Length = 335

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 122/231 (52%), Gaps = 26/231 (11%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           ++ KYK   V + + L+YDL  L A D N L+  +LK++ D YL    RD TQLLIN+I+
Sbjct: 14  EEKKYKPTKVNKHLELEYDLGTLLAIDENELNNDKLKSNLDTYLHSLARDNTQLLINKIW 73

Query: 71  KLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           +LPI   D   +  LP+   ++PR          ++WEKFAK KGI  + K+K+ +D+  
Sbjct: 74  ELPIHIIDDVTMVTLPKSKYLLPRSLPVPPPRQPSKWEKFAKEKGIVKKKKDKLKWDDEL 133

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES 190
            +W+P +GYK    +   +W++ VP N DP+EDQF+                 ++ I   
Sbjct: 134 KKWIPLYGYKRAEAEREKNWIMEVPDNADPYEDQFTKKP--------------KKKIYIF 179

Query: 191 EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGVK 241
               + T GA             + ++K++TAS+GKF K+L  E + K VK
Sbjct: 180 FQTFSTTLGA------------AVTVAKTSTASLGKFQKSLPKEKESKNVK 218



>gi|242247401|ref|NP_001156275.1| ribosome biogenesis regulatory protein homolog [Acyrthosiphon
           pisum]
 gi|239789078|dbj|BAH71186.1| ACYPI008665 [Acyrthosiphon pisum]
          Length = 343

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 72/226 (31%), Positives = 111/226 (49%), Gaps = 3/226 (1%)

Query: 13  SKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKL 72
           S  +S++V + +  + DL  L  FD+N  D  +L++D + YL   TR+  QLLIN++F+L
Sbjct: 17  SAQQSVSVTKVLDPEIDLGTLLCFDSNDFDTPQLRSDQEKYLTYETRNNVQLLINKLFEL 76

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P+   D     +LPE    +PRE         T+W+KFA  KGI+   K K  +D+   +
Sbjct: 77  PMKNEDGYMYVDLPEPRYNLPREKPLPTPKPLTKWQKFAIEKGIKKTPKPKATWDDILQK 136

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQN-DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE 191
           W+P +GYK    D   DW++ VP N  DP  D F+                  RNI  S 
Sbjct: 137 WIPTYGYKKAAADKEKDWILEVPGNAADPNIDLFAQKREAKKERVAKNEYQRLRNIAASR 196

Query: 192 AALNQTKGADAR--SLRKGELQRQIAISKSATASIGKFDKTLKGEL 235
                  G      +L   +L+  + ++K +TAS+GKF   +  E+
Sbjct: 197 KIKVPAVGLPPLEGTLHSNQLKTAVDVAKISTASVGKFQPKISKEV 242



>gi|195020101|ref|XP_001985121.1| GH14686 [Drosophila grimshawi]
 gi|193898603|gb|EDV97469.1| GH14686 [Drosophila grimshawi]
          Length = 344

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 122/230 (53%), Gaps = 5/230 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N L++ ++  + + YL E TRD TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRIDVGTLLITDPNDLEDRQIAKNKEEYLAELTRDNTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K+K  YD+   +W
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKPPGVRPMTKWEKFAKEKGITKKKKDKKTYDDVLDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI---EES 190
           VP +G+K    +   +W++ VPQN DP  D F                   +NI   ++ 
Sbjct: 137 VPTYGFKHAEAEKDKEWVLEVPQNADPNTDMFQKKMDLRNEKVAKNEIQRMKNIVRAKKV 196

Query: 191 EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           E   +   G +A S    +L   + ++K++TAS+GKF   L  E + +G+
Sbjct: 197 EMPRSGYLGPEAAS--SNQLLTAVTVAKASTASVGKFQNKLPKEKEARGL 244



>gi|146412013|ref|XP_001481978.1| hypothetical protein PGUG_05741 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146393485|gb|EDK41643.1| hypothetical protein PGUG_05741 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 217

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 98/153 (64%), Gaps = 12/153 (7%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           +YK + V++PIP  +DL  LAAFD N LD  +LK + + YL+  TRD  QLL+NQI  LP
Sbjct: 25  EYKPVHVDQPIPTTFDLGNLAAFDPNPLDNEQLKTNKEQYLQSVTRDNVQLLVNQILSLP 84

Query: 74  I-TTSDLG----------KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN 122
           + TT+D             LA+LPE  T++PRE         T+WE+FA  KGI+ + K+
Sbjct: 85  MKTTTDTHGSSTGQDSTMTLAQLPEPTTMLPREKPIPKPKPPTKWEQFAAKKGIKAKAKD 144

Query: 123 -KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            KM+YDEATG+WVP+WGYKG N +  + WL+ V
Sbjct: 145 GKMVYDEATGQWVPKWGYKGKNKELDDQWLVEV 177



>gi|485638458|gb|EOD32863.1| hypothetical protein EMIHUDRAFT_364204 [Emiliania huxleyi CCMP1516]
          Length = 383

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 114/249 (45%), Gaps = 23/249 (9%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           SI VE+   L+YDLA LAAFD   L    L  D + +L E  RD  QL+ N+++ + + +
Sbjct: 29  SIEVEKEDDLEYDLAHLAAFDPAPLSAEALSADAEAHLLETARDNAQLMANRLYAI-LAS 87

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPR 136
            +   +  LP   T +PRE         TRWEKFA  KGI  + ++KM++DEA G+W PR
Sbjct: 88  QESKAVIRLPPPTTQLPREKPLPKPRPQTRWEKFAAEKGIVKKKRSKMVWDEAAGQWAPR 147

Query: 137 WGYKGTN--GDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAAL 194
           +G+   N   D    WL+P    +D   D F                   RN  E+  A 
Sbjct: 148 YGFGRANKQDDPLKTWLVPAKPGEDGSTDPFEAAAGKRGEARAKQKRQEERNRLEAAHAA 207

Query: 195 NQT--------------------KGADARSLRKGELQRQIAISKSATASIGKFDKTLKGE 234
             T                    +   A S +K  L R I  ++ +TAS G+FD+ L+ E
Sbjct: 208 GLTSRGKGAAAGAGGSLGSSVIARDLGAASEKKEYLSRAIRTTQVSTASAGRFDRQLEHE 267

Query: 235 LKLKGVKRK 243
              +  KRK
Sbjct: 268 PSKERGKRK 276



>gi|430811976|emb|CCJ30572.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 169

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 86/141 (60%), Gaps = 2/141 (1%)

Query: 21  ERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLG 80
           ++ IPL+ DL  L AF+ N LD   L+N+ + Y+   ++   ++L+N+IF L   T+  G
Sbjct: 9   KKSIPLKLDLGNLCAFNFNPLDICSLENNKEEYIMSLSKTNIEILVNKIFSLSKITTLDG 68

Query: 81  KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK--NKMIYDEATGEWVPRWG 138
              ELPE IT +PRE         T+W+KFA+ K I+ +NK   K+IYDE   +WVP+WG
Sbjct: 69  FFIELPEPITTLPREKSIQKSKPETKWKKFARIKRIKPKNKIDGKLIYDENEKKWVPKWG 128

Query: 139 YKGTNGDGANDWLIPVPQNDD 159
           YKG N +  N WLI +  ++D
Sbjct: 129 YKGKNKNTENQWLIEINSHED 149



>gi|195376833|ref|XP_002047197.1| GJ12069 [Drosophila virilis]
 gi|194154355|gb|EDW69539.1| GJ12069 [Drosophila virilis]
          Length = 347

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 119/228 (52%), Gaps = 1/228 (0%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +  + D+  L   D N  D+ +L N+ + YL   TR+ TQLL+N I++LP
Sbjct: 17  KYKPITVEKHLECRIDVGSLLITDPNDFDDRQLANNKEEYLAALTRENTQLLVNAIWELP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               D   +A+LPE  TV+PR          T+WEKFAK KGI  + K+K  YD+   +W
Sbjct: 77  TERVDESIVAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGITKKKKDKKTYDDVLDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA 193
           VP +G+K    +   DW++ VP+N DP  D F                   RNI  ++  
Sbjct: 137 VPTYGFKRAEAEKDKDWVLEVPENADPNTDMFQKKMDLRNEKVAKNEIQRMRNIVRAKKI 196

Query: 194 -LNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
            + ++      +    +L   + ++KS+TAS+GKF   L  E + +G+
Sbjct: 197 DMPRSGYLGPEAASSNQLLTAVTVAKSSTASVGKFQSKLPKEKEARGL 244



>gi|512199294|gb|EPE28128.1| hypothetical protein GLAREA_04919 [Glarea lozoyensis ATCC 20868]
          Length = 203

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 87/155 (56%), Gaps = 6/155 (3%)

Query: 5   SDQLETQKSKYK-SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
           S  LE  ++K    +TV +P P  +DL LL A D N L  +   N  D+ L    RDG Q
Sbjct: 3   STTLEAGETKKPLPVTVNKPTPYTFDLGLLLATDPNPLVLTSKANLEDD-LAATARDGAQ 61

Query: 64  LLINQIFK-LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN-- 120
            L+NQ+    P+ ++  G L  LP   T +PRE         T W+KFA  KGI+ +   
Sbjct: 62  ALLNQLLSTCPVASTPNGVLLSLPAIETSLPREKPLPPPKAQTTWQKFAAKKGIKPKTAE 121

Query: 121 -KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            K KM+YDEATGEWVP+WGYKG N  G NDW++ V
Sbjct: 122 EKKKMVYDEATGEWVPKWGYKGKNKAGENDWIVEV 156



>gi|260947418|ref|XP_002618006.1| hypothetical protein CLUG_01465 [Clavispora lusitaniae ATCC 42720]
 gi|238847878|gb|EEQ37342.1| hypothetical protein CLUG_01465 [Clavispora lusitaniae ATCC 42720]
          Length = 201

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 92/153 (60%), Gaps = 14/153 (9%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKN--DTDNYLKEYTRDGTQLLINQIFK 71
           K+K +TV +PIP  +DL  LA FD N LD ++LK+    + YL   TRD  QLLINQ+  
Sbjct: 5   KFKPVTVNKPIPNTFDLGNLATFDPNPLDNAKLKDPEQKEAYLASVTRDNLQLLINQVLS 64

Query: 72  LPI-TTSDLG----------KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN 120
           LPI TT+D             L  LPE  T +PRE         T+WE+FA  KGI+ + 
Sbjct: 65  LPIQTTTDTHGSSTGQDSTMTLIRLPEPSTPLPREKSIPKDKPLTKWEQFAAKKGIKAKA 124

Query: 121 KN-KMIYDEATGEWVPRWGYKGTNGDGANDWLI 152
           K+ K++YDEATGEWVP+WGYKG N    + WL+
Sbjct: 125 KDGKLVYDEATGEWVPKWGYKGKNKALDDQWLV 157



>gi|339241523|ref|XP_003376687.1| ribosome biogenesis regulatory protein-like protein [Trichinella
           spiralis]
 gi|316974584|gb|EFV58068.1| ribosome biogenesis regulatory protein-like protein [Trichinella
           spiralis]
          Length = 471

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 117/232 (50%), Gaps = 22/232 (9%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTS 77
           + + R +    DL  L   +   +D+  +K +T+  +    R+  QL+ N++++LP    
Sbjct: 10  LNITRAVDPLIDLGNLLVDEQEPVDQHLMKENTEMAVMNKVRESVQLMANKLWELPTQRI 69

Query: 78  DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRW 137
           +   + ELP   + +PRE         T+WE++AK KGIQ R + +MI+DEA  +W PRW
Sbjct: 70  EDAIVVELPAPTSRLPREKPIPKKAPPTKWEEYAKMKGIQKRKRTRMIWDEAAQDWKPRW 129

Query: 138 GYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQT 197
           GY   N D   DWLI +P+  DP+ D F                  R+  ++   A N+ 
Sbjct: 130 GYNRAN-DNTKDWLIEIPRQKDPYVDYFG----------------ERKEAKKERIAKNEL 172

Query: 198 KGADARSLRKGELQRQIAISKSATASIGKFDKTLKGEL--KLKGVKRKFEPS 247
           +     S R   +  ++  ++ ATAS+GKF + L+GE   K KG K KF P+
Sbjct: 173 RRLKNISRR---VAHKVERARLATASMGKFAEKLRGEKAPKNKGKKNKFLPN 221



>gi|345316560|ref|XP_001509960.2| PREDICTED: ribosome biogenesis regulatory protein homolog
           [Ornithorhynchus anatinus]
          Length = 474

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 86/246 (34%), Positives = 126/246 (51%), Gaps = 13/246 (5%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKN-DTDNYLKEYTRDGTQLLINQIFKL 72
           K + I V + + L++DL  L A D N  D  R  +   +  L+   RD TQLL+N++++L
Sbjct: 20  KLRRIAVHKELELEFDLGHLLATDRNPTDALRRSSAGLEPGLRALARDNTQLLVNRLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P T  +   + +LPE  T +PRE         TRW++FA+ KGI+ R K  +++DEA  E
Sbjct: 80  PATRVEEALVVQLPEPATRLPREKPLPKARPPTRWQQFARLKGIRARKKTNLVWDEARRE 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGY+    D   DWLI VP   DP +DQF+                  RNI  +  
Sbjct: 140 WRRRWGYQRAK-DDTKDWLIEVPHAADPMQDQFALRLRAKKERVARNEFNRLRNIARAH- 197

Query: 193 ALNQTKGADARSLR------KGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
            L    G D   +R      + EL R   ++K +TAS+G+F + L  E   +G   KR+F
Sbjct: 198 KLPPPPGRD--GMRPTGHQDREELGRAERVAKRSTASLGRFQERLPKEKAPRGPGRKRQF 255

