BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10338_c0_seq1-m.126 5prime_partial 2-670(+) 223 (+)
         (222 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511006298|gb|EPB87614.1| hypothetical protein HMPREF1544_0559...   159   4e-37   Mucor circinelloides f. circinelloides 1006PhL
gi|392566884|gb|EIW60059.1| chord-domain-containing protein [Tra...   152   7e-35   Trametes versicolor FP-101664 SS1
gi|405122993|gb|AFR97758.1| CORD and CS domain-containing protei...   151   1e-34   Cryptococcus neoformans var. grubii H99
gi|393220298|gb|EJD05784.1| chord-domain-containing protein [Fom...   151   1e-34   Fomitiporia mediterranea MF3/22
gi|328774153|gb|EGF84190.1| hypothetical protein BATDEDRAFT_8492...   149   4e-34   Batrachochytrium dendrobatidis JAM81
gi|353238059|emb|CCA70016.1| related to diploid state maintenanc...   149   5e-34   Serendipita indica DSM 11827
gi|392573395|gb|EIW66535.1| hypothetical protein TREMEDRAFT_4566...   149   7e-34   Tremella mesenterica DSM 1558
gi|321252979|ref|XP_003192584.1| hypothetical protein CGB_C1210W...   148   7e-34   Cryptococcus gattii WM276
gi|336367710|gb|EGN96054.1| hypothetical protein SERLA73DRAFT_58...   146   4e-33   Serpula lacrymans var. lacrymans S7.3
gi|402225636|gb|EJU05697.1| chord-domain-containing protein [Dac...   145   6e-33   Dacryopinax primogenitus
gi|401888408|gb|EJT52366.1| hypothetical protein A1Q1_04577 [Tri...   145   9e-33   Trichosporon asahii var. asahii CBS 2479
gi|345562204|gb|EGX45276.1| hypothetical protein AOL_s00173g377 ...   144   1e-32   Arthrobotrys oligospora ATCC 24927
gi|409045989|gb|EKM55469.1| hypothetical protein PHACADRAFT_9471...   144   1e-32   Phanerochaete carnosa HHB-10118-sp
gi|406696457|gb|EKC99745.1| hypothetical protein A1Q2_05966 [Tri...   144   2e-32   Trichosporon asahii var. asahii CBS 8904
gi|58265466|ref|XP_569889.1| hypothetical protein [Cryptococcus ...   143   2e-32   Cryptococcus neoformans var. neoformans JEC21
gi|425779334|gb|EKV17401.1| hypothetical protein PDIG_15250 [Pen...   143   2e-32   Penicillium digitatum PHI26
gi|384501633|gb|EIE92124.1| hypothetical protein RO3G_16835 [Rhi...   141   1e-31   Rhizopus delemar RA 99-880
gi|443920789|gb|ELU40630.1| CHORD domain-containing protein [Rhi...   140   2e-31   Rhizoctonia solani AG-1 IA
gi|403412626|emb|CCL99326.1| predicted protein [Fibroporia radic...   140   3e-31   Fibroporia radiculosa
gi|389749377|gb|EIM90554.1| hypothetical protein STEHIDRAFT_5089...   139   5e-31   Stereum hirsutum FP-91666 SS1
gi|472587860|gb|EMS25356.1| CORD and CS domain containing protei...   138   1e-30   Rhodotorula toruloides NP11
gi|255936493|ref|XP_002559273.1| Pc13g08480 [Penicillium chrysog...   138   1e-30   Penicillium rubens Wisconsin 54-1255
gi|331243814|ref|XP_003334549.1| hypothetical protein PGTG_15978...   137   2e-30   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|121701713|ref|XP_001269121.1| CORD and CS domain protein [Asp...   137   2e-30   Aspergillus clavatus NRRL 1
gi|170094796|ref|XP_001878619.1| predicted protein [Laccaria bic...   137   2e-30   Laccaria bicolor S238N-H82
gi|408398874|gb|EKJ78000.1| hypothetical protein FPSE_01788 [Fus...   137   3e-30   Fusarium pseudograminearum CS3096
gi|342876141|gb|EGU77799.1| hypothetical protein FOXB_11663 [Fus...   136   3e-30   Fusarium oxysporum Fo5176
gi|46108680|ref|XP_381398.1| hypothetical protein FG01222.1 [Fus...   136   4e-30   
gi|38489215|gb|AAR21293.1| ChpA [Emericella nidulans] >gi|385320...   136   4e-30   Aspergillus nidulans
gi|70995530|ref|XP_752520.1| CORD and CS domain protein [Aspergi...   135   6e-30   Aspergillus fumigatus Af293
gi|358388785|gb|EHK26378.1| hypothetical protein TRIVIDRAFT_8641...   135   7e-30   Trichoderma virens Gv29-8
gi|340517392|gb|EGR47636.1| predicted protein [Trichoderma reese...   135   7e-30   Trichoderma reesei QM6a
gi|296417140|ref|XP_002838219.1| hypothetical protein [Tuber mel...   135   1e-29   Tuber melanosporum Mel28
gi|475664532|gb|EMT62327.1| Cysteine and histidine-rich domain-c...   135   1e-29   Fusarium oxysporum f. sp. cubense race 4
gi|400601428|gb|EJP69071.1| copper amine oxidase [Beauveria bass...   134   1e-29   Beauveria bassiana ARSEF 2860
gi|119495659|ref|XP_001264609.1| CORD and CS domain protein [Neo...   134   1e-29   Aspergillus fischeri NRRL 181
gi|302692292|ref|XP_003035825.1| hypothetical protein SCHCODRAFT...   134   1e-29   Schizophyllum commune H4-8
gi|326479168|gb|EGE03178.1| diploid state maintenance protein ch...   134   2e-29   Trichophyton equinum CBS 127.97
gi|326475808|gb|EGD99817.1| CORD and CS domain-containing protei...   134   2e-29   Trichophyton tonsurans CBS 112818
gi|453088822|gb|EMF16862.1| chord-domain-containing protein [Myc...   134   2e-29   Sphaerulina musiva SO2202
gi|396462286|ref|XP_003835754.1| similar to cysteine and histidi...   134   2e-29   Leptosphaeria maculans JN3
gi|327293954|ref|XP_003231673.1| CORD and CS domain-containing p...   133   3e-29   Trichophyton rubrum CBS 118892
gi|452987540|gb|EME87295.1| hypothetical protein MYCFIDRAFT_1260...   133   3e-29   Cercospora fijiensis CIRAD86
gi|302664631|ref|XP_003023943.1| hypothetical protein TRV_01884 ...   133   3e-29   Trichophyton verrucosum HKI 0517
gi|302496214|ref|XP_003010110.1| hypothetical protein ARB_03677 ...   133   3e-29   Arthroderma benhamiae CBS 112371
gi|258568870|ref|XP_002585179.1| hypothetical protein UREG_05868...   133   4e-29   Uncinocarpus reesii 1704
gi|494830946|gb|EON67457.1| hypothetical protein W97_06711 [Coni...   132   5e-29   Coniosporium apollinis CBS 100218
gi|169781504|ref|XP_001825215.1| CORD and CS domain protein [Asp...   132   5e-29   Aspergillus oryzae RIB40
gi|238498286|ref|XP_002380378.1| CORD and CS domain protein [Asp...   132   5e-29   Aspergillus flavus NRRL3357
gi|296816483|ref|XP_002848578.1| diploid state maintenance prote...   132   8e-29   Arthroderma otae CBS 113480
gi|451999161|gb|EMD91624.1| hypothetical protein COCHEDRAFT_1136...   131   1e-28   Bipolaris maydis C5
gi|119184351|ref|XP_001243096.1| hypothetical protein CIMG_06992...   131   1e-28   Coccidioides immitis RS
gi|392596105|gb|EIW85428.1| chord-domain-containing protein [Con...   131   1e-28   Coniophora puteana RWD-64-598 SS2
gi|346979500|gb|EGY22952.1| integrin beta-1-binding protein [Ver...   131   2e-28   Verticillium dahliae VdLs.17
gi|328860798|gb|EGG09903.1| hypothetical protein MELLADRAFT_3410...   130   2e-28   Melampsora larici-populina 98AG31
gi|169623510|ref|XP_001805162.1| hypothetical protein SNOG_14997...   130   2e-28   Parastagonospora nodorum SN15
gi|346320893|gb|EGX90493.1| CORD and CS domain protein [Cordycep...   130   2e-28   Cordyceps militaris CM01
gi|303320331|ref|XP_003070165.1| CHORD family protein [Coccidioi...   130   3e-28   Coccidioides posadasii C735 delta SOWgp
gi|212542623|ref|XP_002151466.1| CORD and CS domain protein [Tal...   129   6e-28   Talaromyces marneffei ATCC 18224
gi|315050021|ref|XP_003174385.1| diploid state maintenance prote...   129   7e-28   Microsporum gypseum CBS 118893
gi|330916180|ref|XP_003297323.1| hypothetical protein PTT_07684 ...   129   7e-28   Pyrenophora teres f. teres 0-1
gi|407926307|gb|EKG19274.1| hypothetical protein MPH_03137 [Macr...   129   8e-28   Macrophomina phaseolina MS6
gi|171687839|ref|XP_001908860.1| hypothetical protein [Podospora...   128   9e-28   Podospora anserina S mat+
gi|189189136|ref|XP_001930907.1| CORD and CS domain containing p...   128   1e-27   Pyrenophora tritici-repentis Pt-1C-BFP
gi|358372826|dbj|GAA89427.1| CORD and CS domain protein [Aspergi...   127   2e-27   Aspergillus kawachii IFO 4308
gi|322697940|gb|EFY89714.1| CORD and CS domain containing protei...   127   2e-27   Metarhizium acridum CQMa 102
gi|350629616|gb|EHA17989.1| hypothetical protein ASPNIDRAFT_4759...   127   3e-27   Aspergillus niger ATCC 1015
gi|145239673|ref|XP_001392483.1| CORD and CS domain protein [Asp...   127   3e-27   Aspergillus niger CBS 513.88
gi|395333641|gb|EJF66018.1| chord-domain-containing protein [Dic...   126   4e-27   Dichomitus squalens LYAD-421 SS1
gi|398411184|ref|XP_003856935.1| hypothetical protein MYCGRDRAFT...   126   4e-27   Zymoseptoria tritici IPO323
gi|452847327|gb|EME49259.1| hypothetical protein DOTSEDRAFT_6813...   126   4e-27   Dothistroma septosporum NZE10
gi|115491611|ref|XP_001210433.1| hypothetical protein ATEG_00347...   125   7e-27   Aspergillus terreus NIH2624
gi|406862834|gb|EKD15883.1| CORD and CS domain containing protei...   125   1e-26   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|485917275|gb|EOD44308.1| putative cord and cs domain protein ...   125   1e-26   Neofusicoccum parvum UCRNP2
gi|399166054|emb|CCE33095.1| related to zinc-binding protein [Cl...   124   1e-26   Claviceps purpurea 20.1
gi|330794004|ref|XP_003285071.1| hypothetical protein DICPUDRAFT...   124   2e-26   Dictyostelium purpureum
gi|501304723|dbj|GAC94017.1| hypothetical protein PHSY_001586 [P...   124   2e-26   Pseudozyma hubeiensis SY62
gi|482805003|gb|EOA82102.1| hypothetical protein SETTUDRAFT_1655...   124   2e-26   Setosphaeria turcica Et28A
gi|322705627|gb|EFY97211.1| CORD and CS domain containing protei...   124   2e-26   
gi|164427312|ref|XP_964180.2| hypothetical protein NCU03087 [Neu...   123   3e-26   
gi|336267110|ref|XP_003348321.1| hypothetical protein SMAC_02818...   123   3e-26   Sordaria macrospora k-hell
gi|336464494|gb|EGO52734.1| hypothetical protein NEUTE1DRAFT_126...   123   3e-26   Neurospora tetrasperma FGSC 2508
gi|239608220|gb|EEQ85207.1| CORD and CS domain-containing protei...   123   4e-26   Blastomyces dermatitidis ER-3
gi|440633022|gb|ELR02941.1| hypothetical protein GMDG_01162 [Geo...   122   5e-26   Pseudogymnoascus destructans 20631-21
gi|451848200|gb|EMD61506.1| hypothetical protein COCSADRAFT_1483...   122   6e-26   Bipolaris sorokiniana ND90Pr
gi|358395849|gb|EHK45236.1| hypothetical protein TRIATDRAFT_2999...   122   7e-26   Trichoderma atroviride IMI 206040
gi|320591275|gb|EFX03714.1| cord and cs domain containing protei...   122   9e-26   Grosmannia clavigera kw1407
gi|512207497|gb|EPE36315.1| HSP20-like chaperone [Glarea lozoyen...   121   1e-25   Glarea lozoyensis ATCC 20868
gi|116180402|ref|XP_001220050.1| hypothetical protein CHGG_00829...   121   1e-25   Chaetomium globosum CBS 148.51
gi|429848165|gb|ELA23679.1| cord and cs domain protein [Colletot...   120   2e-25   Colletotrichum gloeosporioides Nara gc5
gi|380475580|emb|CCF45181.1| CORD and CS domain-containing prote...   120   3e-25   Colletotrichum higginsianum
gi|512186481|gb|EPE02273.1| cord and cs domain protein [Ophiosto...   120   3e-25   Ophiostoma piceae UAMH 11346
gi|440482082|gb|ELQ62604.1| CORD and CS domain-containing protei...   120   3e-25   Magnaporthe oryzae P131
gi|261203499|ref|XP_002628963.1| CORD and CS domain-containing p...   119   4e-25   Blastomyces gilchristii SLH14081
gi|71017293|ref|XP_758971.1| hypothetical protein UM02824.1 [Ust...   119   4e-25   
gi|465793934|emb|CCU98832.1| unnamed protein product [Malassezia...   118   9e-25   Malassezia sympodialis ATCC 42132
gi|302925638|ref|XP_003054134.1| hypothetical protein NECHADRAFT...   118   1e-24   Nectria haematococca mpVI 77-13-4
gi|443898867|dbj|GAC76201.1| Zn2+-binding protein Melusin/RAR1 [...   118   1e-24   Moesziomyces antarcticus T-34
gi|470249919|ref|XP_004367191.1| hypothetical protein DFA_07328 ...   118   1e-24   Dictyostelium fasciculatum
gi|389633065|ref|XP_003714185.1| CORD and CS domain-containing p...   118   1e-24   Magnaporthe oryzae 70-15
gi|449304691|gb|EMD00698.1| hypothetical protein BAUCODRAFT_6133...   118   1e-24   Baudoinia panamericana UAMH 10762
gi|471574562|gb|EMR72386.1| putative cord and cs domain-containi...   117   2e-24   Eutypa lata UCREL1
gi|336380423|gb|EGO21576.1| hypothetical protein SERLADRAFT_4101...   117   2e-24   Serpula lacrymans var. lacrymans S7.9
gi|225679587|gb|EEH17871.1| CORD and CS domain-containing protei...   117   2e-24   Paracoccidioides brasiliensis Pb03
gi|358056186|dbj|GAA97926.1| hypothetical protein E5Q_04606 [Mix...   117   3e-24   Mixia osmundae IAM 14324
gi|367043696|ref|XP_003652228.1| hypothetical protein THITE_2113...   116   3e-24   Thielavia terrestris NRRL 8126
gi|226291319|gb|EEH46747.1| integrin beta-1-binding protein [Par...   116   4e-24   Paracoccidioides brasiliensis Pb18
gi|225560074|gb|EEH08356.1| CORD and CS domain-containing protei...   116   5e-24   Histoplasma capsulatum G186AR
gi|500259256|gb|EOO02086.1| putative cord and cs domain-containi...   115   6e-24   Phaeoacremonium minimum UCRPA7
gi|242768532|ref|XP_002341589.1| CORD and CS domain protein [Tal...   115   1e-23   Talaromyces stipitatus ATCC 10500
gi|343429635|emb|CBQ73207.1| related to diploid state maintenanc...   115   1e-23   Sporisorium reilianum SRZ2
gi|295667758|ref|XP_002794428.1| diploid state maintenance prote...   115   1e-23   Paracoccidioides lutzii Pb01
gi|340914653|gb|EGS17994.1| hypothetical protein CTHT_0060070 [C...   114   1e-23   Chaetomium thermophilum var. thermophilum DSM 1495
gi|156053031|ref|XP_001592442.1| hypothetical protein SS1G_06683...   114   2e-23   Sclerotinia sclerotiorum 1980 UF-70
gi|281210930|gb|EFA85096.1| predicted protein [Polysphondylium p...   114   2e-23   Polysphondylium pallidum PN500
gi|240278824|gb|EER42330.1| CORD and CS protein [Ajellomyces cap...   114   2e-23   Histoplasma capsulatum H143
gi|347837628|emb|CCD52200.1| similar to CORD and CS domain-conta...   114   2e-23   Botrytis cinerea T4
gi|367020152|ref|XP_003659361.1| hypothetical protein MYCTH_2313...   113   3e-23   Myceliophthora thermophila ATCC 42464
gi|388853900|emb|CCF52398.1| related to diploid state maintenanc...   112   6e-23   Ustilago hordei
gi|477537008|gb|ENH88468.1| cord and cs domain protein [Colletot...   111   2e-22   Colletotrichum orbiculare MAFF 240422
gi|378729041|gb|EHY55500.1| hypothetical protein HMPREF1120_0363...   110   2e-22   Exophiala dermatitidis NIH/UT8656
gi|310790918|gb|EFQ26451.1| CORD and CS domain-containing protei...   109   5e-22   Colletotrichum graminicola M1.001
gi|167517191|ref|XP_001742936.1| hypothetical protein [Monosiga ...   105   1e-20   Monosiga brevicollis MX1
gi|402072105|gb|EJT68059.1| CORD and CS domain-containing protei...   105   1e-20   Gaeumannomyces graminis var. tritici R3-111a-1
gi|326427601|gb|EGD73171.1| hypothetical protein PTSG_04884 [Sal...   104   2e-20   Salpingoeca rosetta
gi|67517941|ref|XP_658745.1| hypothetical protein AN1141.2 [Aspe...   103   2e-20   Aspergillus nidulans FGSC A4
gi|426370096|ref|XP_004052009.1| PREDICTED: cysteine and histidi...   103   3e-20   Gorilla gorilla gorilla [lowland gorilla]
gi|443702188|gb|ELU00349.1| hypothetical protein CAPTEDRAFT_1656...   103   3e-20   Capitella teleta
gi|209969825|ref|NP_001123267.2| cysteine and histidine-rich dom...   103   4e-20   Nasonia vitripennis
gi|164655004|ref|XP_001728634.1| hypothetical protein MGL_4233 [...   103   4e-20   Malassezia globosa CBS 7966
gi|194909877|ref|XP_001982027.1| GG11265 [Drosophila erecta] >gi...   102   6e-20   Drosophila erecta
gi|321472345|gb|EFX83315.1| hypothetical protein DAPPUDRAFT_1951...   102   8e-20   Daphnia pulex
gi|6581054|gb|AAF18436.1|AF192465_1 CHORD containing protein [Dr...   102   9e-20   Drosophila melanogaster
gi|195400040|ref|XP_002058626.1| GJ14211 [Drosophila virilis] >g...   102   9e-20   Drosophila virilis
gi|21355187|ref|NP_651226.1| CHORD [Drosophila melanogaster] >gi...   102   9e-20   Drosophila melanogaster
gi|241626044|ref|XP_002409601.1| cysteine and histidine-rich dom...   102   9e-20   Ixodes scapularis [blacklegged tick]
gi|242024533|ref|XP_002432682.1| Integrin beta-1-binding protein...   101   1e-19   Pediculus humanus corporis [human body lice]
gi|332207896|ref|XP_003253031.1| PREDICTED: cysteine and histidi...   101   1e-19   Nomascus leucogenys [White-cheeked Gibbon]
gi|426370094|ref|XP_004052008.1| PREDICTED: cysteine and histidi...   101   1e-19   Gorilla gorilla gorilla [lowland gorilla]
gi|426370098|ref|XP_004052010.1| PREDICTED: cysteine and histidi...   101   1e-19   Gorilla gorilla gorilla [lowland gorilla]
gi|307199859|gb|EFN80256.1| Cysteine and histidine-rich domain-c...   101   2e-19   Harpegnathos saltator
gi|260789534|ref|XP_002589801.1| hypothetical protein BRAFLDRAFT...   100   2e-19   Branchiostoma floridae
gi|75076829|sp|Q4R7U2.1|CHRD1_MACFA RecName: Full=Cysteine and h...   100   2e-19   Macaca fascicularis [crab eating macaque]
gi|383873111|ref|NP_001244685.1| cysteine and histidine-rich dom...   100   3e-19   Macaca mulatta [rhesus macaque]
gi|195504892|ref|XP_002099274.1| GE23458 [Drosophila yakuba] >gi...   100   3e-19   Drosophila yakuba
gi|402896523|ref|XP_003911346.1| PREDICTED: cysteine and histidi...   100   3e-19   
gi|195573393|ref|XP_002104678.1| GD21075 [Drosophila simulans] >...   100   4e-19   Drosophila simulans
gi|397485374|ref|XP_003813823.1| PREDICTED: cysteine and histidi...   100   4e-19   
gi|195331552|ref|XP_002032465.1| GM26571 [Drosophila sechellia] ...   100   4e-19   Drosophila sechellia
gi|195444282|ref|XP_002069796.1| GK11385 [Drosophila willistoni]...   100   4e-19   Drosophila willistoni
gi|350535042|ref|NP_001233351.1| cysteine and histidine-rich dom...   100   4e-19   Pan troglodytes
gi|119587274|gb|EAW66870.1| cysteine and histidine-rich domain (...   100   4e-19   Homo sapiens [man]
gi|221316566|ref|NP_036256.2| cysteine and histidine-rich domain...   100   4e-19   Homo sapiens [man]
gi|221316570|ref|NP_001137545.1| cysteine and histidine-rich dom...    99   5e-19   Homo sapiens [man]
gi|12002207|gb|AAG43237.1|AF123249_1 chymotrypsin-like protein [...    99   5e-19   Homo sapiens [man]
gi|403301743|ref|XP_003941542.1| PREDICTED: cysteine and histidi...    99   6e-19   Saimiri boliviensis boliviensis