Query: 245 EPSIGD 250
           +P +GD
Sbjct: 256 QPLLGD 261



>gi|19112636|ref|NP_595844.1| ribosome biogenesis protein Rrs1 (predicted) [Schizosaccharomyces
           pombe 972h-]
 gi|21362902|sp|O59678.1|RRS1_SCHPO RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|3006152|emb|CAA18393.1| ribosome biogenesis protein Rrs1 (predicted) [Schizosaccharomyces
           pombe]
          Length = 166

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 87/138 (63%), Gaps = 2/138 (1%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLK-NDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           S  +E  IPL +DL  +AAFD + LDE++L  ++ +++L   +RD  Q L+N++  LP  
Sbjct: 2   SAQIENSIPLDFDLGNMAAFDISPLDETKLSGSEKESFLFSLSRDNVQQLVNKMISLPKE 61

Query: 76  TSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWV 134
            +  G L +LPE +T +PR          T+W++FA+ KGI  + +  ++++DEA+GEWV
Sbjct: 62  RTSDGVLLQLPETVTPLPRAKPLPKPKPETKWQRFARIKGIAPKKREGRLVFDEASGEWV 121

Query: 135 PRWGYKGTNGDGANDWLI 152
           P+WGYKG N +    WL+
Sbjct: 122 PKWGYKGKNKELETQWLV 139



>gi|320581208|gb|EFW95429.1| ribosome biogenesis regulatory protein Rrs1p, putative [Ogataea
           parapolymorpha DL-1]
          Length = 276

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 89/148 (60%), Gaps = 11/148 (7%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFKLP 73
           K +TVE+PIP+ YDL  LA FD N L+ S++ ND   ++YL++ TRD  QLLINQ+  LP
Sbjct: 87  KPVTVEKPIPVNYDLGNLAVFDPNPLEASKITNDKTKNDYLRDVTRDNVQLLINQVLSLP 146

Query: 74  IT-TSD-------LGKLAELPEQITVIPREXXXXXXXXXTRWEKFA-KAKGIQHRNKNKM 124
           +  TSD          L +LP+  T +PRE         T+WE FA K    +     K+
Sbjct: 147 LKKTSDNSNGQNSTMTLIQLPDPTTQLPREKSIPKAKEPTKWELFAAKKGIKKKGKDGKL 206

Query: 125 IYDEATGEWVPRWGYKGTNGDGANDWLI 152
           +YDE TG+WV +WGYKG N +  +DWL+
Sbjct: 207 VYDERTGKWVNKWGYKGKNKEVESDWLV 234



>gi|406862481|gb|EKD15531.1| ribosome biogenesis regulatory protein [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 198

 Score =  117 bits (293), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 83/141 (58%), Gaps = 5/141 (3%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           + V +P P  +DL LL A D N +  +  +N  D+ L    RDG Q L+NQ+    PI +
Sbjct: 13  VEVNKPTPYTFDLGLLLASDPNPVLLTSPENLEDD-LAATARDGAQALLNQLLSTCPIAS 71

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN---KNKMIYDEATGEW 133
           +  G L  LPE  T +PRE         T WEKFA  KGI+ ++   + KM+YD+ATGEW
Sbjct: 72  TPNGVLLSLPEIETRLPREKPLPPPKAQTTWEKFAAKKGIKAKSAEQRKKMVYDDATGEW 131

Query: 134 VPRWGYKGTNGDGANDWLIPV 154
           VP+WGYKG N  G NDW++ V
Sbjct: 132 VPKWGYKGANKAGENDWIVEV 152



>gi|255714773|ref|XP_002553668.1| KLTH0E04268p [Lachancea thermotolerans]
 gi|238935050|emb|CAR23231.1| KLTH0E04268p [Lachancea thermotolerans CBS 6340]
          Length = 205

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 91/158 (57%), Gaps = 17/158 (10%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDT---DNYLKEYTRDGTQLLINQIFKLPI 74
           +TVE+PIP+ YDL  LA FD+N LD + L +     +  +K+ +RD  QL+INQI  LPI
Sbjct: 13  VTVEKPIPVTYDLGNLAVFDSNTLDRNDLDSSNAQREENIKKISRDNVQLMINQILSLPI 72

Query: 75  TT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN- 122
            +           S    L +LPE  + +PRE         ++WE+FA  KGI+ + ++ 
Sbjct: 73  KSTTESANGTSGQSASMTLVQLPEPTSELPREKPLPKPKAPSKWEQFAAKKGIKPKERSG 132

Query: 123 KMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDP 160
           KM+YDE  G+WVP+WG+ G N      WL+ V  +D+P
Sbjct: 133 KMVYDEDAGQWVPKWGFNGANKKLDKQWLVEV--DDEP 168



>gi|156381110|ref|XP_001632109.1| predicted protein [Nematostella vectensis]
 gi|156219160|gb|EDO40046.1| predicted protein [Nematostella vectensis]
          Length = 244

 Score =  117 bits (292), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 112/209 (53%), Gaps = 15/209 (7%)

Query: 51  DNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKF 110
           +++LK   R+ TQLL N+I+KLP    +   LA+LP   TVIPRE         TRWE++
Sbjct: 16  EDFLKNLARENTQLLFNEIWKLPTERFEGVILAQLPAPTTVIPREKPVPKPKPLTRWEEY 75

Query: 111 AKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXX 170
           AK KGI+ + + + ++DE   +W+PR+GY+  N D   DWL  VP N DPFEDQF     
Sbjct: 76  AKLKGIKKKKRERKVWDEEKQKWLPRYGYERGN-DNTKDWLAVVPDNADPFEDQFEKRLE 134

Query: 171 XXXXXXXXXXXXHRRNIEESEAALNQTKGADARSLR------KGELQRQIAISKSATASI 224
                         RNI    A   + K AD R+L+      K ++   I  ++ ATAS+
Sbjct: 135 KKKERIAKNEYQRLRNI----AKHKKVKVAD-RNLKPSLKQSKDQIMAAIGATRKATASV 189

Query: 225 GKFDKTLKGE---LKLKGVKRKFEPSIGD 250
           GKF + L  E    K +G KRKF+   G+
Sbjct: 190 GKFTEKLAKEKVPKKAEGRKRKFDAVAGE 218



>gi|470293505|ref|XP_004343908.1| Rrs1 protein [Capsaspora owczarzaki ATCC 30864]
 gi|320165153|gb|EFW42052.1| Rrs1 protein [Capsaspora owczarzaki ATCC 30864]
          Length = 307

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 123/242 (50%), Gaps = 7/242 (2%)

Query: 13  SKYKSITVERPIPLQYDLALLAAFDTNALDESRL-KNDTDNYLKEYTRDGTQLLINQIFK 71
           +K +++TV+R  P   D   L   DT  L  S L       Y++   RDG Q+L N I++
Sbjct: 16  AKRRAVTVDREQPHDVDAGNLMVVDTVPLLPSELTAARRGEYIRALARDGVQVLFNAIWE 75

Query: 72  LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEAT 130
           LP T +D   LA LP     IPRE         T+WE+FA  KGI+  +K +  ++D+  
Sbjct: 76  LPTTRADEVVLASLPNPTYAIPREKPVPKPKQLTKWEQFALKKGIKKNSKRDTRVFDDTK 135

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES 190
            E+V R GY+        DW+I +P   DPF D F+                  RNI ++
Sbjct: 136 QEFVRRHGYEHRKNQDDKDWIIELPDQADPFVDYFAKRNELKKGRVAKNEMQQARNIAKA 195

Query: 191 EAALNQTKGADARS--LRKGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEP 246
              + Q   A + S   +K  L+ Q+  +K++TAS+G+FDK++  E K+K  G KR+++ 
Sbjct: 196 N-PVKQGLAAPSTSNDAKKQLLKEQLKRTKTSTASLGRFDKSIGKEPKIKTPGKKRQYDS 254

Query: 247 SI 248
           ++
Sbjct: 255 AV 256



>gi|440639714|gb|ELR09633.1| hypothetical protein GMDG_04124 [Geomyces destructans 20631-21]
          Length = 196

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 85/150 (56%), Gaps = 6/150 (4%)

Query: 9   ETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQ 68
           E Q+     + V++P P  +DL  L A D N L+ +    + ++ L    RDG Q LINQ
Sbjct: 3   EVQELTRLPVVVDKPTPYIFDLGYLLANDPNPLELN--SENIEDDLSATARDGAQALINQ 60

Query: 69  IF-KLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN---KNKM 124
           +    PIT++  G L  LP   T +PRE         T WE+FA+ KGI+ +    + KM
Sbjct: 61  LLGTCPITSAPAGVLLTLPTPSTHLPREKPLPPPKAETTWERFARKKGIKAKTADVRQKM 120

Query: 125 IYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            YDEATGEWVP+WGYKG N  G NDW++ V
Sbjct: 121 QYDEATGEWVPKWGYKGANKAGENDWIVEV 150



>gi|154314321|ref|XP_001556485.1| hypothetical protein BC1G_05254 [Botryotinia fuckeliana B05.10]
 gi|347827405|emb|CCD43102.1| similar to ribosome biogenesis protein (Rrs1) [Botryotinia
           fuckeliana T4]
 gi|472241577|gb|EMR86293.1| putative ribosome biogenesis protein [Botryotinia fuckeliana BcDW1]
          Length = 202

 Score =  115 bits (289), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 85/151 (56%), Gaps = 5/151 (3%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           QK     ITV +P P  +DL LL A D N L  +   N  D+ L    RDG Q L+NQ+ 
Sbjct: 7   QKPSKLPITVNKPTPYTFDLGLLLAEDPNPLLLTTSANLEDD-LAATARDGAQALLNQLL 65

Query: 71  K-LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN---KNKMIY 126
              PI ++  G L  LP   T +PRE         T W+KFA  KGI+ +    K K++Y
Sbjct: 66  STCPIASTPNGVLLSLPGIATKLPREKPLPPPVAQTTWQKFAAKKGIKPKTAEAKKKLVY 125

Query: 127 DEATGEWVPRWGYKGTNGDGANDWLIPVPQN 157
           DE+TGEWVP+WGYKG N  G +DW++ V +N
Sbjct: 126 DESTGEWVPKWGYKGINKKGEDDWIVEVNEN 156



>gi|345568148|gb|EGX51049.1| hypothetical protein AOL_s00054g785 [Arthrobotrys oligospora ATCC
           24927]
          Length = 206

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 92/153 (60%), Gaps = 3/153 (1%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            S ++E  + +   +TV +PIPL YDL  L AFD+N L      +  +  L    RD TQ
Sbjct: 1   MSTEMEVDEPQRLPVTVTKPIPLTYDLGHLTAFDSNPLP-PLTPSTLEQTLHSTARDATQ 59

Query: 64  LLINQIFK-LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN 122
           LLINQI   + + ++  G  A LPE IT +PRE         T WEKFAK KGI  + K+
Sbjct: 60  LLINQILTTVALKSTQDGVYATLPEPITNLPREKPVPKAKELTSWEKFAKKKGIAAKAKD 119

Query: 123 -KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            KM+YDEATGEWVP+WGYKG+N  G +DW + V
Sbjct: 120 GKMVYDEATGEWVPKWGYKGSNKGGEDDWAVEV 152



>gi|317419902|emb|CBN81938.1| Ribosome biogenesis regulatory protein homolog [Dicentrarchus
           labrax]
          Length = 353

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 128/241 (53%), Gaps = 5/241 (2%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K KSI+V + + L++D+  L A D N ++    +    +++L+   RD TQLLINQI+K 
Sbjct: 20  KLKSISVHKELDLEFDVGNLLACDKNRIEVRGFREQKKEDFLRSLARDNTQLLINQIWKQ 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   + +LPE  T +PRE         T+WE+FAK KGIQ + K  +++DE   E
Sbjct: 80  PTERVEEAIVVKLPESATPLPREKPPPKPKPPTKWEEFAKLKGIQKKKKTNLVWDETAKE 139

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W  RWGYK    D   +WLI VP+  DP EDQF+                  +NI  ++ 
Sbjct: 140 WKRRWGYKRAK-DDTKEWLIEVPETADPNEDQFAKRVKAKKERVAKNEFNRLKNIARAQK 198

Query: 193 ALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGELKLK--GVKRKFEPSIG 249
                 G    + + K +L + ++++K++TAS G+F   L  E   K  G +RKFEP IG
Sbjct: 199 IKVPGVGLTPVAQQSKDDLSKAVSVAKTSTASAGRFQDRLPKEKPPKNTGKRRKFEPLIG 258

Query: 250 D 250
           +
Sbjct: 259 N 259



>gi|158286807|ref|XP_308939.3| AGAP006808-PA [Anopheles gambiae str. PEST]
 gi|157020644|gb|EAA04194.3| AGAP006808-PA [Anopheles gambiae str. PEST]
          Length = 346

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 116/228 (50%), Gaps = 2/228 (0%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLP 73
           KYK ITVE+ +    D+  +   D N  DE ++K D + Y+ + TRD  QLLIN I++LP
Sbjct: 17  KYKPITVEKALEPTIDVGHMLVSDPNYYDEEQMKADREKYVLDLTRDNVQLLINSIWQLP 76

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEW 133
               +   +A+LP     +PR          T+WE+FAK KGI+ R ++K ++D    +W
Sbjct: 77  TERVEESIVAKLPPPKAPLPRARKLPVPKPLTKWEEFAKKKGIKKRTRDKKVFDPVLDKW 136