gi|403301745|ref|XP_003941543.1| PREDICTED: cysteine and histidi...    99   6e-19   
gi|149719233|ref|XP_001488703.1| PREDICTED: cysteine and histidi...    99   7e-19   Equus caballus [domestic horse]
gi|358335563|dbj|GAA27687.2| cysteine and histidine-rich domain-...    99   9e-19   Clonorchis sinensis [oriental liver fluke]
gi|118404486|ref|NP_001072688.1| integrin beta 1 binding protein...    99   1e-18   Xenopus tropicalis [western clawed frog]
gi|206597559|ref|NP_001125118.1| cysteine and histidine-rich dom...    99   1e-18   Pongo abelii [Orang-utan]
gi|498957342|ref|XP_004524138.1| PREDICTED: cysteine and histidi...    99   1e-18   Ceratitis capitata
gi|281337340|gb|EFB12924.1| hypothetical protein PANDA_005065 [A...    98   1e-18   Ailuropoda melanoleuca
gi|301763016|ref|XP_002916922.1| PREDICTED: cysteine and histidi...    98   1e-18   Ailuropoda melanoleuca
gi|119587271|gb|EAW66867.1| cysteine and histidine-rich domain (...    98   1e-18   Homo sapiens [man]
gi|403269836|ref|XP_003926916.1| PREDICTED: cysteine and histidi...    98   2e-18   
gi|114052382|ref|NP_001039377.1| cysteine and histidine-rich dom...    98   2e-18   Bos taurus [bovine]
gi|301763018|ref|XP_002916923.1| PREDICTED: cysteine and histidi...    98   2e-18   
gi|507556478|ref|XP_004661994.1| PREDICTED: cysteine and histidi...    98   2e-18   Jaculus jaculus
gi|440895125|gb|ELR47394.1| Cysteine and histidine-rich domain-c...    98   2e-18   Bos mutus
gi|405958045|gb|EKC24211.1| Cysteine and histidine-rich domain-c...    98   2e-18   Crassostrea gigas
gi|512919933|ref|XP_004929505.1| PREDICTED: cysteine and histidi...    98   2e-18   Bombyx mori [silk moth]
gi|312385742|gb|EFR30167.1| hypothetical protein AND_00397 [Anop...    97   2e-18   
gi|426252197|ref|XP_004019802.1| PREDICTED: cysteine and histidi...    97   2e-18   
gi|195144882|ref|XP_002013425.1| GL23415 [Drosophila persimilis]...    97   2e-18   Drosophila persimilis
gi|125775143|ref|XP_001358823.1| GA19433 [Drosophila pseudoobscu...    97   2e-18   Drosophila pseudoobscura pseudoobscura
gi|332024062|gb|EGI64279.1| Cysteine and histidine-rich domain-c...    97   2e-18   Acromyrmex echinatior
gi|164664460|ref|NP_001106917.1| cysteine and histidine-rich dom...    97   2e-18   Sus scrofa [pigs]
gi|148231071|ref|NP_001091174.1| integrin beta 1 binding protein...    97   3e-18   Xenopus laevis [clawed frog]
gi|194746448|ref|XP_001955692.1| GF16113 [Drosophila ananassae] ...    97   3e-18   Drosophila ananassae
gi|472385242|ref|XP_004411984.1| PREDICTED: cysteine and histidi...    97   4e-18   Odobenus rosmarus divergens
gi|466019580|ref|XP_004271933.1| PREDICTED: cysteine and histidi...    97   4e-18   Orcinus orca [Orca]
gi|466019585|ref|XP_004271934.1| PREDICTED: cysteine and histidi...    97   4e-18   
gi|91077034|ref|XP_967567.1| PREDICTED: similar to CHORD CG6198-...    97   4e-18   Tribolium castaneum [rust-red flour beetle]
gi|472385244|ref|XP_004411985.1| PREDICTED: cysteine and histidi...    96   4e-18   Odobenus rosmarus divergens
gi|224043653|ref|XP_002186547.1| PREDICTED: cysteine and histidi...    96   4e-18   Taeniopygia guttata
gi|357622949|gb|EHJ74291.1| hypothetical protein KGM_22001 [Dana...    96   4e-18   Danaus plexippus [American monarch]
gi|13385324|ref|NP_080120.1| cysteine and histidine-rich domain-...    96   5e-18   Mus musculus [mouse]
gi|157822247|ref|NP_001101598.1| cysteine and histidine-rich dom...    96   5e-18   Rattus norvegicus [brown rat]
gi|345787901|ref|XP_533979.3| PREDICTED: cysteine and histidine-...    96   5e-18   Canis lupus familiaris [dogs]
gi|511887714|ref|XP_004763623.1| PREDICTED: cysteine and histidi...    96   5e-18   Mustela putorius furo [black ferret]
gi|507691288|ref|XP_004641969.1| PREDICTED: cysteine and histidi...    96   5e-18   Octodon degus
gi|478506426|ref|XP_004427508.1| PREDICTED: cysteine and histidi...    96   5e-18   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|355752534|gb|EHH56654.1| hypothetical protein EGM_06111 [Maca...    96   5e-18   Macaca fascicularis [crab eating macaque]
gi|511887716|ref|XP_004763624.1| PREDICTED: cysteine and histidi...    96   5e-18   
gi|327287046|ref|XP_003228240.1| PREDICTED: cysteine and histidi...    96   6e-18   
gi|507691284|ref|XP_004641968.1| PREDICTED: cysteine and histidi...    96   6e-18   Octodon degus
gi|348565659|ref|XP_003468620.1| PREDICTED: cysteine and histidi...    96   6e-18   Cavia porcellus [guinea pig]
gi|354498594|ref|XP_003511400.1| PREDICTED: cysteine and histidi...    96   6e-18   Cricetulus griseus [Chinese hamsters]
gi|345787903|ref|XP_003432986.1| PREDICTED: cysteine and histidi...    96   6e-18   
gi|149635154|ref|XP_001512381.1| PREDICTED: cysteine and histidi...    96   6e-18   Ornithorhynchus anatinus [duck-billed platypus]
gi|507690663|ref|XP_004641822.1| PREDICTED: cysteine and histidi...    96   6e-18   Octodon degus
gi|478506428|ref|XP_004427509.1| PREDICTED: cysteine and histidi...    96   6e-18   
gi|395520569|ref|XP_003764400.1| PREDICTED: cysteine and histidi...    96   7e-18   Sarcophilus harrisii
gi|395814695|ref|XP_003780879.1| PREDICTED: cysteine and histidi...    96   8e-18   Otolemur garnettii
gi|498981622|ref|XP_004550105.1| PREDICTED: cysteine and histidi...    96   8e-18   
gi|348518674|ref|XP_003446856.1| PREDICTED: cysteine and histidi...    96   8e-18   Oreochromis niloticus
gi|449269579|gb|EMC80340.1| Cysteine and histidine-rich domain-c...    96   9e-18   Columba livia [carrier pigeon]
gi|505788594|ref|XP_004605239.1| PREDICTED: cysteine and histidi...    96   9e-18   Sorex araneus [Eurasian shrew]
gi|6581056|gb|AAF18437.1|AF192466_1 CHORD containing protein-1 [...    95   1e-17   Homo sapiens [man]
gi|512874914|ref|XP_004893557.1| PREDICTED: cysteine and histidi...    95   1e-17   
gi|512874918|ref|XP_004893558.1| PREDICTED: cysteine and histidi...    95   1e-17   
gi|195036428|ref|XP_001989672.1| GH18665 [Drosophila grimshawi] ...    95   1e-17   Drosophila grimshawi
gi|291384094|ref|XP_002708685.1| PREDICTED: cysteine and histidi...    95   1e-17   Oryctolagus cuniculus [European rabbit]
gi|41056073|ref|NP_956633.1| cysteine and histidine-rich domain-...    95   1e-17   Danio rerio [leopard danio]
gi|449267899|gb|EMC78790.1| Cysteine and histidine-rich domain-c...    95   2e-17   Columba livia [carrier pigeon]
gi|410972473|ref|XP_003992683.1| PREDICTED: cysteine and histidi...    94   2e-17   Felis catus [cat]
gi|291227043|ref|XP_002733497.1| PREDICTED: cysteine and histidi...    94   2e-17   Saccoglossus kowalevskii
gi|259488543|tpe|CBF88062.1| TPA: ChpADiploid state maintenance ...    94   2e-17   Aspergillus nidulans FGSC A4
gi|380020848|ref|XP_003694289.1| PREDICTED: cysteine and histidi...    94   2e-17   Apis florea [dwarf honeybee]
gi|410972475|ref|XP_003992684.1| PREDICTED: cysteine and histidi...    94   2e-17   
gi|391332709|ref|XP_003740773.1| PREDICTED: cysteine and histidi...    94   2e-17   Metaseiulus occidentalis
gi|483493278|gb|EOA93338.1| Cysteine and histidine-rich domain-c...    94   2e-17   Anas platyrhynchos [duck]
gi|66507739|ref|XP_395533.2| PREDICTED: cysteine and histidine-r...    94   3e-17   Apis mellifera [European honey bee]
gi|148224594|ref|NP_001084590.1| cysteine and histidine-rich dom...    94   3e-17   Xenopus laevis [clawed frog]
gi|504145632|ref|XP_004585237.1| PREDICTED: cysteine and histidi...    94   3e-17   Ochotona princeps [southern American pika]
gi|318054646|ref|NP_001188062.1| cysteine and histidine-rich dom...    94   3e-17   Ictalurus punctatus
gi|308322439|gb|ADO28357.1| cysteine and histidine-rich domain-c...    94   3e-17   Ictalurus furcatus
gi|86279688|gb|ABC94499.1| putative chymotrypsin-like protein [I...    94   3e-17   Ictalurus punctatus
gi|344287779|ref|XP_003415630.1| PREDICTED: cysteine and histidi...    93   4e-17   
gi|344287777|ref|XP_003415629.1| PREDICTED: cysteine and histidi...    93   4e-17   Loxodonta africana [African bush elephant]
gi|402890696|ref|XP_003908615.1| PREDICTED: cysteine and histidi...    93   5e-17   
gi|326918752|ref|XP_003205652.1| PREDICTED: cysteine and histidi...    93   5e-17   
gi|327269263|ref|XP_003219414.1| PREDICTED: cysteine and histidi...    93   5e-17   
gi|363732737|ref|XP_420200.3| PREDICTED: cysteine and histidine-...    93   5e-17   Gallus gallus [bantam]
gi|170057517|ref|XP_001864518.1| integrin beta-1-binding protein...    93   6e-17   Culex quinquefasciatus
gi|327269265|ref|XP_003219415.1| PREDICTED: cysteine and histidi...    93   6e-17   
gi|51010995|ref|NP_001003457.1| uncharacterized protein LOC44506...    92   7e-17   Danio rerio [leopard danio]
gi|410956946|ref|XP_003985097.1| PREDICTED: cysteine and histidi...    92   7e-17   
gi|513180394|ref|XP_004940688.1| PREDICTED: cysteine and histidi...    92   7e-17   
gi|340713157|ref|XP_003395114.1| PREDICTED: cysteine and histidi...    92   8e-17   Bombus terrestris [large earth bumblebee]
gi|471418084|ref|XP_004390542.1| PREDICTED: cysteine and histidi...    92   8e-17   Trichechus manatus latirostris
gi|47227100|emb|CAG00462.1| unnamed protein product [Tetraodon n...    92   8e-17   Tetraodon nigroviridis
gi|471418082|ref|XP_004390541.1| PREDICTED: cysteine and histidi...    92   9e-17   Trichechus manatus latirostris
gi|71895117|ref|NP_001026003.1| cysteine and histidine-rich doma...    92   9e-17   Gallus gallus [bantam]
gi|326914526|ref|XP_003203576.1| PREDICTED: cysteine and histidi...    92   9e-17   
gi|350417087|ref|XP_003491250.1| PREDICTED: cysteine and histidi...    92   9e-17   
gi|110774352|ref|XP_001123035.1| PREDICTED: cysteine and histidi...    92   9e-17   
gi|68448475|ref|NP_001020346.1| cysteine and histidine-rich doma...    92   1e-16   Danio rerio [leopard danio]
gi|157115086|ref|XP_001658106.1| integrin beta 1 binding protein...    92   1e-16   Aedes aegypti
gi|290561016|gb|ADD37910.1| Cysteine and histidine-rich domain-c...    92   1e-16   Lepeophtheirus salmonis
gi|483516671|gb|EOB03448.1| Cysteine and histidine-rich domain-c...    92   1e-16   Anas platyrhynchos [duck]
gi|410915798|ref|XP_003971374.1| PREDICTED: cysteine and histidi...    91   1e-16   
gi|410915800|ref|XP_003971375.1| PREDICTED: cysteine and histidi...    91   2e-16   
gi|195108471|ref|XP_001998816.1| GI24177 [Drosophila mojavensis]...    91   2e-16   Drosophila mojavensis
gi|488580802|ref|XP_004475844.1| PREDICTED: cysteine and histidi...    91   2e-16   Dasypus novemcinctus
gi|488580804|ref|XP_004475845.1| PREDICTED: cysteine and histidi...    91   3e-16   
gi|383865839|ref|XP_003708380.1| PREDICTED: cysteine and histidi...    91   3e-16   
gi|118783063|ref|XP_562821.2| AGAP003064-PA [Anopheles gambiae s...    90   4e-16   Anopheles gambiae str. PEST
gi|347969183|ref|XP_312747.5| AGAP003061-PA [Anopheles gambiae s...    90   4e-16   Anopheles gambiae str. PEST
gi|307172259|gb|EFN63764.1| Cysteine and histidine-rich domain-c...    89   6e-16   Camponotus floridanus
gi|328714834|ref|XP_001946683.2| PREDICTED: cysteine and histidi...    89   1e-15   
gi|410931133|ref|XP_003978950.1| PREDICTED: cysteine and histidi...    88   1e-15   
gi|47213470|emb|CAF91127.1| unnamed protein product [Tetraodon n...    88   2e-15   Tetraodon nigroviridis
gi|156386846|ref|XP_001634122.1| predicted protein [Nematostella...    87   2e-15   Nematostella vectensis
gi|499025807|ref|XP_004563650.1| PREDICTED: cysteine and histidi...    87   2e-15   
gi|318087198|gb|ADV40191.1| putative cysteine and histidine-rich...    87   3e-15   Latrodectus hesperus [black widow]
gi|395851939|ref|XP_003798505.1| PREDICTED: cysteine and histidi...    87   3e-15   Otolemur garnettii
gi|198433494|ref|XP_002129382.1| PREDICTED: cysteine and histidi...    87   3e-15   Ciona intestinalis [sea vase]
gi|225717222|gb|ACO14457.1| Cysteine and histidine-rich domain-c...    87   3e-15   Esox lucius
gi|340375423|ref|XP_003386234.1| PREDICTED: LOW QUALITY PROTEIN:...    87   4e-15   
gi|348532995|ref|XP_003453991.1| PREDICTED: cysteine and histidi...    86   1e-14   
gi|390344220|ref|XP_797726.3| PREDICTED: cysteine and histidine-...    85   1e-14   Strongylocentrotus purpuratus [purple urchin]
gi|348570522|ref|XP_003471046.1| PREDICTED: integrin beta-1-bind...    85   1e-14   Cavia porcellus [guinea pig]
gi|119625701|gb|EAX05296.1| integrin beta 1 binding protein (mel...    85   2e-14   Homo sapiens [man]
gi|507707540|ref|XP_004716722.1| PREDICTED: integrin beta-1-bind...    85   2e-14   Echinops telfairi [lesser hedgehog tenrec]
gi|507710142|ref|XP_004646844.1| PREDICTED: integrin beta-1-bind...    85   2e-14   Octodon degus
gi|512908055|ref|XP_004901249.1| PREDICTED: integrin beta-1-bind...    84   2e-14   
gi|504171448|ref|XP_004595310.1| PREDICTED: integrin beta-1-bind...    84   2e-14   Ochotona princeps [southern American pika]
gi|328710099|ref|XP_003244165.1| PREDICTED: cysteine and histidi...    84   2e-14   
gi|334350451|ref|XP_001367602.2| PREDICTED: integrin beta-1-bind...    84   2e-14   
gi|157818035|ref|NP_001101715.1| integrin beta-1-binding protein...    84   2e-14   
gi|74007660|ref|XP_538074.2| PREDICTED: integrin beta-1-binding ...    84   2e-14   
gi|507982266|ref|XP_004694535.1| PREDICTED: integrin beta-1-bind...    84   2e-14   
gi|7305191|ref|NP_038740.1| integrin beta-1-binding protein 2 [M...    84   3e-14   
gi|478531503|ref|XP_004439905.1| PREDICTED: integrin beta-1-bind...    84   3e-14   
gi|291407671|ref|XP_002720146.1| PREDICTED: integrin beta 1 bind...    84   3e-14   
gi|444727536|gb|ELW68023.1| Integrin beta-1-binding protein 2 [T...    84   4e-14   
gi|507554445|ref|XP_004660999.1| PREDICTED: integrin beta-1-bind...    84   4e-14   
gi|339252562|ref|XP_003371504.1| chord superfamily [Trichinella ...    83   4e-14   
gi|472353975|ref|XP_004396650.1| PREDICTED: integrin beta-1-bind...    83   4e-14   
gi|80477904|gb|AAI08902.1| ITGB1BP2 protein [Homo sapiens]             83   4e-14   
gi|403305178|ref|XP_003943147.1| PREDICTED: integrin beta-1-bind...    83   4e-14   
gi|332247218|ref|XP_003272751.1| PREDICTED: integrin beta-1-bind...    83   5e-14   
gi|6912438|ref|NP_036410.1| integrin beta-1-binding protein 2 [H...    83   5e-14   
gi|432920882|ref|XP_004080014.1| PREDICTED: cysteine and histidi...    83   5e-14   
gi|432096329|gb|ELK27090.1| Integrin beta-1-binding protein 2 [M...    83   5e-14   
gi|466038317|ref|XP_004275797.1| PREDICTED: integrin beta-1-bind...    83   5e-14   
gi|470636072|ref|XP_004323456.1| PREDICTED: integrin beta-1-bind...    83   6e-14   
gi|257206202|emb|CAX82752.1| Integrin beta-1-binding protein 2 [...    83   6e-14   
gi|281340178|gb|EFB15762.1| hypothetical protein PANDA_019198 [A...    83   6e-14   
gi|229893767|gb|ACQ90241.1| melusin trancript variant 1 [Sus scr...    83   6e-14   
gi|395546215|ref|XP_003774985.1| PREDICTED: integrin beta-1-bind...    83   6e-14   
gi|301787373|ref|XP_002929100.1| PREDICTED: integrin beta-1-bind...    83   6e-14   
gi|194228014|ref|XP_001915337.1| PREDICTED: integrin beta-1-bind...    82   8e-14   
gi|76156795|gb|AAX27924.2| SJCHGC05923 protein [Schistosoma japo...    82   9e-14   
gi|109131169|ref|XP_001091670.1| PREDICTED: integrin beta-1-bind...    82   9e-14   
gi|402910490|ref|XP_003917909.1| PREDICTED: integrin beta-1-bind...    82   9e-14   
gi|471391187|ref|XP_004380194.1| PREDICTED: integrin beta-1-bind...    82   1e-13   
gi|431914408|gb|ELK15665.1| Integrin beta-1-binding protein 2 [P...    82   1e-13   
gi|256074434|ref|XP_002573530.1| cysteine and histidine-rich dom...    82   1e-13   
gi|226484766|emb|CAX74292.1| Integrin beta-1-binding protein 2 [...    82   1e-13   
gi|296235737|ref|XP_002763027.1| PREDICTED: integrin beta-1-bind...    82   1e-13   
gi|226469016|emb|CAX69987.1| Integrin beta-1-binding protein 2 [...    82   1e-13   
gi|428167453|gb|EKX36412.1| hypothetical protein GUITHDRAFT_1657...    82   1e-13   
gi|410988800|ref|XP_004000665.1| PREDICTED: integrin beta-1-bind...    81   1e-13   
gi|354497964|ref|XP_003511087.1| PREDICTED: integrin beta-1-bind...    81   2e-13   
gi|329664540|ref|NP_001192661.1| integrin beta-1-binding protein...    81   2e-13   
gi|238914601|gb|ACR78150.1| melusin [Sus scrofa]                       81   2e-13   
gi|344282026|ref|XP_003412776.1| PREDICTED: integrin beta-1-bind...    81   2e-13   
gi|74136751|ref|NP_001028181.1| integrin beta-1-binding protein ...    81   2e-13   
gi|344246848|gb|EGW02952.1| Non-POU domain-containing octamer-bi...    81   2e-13   
gi|355745370|gb|EHH49995.1| hypothetical protein EGM_00749, part...    80   3e-13   
gi|511915967|ref|XP_004777285.1| PREDICTED: integrin beta-1-bind...    80   3e-13   
gi|355558103|gb|EHH14883.1| hypothetical protein EGK_00878, part...    80   3e-13   
gi|511915969|ref|XP_004777286.1| PREDICTED: integrin beta-1-bind...    80   4e-13   
gi|449499312|ref|XP_002187746.2| PREDICTED: cysteine and histidi...    79   6e-13   
gi|393910997|gb|EJD76117.1| hypothetical protein, variant [Loa loa]    79   6e-13   
gi|312077228|ref|XP_003141211.1| hypothetical protein LOAG_05626...    79   6e-13   
gi|478251770|gb|ENN72218.1| hypothetical protein YQE_11133, part...    79   7e-13   
gi|393910996|gb|EFO22861.2| hypothetical protein LOAG_05626 [Loa...    79   7e-13   
gi|426257208|ref|XP_004022224.1| PREDICTED: integrin beta-1-bind...    79   9e-13   
gi|332375727|gb|AEE63004.1| unknown [Dendroctonus ponderosae]          78   1e-12   
gi|505856357|ref|XP_004621584.1| PREDICTED: integrin beta-1-bind...    77   2e-12   
gi|313227225|emb|CBY22372.1| unnamed protein product [Oikopleura...    77   4e-12   
gi|196005965|ref|XP_002112849.1| hypothetical protein TRIADDRAFT...    76   5e-12   
gi|397526077|ref|XP_003832966.1| PREDICTED: LOW QUALITY PROTEIN:...    75   8e-12   
gi|313241653|emb|CBY33878.1| unnamed protein product [Oikopleura...    75   2e-11   
gi|170590606|ref|XP_001900063.1| CHORD family protein [Brugia ma...    73   5e-11   