Query: 134 VPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA- 192
           VP +GY+    +   DW++ VPQN DP+ D F                   +NI  ++  
Sbjct: 137 VPTYGYQRYKAEKEKDWVLEVPQN-DPYRDMFKEKRDLRLERVAKNEVARMKNIARAKKI 195

Query: 193 ALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV 240
           A  +T      +    +L     I K++TAS+G F ++L  E + +G+
Sbjct: 196 ATPRTGFVGPETASAKQLITASNIVKASTASVGVFQESLPNEKQARGL 243



>gi|403217665|emb|CCK72158.1| hypothetical protein KNAG_0J00750 [Kazachstania naganishii CBS
           8797]
          Length = 186

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 84/143 (58%), Gaps = 10/143 (6%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTS 77
           +TVE+PIP+ YDL  L  FD+N +D S      +  ++  TRD  QLLINQ+  LPI TS
Sbjct: 9   VTVEKPIPVTYDLGNLTVFDSNVVDVSA----GEVAVQSATRDNVQLLINQLLSLPIRTS 64

Query: 78  DLG-----KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATG 131
             G      L +LP+  T +PRE         T+WEKFA  KGI+ + K  + +YDE +G
Sbjct: 65  TEGGGNGIALLQLPQPTTELPREKALPKKKELTKWEKFAAKKGIRSKVKTGRKVYDEESG 124

Query: 132 EWVPRWGYKGTNGDGANDWLIPV 154
           EWV +WG++G N    + WL+ V
Sbjct: 125 EWVNKWGHEGANKKLDSQWLVEV 147



>gi|66821133|ref|XP_644082.1| ribosome biogenesis regulatory protein [Dictyostelium discoideum
           AX4]
 gi|74860288|sp|Q869Q2.1|RRS1_DICDI RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|60472200|gb|EAL70153.1| ribosome biogenesis regulatory protein [Dictyostelium discoideum
           AX4]
          Length = 317

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 116/217 (53%), Gaps = 11/217 (5%)

Query: 26  LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAEL 85
           L YDL  L AFD ++L+++  K++ + Y+ + +RD  QLLI+++F+LPI   + G LA L
Sbjct: 27  LLYDLGNLTAFDHSSLNKTEYKSNPNEYINKLSRDNVQLLISRLFQLPIKEIEEGSLALL 86

Query: 86  PEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGD 145
           P   T IPRE         TRWE FA+ KGI+ + K+ M +D+   E+ P +GYK  N D
Sbjct: 87  PRCTTPIPRERSLPTSKPKTRWEAFAEIKGIKKKKKSSMEWDKEHEEYRPTFGYKKAN-D 145

Query: 146 GANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGA----- 200
            ANDW +    +D   ED F                  +RN +  EA++ Q         
Sbjct: 146 VANDWAMLARPDDKVGEDPFKKLEDEKNDRVSKQKKREQRNFD--EASMRQMSNVGKTLS 203

Query: 201 ---DARSLRKGELQRQIAISKSATASIGKFDKTLKGE 234
              + R   K ++++   ++K +TAS+GKFDK ++ E
Sbjct: 204 FDKEHRGQIKSDMEKVFDVAKLSTASLGKFDKRVENE 240



>gi|302841019|ref|XP_002952055.1| hypothetical protein VOLCADRAFT_118049 [Volvox carteri f.
           nagariensis]
 gi|300262641|gb|EFJ46846.1| hypothetical protein VOLCADRAFT_118049 [Volvox carteri f.
           nagariensis]
          Length = 382

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 110/238 (46%), Gaps = 35/238 (14%)

Query: 26  LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAEL 85
           L +D+  L+A+D   LD +RL  D D    E  R  TQ L+ Q+F LP      G+LA L
Sbjct: 34  LDFDIGNLSAYDPAPLDMARLTVDPDGMCAEIARGITQALVTQLFNLPAEAVRGGRLANL 93

Query: 86  PEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGD 145
           P   T +PR          T+W++FA  KGI  R ++K+ YD+ TGEW  R+GYK  N D
Sbjct: 94  PAPTTQLPRALPVPKAKPLTKWQQFAAKKGIVKRKRSKLAYDDTTGEWRRRYGYKRLNDD 153

Query: 146 GANDW-LIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQTKGADA-- 202
             ND  +I     D P ED F+                   N+++    + +  GA A  
Sbjct: 154 --NDIPIIEAKATDKPGEDPFAALAAEKRERVKANRASQLANLKQ----VAKRVGAGALP 207

Query: 203 ----------------------RSLRKGELQRQIA----ISKSATASIGKFDKTLKGE 234
                                 +SLR+ EL++ I     ++  +TASIGKFDK L GE
Sbjct: 208 ASLRLAATLPGEGGKKVGKGMDKSLRRKELKQDIKSASRLAGISTASIGKFDKRLAGE 265



>gi|385305615|gb|EIF49576.1| regulator of ribosome biosynthesis [Dekkera bruxellensis AWRI1499]
          Length = 201

 Score =  113 bits (282), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 93/152 (61%), Gaps = 8/152 (5%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQ 68
           +K++ K  TV++ IP++YD   LA +D   LD +++ +    ++YLK  TRD  QLLINQ
Sbjct: 4   EKTELKPATVQKTIPVEYDTGNLAVYDPAPLDATKISDAXAKESYLKSITRDNVQLLINQ 63

Query: 69  IFKLPITTSDLGK-----LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK-N 122
           +  LP+T   + +     L ELPE I  +PRE         T+WEKFA+ KGI  + K +
Sbjct: 64  VLSLPLTNKKIDEQTNMTLVELPEPIYQLPREKSLPKEKEKTKWEKFAEKKGISKKEKRS 123

Query: 123 KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           + +YDEA+GEWV RWGYKG N    + WL+ V
Sbjct: 124 RKVYDEASGEWVNRWGYKGKNKXMDDQWLVEV 155



>gi|327352353|gb|EGE81210.1| ribosome biogenesis protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 259

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 83/155 (53%), Gaps = 21/155 (13%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK-LPI 74
           ITVE+P P  +DL  L A D N L    L N+T  +  L    RDG Q L+NQ+    PI
Sbjct: 59  ITVEKPTPYTFDLGHLLALDPNPLT---LPNNTSLNAALASTARDGAQSLLNQLLTTCPI 115

Query: 75  TTSDL-GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN----------- 122
           T +   G L  LP + T++PR          T+WE FA+ KGI   NK            
Sbjct: 116 TATPRDGILLSLPPRNTLLPRFKPLPAPKQPTKWELFARKKGIGKYNKKLGSGGGSAEAE 175

Query: 123 ---KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
              K++YDEA+GEWVPRWGYKG N  G NDWL+ V
Sbjct: 176 RRKKLVYDEASGEWVPRWGYKGKNKSGENDWLVEV 210



>gi|268559672|ref|XP_002637827.1| Hypothetical protein CBG04617 [Caenorhabditis briggsae]
 gi|298289231|sp|A8WY26.1|RRS1_CAEBR RecName: Full=Ribosome biogenesis regulatory protein homolog
          Length = 329

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 84/242 (34%), Positives = 116/242 (47%), Gaps = 18/242 (7%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           KS  VE+ I    DL  L   D   L     + D +  L+E  R  TQLL N I++L   
Sbjct: 4   KSTEVEKAIDPIIDLGNLLFIDREPL-----QGDAEEGLEERARKNTQLLFNNIWQLEQK 58

Query: 76  TSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVP 135
             +   +  LP     +PRE         T+WEK+AK KGI+ R K+K ++DEAT EW P
Sbjct: 59  RVEEAIIVTLPAATYRLPREKKLPEKKEPTKWEKYAKEKGIEKRKKDKKVFDEATKEWKP 118

Query: 136 RWGYKGTNGDGANDWLIPVPQN-DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAAL 194
            +GY+  N D   DWLI +P N +DP +D F+                  +N+       
Sbjct: 119 TYGYRRGN-DNTKDWLIEIPDNAEDPNKDFFAERREKKKERVAKNEMQRMKNLARQMKTT 177

Query: 195 NQTK---------GADARSLRKGELQRQIAISKSATASIGKFDKTLKGE-LKLK-GVKRK 243
            +T          G DA+   K +++  +  +K ATAS GKF + LKGE   +K G KRK
Sbjct: 178 VKTGPSTDKMIGVGIDAKDKSKQDVRFAVDRAKLATASAGKFQEGLKGEKANIKTGKKRK 237

Query: 244 FE 245
           FE
Sbjct: 238 FE 239



>gi|261190788|ref|XP_002621803.1| ribosome biogenesis protein [Ajellomyces dermatitidis SLH14081]
 gi|239591226|gb|EEQ73807.1| ribosome biogenesis protein [Ajellomyces dermatitidis SLH14081]
 gi|239614911|gb|EEQ91898.1| ribosome biogenesis protein [Ajellomyces dermatitidis ER-3]
          Length = 225

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 83/155 (53%), Gaps = 21/155 (13%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK-LPI 74
           ITVE+P P  +DL  L A D N L    L N+T  +  L    RDG Q L+NQ+    PI
Sbjct: 25  ITVEKPTPYTFDLGHLLALDPNPLT---LPNNTSLNAALASTARDGAQSLLNQLLTTCPI 81

Query: 75  TTSDL-GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN----------- 122
           T +   G L  LP + T++PR          T+WE FA+ KGI   NK            
Sbjct: 82  TATPRDGILLSLPPRNTLLPRFKPLPAPKQPTKWELFARKKGIGKYNKKLGSGGGSAEAE 141

Query: 123 ---KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
              K++YDEA+GEWVPRWGYKG N  G NDWL+ V
Sbjct: 142 RRKKLVYDEASGEWVPRWGYKGKNKSGENDWLVEV 176



>gi|501756058|emb|CCG80833.1| Ribosome biogenesis regulatory protein homolog [Taphrina deformans
           PYCC 5710]
          Length = 221

 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 83/138 (60%), Gaps = 6/138 (4%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           K ITVE+ IP+++DL  L+AFD N +  S     +D+ L    RDGTQLL+N I   PI 
Sbjct: 22  KVITVEKAIPVEFDLGHLSAFDINPVSSS-----SDDSLLAVARDGTQLLLNAILSCPIQ 76

Query: 76  TSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWV 134
           +++ G L  L E  T +PRE         T+W KFA+ KGI+ + ++ KM++DE   +WV
Sbjct: 77  STNEGVLITLLEPTTRLPREKPVPAESAETKWAKFARLKGIKAKKRDGKMVFDEEKEDWV 136

Query: 135 PRWGYKGTNGDGANDWLI 152
           P+WGYKG N D    W +
Sbjct: 137 PKWGYKGQNKDAEQAWAV 154



>gi|298707303|emb|CBJ25930.1| Ribosome biogenesis regulatory protein homolog [Ectocarpus
           siliculosus]
          Length = 343

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 118/239 (49%), Gaps = 18/239 (7%)

Query: 26  LQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAEL 85
           LQ+DL  L   + + +DE  L +D++ YLK   +   Q LIN++F LP   S++G +A L
Sbjct: 30  LQFDLRNLLVVNPHQVDEQALADDSEEYLKGQAQAAVQSLINRLFVLPTVPSEVGPVATL 89

Query: 86  P-EQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNG 144
           P ++ +++PR          TRW++FAK KGI    +++M++D+   EW PR GYK  N 
Sbjct: 90  PAKEESILPRAKPVPAPKAETRWDRFAKEKGITGSKRSRMVWDDDLKEWRPRHGYKRAND 149

Query: 145 DGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES-------------E 191
              N  ++ V    DP  + +S                  +N+E +              
Sbjct: 150 GVLNHAIVEVKPGKDPMANPWSEAREEKKGRVEKNLSNRAKNVERAGGGAKPGIPVDLLP 209

Query: 192 AALNQTKGADARSLR-KGELQRQIAISKSATASIGKFDKTLKGE---LKLKGVKRKFEP 246
           +A + + G  A + R K   +  + + + +TAS+GKFD+    E    K KGV+R F+P
Sbjct: 210 SAKDGSGGGGAPAKRGKANTKGALELVQHSTASMGKFDERRHAEPERRKGKGVRRAFKP 268



>gi|308500300|ref|XP_003112335.1| CRE-RRBS-1 protein [Caenorhabditis remanei]
 gi|308266903|gb|EFP10856.1| CRE-RRBS-1 protein [Caenorhabditis remanei]
          Length = 369

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 86/247 (34%), Positives = 118/247 (47%), Gaps = 18/247 (7%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           QK   KS  VE+ I    DL  L       +D   L+ D +  L+E  R  TQLL N I+
Sbjct: 39  QKMADKSTEVEKAIDPIVDLGNLLF-----IDREPLQGDPNEGLEERARKNTQLLFNNIW 93

Query: 71  KLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEAT 130
           +L     +      LP     +PRE         T+WEK+AK KGI+ R K+K ++DEAT
Sbjct: 94  QLEQKRVEEAITVTLPVATYRLPREKKMPEKKEPTKWEKYAKEKGIEKRKKDKKVFDEAT 153

Query: 131 GEWVPRWGYKGTNGDGANDWLIPVPQN-DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE 189
            EW P +GY+  N D   DWLI +P N +DP +D F+                  +N+  
Sbjct: 154 KEWKPTYGYRRGN-DNTKDWLIEIPDNAEDPNKDFFAERREKKKERVAKNEMQRMKNLAR 212

Query: 190 SEAALNQTK---------GADARSLRKGELQRQIAISKSATASIGKFDKTLKGE-LKLK- 238
                 +T          G DA+   K +++  +  +K ATAS GKF + LKGE   +K 
Sbjct: 213 QMKTTVKTGPSTEKIIGVGIDAKEKSKQQVRFAVDRAKLATASAGKFQEGLKGEKANVKT 272

Query: 239 GVKRKFE 245
           G KRKFE
Sbjct: 273 GKKRKFE 279



>gi|296414485|ref|XP_002836930.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295632775|emb|CAZ81121.1| unnamed protein product [Tuber melanosporum]
          Length = 184

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 74/127 (58%), Gaps = 2/127 (1%)

Query: 30  LALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITTSDLGKLAELPEQ 88
           +  L AFD N LD +   N  +  L    RD  Q LINQ+   LP+ +   G  A LP+ 
Sbjct: 1   MGNLCAFDANPLDPTTYSNTLEECLNGAARDCAQALINQVLTTLPMKSVSDGVYAGLPDP 60

Query: 89  ITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWGYKGTNGDGA 147
           +T +PRE         T+WE FAK KGI+ + ++ K++YDE  GEWVP+WGYKG N DG 
Sbjct: 61  LTPLPREKPLPKAKEPTKWELFAKKKGIKAKTRDGKLVYDEEKGEWVPKWGYKGKNKDGE 120

Query: 148 NDWLIPV 154
            DW++ V
Sbjct: 121 GDWIVEV 127



>gi|156036162|ref|XP_001586192.1| hypothetical protein SS1G_12767 [Sclerotinia sclerotiorum 1980]
 gi|154698175|gb|EDN97913.1| hypothetical protein SS1G_12767 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 202

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 82/148 (55%), Gaps = 5/148 (3%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF 70
           QK     + V +P P  +DL LL A D N L  +  +N  +  L    RDG Q L+NQ+ 
Sbjct: 7   QKPSKLPVIVNKPTPYTFDLGLLLAEDPNPLLLTTSEN-LEADLAATARDGAQALLNQLL 65

Query: 71  K-LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN---KNKMIY 126
              PI ++  G L  LP   T +PRE         T W+KFA  KGI+ +    K K++Y
Sbjct: 66  STCPIASTPNGVLLSLPAIATKLPREKPLPPPVGQTTWQKFAAKKGIKPKTAEAKKKLVY 125

Query: 127 DEATGEWVPRWGYKGTNGDGANDWLIPV 154
           DE+TGEWVP+WGYKG N  G +DW++ V
Sbjct: 126 DESTGEWVPKWGYKGINKKGEDDWIVEV 153



>gi|396478553|ref|XP_003840559.1| hypothetical protein LEMA_P102110.1 [Leptosphaeria maculans JN3]
 gi|312217131|emb|CBX97080.1| hypothetical protein LEMA_P102110.1 [Leptosphaeria maculans JN3]
          Length = 235

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 80/153 (52%), Gaps = 6/153 (3%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
            +D   T +  +  ITV +P P  +DL  L A D N +      N  +  L    RD  Q
Sbjct: 42  IADSTATSRLPHSPITVNKPTPFTFDLGNLLANDPNPVP----ANANEEVLTATARDAAQ 97

Query: 64  LLINQIFK-LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN 122
            LINQ+     I ++  G    LP   T +PRE         T+WE+FA  KGI+ + ++
Sbjct: 98  ALINQLLSTCEIKSTTEGVHLVLPAPTTALPREKPIPAAKEPTKWERFAAKKGIKDKKRD 157

Query: 123 -KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            K++YDE  GEWVP+WGYKG N DG N WL+ V
Sbjct: 158 GKLVYDEEKGEWVPKWGYKGKNKDGDNQWLVEV 190



>gi|330802790|ref|XP_003289396.1| hypothetical protein DICPUDRAFT_35659 [Dictyostelium purpureum]
 gi|325080514|gb|EGC34066.1| hypothetical protein DICPUDRAFT_35659 [Dictyostelium purpureum]
          Length = 316

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 119/223 (53%), Gaps = 11/223 (4%)

Query: 20  VERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDL 79
           VE    L YDL  L AFD +++D++  K +   Y+ E  R   QLLI+++F+LPI + + 
Sbjct: 20  VEGEDTLLYDLGNLCAFDHSSIDKNEYKENPTKYINELARKNVQLLISRLFQLPIKSIEE 79

Query: 80  GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGY 139
           G LA LP+  T IPRE         TRWE FA+ KGI+ + K+KM +DE   E+ P +GY
Sbjct: 80  GSLALLPKCETKIPRERSVPQGKQKTRWEAFAELKGIKKQKKSKMQWDEKHQEYRPSYGY 139

Query: 140 KGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAALNQ--- 196
           K  N D + +++I   Q+D   +D F                  +RN +  EA++ Q   
Sbjct: 140 KKAN-DDSGEYIIEGKQSDKVGDDPFQKKEEEKNQKVQKQKKREQRNFD--EASMRQMGN 196

Query: 197 -----TKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGE 234
                T   + R   K ++++   ++K +TAS+G+FDK ++ E
Sbjct: 197 VGKSLTFSQENRPTIKSDMEKVFDVAKLSTASLGRFDKKVENE 239



>gi|485633376|gb|EOD28251.1| hypothetical protein EMIHUDRAFT_123316 [Emiliania huxleyi CCMP1516]
          Length = 387

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 85/156 (54%), Gaps = 7/156 (4%)

Query: 13  SKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKL 72
           S   SI VE+   L+YDLA LAAFD   L    L  D + +L E  RD  QL+ N+++ +
Sbjct: 25  SGRPSIEVEKEDDLEYDLAHLAAFDPAPLSAEALSADAEAHLLETARDNAQLMANRLYAI 84

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
            + + +   +  LP   T +PRE         TRWEKFA  KGI  + ++KM++DEA G+
Sbjct: 85  -LASQESKAVIRLPPPTTQLPREKPLPKPRPQTRWEKFAAEKGIVKKKRSKMVWDEAAGQ 143

Query: 133 WVPRWGYKGTN--GDGANDWLIPV-PQND---DPFE 162
           W PR+G+   N   D    WL+P  P  D   DPFE
Sbjct: 144 WAPRYGFGRANKQDDPLKTWLVPAKPGEDGSTDPFE 179



>gi|213406145|ref|XP_002173844.1| ribosome biogenesis protein Rrs1 [Schizosaccharomyces japonicus
           yFS275]
 gi|212001891|gb|EEB07551.1| ribosome biogenesis protein Rrs1 [Schizosaccharomyces japonicus
           yFS275]
          Length = 161

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 79/137 (57%), Gaps = 5/137 (3%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITT 76
           S+ VE+ +PL+ DL  + AFD   +     K   +  L+   RD  Q+LINQ+F LP  +
Sbjct: 2   SVHVEKELPLELDLGNMCAFDIAPVS----KGIKEEQLRALARDNAQVLINQMFSLPTES 57

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK-NKMIYDEATGEWVP 135
           +  G L  LP+  T +PR          TRW+KFA+ KGI  + +  K++YDEA+GEWVP
Sbjct: 58  TKDGLLLLLPDGTTPLPRAKPLPKPKPETRWQKFARIKGIAPKKREGKLVYDEASGEWVP 117

Query: 136 RWGYKGTNGDGANDWLI 152
           RWGY G N    N WL+
Sbjct: 118 RWGYGGKNKALDNQWLV 134



>gi|448089567|ref|XP_004196841.1| Piso0_004067 [Millerozyma farinosa CBS 7064]
 gi|448093860|ref|XP_004197872.1| Piso0_004067 [Millerozyma farinosa CBS 7064]
 gi|359378263|emb|CCE84522.1| Piso0_004067 [Millerozyma farinosa CBS 7064]
 gi|359379294|emb|CCE83491.1| Piso0_004067 [Millerozyma farinosa CBS 7064]
          Length = 200

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 71/155 (45%), Positives = 95/155 (61%), Gaps = 14/155 (9%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFK 71
           ++K +TV++PIP  +DL  LA FD N L+  +LK+D   + YLK  TRD  QLL+NQ+  
Sbjct: 5   EFKPVTVDKPIPNTFDLGNLATFDHNPLENEKLKDDEVREEYLKNITRDNVQLLVNQLLS 64

Query: 72  LPI-TTSD----------LGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN 120
           LP+ TT+D             L +LPE  T +PRE         T+WE FAK KGI+ + 
Sbjct: 65  LPMKTTTDSQNSAGGQDTTMTLIQLPETTTALPREKPLPKPKPPTKWELFAKKKGIKPKE 124

Query: 121 KN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           K+ K++YDEA  EWVP+WGYKG N D  N WL+ V
Sbjct: 125 KSGKLVYDEAKQEWVPKWGYKGKNKDLDNQWLVEV 159



>gi|365758272|gb|EHN00123.1| Rrs1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 151

 Score =  109 bits (273), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 82/142 (57%), Gaps = 23/142 (16%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNY-------LKEYTRDGTQLLINQIF 70
           +TVE+PIP+ YDL  LAAFD+N LD    KND D+        +K  TRD  QLLINQ+ 
Sbjct: 11  VTVEKPIPVVYDLGNLAAFDSNILD----KNDLDSSNAKREEKIKSLTRDNVQLLINQLL 66

Query: 71  KLPITT-----------SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHR 119
            LP+ +           S +  L +LP   T +PRE         T+W+KFA  KGI+ +
Sbjct: 67  SLPMKSTTESAGGTSGQSSVMTLLQLPNATTELPREKPLPKVKAMTKWQKFAAKKGIKPK 126

Query: 120 NK-NKMIYDEATGEWVPRWGYK 140
            +  KM+YDEA+GEWVP+ G +
Sbjct: 127 ERAGKMVYDEASGEWVPKXGLQ 148



>gi|321265488|ref|XP_003197460.1| ribosome biogenesis-related protein [Cryptococcus gattii WM276]
 gi|317463940|gb|ADV25673.1| Ribosome biogenesis-related protein, putative [Cryptococcus gattii
           WM276]
          Length = 314

 Score =  109 bits (272), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 111/219 (50%), Gaps = 3/219 (1%)

Query: 32  LLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQITV 91
           LLAAFD +  D +    D + +L + T   T  L+  +F LP T S  G +A  P   T+
Sbjct: 28  LLAAFDASPTDPAAYA-DREPHLLQLTLASTASLLAALFALPTTPSPAGPVAAFPPPTTL 86

Query: 92  IPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWL 151
           +PRE         T+WE+FA  KGI H+ K K ++D+   EWVPRWG  G N D    WL
Sbjct: 87  LPREKPLPKPKPLTKWERFANEKGISHKKKEKDVWDDERQEWVPRWGRFGKNKDKEEQWL 146

Query: 152 IPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI--EESEAALNQTKGADARSLRKGE 209
             V   ++  +D                   +  NI    +     +   A  R+ RK E
Sbjct: 147 HEVKPGEEADKDPAKTARGERKARIAKNTKQNTANIAAASASVTAARATAAAERAARKEE 206

Query: 210 LQRQIAISKSATASIGKFDKTLKGELKLKGVKRKFEPSI 248
           L R + ISK++TAS+GKFD  ++GE K +G+KRKF+ +I
Sbjct: 207 LNRNMLISKTSTASLGKFDNKIQGEPKARGMKRKFDANI 245



>gi|325090693|gb|EGC44003.1| ribosome biogenesis protein [Ajellomyces capsulatus H88]
          Length = 230

 Score =  109 bits (272), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 86/167 (51%), Gaps = 25/167 (14%)

Query: 10  TQKSKYKS----ITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQ 63
           T K+K K     ITVE+P P  +DL  L A D N L    L NDT  +  L    RDG Q
Sbjct: 18  TSKAKPKPERLPITVEKPTPYTFDLGHLLALDPNPLI---LSNDTSLNAALTATARDGAQ 74

Query: 64  LLINQIFKLPITTSDL--GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK 121
            L+NQ+      TS    G L  LP + T++PR          T+WE FA+ KGI   NK
Sbjct: 75  SLLNQLLTTCTITSTTRDGILLSLPPRTTLLPRFKPLPAPKQPTKWELFARKKGIGKYNK 134

Query: 122 N--------------KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
                          K++YDEA+GEWVPRWGYKG N  G NDWL+ V
Sbjct: 135 KLGSGGGSAEAERRKKLVYDEASGEWVPRWGYKGKNKGGENDWLVEV 181



>gi|225556114|gb|EEH04404.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
          Length = 230

 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 86/167 (51%), Gaps = 25/167 (14%)

Query: 10  TQKSKYKS----ITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQ 63
           T K+K K     ITVE+P P  +DL  L A D N L    L NDT  +  L    RDG Q
Sbjct: 18  TSKAKPKPERLPITVEKPTPYTFDLGHLLALDPNPLI---LSNDTSLNAALTATARDGAQ 74

Query: 64  LLINQIFKLPITTSDL--GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK 121
            L+NQ+      TS    G L  LP + T++PR          T+WE FA+ KGI   NK
Sbjct: 75  SLLNQLLTTCTITSTTRDGILLSLPPRTTLLPRFKPLPAPKQPTKWELFARKKGIGKYNK 134

Query: 122 N--------------KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
                          K++YDEA+GEWVPRWGYKG N  G NDWL+ V
Sbjct: 135 KLGSGGGSAEAERRKKLVYDEASGEWVPRWGYKGKNKGGENDWLVEV 181



>gi|50543670|ref|XP_500001.1| YALI0A12067p [Yarrowia lipolytica]
 gi|49645866|emb|CAG83930.1| YALI0A12067p [Yarrowia lipolytica CLIB122]
          Length = 206

 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 91/159 (57%), Gaps = 17/159 (10%)