>gi|511006298|gb|EPB87614.1| hypothetical protein HMPREF1544_05597 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 348

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 98/137 (71%), Gaps = 6/137 (4%)

Query: 68  PVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEE 127
           PV   T CKR  CG+ + D ATSRG G EA C +H G+P+FHEGSKGWSCCSRKVL+F+E
Sbjct: 139 PVPEGTTCKRRGCGRVWKDQATSRGSGAEATCRHHPGSPIFHEGSKGWSCCSRKVLDFDE 198

Query: 128 FLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTF 187
           FLKI+GCK+GKHLFVG+  +     +E+V CR DWYQT T++I+SIFAK  +K ++ V F
Sbjct: 199 FLKIEGCKEGKHLFVGANSQT----EEMVDCRTDWYQTQTNVILSIFAK--NKDDTKVDF 252

Query: 188 REKEVMICLYKKGRNIY 204
            E  + + +  KG   Y
Sbjct: 253 TEDTINVDIKMKGNKRY 269



>gi|392566884|gb|EIW60059.1| chord-domain-containing protein [Trametes versicolor FP-101664 SS1]
          Length = 342

 Score =  152 bits (383), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 102/174 (58%), Gaps = 7/174 (4%)

Query: 25  ENGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKY 84
           + G E Y S P    +   S+  T  PK      E EEDDL+ PV   T C+   C  +Y
Sbjct: 91  QGGAETYSSAPVNMPSAAASREATPAPKF-----EEEEDDLSAPVTVGTTCRHSGCNVEY 145

Query: 85  VDDATSRGEG-PEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVG 143
             D   R EG   AEC YH   P+FHEGSKG+ CC R+VLEF+EFLKI+GCKKG+H+FV 
Sbjct: 146 ESDELHRTEGGAAAECTYHPKPPIFHEGSKGYLCCKRRVLEFDEFLKIEGCKKGRHVFVP 205

Query: 144 SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLY 197
             K     E+E  +CR D YQTP+ +  S+FAKK D   S+VT  E +V + LY
Sbjct: 206 KQK-ADPQEEEFTECRIDHYQTPSEVHASVFAKKADADTSTVTIEENQVFLDLY 258



 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 8/72 (11%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCS---RKVLEFEEFLKI 131
           C    CGK Y    +    GPE+ C YH+G PVFHEGSK WSCCS   + VL+F++FLKI
Sbjct: 4   CTHKGCGKDY----SPENNGPES-CTYHTGAPVFHEGSKSWSCCSDVNKPVLDFDDFLKI 58

Query: 132 KGCKKGKHLFVG 143
            GC KG+H  V 
Sbjct: 59  PGCTKGQHTDVA 70



>gi|405122993|gb|AFR97758.1| CORD and CS domain-containing protein [Cryptococcus neoformans var.
           grubii H99]
          Length = 375

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 111/192 (57%), Gaps = 23/192 (11%)

Query: 26  NGVEIYDSGPKISY-----TQTISKTITEEPKLAPIE----------------KEPEEDD 64
           +GVE Y +    +      +  +S T T  P + P                  KE E+DD
Sbjct: 97  DGVETYGTAAPTAKLPAAESSKLSNTATSSPSVVPSALTAVTPSQHNTEQKEAKEVEQDD 156

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
            ++PV     CKR +CG  +  +  SRG+G +A C YH    +FHEGSKG+ CC R+VLE
Sbjct: 157 PSVPVPKGARCKRLACGATWEGEEVSRGDGEKAICRYHPQAAIFHEGSKGYLCCKRRVLE 216

Query: 125 FEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSS 184
           F+EF+KI GCK+G+HLFVGS K+    ++E+V CR D YQTPT +I+S FAK  DK  S+
Sbjct: 217 FDEFMKIPGCKEGRHLFVGSKKD--ETKEEVVNCRLDHYQTPTQVIVSAFAKGADKSRST 274

Query: 185 VTFREKEVMICL 196
           +TF  + + + L
Sbjct: 275 ITFTPQTLTLSL 286



>gi|393220298|gb|EJD05784.1| chord-domain-containing protein [Fomitiporia mediterranea MF3/22]
          Length = 347

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 106/173 (61%), Gaps = 2/173 (1%)

Query: 26  NGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYV 85
           +G E + +G   S+  T+     +    AP   E EEDDL++PV S TEC+R  CG K++
Sbjct: 90  DGTETFTTGMSASFLSTLPPAPPKPSTPAPPPVEEEEDDLSVPVDSGTECRRKGCGVKFI 149

Query: 86  DDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGS 144
               SR G+G  A C YH   P+FHEGSKG+ CC R+VLEFEEFLKI+GCK GKHLF   
Sbjct: 150 SQQESRLGDGENAVCTYHPSPPIFHEGSKGYLCCKRRVLEFEEFLKIEGCKTGKHLFAPK 209

Query: 145 GKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLY 197
                  E +   CR D YQTPT++ +SIFAK+ DK  S+V   E EV + L+
Sbjct: 210 KNGYLKAEVQTT-CRIDHYQTPTNVCVSIFAKQADKSRSTVNLEENEVYLDLF 261



>gi|328774153|gb|EGF84190.1| hypothetical protein BATDEDRAFT_84922 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 338

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/190 (43%), Positives = 114/190 (60%), Gaps = 23/190 (12%)

Query: 23  RVENGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPE--EDDLNIP----VASDTECK 76
           + ++GVE +          T++      P   P    P   E D++ P    VA  T CK
Sbjct: 88  KSDDGVETF----------TMASVPAALPASIPAVTAPVFLEKDMHDPADAIVAPGTLCK 137

Query: 77  RPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKK 136
           R +CG+ ++DD TSR +    ECI+H G PVFHEGSKGWSCC+R+VLEF+EFLKIKGC  
Sbjct: 138 RKTCGQSFLDD-TSRSQ----ECIHHPGAPVFHEGSKGWSCCTRRVLEFDEFLKIKGCST 192

Query: 137 GKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMI-C 195
            KH F     E  ++ K++V+CR DWYQTP  +I+SIFAKKVDK  ++V F +  + +  
Sbjct: 193 SKHRFTNVHLESTDI-KQVVECRRDWYQTPDTVILSIFAKKVDKLATTVVFDKTSLKVDI 251

Query: 196 LYKKGRNIYY 205
           L+  G +  Y
Sbjct: 252 LFLDGSSSQY 261



 Score = 72.0 bits (175), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK +        EG   EC+YHSG+ VFHEG KGWSCC+++V +F+ FLKI GC
Sbjct: 6   CANKGCGKPFEPSI----EG-NKECVYHSGSAVFHEGLKGWSCCTKRVTDFDAFLKIPGC 60

Query: 135 KKGKH 139
             G H
Sbjct: 61  TTGTH 65



>gi|353238059|emb|CCA70016.1| related to diploid state maintenance protein chpA [Piriformospora
           indica DSM 11827]
          Length = 358

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 102/151 (67%), Gaps = 5/151 (3%)

Query: 51  PKLAPIEKEP---EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPV 107
           PK AP   +P   +EDD ++ V   T+C+R  C   +V D  SRG+GP++ CIYH   P+
Sbjct: 123 PKPAPSTPQPLVEDEDDTSVKVEPGTKCQRNGCKHLFVSDEESRGDGPQSTCIYHPRQPL 182

Query: 108 FHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGK-EVKNV-EKEIVQCRHDWYQT 165
           FHEGSKG+ CC R+VLEF+EFLKI+GCK GKHLFV     +   V ++E+VQCR D YQT
Sbjct: 183 FHEGSKGYLCCKRRVLEFDEFLKIEGCKTGKHLFVKKKPIDTDGVPQEELVQCRIDHYQT 242

Query: 166 PTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           P  +  S++AKKVDK  S+V F  ++V + L
Sbjct: 243 PGQVRASVYAKKVDKDKSTVIFETEQVHLDL 273



>gi|392573395|gb|EIW66535.1| hypothetical protein TREMEDRAFT_45668 [Tremella mesenterica DSM
           1558]
          Length = 365

 Score =  149 bits (375), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 98/145 (67%), Gaps = 3/145 (2%)

Query: 56  IEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGW 115
           IE E EEDDL++PV   T CKR +CG  +  +  SRG G +++C YH   P+FHEGSKG+
Sbjct: 139 IEIETEEDDLSLPVPEGTRCKRTTCGAIWEGEEISRGNGIKSKCKYHPQPPIFHEGSKGY 198

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
            CC R+VLEF+EF+KI+GC +G HLFVGS K  K   +E V+CR D YQTP  + +S FA
Sbjct: 199 LCCKRRVLEFDEFMKIQGCTEGNHLFVGSDKGEK---EERVECRLDHYQTPMQVHVSAFA 255

Query: 176 KKVDKQNSSVTFREKEVMICLYKKG 200
           K  DK  S VTF  +++ + L+  G
Sbjct: 256 KGADKNKSKVTFETQQLHLDLFLPG 280



>gi|321252979|ref|XP_003192584.1| hypothetical protein CGB_C1210W [Cryptococcus gattii WM276]
 gi|317459053|gb|ADV20797.1| conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 377

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 92/134 (68%), Gaps = 2/134 (1%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DDL+ PV     CKR +CG  +  +  SRGEG +A C YH    +FHEGSKG+ CC R+V
Sbjct: 157 DDLSAPVPDGARCKRLACGATWEGEQVSRGEGEKAVCRYHPQPAIFHEGSKGYLCCKRRV 216

Query: 123 LEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQN 182
           LEF+EF+KI GCK+GKHLFVGS K+    ++E+V CR D YQTPT +I+S FAK  DK  
Sbjct: 217 LEFDEFMKIPGCKEGKHLFVGSKKD--ETKEEVVNCRLDHYQTPTQVIVSAFAKGADKSR 274

Query: 183 SSVTFREKEVMICL 196
           S++TF  + + + L
Sbjct: 275 STITFTPQTLSLDL 288



>gi|336367710|gb|EGN96054.1| hypothetical protein SERLA73DRAFT_58926 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 341

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 97/148 (65%), Gaps = 6/148 (4%)

Query: 54  APIEKEP---EEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFH 109
           AP E  P   EEDDL++PV +   C+   CG  +V D  +R G G EA C YH  +P+F 
Sbjct: 114 APKEPAPVVEEEDDLSVPVQTGAPCRHTGCGVAFVSDEVNRIGNGEEATCTYHPASPIFR 173

Query: 110 EGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHI 169
           EGSKG+ CC R+VLEFEEFLKI+GCK+G+H+FV   K      +E  +CR D YQTP+ +
Sbjct: 174 EGSKGYLCCKRRVLEFEEFLKIEGCKRGRHVFV--PKVSNKAAEEFTECRVDHYQTPSEV 231

Query: 170 IMSIFAKKVDKQNSSVTFREKEVMICLY 197
            +S+FAK+VDK+ S+V   E +V   LY
Sbjct: 232 HVSVFAKQVDKERSTVRIEENKVHFDLY 259



>gi|402225636|gb|EJU05697.1| chord-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 360

 Score =  145 bits (367), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 111/187 (59%), Gaps = 11/187 (5%)

Query: 27  GVEIYDSG---PKISYTQTISKTITEEPKLA-----PIEKEPEEDDLNIPVASDTECKRP 78
           G E+Y +    P ++   ++ K +   PK       P+  E E+D+  + V   T+CKR 
Sbjct: 89  GKEVYTTAAASPTLAAQTSLPKPVPAVPKAPKEPAKPVPIEIEDDEPGVKVEPGTKCKRN 148

Query: 79  SCGKKYVDDATSRGEG-PEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKG 137
            C   YVDD T R EG  EA C++H   P+FHEGSKG+ CC R+VLEF+EFL+I GC  G
Sbjct: 149 GCNAVYVDDETHRTEGGKEAVCVFHPAPPIFHEGSKGYMCCKRRVLEFDEFLRITGCTTG 208

Query: 138 KHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLY 197
           KHLFVG  K     E+E+VQCR D YQTP  + +S+FAKK  K+ S V F E+ V + L+
Sbjct: 209 KHLFVGKPKS-PEAEEELVQCRIDHYQTPKTVQVSVFAKKTGKE-SMVRFGEQSVELDLH 266

Query: 198 KKGRNIY 204
              R  +
Sbjct: 267 LPERKRF 273



>gi|401888408|gb|EJT52366.1| hypothetical protein A1Q1_04577 [Trichosporon asahii var. asahii
           CBS 2479]
          Length = 361

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 84/192 (43%), Positives = 106/192 (55%), Gaps = 21/192 (10%)

Query: 25  ENGVEIYDSGPKISYTQTISKTITEEP------------KLAPIEKEPEEDDLNIPVASD 72
           + GVE Y S P  +          EEP            K  P  +  EEDD +IPV   
Sbjct: 89  KGGVETYGSAPATAPASGTGTPAPEEPADQTPAVTVATQKQEPEPQVEEEDDPDIPVPDG 148

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
             CK   C   +     SRG+GPEA C YH   P+FHEGSKG+ CC R+VLEF++FLKI 
Sbjct: 149 AHCKHLGCNAVWKGQDISRGDGPEAVCTYHPQKPIFHEGSKGYLCCKRRVLEFDDFLKIP 208

Query: 133 GCKKGKHLFVG---SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
           GC KGKHLFVG   SG+E      E+V+ R D YQTPT + +S++AK VDK  S VTF  
Sbjct: 209 GCTKGKHLFVGPKPSGRE------ELVEARVDHYQTPTEVFVSVYAKGVDKATSKVTFGP 262

Query: 190 KEVMICLYKKGR 201
           + + + L+  G 
Sbjct: 263 QSIDLDLHLPGN 274



>gi|345562204|gb|EGX45276.1| hypothetical protein AOL_s00173g377 [Arthrobotrys oligospora ATCC
           24927]
          Length = 326

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 103/173 (59%), Gaps = 4/173 (2%)

Query: 43  ISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           IS+        AP E+ PEED+  + V +  +CKR  C   YV +  SR  G    C++H
Sbjct: 111 ISQARINPQPAAPKEQVPEEDEPGVTVPAGAKCKRNGCEITYVSEEESRKPG---SCVHH 167

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G  +FHEGSKGWSCC R+VLEF EFLKI GC +G H +VG+ K+ +   +EIV CR D+
Sbjct: 168 PGVAIFHEGSKGWSCCKRRVLEFSEFLKIGGCSEGNHCYVGTQKKDEAGGEEIVTCRTDF 227

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIYYMFYLNSYFYI 215
           YQT T+I  SIF KK DK  S++TFR  E+ + L K   N  Y   +  Y  I
Sbjct: 228 YQTYTNINASIFLKKTDKDKSTITFRPTEIDVDL-KTTDNKRYQTTIPLYATI 279



 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 39/69 (56%), Gaps = 8/69 (11%)

Query: 71  SDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLK 130
           S  +C    CGK + D        PE EC +H G PVFHEG KGW CC  +VL F+EFL 
Sbjct: 2   SSQKCTHQGCGKTFSD--------PEEECCFHPGPPVFHEGQKGWKCCKPRVLTFDEFLT 53

Query: 131 IKGCKKGKH 139
           I  C  G+H
Sbjct: 54  IPPCATGRH 62



>gi|409045989|gb|EKM55469.1| hypothetical protein PHACADRAFT_94710 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 343

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/139 (52%), Positives = 90/139 (64%), Gaps = 2/139 (1%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           DDL++ V   T C+   CGK ++    SR GEG EA CIYH   P+FHEGSKG+ CC R+
Sbjct: 124 DDLSVDVPVGTACRHKGCGKTFISSEVSRLGEGEEAVCIYHPKQPIFHEGSKGYLCCRRR 183

Query: 122 VLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           VLEFEEFLKI+GCK+GKHLF    K   N E+E V CR D YQTPT I +S+FAK+ D+ 
Sbjct: 184 VLEFEEFLKIEGCKRGKHLFAPKDKP-SNQEEEHVTCRIDHYQTPTEIHVSVFAKQADRD 242

Query: 182 NSSVTFREKEVMICLYKKG 200
            S+V     E+   L   G
Sbjct: 243 RSAVKIASNEIAFDLVLPG 261



>gi|406696457|gb|EKC99745.1| hypothetical protein A1Q2_05966 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 362

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 109/193 (56%), Gaps = 22/193 (11%)

Query: 25  ENGVEIYDSGPKIS-------------YTQTISKTITEEPKLAPIEKEPEEDDLNIPVAS 71
           + GVE Y S P  +               QT + T+  + +  P  +  EEDD +IPV  
Sbjct: 89  KGGVETYGSAPATAPASGTGTPAPEEPANQTPAVTVATQKQPEPEPQVEEEDDPDIPVPD 148

Query: 72  DTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKI 131
              CK   C   +     SRG+GPEA C YH   P+FHEGSKG+ CC R+VLEF++FLKI
Sbjct: 149 GAHCKHLGCNAVWKGQDISRGDGPEAVCTYHPQKPIFHEGSKGYLCCKRRVLEFDDFLKI 208

Query: 132 KGCKKGKHLFVG---SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
            GC KGKHLFVG   SGKE      E+V+ R D YQTPT + +S++AK VDK  S VTF 
Sbjct: 209 PGCTKGKHLFVGPKPSGKE------ELVEARVDHYQTPTEVFVSVYAKGVDKATSKVTFG 262

Query: 189 EKEVMICLYKKGR 201
            + + + L+  G 
Sbjct: 263 PQSIDLDLHLPGN 275



>gi|58265466|ref|XP_569889.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134108963|ref|XP_776596.1| hypothetical protein CNBC0890 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259276|gb|EAL21949.1| hypothetical protein CNBC0890 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57226121|gb|AAW42582.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 375

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 104/183 (56%), Gaps = 23/183 (12%)

Query: 26  NGVEIYDSGPKISYTQT-----ISKTITEEPKLAP------IEKEPE----------EDD 64
           +GVE Y +    +   T     IS T T  P   P         +P           +DD
Sbjct: 97  DGVETYGTAAPTAKLPTAESSKISNTATSAPSSVPSALTAVTPSQPNKEHKEVKEEEQDD 156

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
            ++PV     CKR +CG  +  +  SRG+G +A C YH    +FHEGSKG+ CC R+VLE
Sbjct: 157 PSVPVPEGARCKRLACGATWEGEEVSRGDGEKAVCRYHPQAAIFHEGSKGYLCCKRRVLE 216

Query: 125 FEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSS 184
           F+EF+KI GCK+GKHLF+G  K+    ++E+V CR D YQTPT +I+S FAK  DK  S+
Sbjct: 217 FDEFMKIPGCKEGKHLFMGPKKD--ETKEEVVNCRLDHYQTPTQVIVSAFAKGADKSRST 274

Query: 185 VTF 187
           +TF
Sbjct: 275 ITF 277



>gi|425779334|gb|EKV17401.1| hypothetical protein PDIG_15250 [Penicillium digitatum PHI26]
 gi|425779619|gb|EKV17664.1| hypothetical protein PDIP_30770 [Penicillium digitatum Pd1]
          Length = 311

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 111/176 (63%), Gaps = 14/176 (7%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           IS T TI+   T  P   P+  EPE DD ++ + ++  C+R SCG  Y   +T+R E   
Sbjct: 94  ISATPTIA---TAAPPAKPVIDEPESDDPDVEIPANATCRRRSCGASYTG-STARDE--- 146

Query: 97  AECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEI 155
            +C++H G PVFHEGSKGWSCC R+VLEF+EFLKI GC +K +H+FVG  K     E+++
Sbjct: 147 EKCVHHPGQPVFHEGSKGWSCCKRRVLEFDEFLKIPGCTEKTRHMFVGKAKPAG--EEKV 204

Query: 156 VQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL----YKKGRNIYYMF 207
              R+D+YQTPT + +S++ KK+DKQ + V F    ++  L     K+ ++ Y +F
Sbjct: 205 DSVRNDFYQTPTAVNVSLYLKKIDKQRAKVQFAANSIIFDLPTTDNKRYQDTYSLF 260



 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   +CGK + D        PE +C+YH G PVFHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCIHKACGKTFTD--------PEEDCVYHPGPPVFHEGQKGWKCCKPRVLTFEEFLGIPP 55

Query: 134 CKKGKHLFV 142
           C  GKH  V
Sbjct: 56  CTTGKHSTV 64



>gi|384501633|gb|EIE92124.1| hypothetical protein RO3G_16835 [Rhizopus delemar RA 99-880]
          Length = 339

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/132 (53%), Positives = 91/132 (68%), Gaps = 8/132 (6%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CKR  CG  + D   SRG  P+A+C YH G P+FHEGSKGWSCCSRKVL+F+EFLKI+
Sbjct: 138 TICKRRGCGHVFKDQEISRG--PDAKCRYHPGAPIFHEGSKGWSCCSRKVLDFDEFLKIE 195

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEV 192
           GCK+G+H+FV       N  +E+V CR DWYQT T++I SIFAK  +K+++ V F E  +
Sbjct: 196 GCKEGRHVFVSKS----NNGEEMVDCRTDWYQTQTNVIFSIFAK--NKEDTQVKFNENSI 249

Query: 193 MICLYKKGRNIY 204
            I +  KG   Y
Sbjct: 250 DIDIKMKGNKRY 261



>gi|443920789|gb|ELU40630.1| CHORD domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 319

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 95/144 (65%), Gaps = 2/144 (1%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSK 113
           P E   +EDD ++ VA  T CKRP C K +V D  SR G+G +A+C YH+  P+FHEGSK
Sbjct: 94  PAEIIEDEDDPSVAVAPGTLCKRPGCRKPFVSDEESRQGDGEDAQCKYHANQPLFHEGSK 153

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           G+ CC + VL+F++FL I GCK GKH+F    +  K  E EIV+ R D YQTPT + +SI
Sbjct: 154 GYVCCKKHVLDFDDFLAIPGCKTGKHVFAPKARADKPTE-EIVKSRIDHYQTPTEVRVSI 212

Query: 174 FAKKVDKQNSSVTFREKEVMICLY 197
           +AK+ D+  S+V     +++I L+
Sbjct: 213 YAKQADQSRSTVVLETDKIIIDLF 236



>gi|403412626|emb|CCL99326.1| predicted protein [Fibroporia radiculosa]
          Length = 348

 Score =  140 bits (352), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 109/178 (61%), Gaps = 18/178 (10%)

Query: 36  KISYTQTISKTITEEPK---LAPIEKEP------------EEDDLNIPVASDTECKRPSC 80
           K++ +QTI++T    P    + P++ +P            +EDDL++PV   T CKR  C
Sbjct: 86  KMTESQTITETYVSGPSESAMPPLKAQPPVTTAPPAPVVEDEDDLSVPVQPGTSCKRNGC 145

Query: 81  GKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKH 139
              +  D  +R G+GP A C YH  TP+FHEGSKG+ CC R+VLEF+EFLKI+GCK G+H
Sbjct: 146 KTVFESDDINRVGDGPGALCTYHPKTPIFHEGSKGYLCCKRRVLEFDEFLKIEGCKTGRH 205