Query: 13  SKYKSITVERPIPLQYDLALLAAFDTNAL--DESRLKND---TDNYLKEYTRDGTQLLIN 67
           S+ K++TVE+P+P+ YDL  LA FDTN +  D + L  D    +  L+  +RD  QLLIN
Sbjct: 2   SEIKTVTVEKPVPVTYDLGNLAVFDTNPVEVDLNDLNVDGQAREEALQAVSRDNAQLLIN 61

Query: 68  QIFKLPI-TTSDLG----------KLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI 116
           Q+   PI  T+D             L  LP+  T +PRE         T+W++FA  KGI
Sbjct: 62  QLLSQPIKNTTDSNSSSGNQNSTMSLIMLPQPSTRLPREKPIPKPKAMTKWQEFALKKGI 121

Query: 117 QHRNKN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
           + + ++ K++YDEATG+WVP+WG+ G N +    W + V
Sbjct: 122 KSKARDGKLVYDEATGKWVPKWGFNGKNKELDQQWCVEV 160



>gi|154275832|ref|XP_001538761.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150413834|gb|EDN09199.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 227

 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 81/155 (52%), Gaps = 21/155 (13%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDT--DNYLKEYTRDGTQLLINQIFKLPIT 75
           ITVE+P P  +DL  L A D N L    L NDT  +  L    RDG Q L+NQ+      
Sbjct: 30  ITVEKPTPYTFDLGHLLALDPNPLI---LSNDTSLNAALTATARDGAQSLLNQLLTTCTI 86

Query: 76  TSDL--GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN----------- 122
           TS    G L  LP + T++PR          T+WE FA+ KGI   NK            
Sbjct: 87  TSTTRDGILLSLPPRTTLLPRFKPLPAPKQPTKWELFARKKGIGKYNKKLGSGGGSAEAE 146

Query: 123 ---KMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
              K++YDEA+GEWVPRWGYKG N  G NDWL+ V
Sbjct: 147 RRKKLVYDEASGEWVPRWGYKGKNKGGENDWLVEV 181



>gi|302915759|ref|XP_003051690.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256732629|gb|EEU45977.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 201

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 79/141 (56%), Gaps = 6/141 (4%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           + VE+P P  +DL  L A D N +D    K D +  L E  RDG Q LINQ+    P+++
Sbjct: 12  VAVEKPTPYTFDLGHLLAEDPNPVDLD--KTDLEQSLAELARDGAQSLINQLLTTCPLSS 69

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK---MIYDEATGEW 133
           +  G L  LP   T +PRE         T+WE+FA  KGI+ + + +   + YDE +GEW
Sbjct: 70  TTEGVLLSLPAPSTRLPREKPVPEAKPPTKWERFAAKKGIKPKTREQRRNLAYDEESGEW 129

Query: 134 VPRWGYKGTNGDGANDWLIPV 154
             +WGYKG N  G +DWL+ V
Sbjct: 130 KRKWGYKGLNKKGEDDWLVEV 150



>gi|451848526|gb|EMD61831.1| hypothetical protein COCSADRAFT_146928 [Bipolaris sorokiniana
           ND90Pr]
          Length = 226

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 76/140 (54%), Gaps = 8/140 (5%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           ITV++P P  +DL  L A D N +         +  LK   RD  Q LINQ+     + +
Sbjct: 47  ITVDKPTPFTFDLGNLLANDPNPI----AAGADEEALKATARDAAQALINQLLSTCQVKS 102

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI--QHRNKNKMIYDEATGEWV 134
           +  G    LP   T +PRE         T+WEKFA  KGI  Q R+ N ++YDE  GEWV
Sbjct: 103 TSEGVHLVLPAPTTPLPREKPIPSAKEPTKWEKFAAKKGIKKQKRDSN-LVYDETKGEWV 161

Query: 135 PRWGYKGTNGDGANDWLIPV 154
           P+WGYKG N DG NDWL+ V
Sbjct: 162 PKWGYKGKNKDGENDWLVEV 181



>gi|242793835|ref|XP_002482246.1| ribosome biogenesis protein (Rrs1), putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218718834|gb|EED18254.1| ribosome biogenesis protein (Rrs1), putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 217

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 81/152 (53%), Gaps = 15/152 (9%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTS 77
           ITV +  P  +DL  L A D N L  S+     +N LK   RDG Q+L+NQ+      TS
Sbjct: 22  ITVTKENPYTFDLGHLLAQDPNPLVISK-SESVNNSLKAVARDGAQVLLNQLLTTCPVTS 80

Query: 78  DL--GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI------------QHRNKNK 123
           +   G L  LP   T++PR          T+WE FA+ KGI            +   + K
Sbjct: 81  NAKDGVLLSLPPPNTLLPRYKPLPKPKEPTKWELFARKKGIGKYSSKPGAALAEKERRKK 140

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVP 155
           ++YDEA+GEWVPRWG+KG N  G NDW++ VP
Sbjct: 141 LVYDEASGEWVPRWGFKGANKSGENDWVVEVP 172



>gi|449683816|ref|XP_002164297.2| PREDICTED: ribosome biogenesis regulatory protein homolog [Hydra
           magnipapillata]
          Length = 335

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 128/248 (51%), Gaps = 17/248 (6%)

Query: 13  SKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKL 72
           SK+KSI V + +    DL  L   D   ++   LK+ ++ +L E  RD  QLL NQI+KL
Sbjct: 21  SKFKSIDVFKEVDPVIDLGNLLLLDLQPVNSDELKSKSEQFLIELARDNAQLLFNQIWKL 80

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           PI   D   LA+LPE  T++PRE         T+WE +AK KGI+ + +++M++DE +  
Sbjct: 81  PIERVDNIVLAKLPEPSTLLPREKPIPKPKPPTKWEIYAKKKGIEKKKRSRMLWDEESKT 140

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEA 192
           W PR GYK T  D   +W I VPQN DP EDQF                    NI     
Sbjct: 141 WKPRHGYKRTK-DDTKEWCIEVPQNADPNEDQFEKKEIAKKERVAKNEIKRLGNI----- 194

Query: 193 ALNQTKGADARSLR--------KGELQRQIAISKSATASIGKFDKTL--KGELKLKGVKR 242
           A N  KG    SL+        K  + ++I ++K +TAS+GKF   L  + E K  G KR
Sbjct: 195 ARNTKKGT-VSSLQFKPTLEKDKTRVSKEIDVAKLSTASMGKFQPKLPHEKENKKTGQKR 253

Query: 243 KFEPSIGD 250
           KFE   G+
Sbjct: 254 KFESVSGN 261



>gi|451992617|gb|EMD85097.1| hypothetical protein COCHEDRAFT_1149416 [Bipolaris maydis C5]
 gi|477582126|gb|ENH99239.1| hypothetical protein COCC4DRAFT_54579 [Bipolaris maydis ATCC 48331]
          Length = 226

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 76/140 (54%), Gaps = 8/140 (5%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           ITV++P P  +DL  L A D N +         +  LK   RD  Q LINQ+     + +
Sbjct: 47  ITVDKPTPFTFDLGNLLANDPNPIPAGA----DEEALKATARDAAQALINQLLSTCQVKS 102

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI--QHRNKNKMIYDEATGEWV 134
           +  G    LP   T +PRE         T+WEKFA  KGI  Q R+ N ++YDE  GEWV
Sbjct: 103 TSEGVHLVLPAPTTPLPREKPIPSAKEPTKWEKFAAKKGIKKQKRDSN-LVYDETKGEWV 161

Query: 135 PRWGYKGTNGDGANDWLIPV 154
           P+WGYKG N DG NDWL+ V
Sbjct: 162 PKWGYKGKNKDGENDWLVEV 181



>gi|341878072|gb|EGT34007.1| hypothetical protein CAEBREN_03804 [Caenorhabditis brenneri]
 gi|341900129|gb|EGT56064.1| hypothetical protein CAEBREN_25604 [Caenorhabditis brenneri]
          Length = 330

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 114/242 (47%), Gaps = 18/242 (7%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           KS  VE+ I    DL  L   D   +     + D    L+E  R  TQLL N I++L   
Sbjct: 4   KSTEVEKAIDPIIDLGNLLFIDREPI-----QGDASEGLEERARKNTQLLFNNIWQLEQK 58

Query: 76  TSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVP 135
             D      LP     +PRE         T+WEK+AK KGI+ R K+K ++DEAT EW P
Sbjct: 59  RVDEAITVTLPAATYRLPREKKLPEKKEPTKWEKYAKEKGIEKRKKDKKVFDEATKEWKP 118

Query: 136 RWGYKGTNGDGANDWLIPVPQN-DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAAL 194
            +GY+  N D   DWLI +P N +DP +D F+                  +N+       
Sbjct: 119 TYGYRRGN-DDTKDWLIEIPDNAEDPNKDFFAERKEKKKERIAKNETQRLKNLARQMKTT 177

Query: 195 NQTK---------GADARSLRKGELQRQIAISKSATASIGKFDKTLKGE-LKLK-GVKRK 243
            ++          G DA+   K +++  +  +K ATAS GKF + LKGE   +K G KRK
Sbjct: 178 VKSGPSTEKIIGVGIDAKEKTKQQVRFAVDRAKLATASAGKFQEGLKGEKANVKTGKKRK 237

Query: 244 FE 245
           FE
Sbjct: 238 FE 239



>gi|110758413|ref|XP_394666.3| PREDICTED: ribosome biogenesis regulatory protein homolog [Apis
           mellifera]
          Length = 339

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 120/239 (50%), Gaps = 4/239 (1%)

Query: 10  TQKSKYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQI 69
           T++   ++  V + I ++ DL  L A D N+LD   +K+  + YLK  TRD  Q+LIN+I
Sbjct: 15  TEEKDTRTTIVNKDIEVETDLGTLLALDYNSLDLKAIKSQPEEYLKNLTRDNVQILINKI 74

Query: 70  FKLPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQ--HRNKNKMIYD 127
           ++LP    D   +A+LP+Q  ++PR          T+W++FAK KGI+   ++K+K+ +D
Sbjct: 75  WELPTERIDEVIVAKLPKQTFILPRSRQIPKPKPLTKWQQFAKEKGIRSKKKSKSKLKWD 134

Query: 128 EATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNI 187
           E   +W+P +GYK        +WL+ V       ED F+                   NI
Sbjct: 135 EVLQKWIPTFGYKRNKAIEQKEWLVEVNDEGKAMEDPFTAAKIAKEERKSKNELQRLHNI 194

Query: 188 EESEAALNQTKGADARSL--RKGELQRQIAISKSATASIGKFDKTLKGELKLKGVKRKF 244
            +++       G   +       +L + + I++++TAS+GKF   L  E   KG+ ++ 
Sbjct: 195 AKTKNIKIPKVGLPTKEHFSDSQQLSQAVTIARTSTASLGKFQDRLPKEKDAKGIAKQV 253



>gi|115395492|ref|XP_001213509.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114193078|gb|EAU34778.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 217

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 80/154 (51%), Gaps = 15/154 (9%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           ITV +P P  +DL  L A D N L+ SR     +  L+   RDG Q L+NQ+    PITT
Sbjct: 23  ITVSKPTPYTFDLGHLLANDPNPLEISR-SEPVNASLRSTARDGAQALLNQLLTTCPITT 81

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN------------KNKM 124
           S  G L  LP   T +PR          T+WE FA+ KGI   N            + K+
Sbjct: 82  SQQGVLLTLPTPTTALPRHKPLPTPKPPTKWELFARKKGIGKYNTRPGAALADKERRKKL 141

Query: 125 IYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND 158
           +YDE  GEWVPRWGYKG N    +DWL+ V + D
Sbjct: 142 VYDEEKGEWVPRWGYKGKNKSD-DDWLVEVNEKD 174



>gi|393912353|gb|EJD76693.1| hypothetical protein LOAG_16371 [Loa loa]
          Length = 354

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 106/223 (47%), Gaps = 7/223 (3%)

Query: 32  LLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGKLAELPEQITV 91
           LL   +   +DE   K  ++  L    RD  Q L N+I++L     D    A+LP  +  
Sbjct: 26  LLIVDNDPLIDEDSKKKPSEEELSARVRDNAQFLFNKIWELERKRIDEAICAKLPGPLFR 85

Query: 92  IPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTNGDGANDWL 151
           +PRE         T+WE++A+ KGI+ R K++ ++DE T EW  R+GYK    + A +WL
Sbjct: 86  LPREKPLPSERQLTKWEQYAQQKGIRKRKKDRKVFDEQTQEWKARYGYKSVKDNNAKEWL 145

Query: 152 IPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE--AALNQTK---GADARSLR 206
           I +P N DP  D F                   RNI   +  ++ N T      D  +  
Sbjct: 146 IEIPDNKDPMVDYFDERRNAKREKVNKNEMQRLRNIARLKGISSANATPLGIAVDLNNRS 205

Query: 207 KGELQRQIAISKSATASIGKFDKTLKGELKL--KGVKRKFEPS 247
           + EL  QI  ++ +TAS G F  ++K E KL   G   K++P+
Sbjct: 206 RHELVNQINRARYSTASHGAFQPSIKNEKKLLKTGKHHKYKPN 248



>gi|169765542|ref|XP_001817242.1| ribosome biogenesis protein (Rrs1) [Aspergillus oryzae RIB40]
 gi|238482103|ref|XP_002372290.1| ribosome biogenesis protein (Rrs1), putative [Aspergillus flavus
           NRRL3357]
 gi|83765097|dbj|BAE55240.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220700340|gb|EED56678.1| ribosome biogenesis protein (Rrs1), putative [Aspergillus flavus
           NRRL3357]
 gi|391864663|gb|EIT73958.1| ribosome biogenesis protein [Aspergillus oryzae 3.042]
          Length = 220