Query: 140 LFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLY 197
           +FV   +E ++  ++   CR D YQTP  + +S+FAKK D+  S+V   E  + + LY
Sbjct: 206 VFVPINRESES--EQFTDCRIDHYQTPREVHVSVFAKKADEGRSTVKIEENAIHLDLY 261



 Score = 72.0 bits (175), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 43/69 (62%), Gaps = 10/69 (14%)

Query: 75  CKRPSCGKKY-VDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCS---RKVLEFEEFLK 130
           C R  CGK Y V+D  S G      C YH G P+FHEG K WSCCS   + VL+F+EF+K
Sbjct: 4   CTRRGCGKDYNVEDNASDG------CTYHPGGPIFHEGLKSWSCCSDVNKPVLDFDEFMK 57

Query: 131 IKGCKKGKH 139
           + GC +G H
Sbjct: 58  LPGCARGPH 66



>gi|389749377|gb|EIM90554.1| hypothetical protein STEHIDRAFT_50891 [Stereum hirsutum FP-91666
           SS1]
          Length = 337

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/140 (48%), Positives = 94/140 (67%), Gaps = 2/140 (1%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           EDDL+ PV   T+CK   C  +YV D  +R G+G  A C YH  +P+FHEGSKG+ CC R
Sbjct: 126 EDDLDAPVPPGTKCKHNGCDIEYVSDEENRKGDGEGAICTYHPQSPIFHEGSKGYLCCKR 185

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           +VLEF+EFLKI+GCKKG+H+FV    +   V+ E+V CR D YQTP+ + +S+FAK+ D 
Sbjct: 186 RVLEFDEFLKIEGCKKGRHVFVPKKSDEDEVQ-ELVNCRIDHYQTPSAVHVSVFAKQADS 244

Query: 181 QNSSVTFREKEVMICLYKKG 200
             S V F + ++ + L+  G
Sbjct: 245 SRSVVRFEQDQIHLDLFLPG 264



>gi|472587860|gb|EMS25356.1| CORD and CS domain containing protein [Rhodosporidium toruloides
           NP11]
          Length = 356

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 94/144 (65%), Gaps = 6/144 (4%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           E+DD  + V     CKR +CGK+Y  +   R EG   EC YH+G P+FHEGSKG+SCC R
Sbjct: 138 EQDDPEVEVKKGMRCKRRACGKEY--EGEDRQEG---ECKYHAGVPIFHEGSKGYSCCKR 192

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           +VLEF+EFL+I+GC+ G+HLFVG+ KE    E E+V  R D YQTP  +I+S+F K+ DK
Sbjct: 193 RVLEFDEFLRIEGCRTGRHLFVGAKKEDDGKE-ELVDLRTDHYQTPRQVIVSVFGKQADK 251

Query: 181 QNSSVTFREKEVMICLYKKGRNIY 204
           + S V F  + + + L    R  +
Sbjct: 252 EASVVKFESEAMHVDLVLPSRKRF 275



>gi|255936493|ref|XP_002559273.1| Pc13g08480 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583893|emb|CAP91917.1| Pc13g08480 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 312

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 110/176 (62%), Gaps = 14/176 (7%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           IS T TI+   T  P   P+ +EPE DD ++ + ++  C+R  CG  Y   +T R E   
Sbjct: 95  ISATPTIA---TAAPPEKPVIEEPESDDPDVEIPANATCRRRGCGASYTG-STVRDE--- 147

Query: 97  AECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEI 155
            +C++H G PVFHEGSKGWSCC R+VLEF+EFLKI GC +K +H+FVG  K     E+++
Sbjct: 148 EKCVHHPGQPVFHEGSKGWSCCKRRVLEFDEFLKIPGCTEKKRHMFVGKAKPPG--EEKV 205

Query: 156 VQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL----YKKGRNIYYMF 207
              R+D+YQTPT + +S++ KK+DKQ + V F    ++  L     K+ ++ Y +F
Sbjct: 206 DTVRNDFYQTPTAVNVSLYLKKIDKQRAKVEFAANSIIFDLPTTDNKRYQDTYPLF 261



 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   +CGK + D        PE +C+YH G PVFHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCVHKACGKTFTD--------PEEDCVYHPGPPVFHEGQKGWKCCKPRVLTFEEFLAIPP 55

Query: 134 CKKGKHLFV 142
           C  GKH  V
Sbjct: 56  CTTGKHSTV 64



>gi|331243814|ref|XP_003334549.1| hypothetical protein PGTG_15978 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309313539|gb|EFP90130.1| hypothetical protein PGTG_15978 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 348

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 109/183 (59%), Gaps = 8/183 (4%)

Query: 35  PKISYTQTISKTITEEPKL--APIEKEPE-EDDLNIPVASDTECKRPSCGKKYVDDAT-S 90
           P    TQ + + I  E  +   P+  +PE +DD    V   ++CKR +CG  +       
Sbjct: 108 PTHQTTQDVFQPIKPEQAIESQPVIPKPELQDDPESIVTEGSKCKRLACGITWHGLGNCK 167

Query: 91  RGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKN 150
           RGE  + EC YH GTPVFHEGSKG+SCC R+VL+F++FL+++GCKK  HLF        N
Sbjct: 168 RGELDKEECTYHPGTPVFHEGSKGYSCCKRRVLDFDDFLRLRGCKKSSHLFTEVSGSTMN 227

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL----YKKGRNIYYM 206
            ++E V+ R D+YQTPT +I+SIFAKKVD++ S + F    V + L     K+ R  + +
Sbjct: 228 DQEESVESRFDFYQTPTSVIVSIFAKKVDQEKSLIKFNTSTVDVDLKLPSNKRFRRTFNL 287

Query: 207 FYL 209
           F L
Sbjct: 288 FGL 290



 Score = 72.0 bits (175), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 51/86 (59%), Gaps = 18/86 (20%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC---SRKVLEFEEFLKI 131
           C R  CGKK+  D   +     +EC++H G PVFHEG K WSCC   ++ V+EF++F+KI
Sbjct: 4   CTRLGCGKKFDPDHNLK-----SECVFHPGQPVFHEGLKSWSCCKEMNKPVMEFDQFMKI 58

Query: 132 KGCKKGKHLFVGSGKEVKNVEKEIVQ 157
           +GC  G H          ++EK +VQ
Sbjct: 59  EGCATGVH----------SLEKPVVQ 74



>gi|121701713|ref|XP_001269121.1| CORD and CS domain protein [Aspergillus clavatus NRRL 1]
 gi|119397264|gb|EAW07695.1| CORD and CS domain protein [Aspergillus clavatus NRRL 1]
          Length = 316

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 106/171 (61%), Gaps = 11/171 (6%)

Query: 42  TISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIY 101
            IS  I      AP+ +E E DD ++ ++++T C+R  C   Y   A+      E +C++
Sbjct: 101 AISPAIAPPSTAAPVAEESESDDPSLEISANTTCRRRGCNAGYNPSASRD----EEKCVH 156

Query: 102 HSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRH 160
           H G P+FHEGSKGWSCC ++VLEF+EFLKI+GCK K KHLF+G GK     E+++   R+
Sbjct: 157 HPGQPIFHEGSKGWSCCKKRVLEFDEFLKIQGCKEKKKHLFIGKGKPPG--EEKVETVRN 214

Query: 161 DWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL----YKKGRNIYYMF 207
           D+YQTP+ + +S++ KK+DK N+ V F    V   L     K+ ++ Y +F
Sbjct: 215 DFYQTPSTVNVSLYLKKIDKDNAKVNFAPTSVEFDLPTTDNKRYKDTYPLF 265



 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK++ D         + +C+YH G PVFHEG KGW CC  +VL FEEFL+I 
Sbjct: 3   SKCVHKGCGKEFTDA--------DEQCVYHPGPPVFHEGQKGWKCCKPRVLTFEEFLEIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|170094796|ref|XP_001878619.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647073|gb|EDR11318.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 344

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 104/170 (61%), Gaps = 10/170 (5%)

Query: 36  KISYTQTISKTIT--EEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           K +Y  T+ ++ T    P  API +E  EDDL I V+  T C+R  C  K+++     G+
Sbjct: 94  KETYGTTLQRSTTPASAPVAAPIVEE--EDDLTIQVSVGTPCRRKGCETKFINRI---GD 148

Query: 94  GPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGK---EVKN 150
              A CIYH   P+F EGSKG+ CC R+VLEF+EFLKIKGCKKG+HLF    +     K 
Sbjct: 149 EEGAVCIYHPAPPIFREGSKGYLCCKRRVLEFDEFLKIKGCKKGRHLFSPPPELKVTFKK 208

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKG 200
             +E+V CR D YQT   + +SIFAK+VDK  S+V F E EV + L+  G
Sbjct: 209 DTEELVTCRVDHYQTIEQVHVSIFAKQVDKDRSTVQFFESEVTLDLFLPG 258



>gi|408398874|gb|EKJ78000.1| hypothetical protein FPSE_01788 [Fusarium pseudograminearum CS3096]
          Length = 316

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 95/140 (67%), Gaps = 6/140 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD ++ +A    CKR +CG  Y   ++   E    EC++H G P+FHEGSKG+SCC
Sbjct: 113 ESEDDDPSLEIADGVGCKRRACGATYKKSSSRDNE----ECVHHPGVPIFHEGSKGYSCC 168

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIV-QCRHDWYQTPTHIIMSIFAK 176
            R+VLEF++F+KI+GCK K KHLFVGSGK+     +E+V   RHD+YQTP ++I S F K
Sbjct: 169 KRRVLEFDQFMKIEGCKTKDKHLFVGSGKKDDTTSEEVVSNVRHDFYQTPVNVIASFFLK 228

Query: 177 KVDKQNSSVTFREKEVMICL 196
           K+DK  + +  + K++ + L
Sbjct: 229 KIDKGTAKIELQPKQLNLDL 248



>gi|342876141|gb|EGU77799.1| hypothetical protein FOXB_11663 [Fusarium oxysporum Fo5176]
          Length = 621

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 101/173 (58%), Gaps = 18/173 (10%)

Query: 38  SYTQTISKTITEEPKLAPI------------EKEPEEDDLNIPVASDTECKRPSCGKKYV 85
           +  Q I       P  API              E E+DD ++ +A    CKR +CG  Y 
Sbjct: 385 ALAQKIDALNAATPSRAPIPTAQHAPTPPPPAPESEDDDPSLEIADGVGCKRRACGATYK 444

Query: 86  DDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGS 144
             ++   E    EC++H G P+FHEGSKG+SCC R+VLEF++F+KI+GCK K +HLFVGS
Sbjct: 445 KGSSRDDE----ECVHHPGVPIFHEGSKGYSCCKRRVLEFDQFMKIEGCKTKNRHLFVGS 500

Query: 145 G-KEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           G K+  N E+ +   RHD+YQTP ++I S F KK+DK  + +    K++ + L
Sbjct: 501 GKKDGANSEEVVSNVRHDFYQTPVNVIASFFLKKIDKSTAKIELEPKQLSLDL 553



>gi|46108680|ref|XP_381398.1| hypothetical protein FG01222.1 [Fusarium graminearum PH-1]
          Length = 316

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 95/140 (67%), Gaps = 6/140 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD ++ +A    CKR +CG  Y   ++   E    EC++H G P+FHEGSKG+SCC
Sbjct: 113 ESEDDDPSLEIADGVGCKRRACGATYKKSSSRDNE----ECVHHPGVPIFHEGSKGYSCC 168

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIV-QCRHDWYQTPTHIIMSIFAK 176
            R+VLEF++F+KI+GCK K KHLFVGSGK+     +E+V   RHD+YQTP ++I S F K
Sbjct: 169 KRRVLEFDQFMKIEGCKTKDKHLFVGSGKKDDATSEEVVSNVRHDFYQTPVNVIASFFLK 228

Query: 177 KVDKQNSSVTFREKEVMICL 196
           K+DK  + +  + K++ + L
Sbjct: 229 KIDKGTAKIELQPKQLNLDL 248



>gi|38489215|gb|AAR21293.1| ChpA [Emericella nidulans]
 gi|38532003|gb|AAR23267.1| diploid state maintenance protein chpA [Emericella nidulans]
          Length = 315

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 112/191 (58%), Gaps = 16/191 (8%)

Query: 24  VENGVEIYDSG-PK-ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCG 81
           V   V + DSG P+ ++++  I           P+ +EPE DD  + +  +  C+R  CG
Sbjct: 83  VAAPVPVRDSGVPRPVAHSPAIPPPSNAP---TPVPEEPESDDPELAIPENATCRRRGCG 139

Query: 82  KKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC-KKGKHL 140
             Y  D +      E  C+YH G PVFHEGSKGWSCC R+VLEF+EFLKI+GC +K +HL
Sbjct: 140 GTYKPDVSRD----EERCVYHPGQPVFHEGSKGWSCCKRRVLEFDEFLKIEGCAEKKRHL 195

Query: 141 FVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL---- 196
           FVG GK     E+++   R+D+YQT T + +S++ KK+DK N+ V F    + + L    
Sbjct: 196 FVGKGKPAG--EEKVESVRNDFYQTATSVNVSLYLKKIDKDNAKVEFTSTGIALDLPTTD 253

Query: 197 YKKGRNIYYMF 207
            K+ ++ Y +F
Sbjct: 254 NKRYKDSYELF 264



>gi|70995530|ref|XP_752520.1| CORD and CS domain protein [Aspergillus fumigatus Af293]
 gi|41581230|emb|CAE47879.1| chord containing protein homologue, putative [Aspergillus
           fumigatus]
 gi|66850155|gb|EAL90482.1| CORD and CS domain protein [Aspergillus fumigatus Af293]
 gi|159131275|gb|EDP56388.1| CORD and CS domain protein [Aspergillus fumigatus A1163]
          Length = 314

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 71/158 (44%), Positives = 103/158 (65%), Gaps = 11/158 (6%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P  ++ EEDD  + + ++  C+R  C K Y D + SR E    +C+YH G P+FHEGSKG
Sbjct: 112 PAVEDTEEDDPALEIPANATCRRRGCNKGY-DPSISRDE---EKCVYHPGQPIFHEGSKG 167

Query: 115 WSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC R+VLEF+EF+KI+GCK K +HLFVG GK     E+++   R+D+YQTP+ + +S+
Sbjct: 168 WSCCKRRVLEFDEFMKIQGCKEKTRHLFVGKGKPAG--EEKVETVRNDFYQTPSTVNVSL 225

Query: 174 FAKKVDKQNSSVTFREKEVMICL----YKKGRNIYYMF 207
           + KK+DK N+ VTF    V   L     K+ ++ Y +F
Sbjct: 226 YLKKIDKDNAKVTFSSTSVEFDLPTTDNKRYKDTYPLF 263



 Score = 75.9 bits (185), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK++ D        P+ +C+YH G PVFHEG KGW CC  +VL FEEFL I 
Sbjct: 3   SKCVHKGCGKEFTD--------PDEDCLYHPGPPVFHEGQKGWKCCKTRVLTFEEFLTIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|358388785|gb|EHK26378.1| hypothetical protein TRIVIDRAFT_86413 [Trichoderma virens Gv29-8]
          Length = 318

 Score =  135 bits (340), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 95/136 (69%), Gaps = 10/136 (7%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L+IP  +D  C+R +CG KY   A+   E    +C++H G P+FHEGSKG+SCC R+VLE
Sbjct: 121 LDIPDGAD--CRRKACGAKYSKGASREDE----QCVHHPGVPIFHEGSKGYSCCKRRVLE 174

Query: 125 FEEFLKIKGCK-KGKHLFVGSGKEVK---NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           F+EF+KI GCK K KHLF+GSGK+ K     E+ +   RHD+YQTPT +I S+F KK++K
Sbjct: 175 FDEFMKIVGCKTKDKHLFIGSGKKDKAEAGNEEILTTVRHDFYQTPTQVIASLFLKKINK 234

Query: 181 QNSSVTFREKEVMICL 196
           + + V F+ KE+ + L
Sbjct: 235 EIAKVVFKAKEIDLDL 250



>gi|340517392|gb|EGR47636.1| predicted protein [Trichoderma reesei QM6a]
          Length = 319

 Score =  135 bits (340), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 110/191 (57%), Gaps = 27/191 (14%)

Query: 24  VENGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPE--------------EDDLNIPV 69
           VE G + +D     +  Q IS+     P   PI+                  +  L+IP 
Sbjct: 70  VEEGPQQFDEA---ALAQKISEASVSAPTRRPIQPAQHVPTPPPPPPDSEDDDPSLDIPD 126

Query: 70  ASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
            +  EC+R +C  KY   +   GE    +C++H G P+FHEGSKG+SCC R+VLEF++F+
Sbjct: 127 GA--ECRRKACSAKYKKGSAREGE----KCVHHPGVPIFHEGSKGYSCCKRRVLEFDQFM 180

Query: 130 KIKGCK-KGKHLFVGSGKEVK---NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSV 185
           KI+GCK K KHLFVGSGK+ K     E+ +   RHD+YQTPT +I S+F KK++K  S V
Sbjct: 181 KIEGCKTKDKHLFVGSGKKDKAESGSEEILTTVRHDFYQTPTQVIASLFLKKINKDTSKV 240

Query: 186 TFREKEVMICL 196
             +EKEV + L
Sbjct: 241 DIKEKEVDLDL 251



>gi|296417140|ref|XP_002838219.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634141|emb|CAZ82410.1| unnamed protein product [Tuber melanosporum]
          Length = 326

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 94/140 (67%), Gaps = 5/140 (3%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           EK  E+DD ++P      C+R  C   Y  D  SR E  + +C +H G P+FHEGSKG+S
Sbjct: 127 EKPLEQDDPSVPAPPGARCRRLGCEATY--DGGSR-EDEDEKCEFHPGVPIFHEGSKGYS 183

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC R+VLEF++FLKI GC   +HLFVG+ K     ++E+V CR+D+YQT T +I+SIFAK
Sbjct: 184 CCKRRVLEFDQFLKIPGCATDRHLFVGAPK--PGDDEELVSCRNDFYQTYTDVIVSIFAK 241

Query: 177 KVDKQNSSVTFREKEVMICL 196
           KVDK  + V F EK++ + L
Sbjct: 242 KVDKTRAEVHFSEKQLDVDL 261



 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 37/65 (56%), Gaps = 8/65 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK + D        PE EC YH G P+FHEG KGW CC  +VL F+EFL I  C
Sbjct: 5   CAHKGCGKTFTD--------PEEECHYHPGAPIFHEGQKGWQCCKTRVLTFDEFLTIPPC 56

Query: 135 KKGKH 139
             GKH
Sbjct: 57  SVGKH 61



>gi|475664532|gb|EMT62327.1| Cysteine and histidine-rich domain-containing protein [Fusarium
           oxysporum f. sp. cubense race 4]
          Length = 336

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 101/173 (58%), Gaps = 18/173 (10%)

Query: 38  SYTQTISKTITEEPKLAPI------------EKEPEEDDLNIPVASDTECKRPSCGKKYV 85
           +  Q I       P  API              E E+DD ++ +A    CKR +CG  Y 
Sbjct: 100 ALAQKIDALNAATPSRAPIPTAQHAPTPPPPAPESEDDDPSLEIADGVGCKRRACGATYK 159

Query: 86  DDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGS 144
             ++   E    EC++H G P+FHEGSKG+SCC R+VLEF++F+KI+GCK K +HLFVGS
Sbjct: 160 KGSSRDDE----ECVHHPGVPIFHEGSKGYSCCKRRVLEFDQFMKIEGCKTKNRHLFVGS 215

Query: 145 G-KEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           G K+  N E+ +   RHD+YQTP ++I S F KK+DK  + +    K++ + L
Sbjct: 216 GKKDGANSEEVVSNVRHDFYQTPVNVIASFFLKKIDKSTAKIELEPKQLNLDL 268



>gi|400601428|gb|EJP69071.1| copper amine oxidase [Beauveria bassiana ARSEF 2860]
          Length = 983

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 89/128 (69%), Gaps = 10/128 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R +CGK Y   A   GE     C+YH G P+FHEGSKG+SCC R+VLEF++F+KI+GC
Sbjct: 792 CRRRTCGKTYTKGAAREGE----SCVYHPGAPIFHEGSKGYSCCKRRVLEFDQFMKIEGC 847

Query: 135 -KKGKHLFVGSGKEVK-----NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
             K +HLF+GSGK+ K     + E+++   RHD+YQTP ++I S F KK++K+ + V FR
Sbjct: 848 ASKDRHLFIGSGKKNKGGSGSSGEEKLETVRHDFYQTPANVIASFFLKKINKEAAKVEFR 907

Query: 189 EKEVMICL 196
           +K V + L
Sbjct: 908 DKVVALDL 915



>gi|119495659|ref|XP_001264609.1| CORD and CS domain protein [Neosartorya fischeri NRRL 181]
 gi|119412771|gb|EAW22712.1| CORD and CS domain protein [Neosartorya fischeri NRRL 181]
          Length = 314

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/159 (42%), Positives = 105/159 (66%), Gaps = 11/159 (6%)

Query: 54  APIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSK 113
            P+ ++ E+DD ++ + ++  C+R  C K Y + + SR E    +C+YH G P+FHEGSK
Sbjct: 111 TPVVEDTEDDDPSLEIPANATCRRRGCNKGY-NPSISRDE---EKCVYHPGQPIFHEGSK 166

Query: 114 GWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMS 172
           GWSCC R+VLEF+EF+KI+GCK K +HLFVG G+     E+++   R+D+YQTP+ + +S
Sbjct: 167 GWSCCKRRVLEFDEFMKIQGCKEKTRHLFVGKGRPAG--EEKVQTVRNDFYQTPSTVNVS 224

Query: 173 IFAKKVDKQNSSVTFREKEVMICL----YKKGRNIYYMF 207
           ++ KK+DK N+ VTF    V   L     K+ ++ Y +F
Sbjct: 225 LYLKKIDKDNAKVTFSSTSVEFDLPTTDNKRYKDTYPLF 263



 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK++ D        P+ +C+YH G PVFHEG KGW CC  +VL FEEFL I 
Sbjct: 3   SKCVHKGCGKEFTD--------PDEDCLYHPGPPVFHEGQKGWKCCKTRVLTFEEFLTIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|302692292|ref|XP_003035825.1| hypothetical protein SCHCODRAFT_105310 [Schizophyllum commune H4-8]
 gi|300109521|gb|EFJ00923.1| hypothetical protein SCHCODRAFT_105310, partial [Schizophyllum
           commune H4-8]
          Length = 331

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 87/137 (63%), Gaps = 2/137 (1%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCS 119
           EEDDL+ PV S T C+   C   +V D  +R G+G    C YH G P+FHEGSKG+ CC 
Sbjct: 119 EEDDLSAPVPSGTVCRHKGCNTVFVSDEVNRQGDGEGTICTYHPGVPIFHEGSKGYLCCK 178

Query: 120 RKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVD 179
           R+VLEF+EFLKI+GCKKG+H+FV        VE E   CR D YQT   + +S+F KK D
Sbjct: 179 RRVLEFDEFLKIEGCKKGRHVFVPKKDPSAPVE-EQTDCRVDHYQTADKVYVSVFGKKAD 237

Query: 180 KQNSSVTFREKEVMICL 196
           K  SSV F  ++V I L
Sbjct: 238 KDKSSVKFEPEKVHIDL 254



>gi|326479168|gb|EGE03178.1| diploid state maintenance protein chpA [Trichophyton equinum CBS
           127.97]
          Length = 322

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (67%), Gaps = 7/130 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYSGSGSREGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRTDYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTF 187
           +DK+ + V F
Sbjct: 237 IDKEAAKVDF 246



>gi|326475808|gb|EGD99817.1| CORD and CS domain-containing protein [Trichophyton tonsurans CBS
           112818]
          Length = 322

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (67%), Gaps = 7/130 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYSGSGSREGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRTDYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTF 187
           +DK+ + V F
Sbjct: 237 IDKEAAKVDF 246



>gi|453088822|gb|EMF16862.1| chord-domain-containing protein [Mycosphaerella populorum SO2202]
          Length = 325

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 102/174 (58%), Gaps = 17/174 (9%)

Query: 28  VEIYDSGPKISYTQ---TISKTITEEPKLAPIEK--------EPEEDDLNIPVASDTECK 76
            +I  + P  + TQ    +   ++  P  AP  +        E E+DD +IP+     CK
Sbjct: 82  AQIRKAAPTPTPTQDESALPPPVSRAPLAAPTARASTTPAPPEDEDDDPSIPIPQGATCK 141

Query: 77  RPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK- 135
           R SCG  Y D     GE    EC++H G  +FHEGSKGW+CC R+VLEF++F+KI GC+ 
Sbjct: 142 RKSCGVVYQDGKDREGE----ECVHHPGQALFHEGSKGWTCCKRRVLEFDQFMKIAGCRT 197

Query: 136 KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
           K +HLFVG  K   + E+ + + R+D+YQT T +I S++ KK+DK+ S V F E
Sbjct: 198 KSRHLFVGRAK-APDEEEALKEVRNDFYQTATSVIASLYLKKIDKERSKVIFDE 250



>gi|396462286|ref|XP_003835754.1| similar to cysteine and histidine-rich domain-containing protein 1
           [Leptosphaeria maculans JN3]
 gi|312212306|emb|CBX92389.1| similar to cysteine and histidine-rich domain-containing protein 1
           [Leptosphaeria maculans JN3]
          Length = 341

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/151 (45%), Positives = 99/151 (65%), Gaps = 11/151 (7%)

Query: 48  TEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTP 106
           TE P  +P   E E+DD +I +     C+R  CG      AT +G   E E C++H G P
Sbjct: 110 TEAPAPSP---ESEDDDPSIALKEGMTCRRRGCG------ATHKGGDREGESCVHHPGAP 160

Query: 107 VFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQT 165
           +FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ K  E+++   R+D+YQT
Sbjct: 161 IFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKERHLFVGSGKKNKEGEEKVDTVRNDFYQT 220

Query: 166 PTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
            T ++ S+F KK+DK  + + F+  +V + L
Sbjct: 221 STSVVASLFLKKIDKDTAVIDFQPAQVKLDL 251



 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D+        E  CIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDE--------EETCIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|327293954|ref|XP_003231673.1| CORD and CS domain-containing protein [Trichophyton rubrum CBS
           118892]
 gi|326466301|gb|EGD91754.1| CORD and CS domain-containing protein [Trichophyton rubrum CBS
           118892]
          Length = 322

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (67%), Gaps = 7/130 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYGGSGSREGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRADYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTF 187
           +DK+ + V F
Sbjct: 237 IDKEAAKVDF 246



>gi|452987540|gb|EME87295.1| hypothetical protein MYCFIDRAFT_126098 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 330

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 100/164 (60%), Gaps = 11/164 (6%)

Query: 35  PKISYTQTISKTITEEPKLA-PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           P ++     ++T    P+ A P   E E+DD +IPV     CKR +CGK Y        E
Sbjct: 108 PPVARAPVAAQT----PRAATPAPPEDEDDDPSIPVPDGATCKRKTCGKSYKAGQNRDDE 163

Query: 94  GPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVE 152
               EC++H G  +FHEGSKGW+CC R+VLEF+EF+KI+GCK K +HLFVG  K+ +  E
Sbjct: 164 ----ECVHHPGAALFHEGSKGWTCCKRRVLEFDEFMKIQGCKTKSRHLFVGKKKD-QESE 218

Query: 153 KEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           +E+   R+D+YQT T +I S++ KK+DK  S V F +    + L
Sbjct: 219 EELKDVRNDFYQTATTVIASLYLKKIDKDRSRVEFSDDGTRVNL 262



>gi|302664631|ref|XP_003023943.1| hypothetical protein TRV_01884 [Trichophyton verrucosum HKI 0517]
 gi|291187966|gb|EFE43325.1| hypothetical protein TRV_01884 [Trichophyton verrucosum HKI 0517]
          Length = 322

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (67%), Gaps = 7/130 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYSGSGSRDGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRTDYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTF 187
           +DK+ + V F
Sbjct: 237 IDKEAAKVDF 246



>gi|302496214|ref|XP_003010110.1| hypothetical protein ARB_03677 [Arthroderma benhamiae CBS 112371]
 gi|291173648|gb|EFE29470.1| hypothetical protein ARB_03677 [Arthroderma benhamiae CBS 112371]
          Length = 322

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (67%), Gaps = 7/130 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYGGSGSREGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRTDYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTF 187
           +DK+ + V F
Sbjct: 237 IDKEAAKVDF 246



>gi|258568870|ref|XP_002585179.1| hypothetical protein UREG_05868 [Uncinocarpus reesii 1704]
 gi|237906625|gb|EEP81026.1| hypothetical protein UREG_05868 [Uncinocarpus reesii 1704]
          Length = 547

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 9/165 (5%)

Query: 24  VENGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKK 83
           V   V I  + P    +   +  +   P  +P   E E DD ++ + ++TEC+R  C   
Sbjct: 315 VRKTVPISQTRPSHPPSTLGATGVQTPPSGSPAPPESESDDPSLEIPANTECRRRGCKAT 374

Query: 84  YVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFV 142
           Y   A+   E    EC++H G P+FHEGSKGWSCC R+VLEF+EF+KI GC  K +HLF+
Sbjct: 375 YNPGASRDAE----ECVHHPGQPIFHEGSKGWSCCKRRVLEFDEFMKIPGCATKARHLFI 430

Query: 143 GSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTF 187
           G GK+    E+++   R D+YQTP+ +++S + KK+DK  + V F
Sbjct: 431 GKGKK----EEKVDTVRTDFYQTPSTVMVSFYLKKIDKDTAKVDF 471



>gi|494830946|gb|EON67457.1| hypothetical protein W97_06711 [Coniosporium apollinis CBS 100218]
          Length = 335

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 105/186 (56%), Gaps = 22/186 (11%)

Query: 48  TEEPKLA-PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTP 106
           T+ P+ A P   E E DD ++P+ +   C+R  C  +YV   +   E    +CI+H G  
Sbjct: 106 TQTPQSASPAPPEDESDDPSLPIPAGQTCRRRGCKAEYVPGTSREDE----KCIHHPGQA 161

Query: 107 VFHEGSKGWSCCSRKVLEFEEFLKIKGCKKG-KHLFVGSGKE-----VKNVEKE------ 154
           +FHEGSKGW+CC R+VLEFEEF+KI+GCK   +HLFVGSGK+     + +V  E      
Sbjct: 162 LFHEGSKGWTCCKRRVLEFEEFMKIEGCKTNDRHLFVGSGKKRGEENLDSVRYETSRAPY 221

Query: 155 -----IVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIYYMFYL 209
                +  C HD+YQTP+ +I S+F KK+DK+ S+V F     +    +   N  Y+  +
Sbjct: 222 SATWSLTTCSHDFYQTPSSVIASLFLKKIDKEKSTVKFASSSTIDLDLRTSDNKRYLQNV 281

Query: 210 NSYFYI 215
             Y  I
Sbjct: 282 PLYAPI 287



 Score = 72.4 bits (176), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 44/84 (52%), Gaps = 11/84 (13%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK Y DD          +C YH G P FHEG KGW CC  +VL FEEFL I  C
Sbjct: 7   CVHKGCGKTYTDD--------NEDCNYHPGPPEFHEGQKGWKCCKPRVLTFEEFLAIPPC 58

Query: 135 KKGKHLFVG---SGKEVKNVEKEI 155
             GKH  V    + + V+N + E+
Sbjct: 59  TTGKHSTVDDTPAPEPVQNKQPEL 82



>gi|169781504|ref|XP_001825215.1| CORD and CS domain protein [Aspergillus oryzae RIB40]
 gi|83773957|dbj|BAE64082.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391865326|gb|EIT74610.1| Zn2+-binding protein Melusin/RAR1 [Aspergillus oryzae 3.042]
          Length = 316

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 113/184 (61%), Gaps = 15/184 (8%)

Query: 30  IYDSG-PKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDA 88
           + DSG P+ +Y+  I+          P  +E E DD ++ + ++  C+R  CG  Y + +
Sbjct: 91  VADSGVPRPTYSPAIAPPSN---AATPAPEESESDDPSLEIPANATCRRKGCGANY-NSS 146

Query: 89  TSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKE 147
            SR E    +C++H G P+FHEGSKGWSCC ++VL+F++FLKI+GCK K  HLFVG GK 
Sbjct: 147 VSREE---EKCVHHPGQPIFHEGSKGWSCCKKRVLDFDDFLKIEGCKEKRGHLFVGKGKP 203

Query: 148 VKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL----YKKGRNI 203
               E+++   R+D+YQTP  + +S++ KK+DK  + V F EK + + L     K+ ++ 
Sbjct: 204 AG--EEKVESVRNDFYQTPHSVNVSLYLKKIDKNQAKVEFSEKSIDLDLPTTDNKRYKDT 261

Query: 204 YYMF 207
           Y +F
Sbjct: 262 YQLF 265



 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 41/70 (58%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK + D        PE  C+YH G PVFHEG KGW CC  +VL F+EFL+I 
Sbjct: 2   SKCVHKGCGKVFTD--------PEEPCVYHPGPPVFHEGQKGWKCCKPRVLTFDEFLEIP 53

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 54  PCTTGKHSTV 63



>gi|238498286|ref|XP_002380378.1| CORD and CS domain protein [Aspergillus flavus NRRL3357]
 gi|220693652|gb|EED49997.1| CORD and CS domain protein [Aspergillus flavus NRRL3357]
          Length = 316

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 113/184 (61%), Gaps = 15/184 (8%)

Query: 30  IYDSG-PKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDA 88
           + DSG P+ +Y+  I+          P  +E E DD ++ + ++  C+R  CG  Y + +
Sbjct: 91  VADSGVPRPTYSPAIAPPSN---AATPAPEESESDDPSLEIPANATCRRKGCGANY-NSS 146

Query: 89  TSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKE 147
            SR E    +C++H G P+FHEGSKGWSCC ++VL+F++FLKI+GCK K  HLFVG GK 
Sbjct: 147 VSREE---EKCVHHPGQPIFHEGSKGWSCCKKRVLDFDDFLKIEGCKEKRGHLFVGKGKP 203

Query: 148 VKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL----YKKGRNI 203
               E+++   R+D+YQTP  + +S++ KK+DK  + V F EK + + L     K+ ++ 
Sbjct: 204 AG--EEKVESVRNDFYQTPHSVNVSLYLKKIDKNQAKVEFSEKSIDLDLPTTDNKRYKDT 261

Query: 204 YYMF 207
           Y +F
Sbjct: 262 YQLF 265



 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 41/70 (58%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK + D        PE  C+YH G PVFHEG KGW CC  +VL F+EFL+I 
Sbjct: 2   SKCVHKGCGKVFTD--------PEEPCVYHPGPPVFHEGQKGWKCCKPRVLTFDEFLEIP 53

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 54  PCTTGKHSTV 63



>gi|296816483|ref|XP_002848578.1| diploid state maintenance protein chpA [Arthroderma otae CBS
           113480]
 gi|238839031|gb|EEQ28693.1| diploid state maintenance protein chpA [Arthroderma otae CBS
           113480]
          Length = 320

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 91/141 (64%), Gaps = 7/141 (4%)

Query: 48  TEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPV 107
           T  P+  P   E E DD ++ +     C+R  CGK Y       GE    EC++H G P+
Sbjct: 110 TPTPRGTPAPPESESDDPSLEIQQGATCRRKGCGKTYSGSGAREGE----ECVHHPGQPI 165

Query: 108 FHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTP 166
           FHEGSKGW+CC R+VLEF+EFL + GCK K +HLF+G+G  VK+ E+++   R D+YQT 
Sbjct: 166 FHEGSKGWTCCKRRVLEFDEFLNLPGCKTKDRHLFIGNG--VKSAEEKVKDVRTDFYQTS 223

Query: 167 THIIMSIFAKKVDKQNSSVTF 187
           + +I S++ KK+ +++S V+F
Sbjct: 224 STVIASVYLKKIIREDSRVSF 244



>gi|451999161|gb|EMD91624.1| hypothetical protein COCHEDRAFT_1136358 [Bipolaris maydis C5]
 gi|477591547|gb|ENI08619.1| hypothetical protein COCC4DRAFT_37323 [Bipolaris maydis ATCC 48331]
          Length = 316

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 101/165 (61%), Gaps = 13/165 (7%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P++   Q   K  T  P   P   E E+DD +I V     C+R  CG      A  +G 
Sbjct: 97  APRVPTAQAAPKP-TASPAPPP---ESEDDDPSIAVKEGMACRRKGCG------AVHKGG 146

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
             + E C++H G P+FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ K  
Sbjct: 147 DRQGESCVHHPGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKDRHLFVGSGKK-KEG 205

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           E+++   RHD+YQT T ++ S++ KK+DK  +SV F+   V + L
Sbjct: 206 EEKLDTVRHDYYQTATLVVASLYLKKIDKATASVEFQPSSVKLDL 250



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 44/82 (53%), Gaps = 8/82 (9%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK Y D+          EC+YH G PVFHEG KGW CC  +VL F+EFL I+ C
Sbjct: 5   CVHKGCGKTYEDE--------NEECVYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEPC 56

Query: 135 KKGKHLFVGSGKEVKNVEKEIV 156
            KGKH  V      + VE   V
Sbjct: 57  TKGKHSDVDDTPAPEPVEAPDV 78



>gi|119184351|ref|XP_001243096.1| hypothetical protein CIMG_06992 [Coccidioides immitis RS]
 gi|392865982|gb|EAS31840.2| CORD and CS domain-containing protein [Coccidioides immitis RS]
          Length = 321

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 107/181 (59%), Gaps = 15/181 (8%)

Query: 33  SGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG 92
           S P ++   T   T T  P   P   E E DD ++ +A+++ C+R  C +KY   A+   
Sbjct: 99  SHPPVTLGATGVHTPT--PSGTPAPPESESDDPSLEIAANSVCRRRGCNEKYSPGASRD- 155

Query: 93  EGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
              E EC+ H G P+FHEGSKGWSCC R+VLEF+EF+KI GC  K +HLF+G GK+    
Sbjct: 156 ---EEECVNHPGQPIFHEGSKGWSCCKRRVLEFDEFMKIPGCNTKKRHLFIGKGKK---G 209

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR-----EKEVMICLYKKGRNIYYM 206
           E+++   R D+YQTP+ +I+S + KK+DK  + V F      E ++     K+ R+ Y +
Sbjct: 210 EEKVDTVRTDFYQTPSTVIVSFYLKKIDKDTAKVNFSSPNTIEFDLPTTDNKRFRDTYEL 269

Query: 207 F 207
           F
Sbjct: 270 F 270



>gi|392596105|gb|EIW85428.1| chord-domain-containing protein [Coniophora puteana RWD-64-598 SS2]
          Length = 350

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 88/137 (64%), Gaps = 2/137 (1%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCS 119
           +EDD +IPV + T C+R  CG ++V D   R G+G +  C YH   P+FHEGSKG+ CC 
Sbjct: 128 DEDDTSIPVTAGTICRRTGCGAEFVSDEVHRVGDGEDTVCTYHPAPPIFHEGSKGYLCCK 187

Query: 120 RKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVD 179
            +VLEF++FLKI GCK G+H+F    +++    +E+  CR D YQTP  + +++FAK+ D
Sbjct: 188 PRVLEFDQFLKIPGCKTGRHVF-APKRKLNTPSEELTDCRVDHYQTPQEVHVTVFAKQAD 246

Query: 180 KQNSSVTFREKEVMICL 196
           K+ S V   E +V   L
Sbjct: 247 KEKSLVKIEESQVHFDL 263



>gi|346979500|gb|EGY22952.1| integrin beta-1-binding protein [Verticillium dahliae VdLs.17]
          Length = 324

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 104/145 (71%), Gaps = 12/145 (8%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD  + + +D  C+R +CG KY   A SR +G E+ C++H G P+FHEGSKG+SCC
Sbjct: 114 ESEDDDPTLAIPADAVCRRKACGAKY---AGSR-DGDES-CVHHPGVPIFHEGSKGYSCC 168

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVK--NVE---KEIVQ-CRHDWYQTPTHIIM 171
            R+VLEF++F+KI+GCK K +HLFVGSGK+ K  NVE   +E+++  R D+YQTP+ +I 
Sbjct: 169 KRRVLEFDQFMKIEGCKTKERHLFVGSGKKNKDGNVETGGEEVLETVRTDFYQTPSTVIA 228

Query: 172 SIFAKKVDKQNSSVTFREKEVMICL 196
           S F KK+ K ++ ++F E+ + + L
Sbjct: 229 SFFLKKIRKDDAKISFAERTLTLDL 253



 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D        PE  C+YH G PVFHEG KGW CC  + L FEEFL I  
Sbjct: 4   KCVHQGCGKLYTD--------PEEVCVYHPGPPVFHEGQKGWKCCKPRFLTFEEFLAIPP 55

Query: 134 CKKGKH 139
           C +GKH
Sbjct: 56  CTEGKH 61



>gi|328860798|gb|EGG09903.1| hypothetical protein MELLADRAFT_34100 [Melampsora larici-populina
           98AG31]
          Length = 325

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/132 (50%), Positives = 91/132 (68%), Gaps = 3/132 (2%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATS-RGEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           DD  + V   ++CKR SCG+++   + S RGE    EC+YH GTP+FHEGSKG+SCC ++
Sbjct: 135 DDPELIVPEGSKCKRLSCGQEWKGGSGSKRGELNHDECLYHPGTPIFHEGSKGYSCCKKR 194

Query: 122 VLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           VL+F+EFLK+ GCKK  HLF+    +  + E E V CR D+YQTPT +I+S+F K V K+
Sbjct: 195 VLDFDEFLKLSGCKKSSHLFLIQESKPTDQE-ESVNCRFDYYQTPTSVIISVFGKGVIKE 253

Query: 182 NSSVTFREKEVM 193
            S V F E +VM
Sbjct: 254 QSQVVF-ENQVM 264



>gi|169623510|ref|XP_001805162.1| hypothetical protein SNOG_14997 [Phaeosphaeria nodorum SN15]
 gi|111056420|gb|EAT77540.1| hypothetical protein SNOG_14997 [Phaeosphaeria nodorum SN15]
          Length = 317

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 92/140 (65%), Gaps = 8/140 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSC 117
           E E+DD +I +     C+R  CG       T +G   + E C++H G P+FHEGSKGWSC
Sbjct: 118 ESEDDDPSIALKDGMTCRRKGCG------VTHKGGDRDGEKCVHHPGAPIFHEGSKGWSC 171

Query: 118 CSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           C R+VLEF++F+ I+GCK K +HLFVGSGK+ K  E+++   RHD+YQT   ++ S++ K
Sbjct: 172 CKRRVLEFDQFMNIEGCKTKDRHLFVGSGKKDKGGEEKLDTVRHDYYQTAVSVVASLYLK 231

Query: 177 KVDKQNSSVTFREKEVMICL 196
           K+DK  + + F+ K V + L
Sbjct: 232 KIDKSTAVIDFQPKSVNLDL 251



>gi|346320893|gb|EGX90493.1| CORD and CS domain protein [Cordyceps militaris CM01]
          Length = 320

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 92/132 (69%), Gaps = 6/132 (4%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           +A    C+R +CG++Y  +A +   G    C++H G P+FHEGSKG+SCC R+VLEF++F
Sbjct: 123 IADGATCRRRTCGQQYKKNAAAARTG--ESCVHHPGVPIFHEGSKGYSCCKRRVLEFDQF 180

Query: 129 LKIKGCK-KGKHLFVGSGKEVKNV---EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSS 184
           +KI+GC  K +HLF+GSGK++K     E+++   RHD+YQTP  +I S F KK++K+ + 
Sbjct: 181 MKIEGCATKDRHLFIGSGKKIKGAASGEEKLETVRHDFYQTPASVIASFFLKKINKETAK 240

Query: 185 VTFREKEVMICL 196
           V F++K + + L
Sbjct: 241 VEFKDKALALDL 252



>gi|303320331|ref|XP_003070165.1| CHORD family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|240109851|gb|EER28020.1| CHORD family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|320041220|gb|EFW23153.1| CORD and CS domain-containing protein [Coccidioides posadasii str.
           Silveira]
          Length = 321

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 106/181 (58%), Gaps = 15/181 (8%)

Query: 33  SGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG 92
           S P ++   T   T T  P   P   E E DD  + +A+++ C+R  C  KY   A+   
Sbjct: 99  SHPPVTLGATGVHTPT--PSGTPAPPESESDDPLLEIAANSVCRRRGCNDKYSPGASRD- 155

Query: 93  EGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
              E EC++H G P+FHEGSKGWSCC R+VLEF+EF+KI GC  K +HLF+G GK+    
Sbjct: 156 ---EEECVHHPGQPIFHEGSKGWSCCKRRVLEFDEFMKIPGCNTKKRHLFIGKGKK---G 209