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 80/154 (51%), Gaps = 15/154 (9%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           ITV +P P  +DL  L A D N L+ SR     +  LK   RDG Q L+NQ+    PIT+
Sbjct: 23  ITVSKPTPYTFDLGHLLANDPNPLEISR-SEPVNVSLKATARDGVQSLLNQLLTTCPITS 81

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI------------QHRNKNKM 124
           S  G L  LP   TV+PR          T+WE FA+ KGI            +   + K+
Sbjct: 82  SQQGVLLTLPAPTTVLPRHKPLPTPKPPTKWELFARKKGIGRFSGKAGAGLAEKERRKKL 141

Query: 125 IYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND 158
           +YDE  GEWVPRWGYKG N     DWL+ V + D
Sbjct: 142 VYDEEKGEWVPRWGYKGKN-KSDEDWLVEVNEKD 174



>gi|212535770|ref|XP_002148041.1| ribosome biogenesis protein (Rrs1), putative [Talaromyces marneffei
           ATCC 18224]
 gi|210070440|gb|EEA24530.1| ribosome biogenesis protein (Rrs1), putative [Talaromyces marneffei
           ATCC 18224]
          Length = 216

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 81/155 (52%), Gaps = 15/155 (9%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTS 77
           I V++  P  +DL  L A D N L   +  N  D+ LK   RDG Q+L+NQ+      TS
Sbjct: 21  IVVQKENPYTFDLGHLLAQDPNPLVIPKSDNVNDS-LKTVARDGAQVLLNQLLTTCPVTS 79

Query: 78  DL--GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI------------QHRNKNK 123
           +   G L  LP   T++PR          TRWE FA+ KGI            +   + K
Sbjct: 80  NAKDGVLLTLPPPNTLLPRFKPLPKPKEPTRWELFARKKGIGKYSSKPGAAFAEKERRKK 139

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND 158
           ++YDEA+GEWVPRWG+KG N  G NDW + VP  D
Sbjct: 140 LVYDEASGEWVPRWGFKGANKSGENDWAVEVPDKD 174



>gi|225709304|gb|ACO10498.1| Ribosome biogenesis regulatory protein homolog [Caligus
           rogercresseyi]
          Length = 354

 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 122/255 (47%), Gaps = 34/255 (13%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTS 77
           +  ERP+    DL  L  F+ N L E    N  ++++K  TRD  QLL+N+++ L     
Sbjct: 29  LCPERPLDQVNDLGNLLGFEANELSE----NPDEDFIKSRTRDNLQLLVNELWGLETERV 84

Query: 78  DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNK--NKMIYDEATGEWVP 135
           +   +  LP   T IPRE         T+WE FAK+KGI ++ K  +++I+D+A  EWVP
Sbjct: 85  EDAIVVSLPAPSTRIPREKPLPKEKPLTKWESFAKSKGIVNKKKKESRLIWDDAVREWVP 144

Query: 136 RWGYKGTNGDGANDWLIPV----PQNDDPFEDQFSXXXXXXXXXXXXXXXXHR-RNIEES 190
           R+GYK    +    W++ +    P N+DPFE                    HR RN+  +
Sbjct: 145 RFGYKKAQAEVKKTWVMEMKGNAPDNEDPFE-----KATEEKRERVAKNEIHRLRNLARA 199

Query: 191 ---------EAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTL--KGELKLK- 238
                    EA L +T    AR     EL     +++ +TAS+G F + L  K E  +K 
Sbjct: 200 KNVKVPSVKEAVLPKT---SARKSSAKELSHAADLARRSTASLGVFQEKLASKVEKNVKK 256

Query: 239 ---GVKRKFEPSIGD 250
              G KRKF+  + D
Sbjct: 257 VPTGRKRKFDALVND 271



>gi|17558012|ref|NP_506573.1| Protein RRBS-1 [Caenorhabditis elegans]
 gi|21362907|sp|Q9XVT0.1|RRS1_CAEEL RecName: Full=Ribosome biogenesis regulatory protein homolog
 gi|3874344|emb|CAB02731.1| Protein RRBS-1 [Caenorhabditis elegans]
          Length = 333

 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 114/242 (47%), Gaps = 18/242 (7%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPIT 75
           KS  VE+ I    DL  L   D   +     + D    L+E  R  TQLL N I++L   
Sbjct: 4   KSTEVEKAIDPIIDLGNLLFIDREPI-----QGDASEGLEERARKNTQLLFNNIWQLEQK 58

Query: 76  TSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVP 135
             +   +  LP     +PRE         T+WEK+A  KGI+ R K+K ++DEAT EW P
Sbjct: 59  RVEEAIIVTLPPATYRLPREKRLPEKKEPTKWEKYAAEKGIEKRKKDKKVFDEATKEWKP 118

Query: 136 RWGYKGTNGDGANDWLIPVPQN-DDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAAL 194
            +GY+  N D   DWLI +P N +DP +D F+                  +N+       
Sbjct: 119 TYGYRRGN-DDTKDWLIEIPDNAEDPNKDFFAERREKKKERVAKNDMQRMKNLARQMKTT 177

Query: 195 NQTK---------GADARSLRKGELQRQIAISKSATASIGKFDKTLKGE-LKLK-GVKRK 243
            ++          G DA+   K +++  +  +K ATAS GKF + LKGE   +K G KRK
Sbjct: 178 VKSGPSTEKMIGVGVDAKEKSKQQVRFAVDRAKLATASAGKFQEGLKGEKANVKTGKKRK 237

Query: 244 FE 245
           FE
Sbjct: 238 FE 239



>gi|148906982|gb|ABR16635.1| unknown [Picea sitchensis]
          Length = 343

 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 113/241 (46%), Gaps = 21/241 (8%)

Query: 27  QYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQL---LINQIFKLPITTSDLGKLA 83
           Q DL  L AFD++    S   ++ +  +KE    GT+L   + +++F LP T    G L 
Sbjct: 13  QIDLGNLTAFDSHDPGASATSSE-EELVKECLEKGTRLVQAIADKLFSLPSTPDKEGPLV 71

Query: 84  ELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTN 143
           +LP   T IPRE         T+WE FA++KGI+ R ++K +YDE +GEW  R GY    
Sbjct: 72  QLPTPTTPIPREKPLPKAKPPTKWEVFAQSKGIKKRKRSKHLYDEPSGEWKRRHGY-NRA 130

Query: 144 GDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE--AALNQTKGAD 201
           GD  +  +I     D+P ED FS                   N++++    AL  T    
Sbjct: 131 GDENDIPIIEAKPTDEPGEDPFSKKKTEKKARVQKNEKSQLENLKKAAKVGALPSTVQLA 190

Query: 202 ARSLR------------KGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEPS 247
           A SL             K +L      + SATAS+GKFD+ L GE   K  G  RKF P 
Sbjct: 191 ATSLPITGTRDIPKKVGKDDLGHAAGFASSATASVGKFDERLPGEKTPKHPGKHRKFLPV 250

Query: 248 I 248
           +
Sbjct: 251 V 251



>gi|441647489|ref|XP_003274825.2| PREDICTED: ribosome biogenesis regulatory protein homolog [Nomascus
           leucogenys]
          Length = 448

 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 93/188 (49%), Gaps = 15/188 (7%)

Query: 72  LPITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATG 131
           LP    +   +A LPE  T +PRE         TRW++FA+ KGI+ + K  +++DE +G
Sbjct: 162 LPTERGEEAIVARLPEPTTRLPREKPLPRPRPLTRWQQFARLKGIRPKKKTNLVWDEVSG 221

Query: 132 EWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEE-- 189
           +W  RWGY+    D   +WLI VP N DP EDQF+                  RN+    
Sbjct: 222 QWRRRWGYQRAR-DDTKEWLIEVPGNADPLEDQFAKRIQAKKERVAKNELNRLRNLARAH 280

Query: 190 -----SEAALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KR 242
                S A L+ T         K EL R + ++K +TAS+G+F + L  E   +G   KR
Sbjct: 281 KMQLPSAAGLHPTGHQS-----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKR 335

Query: 243 KFEPSIGD 250
           KF+P  GD
Sbjct: 336 KFQPLFGD 343



>gi|296805571|ref|XP_002843610.1| regulator of ribosome biosynthesis [Arthroderma otae CBS 113480]
 gi|238844912|gb|EEQ34574.1| regulator of ribosome biosynthesis [Arthroderma otae CBS 113480]
          Length = 225

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 79/155 (50%), Gaps = 18/155 (11%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDT----DNYLKEYTRDGTQLLINQIFK-L 72
           ITVE+P P  +DL  L A D N +D  +    +    +  LK   RDG Q L+NQ+    
Sbjct: 21  ITVEKPTPYVFDLGNLMALDANPIDLPQSARTSPLVLNQALKATARDGAQCLVNQLLTTC 80

Query: 73  PITTS-DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN----------- 120
           PITTS   G L  LP   T++PR          T+WE FA+ KGI   N           
Sbjct: 81  PITTSMHEGVLLTLPRPTTMVPRFKPLPTPKPPTKWELFARKKGIGQYNTKIGSGLADTE 140

Query: 121 -KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
            K  ++YDE  GEWVP+WGYKG N    NDWL+ V
Sbjct: 141 RKKNLVYDEEKGEWVPKWGYKGKNKASENDWLVEV 175



>gi|494830191|gb|EON66757.1| hypothetical protein W97_06003 [Coniosporium apollinis CBS 100218]
          Length = 292

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 80/143 (55%), Gaps = 6/143 (4%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-L 72
           K  SI V +P P  +DL  L   D N L      N T++ L    RD  Q LINQ+    
Sbjct: 108 KRPSIHVTKPTPYTFDLGHLLCIDPNPLP----PNPTESVLASTARDCAQALINQLLTTC 163

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK-MIYDEATG 131
            IT++  G    LP   T +PRE         T+WEKFA+ KGI+ + K   ++YDEA+G
Sbjct: 164 AITSTAEGVHLNLPAPETKLPREKAVPAAKEPTKWEKFAQKKGIKDKKKEGKLVYDEASG 223

Query: 132 EWVPRWGYKGTNGDGANDWLIPV 154
           EWVP+WGYKG N +G NDWL+ V
Sbjct: 224 EWVPKWGYKGKNKEGENDWLVEV 246



>gi|358373068|dbj|GAA89668.1| ribosome biogenesis protein [Aspergillus kawachii IFO 4308]
          Length = 212

 Score =  105 bits (263), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 81/154 (52%), Gaps = 15/154 (9%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           +TV +P P  +DL  L A D N L+ SR     D  LK   RDGTQ L+NQ+    PIT+
Sbjct: 15  VTVSKPTPYTFDLGHLLANDPNPLEISR-SEPLDVSLKATARDGTQSLLNQLLTTCPITS 73

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI------------QHRNKNKM 124
           S  G L  LP   TV+PR          T+WE FA+ KGI                + K+
Sbjct: 74  SQQGVLLTLPPPTTVLPRFKPLPTPKPPTKWELFARKKGIGKYSSRPGAALADKERRKKL 133

Query: 125 IYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND 158
           +YDE  GEWVPRWGYKG N    ++WL+ V + D
Sbjct: 134 VYDEEKGEWVPRWGYKGKN-KSDDEWLVEVNEKD 166



>gi|145247983|ref|XP_001396240.1| ribosome biogenesis protein (Rrs1) [Aspergillus niger CBS 513.88]
 gi|134080987|emb|CAK41501.1| unnamed protein product [Aspergillus niger]
 gi|350638944|gb|EHA27299.1| hypothetical protein ASPNIDRAFT_192136 [Aspergillus niger ATCC
           1015]
          Length = 212

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 81/154 (52%), Gaps = 15/154 (9%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           +TV +P P  +DL  L A D N L+ SR     D  LK   RDGTQ L+NQ+    PIT+
Sbjct: 15  VTVSKPTPYTFDLGHLLANDPNPLEISR-SEPLDVSLKATARDGTQSLLNQLLTTCPITS 73

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI------------QHRNKNKM 124
           S  G L  LP   TV+PR          T+WE FA+ KGI                + K+
Sbjct: 74  SQQGVLLTLPSPSTVLPRFKPLPTPKPPTKWELFARKKGIGKYSSRPGAALADKERRKKL 133

Query: 125 IYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND 158
           +YDE  GEWVPRWGYKG N    ++WL+ V + D
Sbjct: 134 VYDEEKGEWVPRWGYKGKN-KSDDEWLVEVNEKD 166



>gi|407921447|gb|EKG14594.1| Ribosomal biogenesis regulatory protein [Macrophomina phaseolina
           MS6]
          Length = 202

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 80/143 (55%), Gaps = 7/143 (4%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-L 72
           K   +TVE+PIP  +D+  L   D N L  S      ++ ++   RD  Q+LINQ+    
Sbjct: 20  KRAPVTVEKPIPYTFDVGNLLCTDANPLPGS-----DEDTIRNTARDCAQVLINQLLTTC 74

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATG 131
            + ++  G L +LP   T +PRE         T+WE FA  KGI+ + ++ K++YDE  G
Sbjct: 75  AVRSTKEGVLLDLPTPTTPLPREKPAPKPKEPTKWELFAAKKGIKDKKRDGKLVYDEEKG 134

Query: 132 EWVPRWGYKGTNGDGANDWLIPV 154
           EWVP+WGYKG N D  + WL+ V
Sbjct: 135 EWVPKWGYKGKNKDMDDQWLVEV 157



>gi|358377993|gb|EHK15676.1| hypothetical protein TRIVIDRAFT_38549 [Trichoderma virens Gv29-8]
          Length = 198