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR-----EKEVMICLYKKGRNIYYM 206
           E+++   R D+YQTP+ +I+S + KK+DK  + V F      E ++     K+ R+ Y +
Sbjct: 210 EEKVDTVRTDFYQTPSTVIVSFYLKKIDKDTAKVHFSSPNMIEFDLPTTDNKRFRDTYEL 269

Query: 207 F 207
           F
Sbjct: 270 F 270



>gi|212542623|ref|XP_002151466.1| CORD and CS domain protein [Talaromyces marneffei ATCC 18224]
 gi|210066373|gb|EEA20466.1| CORD and CS domain protein [Talaromyces marneffei ATCC 18224]
          Length = 315

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 93/157 (59%), Gaps = 8/157 (5%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           IS       T T     AP   EP+ DD ++ + S+  C+R  C   Y  DA+   E   
Sbjct: 95  ISAAAAALPTPTPNTASAPAP-EPDSDDPSLSIPSNATCRRKGCNATYNPDASRDSE--- 150

Query: 97  AECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEI 155
             C +H G P+FHEGSKGWSCC R+VLEF+EF+KI GCK K +HLFVG GK     E+++
Sbjct: 151 -TCEHHPGQPIFHEGSKGWSCCKRRVLEFDEFMKIPGCKEKKRHLFVGKGKPAG--EEKV 207

Query: 156 VQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEV 192
              R D+YQT T I  S++ KK+DK+ + VTF E  V
Sbjct: 208 EDVRTDFYQTATTINASLYLKKIDKEKAKVTFTENTV 244



 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 40/70 (57%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T+C    CGK + D         E +CIYH G PVFHEG KGW CC  +VL F+EFL I 
Sbjct: 3   TKCVHKGCGKVFTDL--------EEDCIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLTIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|315050021|ref|XP_003174385.1| diploid state maintenance protein chpA [Arthroderma gypseum CBS
           118893]
 gi|311342352|gb|EFR01555.1| diploid state maintenance protein chpA [Arthroderma gypseum CBS
           118893]
          Length = 323

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 62/130 (47%), Positives = 85/130 (65%), Gaps = 7/130 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    EC++H G PVFHEGSKGWSCC
Sbjct: 124 ESESDDPSLEIQQGATCRRKGCGKTYSGSGSREGE----ECVHHPGYPVFHEGSKGWSCC 179

Query: 119 SRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GC  K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 180 KRRVLEFDEFLKMPGCTTKNRHLFIGKGK--KSAEEKVNHVRTDYYQTSSTVIASVYLKK 237

Query: 178 VDKQNSSVTF 187
           +DK  + V F
Sbjct: 238 IDKDTAKVEF 247



>gi|330916180|ref|XP_003297323.1| hypothetical protein PTT_07684 [Pyrenophora teres f. teres 0-1]
 gi|311330067|gb|EFQ94580.1| hypothetical protein PTT_07684 [Pyrenophora teres f. teres 0-1]
          Length = 316

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/165 (41%), Positives = 100/165 (60%), Gaps = 13/165 (7%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P++   Q   K  T  P   P   E E+DD ++ +     C+R  CG      A  +G 
Sbjct: 97  APRLPTAQATPKP-TASPAPPP---ESEDDDPSVALKEGMTCRRKGCG------AVHKGG 146

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
             E E C++H G P+FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ K  
Sbjct: 147 NREGESCVHHPGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKDRHLFVGSGKK-KEG 205

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           E+++   RHD+YQT T ++ S++ KK+DK  + + F+   V + L
Sbjct: 206 EEKLDTVRHDFYQTATSVVASLYLKKIDKSTAVIDFQPTHVKLDL 250



 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D+          ECIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDE--------NEECIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|407926307|gb|EKG19274.1| hypothetical protein MPH_03137 [Macrophomina phaseolina MS6]
          Length = 314

 Score =  129 bits (323), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 93/148 (62%), Gaps = 5/148 (3%)

Query: 58  KEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSC 117
           +E E+DD ++P+     CKR +C  KY  DA S G   + +C++H G P+FHEGSKG+SC
Sbjct: 113 QEDEDDDPSLPIPDGAPCKRKACNAKY--DA-SAGRQDDEQCVHHPGAPIFHEGSKGYSC 169

Query: 118 CSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           C R+VLEF+EF+KI+GC  K +HLFVG  K+ +  E  +   R D+YQT T +I S+F K
Sbjct: 170 CKRRVLEFDEFMKIEGCATKARHLFVGKKKD-EGAEDVVESVRSDFYQTSTTVIASLFLK 228

Query: 177 KVDKQNSSVTFREKEVMICLYKKGRNIY 204
           K+DK  S+V      + + L    +  Y
Sbjct: 229 KIDKATSTVELSASNIKLDLRTTDKKRY 256



>gi|171687839|ref|XP_001908860.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943881|emb|CAP69533.1| unnamed protein product [Podospora anserina S mat+]
          Length = 319

 Score =  128 bits (322), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 93/145 (64%), Gaps = 11/145 (7%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD  I +     C+R  CG  Y   ++  GE     C++H G P+FHEGSKG+SCC
Sbjct: 110 ESEDDDATIEIPDGRVCRRKGCGVAYKKGSSREGE----SCVHHPGAPIFHEGSKGYSCC 165

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVK------NVEKEIVQCRHDWYQTPTHIIM 171
            R+VLEF++F+KI+GCK K +HLFVGSG++ K        E+ +   R D+YQTPT +I 
Sbjct: 166 KRRVLEFDQFMKIEGCKTKDRHLFVGSGEKDKAKTSSAGGEEVLETVRTDFYQTPTSVIA 225

Query: 172 SIFAKKVDKQNSSVTFREKEVMICL 196
           S F KK+DK+ S V F++K + + L
Sbjct: 226 SFFLKKIDKEASKVEFQDKTIDLDL 250



 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 39/65 (60%), Gaps = 8/65 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK+Y D        PE  C YH G PVFHEG KGW CC  +VL FEEF+ I+ C
Sbjct: 5   CVHQGCGKEYTD--------PEEVCRYHPGPPVFHEGQKGWKCCKPRVLTFEEFMAIEPC 56

Query: 135 KKGKH 139
            +GKH
Sbjct: 57  TEGKH 61



>gi|189189136|ref|XP_001930907.1| CORD and CS domain containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187972513|gb|EDU40012.1| CORD and CS domain containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 316

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 100/165 (60%), Gaps = 13/165 (7%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P++   Q   K       LAP   E E+DD ++ +     C+R  CG      A  +G 
Sbjct: 97  APRLPTAQAAPKPTAS---LAP-PPESEDDDPSVVLKEGMTCRRKGCG------AVHKGG 146

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
             E E C++H G P+FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ K  
Sbjct: 147 NREGESCVHHPGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKDRHLFVGSGKK-KEG 205

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           E+++   RHD+YQT T ++ S++ KK+DK  + V F+   V + L
Sbjct: 206 EEKLDTVRHDFYQTATSVVASLYLKKIDKSTAVVDFQLNHVKLDL 250



 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D+          ECIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDE--------NEECIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|358372826|dbj|GAA89427.1| CORD and CS domain protein [Aspergillus kawachii IFO 4308]
          Length = 315

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 96/155 (61%), Gaps = 7/155 (4%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +EPE DD  + + ++  C+R  C   Y D   SR E    +C+YH G P+FHEGSKG
Sbjct: 113 PVPEEPESDDPELAIPANATCRRRGCNAGY-DANVSRDE---EKCVYHPGQPIFHEGSKG 168

Query: 115 WSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC ++VLEF+EFLKI+GC +K KHLFVG GK     E+++   R+D+YQT + + +S+
Sbjct: 169 WSCCKKRVLEFDEFLKIQGCSEKKKHLFVGKGKPAG--EEKVESVRNDFYQTASSVNVSL 226

Query: 174 FAKKVDKQNSSVTFREKEVMICLYKKGRNIYYMFY 208
           + KK++K  + V F+   + + L       Y   Y
Sbjct: 227 YLKKINKDTAKVEFKATSIELDLPTTDNKRYTDSY 261



>gi|322697940|gb|EFY89714.1| CORD and CS domain containing protein [Metarhizium acridum CQMa
           102]
          Length = 271

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 96/138 (69%), Gaps = 12/138 (8%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L IP  S   C+R +CG++Y   ++  GE     C+YH G P+FHEGSKG+SCC R+VLE
Sbjct: 71  LEIPDGS--TCRRRTCGQRYKKGSSREGEA----CVYHPGVPIFHEGSKGYSCCKRRVLE 124

Query: 125 FEEFLKIKGCK-KGKHLFVGSGK----EVKNVEKEIVQ-CRHDWYQTPTHIIMSIFAKKV 178
           F++F+KI+GCK K +HLF+GSGK    +  +  +E++   RHD+YQT T +I + F KK+
Sbjct: 125 FDQFMKIEGCKTKDRHLFIGSGKKEDEKTGSAGEEVLSTVRHDFYQTATTVIAAFFLKKI 184

Query: 179 DKQNSSVTFREKEVMICL 196
           +K+++ V F+++++ + L
Sbjct: 185 NKESAKVRFQDRQLALDL 202



>gi|350629616|gb|EHA17989.1| hypothetical protein ASPNIDRAFT_47594 [Aspergillus niger ATCC 1015]
          Length = 314

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 97/155 (62%), Gaps = 7/155 (4%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +EP+ DD  + + ++  C+R  C   Y D + SR E    +C+YH G P+FHEGSKG
Sbjct: 112 PVPEEPDSDDPELAIPANATCRRRGCNAGY-DASVSRDE---EKCVYHPGQPIFHEGSKG 167

Query: 115 WSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC ++VLEF+EFLKI+GC +K KHLFVG GK     E+++   R+D+YQT + + +S+
Sbjct: 168 WSCCKKRVLEFDEFLKIQGCSEKKKHLFVGKGKPPG--EEKVESVRNDFYQTASSVNVSL 225

Query: 174 FAKKVDKQNSSVTFREKEVMICLYKKGRNIYYMFY 208
           + KK++K  + V F+   + + L       Y   Y
Sbjct: 226 YLKKINKDTAKVEFKATSIELDLPTTDNKRYTDSY 260



>gi|145239673|ref|XP_001392483.1| CORD and CS domain protein [Aspergillus niger CBS 513.88]
 gi|134076994|emb|CAK45403.1| unnamed protein product [Aspergillus niger]
          Length = 314

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 97/155 (62%), Gaps = 7/155 (4%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +EP+ DD  + + ++  C+R  C   Y D + SR E    +C+YH G P+FHEGSKG
Sbjct: 112 PVPEEPDSDDPELAIPANATCRRRGCNAGY-DASVSRDE---EKCVYHPGQPIFHEGSKG 167

Query: 115 WSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC ++VLEF+EFLKI+GC +K KHLFVG GK     E+++   R+D+YQT + + +S+
Sbjct: 168 WSCCKKRVLEFDEFLKIQGCSEKKKHLFVGKGKPPG--EEKVESVRNDFYQTASSVNVSL 225

Query: 174 FAKKVDKQNSSVTFREKEVMICLYKKGRNIYYMFY 208
           + KK++K  + V F+   + + L       Y   Y
Sbjct: 226 YLKKINKDTAKVEFKATSIELDLPTTDNKRYTDSY 260



>gi|395333641|gb|EJF66018.1| chord-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 363

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/193 (40%), Positives = 104/193 (53%), Gaps = 27/193 (13%)

Query: 27  GVEIYDSGPKISYTQTI-SKTITEEPKLAPIEK-EPEEDDLNIPVASDTECKRPSCGKKY 84
             E Y S P  S T T  SK+++E    A + K E EEDDL   V   T C+   C   Y
Sbjct: 92  AAETYSSVPAGSSTSTPGSKSVSE----AVVTKFEEEEDDLEASVPPGTTCRHKGCNVVY 147

Query: 85  VDDATSRGEGPEA-ECIYHSGTPVFHEGSK-------------------GWSCCSRKVLE 124
            +D   R EG  A EC YH   P+FHEGSK                   G+ CC R+VLE
Sbjct: 148 ENDDLHRKEGGAASECTYHPKPPIFHEGSKVRLQSRPDQSIAPVLTVAKGYLCCKRRVLE 207

Query: 125 FEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSS 184
           F+EFLKI+GC KG H+FV   ++    ++E  QCR D YQTP+ +  S+FAKK D + S+
Sbjct: 208 FDEFLKIEGCTKGSHVFV-PKRKANTQQEEFTQCRIDHYQTPSEVHASVFAKKADPEAST 266

Query: 185 VTFREKEVMICLY 197
           +  +E EV + +Y
Sbjct: 267 IKIQETEVFLDIY 279



>gi|398411184|ref|XP_003856935.1| hypothetical protein MYCGRDRAFT_84253 [Zymoseptoria tritici IPO323]
 gi|339476820|gb|EGP91911.1| hypothetical protein MYCGRDRAFT_84253 [Zymoseptoria tritici IPO323]
          Length = 318

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 94/151 (62%), Gaps = 8/151 (5%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           +DD ++P+  +  CKR  CG +Y     S     E +C++H G  +FHEGSKGW+CC R+
Sbjct: 120 DDDPSLPIPDNASCKRKGCGVQY----RSGQNRDEEQCVHHPGQAIFHEGSKGWTCCKRR 175

Query: 122 VLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           VLEF+EF+KI+GCK K +HLFVG  K+  + E+ + + R+D+YQT T +I S++ KK+DK
Sbjct: 176 VLEFDEFMKIQGCKTKSRHLFVGKKKDA-DAEELVNEVRNDFYQTATTVIASLYLKKIDK 234

Query: 181 QNSSVTFRE--KEVMICLYKKGRNIYYMFYL 209
             S V F E  K V + L    +  Y    L
Sbjct: 235 DRSKVEFSEDGKAVELDLVTSDKKRYQTTML 265



 Score = 72.8 bits (177), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 39/69 (56%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        PE  C+YH G PVFHEG KGW CC  +VL F+EF+ I  
Sbjct: 4   KCVHKGCGKLFSD--------PEDPCVYHPGPPVFHEGQKGWKCCKPRVLTFDEFMTIPP 55

Query: 134 CKKGKHLFV 142
           C  GKH  V
Sbjct: 56  CTTGKHTTV 64



>gi|452847327|gb|EME49259.1| hypothetical protein DOTSEDRAFT_68130 [Dothistroma septosporum
           NZE10]
          Length = 320

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 90/152 (59%), Gaps = 6/152 (3%)

Query: 46  TITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGT 105
           T    P  +P   E EEDD +I VA    CKR +CG  +     S     E EC++H G 
Sbjct: 106 TAAPRPSPSPALPEEEEDDPSIVVADGASCKRRACGASF----KSGQNRDEEECVHHPGQ 161

Query: 106 PVFHEGSKGWSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQ 164
            +FHEGSKGW+CC R+VLEF+EF+KI GC  K +HLFVG  K+    EK + + R+D+YQ
Sbjct: 162 ALFHEGSKGWTCCKRRVLEFDEFMKIPGCTTKSRHLFVGKTKDPDEEEK-LSEVRNDFYQ 220

Query: 165 TPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           T T +I S++ KKVD+  S V F      I L
Sbjct: 221 TATTVIASLYLKKVDQDRSKVDFSADGTKIDL 252



>gi|115491611|ref|XP_001210433.1| hypothetical protein ATEG_00347 [Aspergillus terreus NIH2624]
 gi|114197293|gb|EAU38993.1| hypothetical protein ATEG_00347 [Aspergillus terreus NIH2624]
          Length = 424

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 96/158 (60%), Gaps = 11/158 (6%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +E E DD +  + ++  C+R  C   Y    +   E     C++H G P+FHEGSKG
Sbjct: 114 PVPEESESDDPSQEIPANATCRRKGCNASYNPSGSREDE----TCVHHPGQPIFHEGSKG 169

Query: 115 WSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC ++VLEF+EFLKI+GCK K KHLFVG GK     E+++   R+D+YQTP  + +S+
Sbjct: 170 WSCCKKRVLEFDEFLKIQGCKEKKKHLFVGKGKPPG--EEKVESVRNDFYQTPHSVNVSL 227

Query: 174 FAKKVDKQNSSVTFREKEVMICL----YKKGRNIYYMF 207
           + KK+DK  + V F E  + + L     K+  + Y +F
Sbjct: 228 YLKKIDKTKAGVKFAENSIDLDLPTTDNKRYTDTYELF 265



 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK++ D        P+  C+YH G PVFHEG KGW CC  +VL F+EFL I 
Sbjct: 3   SKCVHKGCGKEFSD--------PDEPCVYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|406862834|gb|EKD15883.1| CORD and CS domain containing protein [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 319

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/137 (48%), Positives = 91/137 (66%), Gaps = 13/137 (9%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSRKVL 123
           L IP      C+R +CG+ Y       GEG E E C++H G P+FHEGSKG++CC R+VL
Sbjct: 122 LEIPAGK--LCRRKACGQSY------NGEGREGEKCVFHPGVPIFHEGSKGYTCCKRRVL 173

Query: 124 EFEEFLKIKGCK-KGKHLFVGSG-KEVKNVEKEIV--QCRHDWYQTPTHIIMSIFAKKVD 179
           EF+EF++I+GC+ K +HLFVGSG K+  N E E V    RHD+YQTPT  I S F KK++
Sbjct: 174 EFDEFMRIEGCETKDRHLFVGSGKKKGGNSEGEEVLETVRHDFYQTPTTAIASFFLKKIN 233

Query: 180 KQNSSVTFREKEVMICL 196
           K+N+ + F   E+ + L
Sbjct: 234 KENAKIEFSSSEISLDL 250



>gi|485917275|gb|EOD44308.1| putative cord and cs domain protein [Neofusicoccum parvum UCRNP2]
          Length = 310

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 94/147 (63%), Gaps = 7/147 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E EEDD  +PV +   CKR +CG  Y   + SR +G EA C++H G P+FHEGSKG+SCC
Sbjct: 112 EDEEDDPAVPVPAGATCKRKACGATY---SGSR-DGDEA-CVHHPGFPIFHEGSKGYSCC 166

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EF++I+GC  K +HLFVG  K+ +  E  +   R D+YQT T +I S+F KK
Sbjct: 167 KRRVLEFDEFMRIEGCATKDRHLFVGRKKD-EAAEDVVESVRSDFYQTTTTVIASLFLKK 225

Query: 178 VDKQNSSVTFREKEVMICLYKKGRNIY 204
           +DK  S++      + + L+   +  Y
Sbjct: 226 IDKATSTIELGATSIKLDLHTSDKKRY 252



>gi|399166054|emb|CCE33095.1| related to zinc-binding protein [Claviceps purpurea 20.1]
          Length = 323

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 92/140 (65%), Gaps = 9/140 (6%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           +DD  + +     C+R +CG+KY   A+   E    +C++H G P+FHEGSKG+ CC R+
Sbjct: 120 DDDPALEIPQGATCRRRTCGQKYNKGASRDDE----KCVHHPGAPIFHEGSKGYLCCKRR 175

Query: 122 VLEFEEFLKIKGC-KKGKHLFVGSG----KEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           VLEF++FL I+GC  K +HLF+GS     KE    E+ +   RHD+YQT T++I S F K
Sbjct: 176 VLEFDQFLNIEGCTTKNRHLFIGSAKKKDKEGTVGEEILTTVRHDFYQTATNVIASFFLK 235

Query: 177 KVDKQNSSVTFREKEVMICL 196
           K+DK+ + V F++K++++ L
Sbjct: 236 KIDKETAKVEFQDKQIVLDL 255



>gi|330794004|ref|XP_003285071.1| hypothetical protein DICPUDRAFT_148893 [Dictyostelium purpureum]
 gi|325084994|gb|EGC38410.1| hypothetical protein DICPUDRAFT_148893 [Dictyostelium purpureum]
          Length = 321

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 86/142 (60%), Gaps = 12/142 (8%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEG 111
           KL    +E + +D  IP  +  +C R SC K +  D +SR E    EC YH G PVFHEG
Sbjct: 129 KLPEYVEENDPEDAVIPEGA--QCCRNSC-KAFYKDESSRTE----ECHYHPGEPVFHEG 181

Query: 112 SKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIM 171
           SKGWSCC  K   FEEFLKIKGCK GKH F+   K+   VE     CRHDWYQ    IIM
Sbjct: 182 SKGWSCCKPKAAIFEEFLKIKGCKTGKHKFIPPPKDESKVE-----CRHDWYQQFDAIIM 236

Query: 172 SIFAKKVDKQNSSVTFREKEVM 193
           +I+AK VDK NS + F + + +
Sbjct: 237 TIYAKNVDKVNSKIQFVDNQTI 258



>gi|501304723|dbj|GAC94017.1| hypothetical protein PHSY_001586 [Pseudozyma hubeiensis SY62]
          Length = 368

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 86/146 (58%), Gaps = 10/146 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E++P E D  +P      CKR  CG K+   A  R       C +H G+P+FHEGSKGWS
Sbjct: 156 EQDPVETDATLPAG--LACKRGGCGYKHQGGARDRSS---ETCKHHKGSPIFHEGSKGWS 210

Query: 117 CCSRKVLEFEEFLKIKGCKKGK--HLFVGSGKEVKNVE---KEIVQCRHDWYQTPTHIIM 171
           CC R+VL+F +FL+I+ C   K  HLFVG+ K   + E   +E V CR D Y+TP  I +
Sbjct: 211 CCKRRVLDFNDFLQIEPCTTAKSGHLFVGAPKAAADGELDGEESVDCRMDHYETPNDIRL 270

Query: 172 SIFAKKVDKQNSSVTFREKEVMICLY 197
           +++AK VD  NSS+ F E  V+  L 
Sbjct: 271 TVYAKAVDAANSSIEFNEDSVVFSLL 296



>gi|482805003|gb|EOA82102.1| hypothetical protein SETTUDRAFT_165581 [Setosphaeria turcica Et28A]
          Length = 317

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/183 (39%), Positives = 103/183 (56%), Gaps = 19/183 (10%)

Query: 24  VENGVEIY---------DSGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTE 74
           V NG E+             P++   Q  +      P   P   E E+DD +I +     
Sbjct: 78  VPNGTEVNLGSLDESLPPPAPRVPTAQAAAPKPAGSPAPPP---ESEDDDASIALKEGMT 134

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R  CG  Y      +GE     C+YH+G P+FHEGSKGWSCC R+VLEF++F+ I+GC
Sbjct: 135 CRRKGCGALY-KGGDRQGE----SCVYHAGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGC 189

Query: 135 K-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVM 193
           K K +HLFVGSGK+ +  EK     RHD+YQT T ++ S++ KK+DK  ++V F+   V 
Sbjct: 190 KTKDRHLFVGSGKKKEGEEKLET-VRHDFYQTATSVVASLYLKKIDKATATVDFQSTCVK 248

Query: 194 ICL 196
           + L
Sbjct: 249 LDL 251



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 45/83 (54%), Gaps = 8/83 (9%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y DD        + ECIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDD--------QEECIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKHLFVGSGKEVKNVEKEIV 156
           C +G H  V      + VE   V
Sbjct: 56  CTQGTHSEVDDTPAPEPVETPDV 78



>gi|322705627|gb|EFY97211.1| CORD and CS domain containing protein [Metarhizium anisopliae ARSEF
           23]
          Length = 445

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 94/139 (67%), Gaps = 13/139 (9%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L IP  S   C+R +CG++Y   +   GE     C++H G P+FHEGSKG+SCC R+VLE
Sbjct: 123 LEIPDGS--TCRRRTCGQRYKKGSLREGEA----CVHHPGVPIFHEGSKGYSCCKRRVLE 176

Query: 125 FEEFLKIKGCK-KGKHLFVGSGKEVKN------VEKEIVQCRHDWYQTPTHIIMSIFAKK 177
           F++F+KI+GCK K +HLF+GSGK+ +        E+ +   RHD+YQT T +I + F KK
Sbjct: 177 FDQFMKIEGCKTKDRHLFIGSGKKEEEEKTGSAGEEVLSTVRHDFYQTATTVIAAFFLKK 236

Query: 178 VDKQNSSVTFREKEVMICL 196
           ++K+++ V F EK++++ L
Sbjct: 237 INKESAKVEFLEKQLVLDL 255



>gi|164427312|ref|XP_964180.2| hypothetical protein NCU03087 [Neurospora crassa OR74A]
 gi|157071690|gb|EAA34944.2| hypothetical protein NCU03087 [Neurospora crassa OR74A]
 gi|350296586|gb|EGZ77563.1| CS-domain-containing protein [Neurospora tetrasperma FGSC 2509]
          Length = 299

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 92/143 (64%), Gaps = 9/143 (6%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E ++D+  I +     C+R +CG  Y   A+  GE    +C++H G P+FHEGSKG+SCC
Sbjct: 93  ESDDDEEGIEIPDGRVCRRKACGATYQKGASREGE----KCVHHPGAPIFHEGSKGYSCC 148

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKE----VKNVEKEIVQCRHDWYQTPTHIIMSI 173
            R+VLEF++F+KI+GCK K +HLFVGSGK+        E+ +   R D+YQTP+ +I S 
Sbjct: 149 KRRVLEFDQFMKIEGCKTKDRHLFVGSGKKEAAAASGGEEILETVRTDFYQTPSSVIASF 208

Query: 174 FAKKVDKQNSSVTFREKEVMICL 196
           F KK++K  + V F+   +++ L
Sbjct: 209 FLKKINKDAAKVEFKPNSIVLDL 231



>gi|336267110|ref|XP_003348321.1| hypothetical protein SMAC_02818 [Sordaria macrospora k-hell]
 gi|380091974|emb|CCC10241.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 321

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 92/143 (64%), Gaps = 9/143 (6%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+D+  I +     C+R +CG  Y   A+  GE    +C++H G P+FHEGSKG+SCC
Sbjct: 114 ESEDDEEGIEIPEGRVCRRKTCGAAYQKGASREGE----KCVHHPGAPIFHEGSKGYSCC 169

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKE----VKNVEKEIVQCRHDWYQTPTHIIMSI 173
            R+VLEF++F+KI+GCK K +HLFVGSGK+        E+ +   R D+YQTPT +I S 
Sbjct: 170 KRRVLEFDQFMKIEGCKTKDRHLFVGSGKKEAAAASGGEEILETVRTDFYQTPTSVIASF 229

Query: 174 FAKKVDKQNSSVTFREKEVMICL 196
           F KK++K  ++V F+   + + L
Sbjct: 230 FLKKINKDVATVEFKPNAIDLDL 252



 Score = 72.0 bits (175), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 8/65 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK Y D        PE  C YH G PVFHEG KGW CC  +VL FEEF+ I+ C
Sbjct: 7   CVHQGCGKVYTD--------PEEVCRYHPGPPVFHEGQKGWKCCKPRVLTFEEFMTIEPC 58

Query: 135 KKGKH 139
            +GKH
Sbjct: 59  TEGKH 63



>gi|336464494|gb|EGO52734.1| hypothetical protein NEUTE1DRAFT_126191 [Neurospora tetrasperma
           FGSC 2508]
          Length = 299

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 91/143 (63%), Gaps = 9/143 (6%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E ++D+  I +     C+R +CG  Y   A   GE    +C++H G P+FHEGSKG+SCC
Sbjct: 93  ESDDDEEGIEIPDGRVCRRKACGATYQKGANREGE----KCVHHPGAPIFHEGSKGYSCC 148

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKE----VKNVEKEIVQCRHDWYQTPTHIIMSI 173
            R+VLEF++F+KI+GCK K +HLFVGSGK+        E+ +   R D+YQTP+ +I S 
Sbjct: 149 KRRVLEFDQFMKIEGCKTKDRHLFVGSGKKEAAAASGGEEILEMVRTDFYQTPSSVIASF 208

Query: 174 FAKKVDKQNSSVTFREKEVMICL 196
           F KK++K  + V F+   +++ L
Sbjct: 209 FLKKINKDAAKVEFKPNSIVLDL 231



>gi|239608220|gb|EEQ85207.1| CORD and CS domain-containing protein [Ajellomyces dermatitidis
           ER-3]
 gi|327349404|gb|EGE78261.1| diploid state maintenance protein chpA [Ajellomyces dermatitidis
           ATCC 18188]
          Length = 315

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 93/160 (58%), Gaps = 7/160 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ + +   C+R  C  KY    +   E    +C++H G P+FHEGSKGWSCC
Sbjct: 116 ESESDDPSLAIKAGATCRRRGCNAKYSPSVSRDDE----KCVHHPGQPIFHEGSKGWSCC 171

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EF+KI GCK K +HLF+G GK  K+ E+++   R D+YQT T I+ +++ KK
Sbjct: 172 KRRVLEFDEFMKIIGCKEKARHLFLGKGK--KSGEEKVDNIRTDFYQTATSIMATLYLKK 229

Query: 178 VDKQNSSVTFREKEVMICLYKKGRNIYYMFYLNSYFYIKL 217
           +DK ++ V F     +        N  +    N Y  I +
Sbjct: 230 IDKASAKVNFSSPTTIELDLPTADNKRFKETFNLYAPIDV 269



 Score = 72.0 bits (175), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 48/100 (48%), Gaps = 11/100 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+  C YH G P FHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHKGCGKVFTD--------PDEPCTYHPGPPEFHEGHKGWKCCKPRVLSFDEFLTIPP 55

Query: 134 CKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           C  GKH  V         +KE  Q   D   TP H  ++I
Sbjct: 56  CTTGKHSAV-DDTPAPEPQKETPQAAPD--TTPKHTPIAI 92



>gi|440633022|gb|ELR02941.1| hypothetical protein GMDG_01162 [Geomyces destructans 20631-21]
          Length = 317

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 91/140 (65%), Gaps = 10/140 (7%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           D+ ++ ++    C+R +CG  Y    +  GE    +C +H G P+FHEGSKG+SCC R+V
Sbjct: 114 DNQSLEISEGKTCRRKACGATYKKGQSREGE----KCTHHPGAPIFHEGSKGYSCCKRRV 169

Query: 123 LEFEEFLKIKGC-KKGKHLFVGSGK-----EVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           LEF+EF++I+GC KK +HLF+GSGK     E+   E+++   RHD+YQT   +I S+F K
Sbjct: 170 LEFDEFMRIEGCKKKDRHLFIGSGKKDKKDELSGGEEKVETVRHDYYQTGATVIASLFLK 229

Query: 177 KVDKQNSSVTFREKEVMICL 196
           K+ K+ S+V F  + V + L
Sbjct: 230 KIVKEESTVKFTPQAVELNL 249



>gi|451848200|gb|EMD61506.1| hypothetical protein COCSADRAFT_148323 [Bipolaris sorokiniana
           ND90Pr]
          Length = 316

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 99/165 (60%), Gaps = 13/165 (7%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P++   Q   K  T  P   P   E E+DD +I V     C+R  CG      A  +G 
Sbjct: 97  APRVPTAQAAPKP-TASPAPPP---ESEDDDPSIAVKEGMTCRRKGCG------AVHKGG 146

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
             + E C++H G P+FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ +  
Sbjct: 147 DRQGESCVHHPGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKDRHLFVGSGKKKEGE 206

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           EK     RHD+YQT T ++ S++ KK+DK  +SV F+   V + L
Sbjct: 207 EKLET-VRHDYYQTATSVVASLYLKKIDKTTASVEFQPSSVKLDL 250



 Score = 75.9 bits (185), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 45/83 (54%), Gaps = 8/83 (9%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D+          ECIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDE--------NEECIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKHLFVGSGKEVKNVEKEIV 156
           C KGKH  V      + VE   V
Sbjct: 56  CTKGKHSDVDDTPAPEPVETPDV 78



>gi|358395849|gb|EHK45236.1| hypothetical protein TRIATDRAFT_299931 [Trichoderma atroviride IMI
           206040]
          Length = 318

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 62/132 (46%), Positives = 86/132 (65%), Gaps = 8/132 (6%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           +    EC+R  C  KY   +   GE    EC++H G P+FHEGSKG+SCC R+VLEF++F
Sbjct: 123 IPDGAECRRKGCTIKYKKGSAREGE----ECVHHPGVPIFHEGSKGYSCCKRRVLEFDQF 178

Query: 129 LKIKGCK-KGKHLFVGSGKE---VKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSS 184
           +K++GCK K KHLFVGSGK+       E+ +   RHD+YQT T +I S F KK+ K+ + 
Sbjct: 179 MKMEGCKTKDKHLFVGSGKKDTPESGSEEILTTVRHDFYQTSTQVIASYFLKKIKKETAK 238

Query: 185 VTFREKEVMICL 196
           V F+ KE+ + L
Sbjct: 239 VDFKGKELDLDL 250



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 8/65 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C R  CGK+Y D        PE EC YH G PVFHEG KGW CC  +VL F+EF+ I  C
Sbjct: 5   CVRQGCGKEYTD--------PEEECHYHPGPPVFHEGQKGWKCCKPRVLTFDEFMDIPPC 56

Query: 135 KKGKH 139
             G H
Sbjct: 57  TTGTH 61



>gi|320591275|gb|EFX03714.1| cord and cs domain containing protein [Grosmannia clavigera kw1407]
          Length = 341

 Score =  122 bits (305), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 97/149 (65%), Gaps = 12/149 (8%)

Query: 53  LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEG 111
           +AP E E +E  L IPV     C+R  CG  Y     ++G   EAE C++H G P+FHEG
Sbjct: 132 VAPPESEDDEPSLEIPVGR--VCRRRGCGVAY-----AKGGSREAESCVHHPGAPIFHEG 184

Query: 112 SKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV---EKEIVQCRHDWYQTPT 167
           SKG++CC R+VLEF++F+KI+GC+ KG+HLFVGSG++ K     E+ +   R D+YQ+ T
Sbjct: 185 SKGYTCCKRRVLEFDQFMKIEGCQTKGRHLFVGSGRKDKGSGAGEELLETVRTDFYQSST 244

Query: 168 HIIMSIFAKKVDKQNSSVTFREKEVMICL 196
            + +S F KK+DK  + + F E+ + + L
Sbjct: 245 VLTVSFFLKKIDKDKAVIRFLEEAIDLDL 273



>gi|512207497|gb|EPE36315.1| HSP20-like chaperone [Glarea lozoyensis ATCC 20868]
          Length = 286

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 87/126 (69%), Gaps = 10/126 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R +CG+ Y    T   EG   +C+YH G P+FHEGSKG++CC R+VLEF+EF+KI+GC
Sbjct: 99  CRRKACGQSY----TGNREG--EKCVYHPGAPIFHEGSKGYTCCKRRVLEFDEFMKIEGC 152

Query: 135 K-KGKHLFVGSGKEVK---NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREK 190
           K K +HLFVGSG++ K     E+ +   RHD+YQTPT  I S F KK++K+ + V F + 
Sbjct: 153 KTKDRHLFVGSGEKSKAKTGGEEVLETVRHDFYQTPTSAIASFFLKKINKEKAVVEFSKT 212

Query: 191 EVMICL 196
           E+ + L
Sbjct: 213 ELNLDL 218



>gi|116180402|ref|XP_001220050.1| hypothetical protein CHGG_00829 [Chaetomium globosum CBS 148.51]
 gi|88185126|gb|EAQ92594.1| hypothetical protein CHGG_00829 [Chaetomium globosum CBS 148.51]
          Length = 328

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/133 (45%), Positives = 85/133 (63%), Gaps = 17/133 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R  CG  Y   ++  GE     C++H G P+FHEGSKG+ CC R+VLEF++F+KI+GC
Sbjct: 133 CRRKGCGATYTKGSSREGEA----CVHHPGAPIFHEGSKGYVCCKRRVLEFDQFMKIEGC 188

Query: 135 K-KGKHLFVGSGKEVKNV----------EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNS 183
           K K +HLFVGSG   KN           E+ +   RHD+YQTPT +I S F KK+DK+ +
Sbjct: 189 KTKNRHLFVGSGS--KNATGKGPTGSGGEELLETVRHDFYQTPTAVIASFFLKKIDKEAA 246

Query: 184 SVTFREKEVMICL 196
            V F E+ +++ L
Sbjct: 247 KVEFEEQALVLDL 259



>gi|429848165|gb|ELA23679.1| cord and cs domain protein [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 321

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 92/140 (65%), Gaps = 11/140 (7%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSRK 121
           DD ++ +A    C+R +C   Y      +G   +AE C++H G P+FHEGSKG+SCC R+
Sbjct: 118 DDASLEIADGATCRRKACSATY-----RKGSSRDAESCVHHPGVPIFHEGSKGYSCCKRR 172

Query: 122 VLEFEEFLKIKGCK-KGKHLFVGSGKE----VKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           VLEF++F+KI+GCK K +HLF+GSGK+        E+++   R+D+YQTP+ +I S F K
Sbjct: 173 VLEFDQFMKIEGCKTKNRHLFIGSGKKKGAAADGGEEKLDTVRNDFYQTPSTVIASFFLK 232

Query: 177 KVDKQNSSVTFREKEVMICL 196
           K+ K ++ + F+ + + + L
Sbjct: 233 KIVKDSAKIEFKSQSIALDL 252



>gi|380475580|emb|CCF45181.1| CORD and CS domain-containing protein [Colletotrichum higginsianum]
          Length = 323

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 91/140 (65%), Gaps = 11/140 (7%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ +   T C+R +C   Y    +  GE     C++H G P+FHEGSKG+SCC R+V
Sbjct: 120 DDASLEIPDGTTCRRKACSVTYRKGTSRDGE----SCVHHPGVPIFHEGSKGYSCCKRRV 175

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNV-----EKEIVQCRHDWYQTPTHIIMSIFAK 176
           LEF++F+KI+GCK K +HLF+GSGK+ KN      E+++   R D+YQTP+ +I S F K
Sbjct: 176 LEFDQFMKIEGCKTKDRHLFIGSGKK-KNAAAAGGEEKLDTVRTDFYQTPSTVIASFFLK 234

Query: 177 KVDKQNSSVTFREKEVMICL 196
           K+ K ++ + F+ + + + L
Sbjct: 235 KIVKDSAKIEFKPQSIALDL 254



>gi|512186481|gb|EPE02273.1| cord and cs domain protein [Ophiostoma piceae UAMH 11346]
          Length = 347

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 84/146 (57%), Gaps = 10/146 (6%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           EEDD  + +     C+R  C   Y   A      P+  C +H G P+FHEGSKG+SCC R
Sbjct: 134 EEDDPTLEIPDGRTCQRRGCNATYTKGADRSATAPDENCEHHPGAPIFHEGSKGYSCCKR 193

Query: 121 KVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEK---------EIVQCRHDWYQTPTHII 170
           +VLEF++F+KI+GC KK +HLFVG  K   N +          E+   R D+YQ+ T + 
Sbjct: 194 RVLEFDQFMKIEGCHKKPRHLFVGRKKAPANAQNTEGGEAGEEEVKDVRFDFYQSATSLT 253

Query: 171 MSIFAKKVDKQNSSVTFREKEVMICL 196
           +S F KK+DK+ + V F E+ V + L
Sbjct: 254 VSFFLKKIDKERAVVMFEEQSVSLDL 279



>gi|440482082|gb|ELQ62604.1| CORD and CS domain-containing protein, partial [Magnaporthe oryzae
           P131]
          Length = 255

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (58%), Gaps = 13/145 (8%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           E+DD  + +     C+R +CG  Y   A   GE    +C++H G P+FHEGSKG+SCC R
Sbjct: 47  EDDDPALEIPDGKTCRRKTCGATYKKGAAREGE----QCVHHPGVPIFHEGSKGYSCCKR 102

Query: 121 KVLEFEEFLKIKGCK-KGKHLFV--------GSGKEVKNVEKEIVQCRHDWYQTPTHIIM 171
           +VLEF++F+KI+GC  KG+HLF+               + E+ +   RHD+YQT T +I 
Sbjct: 103 RVLEFDQFMKIEGCATKGRHLFIGSGGKKKGAGANGAGDGEQLLESVRHDYYQTATTVIA 162

Query: 172 SIFAKKVDKQNSSVTFREKEVMICL 196
           S F KK+DK  + V F  + + + L
Sbjct: 163 SFFLKKIDKDRAKVIFNAQSITLDL 187



>gi|261203499|ref|XP_002628963.1| CORD and CS domain-containing protein [Ajellomyces dermatitidis
           SLH14081]
 gi|239586748|gb|EEQ69391.1| CORD and CS domain-containing protein [Ajellomyces dermatitidis
           SLH14081]
          Length = 315

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 91/156 (58%), Gaps = 7/156 (4%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ + +   C+R  C  KY    +   E    +C++H G P+FHEGSKGWSCC R+V
Sbjct: 120 DDPSLAIKAGATCRRRGCNAKYSPSVSRDDE----KCVHHPGQPIFHEGSKGWSCCKRRV 175

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GCK + +HLF+G GK  K+ E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 176 LEFDEFMKIIGCKERARHLFLGKGK--KSGEEKVDNIRTDFYQTATSIMATLYLKKIDKA 233

Query: 182 NSSVTFREKEVMICLYKKGRNIYYMFYLNSYFYIKL 217
           ++ V F     +        N  +    N Y  I +
Sbjct: 234 SAKVNFSSPTTIELDLPTADNKRFKETFNLYAPIDV 269



 Score = 72.0 bits (175), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 48/100 (48%), Gaps = 11/100 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+  C YH G P FHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHKGCGKVFTD--------PDEPCTYHPGPPEFHEGHKGWKCCKPRVLSFDEFLTIPP 55

Query: 134 CKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           C  GKH  V         +KE  Q   D   TP H  ++I
Sbjct: 56  CTTGKHSAV-DDTPAPEPQKETPQAAPD--TTPKHTPIAI 92



>gi|71017293|ref|XP_758971.1| hypothetical protein UM02824.1 [Ustilago maydis 521]
 gi|46098637|gb|EAK83870.1| hypothetical protein UM02824.1 [Ustilago maydis 521]
          Length = 368

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/145 (42%), Positives = 88/145 (60%), Gaps = 10/145 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E++P + D  +  +    CKR  CG K+  D   R    E+ C +H G+P+FHEGSKGWS
Sbjct: 156 EQDPADADATL--SPGVVCKRAGCGYKH--DGGVRDRSSES-CKHHKGSPIFHEGSKGWS 210

Query: 117 CCSRKVLEFEEFLKIKGCKKGK--HLFVGSGKEV---KNVEKEIVQCRHDWYQTPTHIIM 171
           CC R+VL+F +FL+I+ C   K  HLFVG+ K        ++E V CR D Y+TP  I +
Sbjct: 211 CCKRRVLDFNDFLQIQPCTTSKFGHLFVGAAKPAALDATDDEERVDCRMDHYETPNDIRL 270

Query: 172 SIFAKKVDKQNSSVTFREKEVMICL 196
           S++AK VD  NSS+ F++  V+  L
Sbjct: 271 SVYAKAVDAANSSIEFKQDAVVFSL 295



>gi|465793934|emb|CCU98832.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 309

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 62/164 (37%), Positives = 94/164 (57%), Gaps = 10/164 (6%)

Query: 36  KISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP 95
           ++S     ++T    PK      EP + +    +A+ T C+RP CG  +V +A       
Sbjct: 83  QLSGDAPQTRTAPAPPKATEPAPEPRDPETLTSIAAGTACRRPGCG--FVAEAAIPARDR 140

Query: 96  EAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGK--HLFVGSGKEVKNVE 152
            AE C YH GTP+FHEGSKG++CC R+VL F++FL+I+ C   +  HLF      V   +
Sbjct: 141 TAESCRYHRGTPIFHEGSKGYTCCKRRVLHFDDFLQIEPCTTAEHGHLFA-----VPEPD 195

Query: 153 KEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           K  V CR D Y+TP  + ++++AK VD + S++  RE EV++ L
Sbjct: 196 KAQVSCRVDHYETPADVRVTVYAKNVDAEQSTIEIRESEVVLSL 239



>gi|302925638|ref|XP_003054134.1| hypothetical protein NECHADRAFT_98694 [Nectria haematococca mpVI
           77-13-4]
 gi|256735075|gb|EEU48421.1| hypothetical protein NECHADRAFT_98694 [Nectria haematococca mpVI
           77-13-4]
          Length = 318

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/136 (45%), Positives = 88/136 (64%), Gaps = 10/136 (7%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L IP  +   CKR +CG  Y   ++  GE    EC++H G P+FHEGSKG+SCC R+VLE
Sbjct: 121 LEIPDGA--ACKRKTCGAVYKKGSSRDGE----ECVHHPGVPIFHEGSKGYSCCKRRVLE 174