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 81/145 (55%), Gaps = 10/145 (6%)

Query: 18  ITVERPIPLQYDLALLAAFDTN--ALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPI 74
           + VE+P P  +DL  L A D N  ALD + +    D  L +  RDG Q LINQ+    P+
Sbjct: 12  VVVEKPTPYTFDLGHLLAEDPNPVALDHAAI----DQSLAQIARDGAQSLINQLLTTCPL 67

Query: 75  TTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK---MIYDEATG 131
            ++  G L  LP+  T +PRE         T+WE+FA  KGI+ + + +   + YDE +G
Sbjct: 68  KSTTDGVLLTLPQPATRLPREKPVPQPKPPTKWERFAAKKGIKAKTREQRRNLAYDEESG 127

Query: 132 EWVPRWGYKGTNGDGANDWLIPVPQ 156
           EW  +WGYKG N  G +DWL+ V Q
Sbjct: 128 EWKRKWGYKGLNKKGEDDWLVEVDQ 152



>gi|426236119|ref|XP_004012022.1| PREDICTED: ribosome biogenesis regulatory protein homolog [Ovis
           aries]
          Length = 349

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 111/246 (45%), Gaps = 30/246 (12%)

Query: 14  KYKSITVERPIPLQYDLALLAAFDTNALDESRLKNDT-DNYLKEYTRDGTQLLINQIFKL 72
           K + ITV++ + L++DL  L A D N     R    T +  L+   RD TQLLINQ+++L
Sbjct: 20  KLQRITVQKELELEFDLGNLLASDRNPPTGLRHAGPTQEAELRALARDNTQLLINQLWQL 79

Query: 73  PITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGE 132
           P    +   +A LPE  T +PR          TRW++                +DE    
Sbjct: 80  PTERVEEALVARLPEPSTRLPRGKPVPRPRPLTRWQQ----------------WDEVRAR 123

Query: 133 WVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESE- 191
              RWGY+    D   +WLI VP N DP EDQF+                  RN+  +  
Sbjct: 124 GPRRWGYQRAR-DDTKEWLIEVPGNADPMEDQFAKRIQAKKERVAKNELNRLRNLARAHK 182

Query: 192 -----AALNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGELKLKGV--KRKF 244
                AA     G  +    K EL R + ++K +TAS+G+F + L  E   +G   KRKF
Sbjct: 183 MQLPSAAGMHPTGHQS----KEELGRAMQVAKVSTASVGRFQERLPKEKAPRGSGKKRKF 238

Query: 245 EPSIGD 250
           +P  GD
Sbjct: 239 QPLFGD 244



>gi|302498738|ref|XP_003011366.1| hypothetical protein ARB_02425 [Arthroderma benhamiae CBS 112371]
 gi|291174916|gb|EFE30726.1| hypothetical protein ARB_02425 [Arthroderma benhamiae CBS 112371]
          Length = 228

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/187 (36%), Positives = 92/187 (49%), Gaps = 22/187 (11%)

Query: 2   IYFSDQLETQKSKYKS----ITVERPIPLQYDLALLAAFDTNALDESRLKNDT----DNY 53
           I  +D     KSK K     ITVE+P P  +DL  L A D N +D  +    +    +  
Sbjct: 4   IAMADSTTKVKSKTKPERLPITVEKPTPYVFDLGNLMALDANPIDLPQSAKSSPLILNQT 63

Query: 54  LKEYTRDGTQLLINQIFK-LPITTS-DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFA 111
           LK   RDG Q L+NQ+    PIT+S   G L  LP   T++PR          T+WE FA
Sbjct: 64  LKATARDGAQCLVNQLLTTCPITSSMQDGVLLTLPRPTTMVPRFKPLPTPKPPTKWELFA 123

Query: 112 KAKGIQHRN------------KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDD 159
           + KGI   N            K  ++YDE  GEWVP+WGYKG N    +DWL+ V ++  
Sbjct: 124 RKKGIGKYNTKLGSGLAETERKKNLVYDEEKGEWVPKWGYKGKNKGTEDDWLVEVDESKW 183

Query: 160 PFEDQFS 166
             E+Q +
Sbjct: 184 KKEEQMN 190



>gi|258564434|ref|XP_002582962.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237908469|gb|EEP82870.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 228

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 86/167 (51%), Gaps = 16/167 (9%)

Query: 4   FSDQLETQKSKYKSITVERPIPLQYDLALLAAFDTNALD--ESRLKNDT--DNYLKEYTR 59
           F+     QK +   ITV++P P  +DL  L A D N ++   + L N T  D+ LK   R
Sbjct: 13  FNASKTKQKRERLPITVDKPNPYTFDLGRLMALDPNPINLPPNSLTNPTLLDSTLKSTAR 72

Query: 60  DGTQLLINQIF-KLPITTSDL-GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQ 117
           DG Q L+NQ+    PIT+S   G L  LP   T +PR          T+WE FA+ KGI 
Sbjct: 73  DGAQCLLNQLLTACPITSSSTEGVLLTLPAPTTPLPRFKPLPTPKPPTKWELFARKKGIG 132

Query: 118 HRN----------KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
             N          + K++YDE  GEWVPRWGYKG N    N WL+ V
Sbjct: 133 KYNTKLGANEAERRKKLVYDEEKGEWVPRWGYKGKNKAEDNQWLVEV 179



>gi|500252637|gb|EON96449.1| putative ribosome biogenesis protein [Togninia minima UCRPA7]
          Length = 194

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 80/142 (56%), Gaps = 7/142 (4%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           + V +P P  +DL LL A D N L+      + +  L    RDG Q LINQ+    PIT+
Sbjct: 12  VAVNKPTPYTFDLGLLLANDPNPLELD--PENLEGSLAAVARDGAQALINQLLTTCPITS 69

Query: 77  S-DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK---MIYDEATGE 132
           S D G L  LP Q T +PRE         T+WE+FAK +GI+ + + +   + ++EA+GE
Sbjct: 70  SKDAGVLLSLPPQTTALPREKPVPAAKAPTKWEQFAKRRGIKPKTREQRKNLQFNEASGE 129

Query: 133 WVPRWGYKGTNGDGANDWLIPV 154
           W  +WGYKG N    NDW++ V
Sbjct: 130 WERKWGYKGGNKGVENDWIVEV 151



>gi|402080331|gb|EJT75476.1| ribosome biogenesis protein [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 195

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 78/142 (54%), Gaps = 6/142 (4%)

Query: 17  SITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIF-KLPIT 75
           ++ VE+P P  +DL LL A D N +   R   D ++ L++  RDG Q L+NQ+    PI 
Sbjct: 11  AVAVEKPTPYNFDLGLLLASDPNPVTLDRA--DLESSLRDLARDGAQALVNQLLTACPIQ 68

Query: 76  TSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK---MIYDEATGE 132
           ++  G L  LP Q T +PRE         T+WE+FA  KGI+ + + +     Y+E  GE
Sbjct: 69  STPSGVLLSLPPQQTPLPREKPVPAAKEPTKWERFAAKKGIKPKTREQRRNTQYNEDKGE 128

Query: 133 WVPRWGYKGTNGDGANDWLIPV 154
           W  +WGYKG N     DWL+ V
Sbjct: 129 WERKWGYKGANKQVEKDWLVEV 150



>gi|389624595|ref|XP_003709951.1| ribosome biogenesis protein [Magnaporthe oryzae 70-15]
 gi|351649480|gb|EHA57339.1| ribosome biogenesis protein [Magnaporthe oryzae 70-15]
 gi|440471621|gb|ELQ40610.1| hypothetical protein OOU_Y34scaffold00414g41 [Magnaporthe oryzae
           Y34]
 gi|440481979|gb|ELQ62509.1| hypothetical protein OOW_P131scaffold01069g28 [Magnaporthe oryzae
           P131]
          Length = 193

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 76/141 (53%), Gaps = 6/141 (4%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           + V +P P  +DLALL A D N ++    K D +  L    RDG Q LINQ+    PI +
Sbjct: 12  VAVNKPTPYSFDLALLLANDPNPVELD--KTDLEGSLSSLARDGAQALINQLLTTCPIQS 69

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK---MIYDEATGEW 133
           +  G L  LP Q T +PRE         T+WE+FA  KGI+ + + +   + Y+E  GEW
Sbjct: 70  TPSGVLLSLPAQQTALPREKPLPAAKEPTKWERFAAKKGIKPKTREQRRNIQYNEEKGEW 129

Query: 134 VPRWGYKGTNGDGANDWLIPV 154
             +WGYKG N     DWL+ V
Sbjct: 130 ERKWGYKGANKQLEKDWLVEV 150



>gi|281206150|gb|EFA80339.1| ribosome biogenesis regulatory protein [Polysphondylium pallidum
           PN500]
          Length = 322

 Score =  104 bits (260), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 121/241 (50%), Gaps = 15/241 (6%)

Query: 5   SDQLETQKSKYKS-ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQ 63
           SD LE   S+Y S   V++   L+YDL  L A+D +++++   K + + YLK  +RD  Q
Sbjct: 14  SDILEN--SRYSSGHLVDKDDTLKYDLKNLTAYDYSSINKVEFKENEEEYLKNLSRDNVQ 71

Query: 64  LLINQIFKLPITTSDLGKLAELPE---QITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN 120
           LL+ ++F LPI   + G LA LP     +T  PRE         TRWE FA  KGI+ + 
Sbjct: 72  LLVTKLFSLPIKAIEEGALALLPNDFASLTPTPREKELPSAKSHTRWEAFAALKGIKKKG 131

Query: 121 KN-KMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXX 179
           K  +M +DE   E+  R  Y     +   D+++   ++D   ED FS             
Sbjct: 132 KKARMEWDEHYQEY--RQSYGANRANKHEDYIMEAKESDKVGEDPFSKAEEEKREKVNKQ 189

Query: 180 XXXHRRNIEESE----AALNQTK--GADARSLRKGELQRQIAISKSATASIGKFDKTLKG 233
                RN+EES     A + + K  G D RS  K ++     ++K +TAS+GKFD+ +K 
Sbjct: 190 KKRENRNLEESSMRSNAGIGKVKDFGKDNRSQLKSDIGNTFNVAKVSTASMGKFDRLMKD 249

Query: 234 E 234
           E
Sbjct: 250 E 250



>gi|121711335|ref|XP_001273283.1| ribosome biogenesis protein (Rrs1), putative [Aspergillus clavatus
           NRRL 1]
 gi|119401434|gb|EAW11857.1| ribosome biogenesis protein (Rrs1), putative [Aspergillus clavatus
           NRRL 1]
          Length = 220

 Score =  104 bits (260), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 79/155 (50%), Gaps = 16/155 (10%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           +TV +P P  +DL  L A D N LD  R     +  LK   RDGTQ L+NQ+    PIT+
Sbjct: 22  VTVSKPTPYTFDLGYLMANDPNPLDLPR-STPLNESLKAIARDGTQSLLNQLLTTCPITS 80

Query: 77  SDL-GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGI------------QHRNKNK 123
           S   G L  LP   T +PR          T+WE FA+ KGI                + K
Sbjct: 81  SAQNGVLLTLPPPATALPRHKPLPTPKQPTKWELFARKKGIGKYSTTPGAALADKERRKK 140

Query: 124 MIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQND 158
           ++YDE  GEWVPRWGYKG N    ++WL+ V + D
Sbjct: 141 LVYDEEKGEWVPRWGYKGKN-KSDDEWLVEVKEKD 174



>gi|340520244|gb|EGR50481.1| hypothetical protein TRIREDRAFT_58428 [Trichoderma reesei QM6a]
          Length = 199

 Score =  104 bits (260), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 79/143 (55%), Gaps = 10/143 (6%)

Query: 18  ITVERPIPLQYDLALLAAFDTN--ALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPI 74
           + VE+P P  +DL LL A D N  ALD S +    D  L +  RDG Q LINQ+    P+
Sbjct: 13  VVVEKPTPYTFDLGLLLAEDPNPVALDPSAI----DASLAQLARDGAQSLINQLLTTCPL 68

Query: 75  TTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK---MIYDEATG 131
            ++  G L  LP   T +PRE         T+WE+FA  KGI+ + + +   + +DE +G
Sbjct: 69  QSTSEGVLLSLPPPATRLPREKPVPQPKPPTKWERFAAKKGIKPKTREQRKNLAFDEESG 128

Query: 132 EWVPRWGYKGTNGDGANDWLIPV 154
           EW  +WGYK  N  G +DWL+ V
Sbjct: 129 EWKRKWGYKALNKKGEDDWLVEV 151



>gi|224082902|ref|XP_002306885.1| predicted protein [Populus trichocarpa]
 gi|222856334|gb|EEE93881.1| predicted protein [Populus trichocarpa]
          Length = 298

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 116/242 (47%), Gaps = 23/242 (9%)

Query: 27  QYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQL---LINQIFKLPITTSDLGKLA 83
           Q DL  L AFD      S + +     + E   +GT+L   +++ +F LP T    G L 
Sbjct: 2   QVDLGNLMAFDPFHHFTS-IPSARSELVAECLSNGTELVQAIVSGVFNLPSTEDIDGPLV 60

Query: 84  ELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWGYKGTN 143
           +LP   T +PRE         TRWE+FAKAKGI++R K+K+++DE TG W  R+GY   N
Sbjct: 61  KLPPPTTKLPREKPLPKPKPPTRWEQFAKAKGIRNRKKDKVVWDEQTGTWKRRYGYDRVN 120

Query: 144 GDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEESEAA---------- 193
            D A+  +I     D+P  D F+                  +N++ +  A          
Sbjct: 121 -DDADVPIIEAKMTDEPGVDPFAKRVAEKKERVQKNQKNQLQNLKTAAKAGALPSHVQLA 179

Query: 194 -----LNQTKGADARSLRKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKFEP 246
                +  T+ A  +   K EL     ++ +ATAS GKFDK L+GE  +K +G  RKF P
Sbjct: 180 ATALPITGTQAAK-KKFTKDELGNVAGLASTATASGGKFDKKLRGEKPVKNQGKHRKFLP 238

Query: 247 SI 248
            +
Sbjct: 239 VV 240



>gi|303316161|ref|XP_003068085.1| Ribosome biogenesis regulatory protein, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240107761|gb|EER25940.1| Ribosome biogenesis regulatory protein, putative [Coccidioides
           posadasii C735 delta SOWgp]
          Length = 230

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 84/160 (52%), Gaps = 16/160 (10%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALD--ESRLKNDT--DNYLKEYTRDGTQLLI 66
           QK +   ITVE+P P  +DL  L A D N L+   + L N    ++ LK   RDG Q L+
Sbjct: 20  QKPERLPITVEKPTPYTFDLGRLMALDPNPLNLPSNSLSNPPVLNSTLKSTARDGAQCLL 79

Query: 67  NQIF-KLPITTSDL-GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN---- 120
           NQ+    PIT+S   G L  LP  +T +PR          T+WE FA+ KGI   N    
Sbjct: 80  NQLLTACPITSSATDGVLLTLPTPVTPLPRFKPLPTPKPPTKWELFARKKGIGKYNNKLG 139

Query: 121 ------KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
                 + K++YDE  GEWVPRWGYKG N    + WL+ V
Sbjct: 140 ANEAERRKKLVYDEEKGEWVPRWGYKGKNKAEDDQWLVEV 179



>gi|406606814|emb|CCH41850.1| Dynamin-binding protein [Wickerhamomyces ciferrii]
          Length = 1011

 Score =  103 bits (258), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 76/134 (56%), Gaps = 14/134 (10%)

Query: 33  LAAFDTNALDESRLK---NDTDNYLKEYTRDGTQLLINQIFKLPITTSDLGK-------- 81
           LA FD+NA++  +L     D + Y+K  +RD  QLLINQI  LPI T+            
Sbjct: 662 LAVFDSNAIENEQLSVNNPDREEYIKSVSRDNAQLLINQILSLPIKTTTESNGSNGQSSS 721

Query: 82  --LAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKN-KMIYDEATGEWVPRWG 138
             L +LP   T +PRE         T+WE+FA  KGIQ + K+ K++YDE + EWVP+WG
Sbjct: 722 ITLVQLPPPTTELPREKPLPKPKEPTKWEQFAARKGIQAKEKSGKLVYDEESREWVPKWG 781

Query: 139 YKGTNGDGANDWLI 152
           YKG N    + WL+
Sbjct: 782 YKGKNKALEDQWLV 795



>gi|320032457|gb|EFW14410.1| ribosome biogenesis protein [Coccidioides posadasii str. Silveira]
          Length = 230

 Score =  103 bits (258), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 84/160 (52%), Gaps = 16/160 (10%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALD--ESRLKNDT--DNYLKEYTRDGTQLLI 66
           QK +   ITVE+P P  +DL  L A D N L+   + L N    ++ LK   RDG Q L+
Sbjct: 20  QKPERLPITVEKPTPYTFDLGRLMALDPNPLNLPSNSLSNPPVLNSTLKSTARDGAQCLL 79

Query: 67  NQIF-KLPITTSDL-GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN---- 120
           NQ+    PIT+S   G L  LP  +T +PR          T+WE FA+ KGI   N    
Sbjct: 80  NQLLTACPITSSATDGVLLTLPTPVTPLPRFKPLPTPKPPTKWELFARKKGIGKYNNKLG 139

Query: 121 ------KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
                 + K++YDE  GEWVPRWGYKG N    + WL+ V
Sbjct: 140 ANEAERQKKLVYDEEKGEWVPRWGYKGKNKAEDDQWLVEV 179



>gi|346321818|gb|EGX91417.1| ribosome biogenesis protein [Cordyceps militaris CM01]
          Length = 198

 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 79/144 (54%), Gaps = 12/144 (8%)

Query: 18  ITVERPIPLQYDLALLAAFDTNA--LDESRLKNDTDNYLKEYTRDGTQLLINQIFKL--P 73
           + VE+P P  +DL  L A D N+  LD + L    +  L    RDG Q LINQ+  +  P
Sbjct: 12  VAVEKPTPYTFDLGYLMAEDPNSITLDAAAL----EQSLASVARDGAQSLINQLLTVCAP 67

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK---MIYDEAT 130
            +T D G L  LP   T +PRE         T+WE+FA  KGI  + + +   + YDEAT
Sbjct: 68  HSTKD-GVLLSLPAPSTRLPREKPVPQARPPTKWERFAAKKGITPKTREQRRNLTYDEAT 126

Query: 131 GEWVPRWGYKGTNGDGANDWLIPV 154
           GEW  +WGYKG N  G ++WL+ V
Sbjct: 127 GEWTRKWGYKGANKKGEDEWLVEV 150



>gi|485918572|gb|EOD45213.1| putative ribosome biogenesis regulatory protein [Neofusicoccum
           parvum UCRNP2]
          Length = 202

 Score =  103 bits (256), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 77/139 (55%), Gaps = 7/139 (5%)

Query: 18  ITVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFK-LPITT 76
           +TVE+PIP  +DL  L   D N L  S      ++ ++E  RD  Q+LINQ+    P+ +
Sbjct: 24  VTVEKPIPYTFDLGNLLCTDANPLPSS-----GEDAIRETARDCAQVLINQLLSTCPVRS 78

Query: 77  SDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFA-KAKGIQHRNKNKMIYDEATGEWVP 135
           +  G L +LP  +T +PRE         T+WE FA K      + +  ++YDE  GEWVP
Sbjct: 79  TKEGVLLDLPTPVTPLPREKPAPKPKEPTKWELFAAKKGIKDKKKEGNLVYDEEKGEWVP 138

Query: 136 RWGYKGTNGDGANDWLIPV 154
           +WGYKG N D  + WL+ V
Sbjct: 139 KWGYKGKNKDQDDQWLVEV 157



>gi|507115176|emb|CDF38667.1| ribosome biogenesis regulatory protein (RRS1) family protein
           [Chondrus crispus]
          Length = 261

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 113/241 (46%), Gaps = 23/241 (9%)

Query: 19  TVERPIPLQYDLALLAAFDTNALDESRLKNDTDNYLKEYTRDGTQLLINQIFKLPITTSD 78
           T + P   + DL  LAAFD             +    E    G + L++ IF LP+  SD
Sbjct: 3   TFQIPPGYEVDLGNLAAFDKRV--------GIEGTPVEVATQGVEPLVHAIFSLPVLESD 54

Query: 79  LGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNKMIYDEATGEWVPRWG 138
             KL  LP     +PR          T+WEKFAK KGIQ R++++++ D+ATGE+VPR+G
Sbjct: 55  EAKLVSLPNGAFHLPRAKPIPKERALTKWEKFAKEKGIQKRHRDRLVLDDATGEYVPRYG 114

Query: 139 YKGTNGDGANDWLIPVPQNDDPFEDQFSXXXXXXXXXXXXXXXXHRRNIEES----EAAL 194
            KG+      D ++P  ++     D F+                H  N+  +     A +
Sbjct: 115 -KGSKNALDRDVILPHKESMGEDYDPFAQKRKEKKQRIKENTKKHNSNLGRAAKGRRAQI 173

Query: 195 NQTKGADA--------RSLRKGELQRQIAISKSATASIGKFDKTLKGE--LKLKGVKRKF 244
           N     D         + L K  L+  +AI++ +TAS G+FD+ +  E   KL+G K+KF
Sbjct: 174 NPVHALDVGKAGPSGKKFLPKKGLKDSLAIAQRSTASAGRFDQKVTNEPKAKLQGRKKKF 233

Query: 245 E 245
           +
Sbjct: 234 Q 234



>gi|400602699|gb|EJP70301.1| ribosome biogenesis regulatory protein [Beauveria bassiana ARSEF
           2860]
          Length = 198

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 79/144 (54%), Gaps = 12/144 (8%)

Query: 18  ITVERPIPLQYDLALLAAFDTNA--LDESRLKNDTDNYLKEYTRDGTQLLINQIFKL--P 73
           + VE+P P  +DL  L A D N+  LD + L    ++ L    RDG Q LINQ+     P
Sbjct: 12  VVVEKPTPYTFDLGYLLASDPNSITLDPTSL----ESSLAAVARDGAQSLINQLLTTCAP 67

Query: 74  ITTSDLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRNKNK---MIYDEAT 130
            +T D G L  LP   T +PRE         T+WE+FA  KGI  + + +   + YDEAT
Sbjct: 68  SSTRD-GVLLSLPAPSTRLPREKPLPAARPPTKWERFAAKKGIAPKTREQRRNLAYDEAT 126

Query: 131 GEWVPRWGYKGTNGDGANDWLIPV 154
           GEW  +WGYKG N  G +DW++ V
Sbjct: 127 GEWTRKWGYKGLNKKGEDDWVVEV 150



>gi|327305643|ref|XP_003237513.1| ribosome biogenesis protein [Trichophyton rubrum CBS 118892]
 gi|326460511|gb|EGD85964.1| ribosome biogenesis protein [Trichophyton rubrum CBS 118892]
          Length = 223

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/185 (36%), Positives = 91/185 (49%), Gaps = 22/185 (11%)

Query: 4   FSDQLETQKSKYKS----ITVERPIPLQYDLALLAAFDTNALDESRLKNDT----DNYLK 55
            +D     KSK K     ITVE+P P  +DL  L A D N +D  +    +    +  LK
Sbjct: 1   MADSTTKVKSKTKPERLPITVEKPTPYVFDLGNLMALDANPIDLPQSAKSSPLILNQSLK 60

Query: 56  EYTRDGTQLLINQIFK-LPITTS-DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKA 113
              RDG Q L+NQ+    PIT+S   G L  LP   T++PR          T+WE FA+ 
Sbjct: 61  ATARDGAQCLVNQLLTTCPITSSMQDGVLLTLPRPTTMVPRFKPLPTPKPPTKWELFARK 120

Query: 114 KGIQHRN------------KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPF 161
           KGI   N            K  ++YDE  GEWVP+WGYKG N    +DWL+ V ++    
Sbjct: 121 KGIGKYNTKLGSGLADTERKKNLVYDEDKGEWVPKWGYKGKNKGTEDDWLVEVDESKWKK 180

Query: 162 EDQFS 166
           E+Q +
Sbjct: 181 EEQMN 185



>gi|302658728|ref|XP_003021065.1| hypothetical protein TRV_04841 [Trichophyton verrucosum HKI 0517]
 gi|291184941|gb|EFE40447.1| hypothetical protein TRV_04841 [Trichophyton verrucosum HKI 0517]
          Length = 222

 Score =  102 bits (255), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 86/169 (50%), Gaps = 18/169 (10%)

Query: 16  KSITVERPIPLQYDLALLAAFDTNALDESRLKNDT----DNYLKEYTRDGTQLLINQIFK 71
           + ITVE+P P  +DL  L A D N +D  +    +    +  LK   RDG Q L+NQ+  
Sbjct: 16  RPITVEKPTPYVFDLGNLMALDANPIDLPQSAKSSPLILNQTLKATARDGAQCLVNQLLT 75

Query: 72  -LPITTS-DLGKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN--------- 120
             PIT+S   G L  LP   T++PR          T+WE FA+ KGI   N         
Sbjct: 76  TCPITSSMQDGVLLTLPRPTTMVPRFKPLPTPKPPTKWELFARKKGIGKYNTKLGSGLAD 135

Query: 121 ---KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPVPQNDDPFEDQFS 166
              K  ++YDE  GEWVP+WGYKG N    +DWL+ V ++    E+Q +
Sbjct: 136 TERKKNLVYDEEKGEWVPKWGYKGKNKGTEDDWLVEVDESKWKKEEQMN 184



>gi|119177131|ref|XP_001240383.1| hypothetical protein CIMG_07546 [Coccidioides immitis RS]
 gi|392867653|gb|EAS29094.2| ribosome biogenesis protein [Coccidioides immitis RS]
          Length = 230

 Score =  102 bits (255), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 84/160 (52%), Gaps = 16/160 (10%)

Query: 11  QKSKYKSITVERPIPLQYDLALLAAFDTNALD--ESRLKNDT--DNYLKEYTRDGTQLLI 66
           QK +   ITVE+P P  +DL  L A D N L+   + L N    ++ LK   RDG Q L+
Sbjct: 20  QKPERLPITVEKPTPYTFDLGRLMALDPNPLNLPANSLSNPPVLNSTLKSTARDGAQCLL 79

Query: 67  NQIF-KLPITTSDL-GKLAELPEQITVIPREXXXXXXXXXTRWEKFAKAKGIQHRN---- 120
           NQ+    PIT+S   G L  LP  +T +PR          T+WE FA+ KGI   N    
Sbjct: 80  NQLLTACPITSSATDGVLLTLPTPVTPLPRFKPLPTPKPPTKWELFARKKGIGKYNNKLG 139

Query: 121 ------KNKMIYDEATGEWVPRWGYKGTNGDGANDWLIPV 154
                 + K++YDE  GEW+PRWGYKG N    + WL+ V
Sbjct: 140 ANEAERRKKLVYDEEKGEWMPRWGYKGKNKAEDDQWLVEV 179