Query: 125 FEEFLKIKGCK-KGKHLFV---GSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           F++F+KI+GCK K KHLFV    +G      E+ +   RHD+YQTP ++I S F KK++K
Sbjct: 175 FDQFMKIEGCKTKTKHLFVGSGKNGNGNGGAEEVLTTVRHDFYQTPANVIASFFLKKINK 234

Query: 181 QNSSVTFREKEVMICL 196
           + + V  + K+V + L
Sbjct: 235 ETAKVELQAKQVNLDL 250



>gi|443898867|dbj|GAC76201.1| Zn2+-binding protein Melusin/RAR1 [Pseudozyma antarctica T-34]
          Length = 369

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 8/152 (5%)

Query: 48  TEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPV 107
            + PK    E++P E D N+P      CKR  CG K+  +  SR    E  C +H GTP+
Sbjct: 150 AQAPKEPVEEEDPVESDANLPAG--LTCKRGGCGFKF--EGGSRDRSSET-CNHHKGTPI 204

Query: 108 FHEGSKGWSCCSRKVLEFEEFLKIKGCKKGK--HLFVGSGK-EVKNVEKEIVQCRHDWYQ 164
           FHEGSKGWSCC R+VL+F++FLKI+ C   K  HLFVG+ K +     +E V CR D Y+
Sbjct: 205 FHEGSKGWSCCKRRVLDFDDFLKIEPCSTAKSGHLFVGAPKTDAGAGGEESVDCRMDHYE 264

Query: 165 TPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           TP  + ++++AK VD   SS+ F+E+ V+  L
Sbjct: 265 TPNDVRLTVYAKAVDAGQSSIEFQEQGVVFSL 296



>gi|470249919|ref|XP_004367191.1| hypothetical protein DFA_07328 [Dictyostelium fasciculatum]
 gi|328871838|gb|EGG20208.1| hypothetical protein DFA_07328 [Dictyostelium fasciculatum]
          Length = 309

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 85/141 (60%), Gaps = 9/141 (6%)

Query: 53  LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGS 112
           L P E     D  N  +A +  C R  C   YVD+++      + ECIYHSG PVFH+GS
Sbjct: 115 LPPKEYVEVNDPENAVIAVNGPCLRQGCKSVYVDESSR-----QQECIYHSGEPVFHDGS 169

Query: 113 KGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMS 172
           KG+SCC  K   FEEFLKIKGCK GKH FVG     K V++  + C++DWYQ+   + ++
Sbjct: 170 KGYSCCKPKAAIFEEFLKIKGCKTGKHRFVGE----KKVQENSIVCKYDWYQSYDAVHLT 225

Query: 173 IFAKKVDKQNSSVTFREKEVM 193
           I+AK+ + Q S + F + + +
Sbjct: 226 IYAKQANTQLSKIEFTDNQTI 246



 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 7/65 (10%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C   SC K+Y  D T+  +     C YH G+ +FH+G KGWSCCS++V+EFE+FL+I GC
Sbjct: 4   CGNNSCDKEY--DETTLDQ-----CCYHPGSAIFHDGMKGWSCCSKRVIEFEDFLQISGC 56

Query: 135 KKGKH 139
             G+H
Sbjct: 57  ASGRH 61



>gi|389633065|ref|XP_003714185.1| CORD and CS domain-containing protein [Magnaporthe oryzae 70-15]
 gi|351646518|gb|EHA54378.1| CORD and CS domain-containing protein [Magnaporthe oryzae 70-15]
 gi|440473693|gb|ELQ42475.1| CORD and CS domain-containing protein [Magnaporthe oryzae Y34]
          Length = 325

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (58%), Gaps = 13/145 (8%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           E+DD  + +     C+R +CG  Y   A   GE    +C++H G P+FHEGSKG+SCC R
Sbjct: 117 EDDDPALEIPDGKTCRRKTCGATYKKGAAREGE----QCVHHPGVPIFHEGSKGYSCCKR 172

Query: 121 KVLEFEEFLKIKGCK-KGKHLFV--------GSGKEVKNVEKEIVQCRHDWYQTPTHIIM 171
           +VLEF++F+KI+GC  KG+HLF+               + E+ +   RHD+YQT T +I 
Sbjct: 173 RVLEFDQFMKIEGCATKGRHLFIGSGGKKKGAGANGAGDGEQLLESVRHDYYQTATTVIA 232

Query: 172 SIFAKKVDKQNSSVTFREKEVMICL 196
           S F KK+DK  + V F  + + + L
Sbjct: 233 SFFLKKIDKDRAKVIFNAQSITLDL 257



>gi|449304691|gb|EMD00698.1| hypothetical protein BAUCODRAFT_61337 [Baudoinia compniacensis UAMH
           10762]
          Length = 332

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 90/150 (60%), Gaps = 6/150 (4%)

Query: 67  IPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFE 126
           +PV     CKR +CG  Y    +  GE    +C++H G  +FHEGSKGW+CC R+VLEF+
Sbjct: 140 LPVPEGAACKRKACGASYKAGQSREGE----DCVHHPGRALFHEGSKGWTCCKRRVLEFD 195

Query: 127 EFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSV 185
           EF+KI GC  K +HLFVG+ K+  N E+ + + R+D+YQT + +I S++ KK++K  S V
Sbjct: 196 EFMKIPGCTTKKRHLFVGAKKD-PNAEELVNEVRNDFYQTASTVIASLYLKKIEKDRSRV 254

Query: 186 TFREKEVMICLYKKGRNIYYMFYLNSYFYI 215
            F +   +        +  Y   L+++  I
Sbjct: 255 VFADDRTVELDLHTSDHKQYKTNLSTFGTI 284



>gi|471574562|gb|EMR72386.1| putative cord and cs domain-containing protein [Eutypa lata UCREL1]
          Length = 329

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 88/140 (62%), Gaps = 13/140 (9%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L IP  +   C+R +CG  Y     SR +  + +C+YH G P+FHEGSKG+SCC R+VLE
Sbjct: 127 LEIPDGA--TCRRKTCGASY-KKGQSRSD--DEQCVYHPGVPIFHEGSKGYSCCKRRVLE 181

Query: 125 FEEFLKIKGCKKG-KHLFVGSGKE-------VKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           F++F+KI+GCK   +HLF+GSGKE         + E+ +   R D+YQTP  +I S F K
Sbjct: 182 FDQFMKIEGCKTSPRHLFIGSGKEKSKSKAGASSGEELLETVRSDFYQTPAAVIASFFLK 241

Query: 177 KVDKQNSSVTFREKEVMICL 196
           K+D   ++V F  + +++ L
Sbjct: 242 KIDSSKATVEFEPQTLVVDL 261



>gi|336380423|gb|EGO21576.1| hypothetical protein SERLADRAFT_410180 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 300

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 92/157 (58%), Gaps = 22/157 (14%)

Query: 54  APIEKEP---EEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFH 109
           AP E  P   EEDDL++PV +        CG  +V D  +R G G EA C YH  + + H
Sbjct: 114 APKEPAPVVEEEDDLSVPVQT-------GCGVAFVSDEVNRIGNGEEATCTYHPASSMTH 166

Query: 110 ---------EGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRH 160
                    E  KG+ CC R+VLEFEEFLKI+GCK+G+H+FV   K      +E  +CR 
Sbjct: 167 SLFSGKEASEMVKGYLCCKRRVLEFEEFLKIEGCKRGRHVFV--PKVSNKAAEEFTECRV 224

Query: 161 DWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLY 197
           D YQTP+ + +S+FAK+VDK+ S+V   E +  I L+
Sbjct: 225 DHYQTPSEVHVSVFAKQVDKERSTVRIEENKRTIDLF 261



>gi|225679587|gb|EEH17871.1| CORD and CS domain-containing protein [Paracoccidioides
           brasiliensis Pb03]
          Length = 314

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 91/160 (56%), Gaps = 7/160 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ + +   C+R  C   +   ++   E    +CI+H G P+FHEGSKGWSCC
Sbjct: 115 ESESDDPSVAINAGATCRRRGCNVSHSLSSSRDDE----KCIHHPGQPIFHEGSKGWSCC 170

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EF+KI GC+ K +HLF+G GK+    E+++   R D+YQT T I+ +++ KK
Sbjct: 171 KRRVLEFDEFMKIAGCREKKRHLFIGKGKQAG--EEKVDNIRTDFYQTATTIMATLYLKK 228

Query: 178 VDKQNSSVTFREKEVMICLYKKGRNIYYMFYLNSYFYIKL 217
           +DK  + V F     +        N  +    N Y  I +
Sbjct: 229 IDKATAKVKFSSPTTIELDLPTSDNKRFRESFNLYAPIDV 268



 Score = 72.4 bits (176), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 43/84 (51%), Gaps = 13/84 (15%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+  C+YH G P FHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCVHKGCGKLFTD--------PDEPCVYHPGPPEFHEGQKGWKCCKPRVLTFEEFLSIPP 55

Query: 134 CKKGKHLFVG-----SGKEVKNVE 152
           C  GKH  V      S KE   +E
Sbjct: 56  CTTGKHSMVDTPALESAKEPPQIE 79



>gi|358056186|dbj|GAA97926.1| hypothetical protein E5Q_04606 [Mixia osmundae IAM 14324]
          Length = 390

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 94/168 (55%), Gaps = 14/168 (8%)

Query: 44  SKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHS 103
           S    E P+      E E+D ++  V +   CKR  C     DD+  R      EC +H 
Sbjct: 159 SAAADESPRSPEPAAELEQDPIDASVQAGMRCKRKGC-PISADDSLDRNAD---ECRFHP 214

Query: 104 GTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWY 163
           G PVFHEGSKG+SCC ++VL+F +FL + GC   +HLFVG  K  K +E   ++ RHD+Y
Sbjct: 215 GDPVFHEGSKGYSCCKKRVLDFGDFLALPGCSTSRHLFVGRPKP-KTIEP--LRLRHDFY 271

Query: 164 QTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL-------YKKGRNIY 204
           QTP  +I S+F KK  K++S V F + ++ + L       Y+K  ++Y
Sbjct: 272 QTPKTVIASVFGKKASKEDSRVIFEQWQMHVDLRLPDEQHYQKTFSLY 319



>gi|367043696|ref|XP_003652228.1| hypothetical protein THITE_2113476 [Thielavia terrestris NRRL 8126]
 gi|346999490|gb|AEO65892.1| hypothetical protein THITE_2113476 [Thielavia terrestris NRRL 8126]
          Length = 320

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 88/140 (62%), Gaps = 13/140 (9%)

Query: 66  NIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEF 125
            + +   + C+R  CG  Y   ++  GE     C++H G P+FHEGSKG+SCC R+VLEF
Sbjct: 116 TVEIPDGSVCRRKGCGAVYKKGSSREGE----TCVHHPGVPIFHEGSKGYSCCKRRVLEF 171

Query: 126 EEFLKIKGCK-KGKHLFVGSGKEVK--------NVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           ++F+KI+GCK K +HLFVGSGK+            E+ +   R D+YQT T +I S F K
Sbjct: 172 DQFMKIEGCKTKQRHLFVGSGKKAAGGKGSGTSGGEELLETVRSDFYQTLTTVIASFFLK 231

Query: 177 KVDKQNSSVTFREKEVMICL 196
           K+DK+ + V F+E+ +++ L
Sbjct: 232 KIDKEAAKVEFQEQALVLDL 251



 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D        P+  C YH G PVFHEG KGW CC  +VL FEEF+KI+ 
Sbjct: 4   KCVHQGCGKLYTD--------PDEVCRYHPGPPVFHEGQKGWKCCKPRVLTFEEFMKIEP 55

Query: 134 CKKGKH 139
           C +GKH
Sbjct: 56  CTEGKH 61



>gi|226291319|gb|EEH46747.1| integrin beta-1-binding protein [Paracoccidioides brasiliensis
           Pb18]
          Length = 314

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 89/156 (57%), Gaps = 7/156 (4%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD +I + +   C+R  C   +   ++   E    +CI+H G P+FHEGSKGWSCC R+V
Sbjct: 119 DDPSIAINAGATCRRRGCNASHSLSSSRDDE----KCIHHPGQPIFHEGSKGWSCCKRRV 174

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GC+ K +HLF+G GK+    E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 175 LEFDEFMKIAGCREKKRHLFIGKGKQAG--EEKVDNIRTDFYQTATTIMATLYLKKIDKA 232

Query: 182 NSSVTFREKEVMICLYKKGRNIYYMFYLNSYFYIKL 217
            + V F     +        N  +    N Y  I +
Sbjct: 233 TAKVKFSSPTTIELDLPTSDNKRFRESFNLYAPIDV 268



 Score = 72.4 bits (176), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 38/69 (55%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+  C+YH G P FHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCVHKGCGKLFTD--------PDEPCVYHPGPPEFHEGQKGWKCCKPRVLTFEEFLSIPP 55

Query: 134 CKKGKHLFV 142
           C  GKH  V
Sbjct: 56  CTTGKHSMV 64



>gi|225560074|gb|EEH08356.1| CORD and CS domain-containing protein [Ajellomyces capsulatus
           G186AR]
          Length = 335

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 80/126 (63%), Gaps = 8/126 (6%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ + +   C+R  C  KY        E    +C +H G P+FHEGSKGWSCC R+V
Sbjct: 141 DDPSLAIEAGAACRRRGCNGKYSPSVPRDDE----KCEHHPGLPIFHEGSKGWSCCKRRV 196

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GCK + +HLF+G   + K  E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 197 LEFDEFMKIAGCKQRSRHLFIG---KAKKTEEKVDNIRTDFYQTATSIMATLYLKKIDKA 253

Query: 182 NSSVTF 187
           N+ V F
Sbjct: 254 NAKVNF 259



>gi|500259256|gb|EOO02086.1| putative cord and cs domain-containing protein [Togninia minima
           UCRPA7]
          Length = 323

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 87/130 (66%), Gaps = 13/130 (10%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           C+R +CG  Y      +G+  ++E C +H G P+FHEGSKG+SCC R+VLEF++F+KI+G
Sbjct: 128 CRRRACGATY-----KKGQSRDSESCTHHPGVPIFHEGSKGYSCCKRRVLEFDQFMKIEG 182

Query: 134 CK-KGKHLFVGSGKEVKN------VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVT 186
           CK K +HLFVGSGK+ K+       E+ +   R D+YQTP+ +I S F KK++K ++ V 
Sbjct: 183 CKTKDRHLFVGSGKKDKSGKEGGAAEELLETVRTDFYQTPSAVIASFFLKKINKDSAKVI 242

Query: 187 FREKEVMICL 196
           F  + + + L
Sbjct: 243 FTSQSIQLDL 252



 Score = 72.8 bits (177), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D        P+  C YH G P+FHEG KGW CC  +VL FEEF+ I  
Sbjct: 4   KCVHQGCGKTYTD--------PDEVCTYHPGPPIFHEGQKGWKCCKPRVLTFEEFMSIPP 55

Query: 134 CKKGKH 139
           C +GKH
Sbjct: 56  CTEGKH 61



>gi|242768532|ref|XP_002341589.1| CORD and CS domain protein [Talaromyces stipitatus ATCC 10500]
 gi|218724785|gb|EED24202.1| CORD and CS domain protein [Talaromyces stipitatus ATCC 10500]
          Length = 315

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 82/129 (63%), Gaps = 9/129 (6%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L+IP  ++  C+R  C   Y  D +   E     C +H G P+FHEGSKGWSCC R+VLE
Sbjct: 124 LSIP--ANATCRRRGCNATYNPDISRDNE----TCAHHPGQPIFHEGSKGWSCCKRRVLE 177

Query: 125 FEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNS 183
           F+EF+KI GC +K +HLFVG GK     E+++   R D+YQT T +  S++ KK+DK+ +
Sbjct: 178 FDEFMKIPGCTEKKRHLFVGKGKAAG--EEKVEDVRTDFYQTATTVNASLYLKKIDKEKA 235

Query: 184 SVTFREKEV 192
           +VTF    V
Sbjct: 236 NVTFTSNTV 244



 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 40/67 (59%), Gaps = 8/67 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T+C    CGK + D        PE +CIYH G PVFHEG KGW CC  +VL F+EFL I 
Sbjct: 3   TKCVHKGCGKVFTD--------PEEDCIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLNIP 54

Query: 133 GCKKGKH 139
            C  GKH
Sbjct: 55  PCTTGKH 61



>gi|343429635|emb|CBQ73207.1| related to diploid state maintenance protein chpA [Sporisorium
           reilianum SRZ2]
          Length = 367

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 94/170 (55%), Gaps = 10/170 (5%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEP--EEDDLNIPVASDTECKRPSCGKKYVDDATSR 91
           G  +   Q  +++ + + K A   KE   EED  +  +A+   CKR  CG K+   A  R
Sbjct: 128 GMSLLAAQNAAQSTSTDSKEARASKEAVEEEDPTDAALAAGLVCKRGGCGYKHPGGARDR 187

Query: 92  GEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGK--HLFV---GSGK 146
                  C +H G+P+FHEGSKGWSCC R+VL+F +FL+I+ C   +  HLFV    +  
Sbjct: 188 AT---ETCNHHKGSPIFHEGSKGWSCCKRRVLDFNDFLQIQPCSTAQSGHLFVGAPKAAA 244

Query: 147 EVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
                 +E V CR D Y+TP  + ++++AK VD  NSS+ F++  V+  L
Sbjct: 245 GGGADGEESVDCRMDHYETPNDVRLTVYAKAVDAANSSIEFQQDGVVFSL 294



>gi|295667758|ref|XP_002794428.1| diploid state maintenance protein chpA [Paracoccidioides sp.
           'lutzii' Pb01]
 gi|226285844|gb|EEH41410.1| diploid state maintenance protein chpA [Paracoccidioides sp.
           'lutzii' Pb01]
          Length = 317

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 82/126 (65%), Gaps = 7/126 (5%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ + +   C+R  C   +   ++   E    +CI+H G P+FHEGSKGWSCC R+V
Sbjct: 122 DDPSVAINAGATCRRRGCNASHSLSSSRDDE----KCIHHPGQPIFHEGSKGWSCCKRRV 177

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GC+ K +HLF+G GK+    E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 178 LEFDEFMKIAGCREKKRHLFIGKGKQAG--EEKVDNIRTDFYQTATTIMATLYLKKIDKA 235

Query: 182 NSSVTF 187
            + V F
Sbjct: 236 AAKVNF 241



 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 44/86 (51%), Gaps = 15/86 (17%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+  C+YH G P FHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCVHKGCGKLFTD--------PDEPCVYHPGPPEFHEGQKGWKCCKPRVLTFEEFLSIPP 55

Query: 134 CKKGKHLFVG-------SGKEVKNVE 152
           C  GKH  V        S +EV  +E
Sbjct: 56  CTTGKHSMVDTPAPESESAREVPRIE 81



>gi|340914653|gb|EGS17994.1| hypothetical protein CTHT_0060070 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 339

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/129 (44%), Positives = 84/129 (65%), Gaps = 11/129 (8%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R  CG  Y   ++   E    +C++H G P+FHEGSKG++CC R+VLEF++F+KI+GC
Sbjct: 147 CRRRGCGAVYKKGSSREDE----KCVHHPGAPIFHEGSKGYTCCKRRVLEFDQFMKIEGC 202

Query: 135 K-KGKHLFVGSGKEVKNV------EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTF 187
           K K +HLFVGSG + KN       E+ +   R D+YQT T +I S F KK+DK  + V F
Sbjct: 203 KTKNRHLFVGSGNKDKNKNTNADGEEVLDTVRTDFYQTQTSVIASFFLKKIDKDKAKVEF 262

Query: 188 REKEVMICL 196
           +++ V + L
Sbjct: 263 QDRAVDLDL 271



>gi|156053031|ref|XP_001592442.1| hypothetical protein SS1G_06683 [Sclerotinia sclerotiorum 1980]
 gi|154704461|gb|EDO04200.1| hypothetical protein SS1G_06683 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 318

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 94/144 (65%), Gaps = 11/144 (7%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSK 113
           P   E E+DD ++ +     C+R +CGK+Y       G+G E E C++H G P+FHEGSK
Sbjct: 108 PPPAESEDDDASLEIPVGKTCRRKACGKQY------EGKGREGEKCVFHPGVPIFHEGSK 161

Query: 114 GWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKE---IVQCRHDWYQTPTHI 169
           G++CC R+VLEF+EF+KI+GCK K  HLF+GSG + K+ E     +   R+D+YQT + +
Sbjct: 162 GYTCCKRRVLEFDEFMKIEGCKSKDAHLFIGSGGKGKSKEGGEEILETVRYDFYQTASSV 221

Query: 170 IMSIFAKKVDKQNSSVTFREKEVM 193
           I S F KK++K N+ V+F   + +
Sbjct: 222 IASFFLKKINKDNAVVSFSASQEL 245



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   SCGK Y D         E +C+YH G PVFHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHQSCGKVYTDS--------EEDCLYHPGPPVFHEGQKGWKCCKPRVLTFDEFLSIPP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|281210930|gb|EFA85096.1| predicted protein [Polysphondylium pallidum PN500]
          Length = 307

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 97/170 (57%), Gaps = 14/170 (8%)

Query: 26  NGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPEE--DDLNIPVASDTECKRPSCGKK 83
           NG E+Y +  K  +     K +T +PK     KE  E  D+ N  +    +C R  C   
Sbjct: 87  NGREVYGTHDKERF---YPKPVTTQPKPQITVKEYIELNDEPNAIIKEGAKCTRNGCTAT 143

Query: 84  YVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVG 143
           YV++ +      E  C YH G  VFHEGSKGW+CC  K   FEEFLKIKGC++GKH F+ 
Sbjct: 144 YVNEQSR-----EETCTYHPGDAVFHEGSKGWACCKPKAALFEEFLKIKGCREGKHKFIP 198

Query: 144 SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVM 193
           +  EVKN  +  V+CR+DWYQ+   +  +I++K V+K+ S V F ++  +
Sbjct: 199 T--EVKN--ENFVECRNDWYQSFDCVHFTIYSKNVNKEKSVVEFVDRNTV 244



 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 43/65 (66%), Gaps = 7/65 (10%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK+Y ++          +C YH G+ +FHEG KGWSCCS++V++F++FL+I GC
Sbjct: 3   CGNNGCGKEYTEETV-------GQCCYHPGSAIFHEGMKGWSCCSKRVVDFDDFLQIPGC 55

Query: 135 KKGKH 139
             G+H
Sbjct: 56  STGQH 60



>gi|240278824|gb|EER42330.1| CORD and CS protein [Ajellomyces capsulatus H143]
 gi|325090078|gb|EGC43388.1| CORD and CS domain-containing protein [Ajellomyces capsulatus H88]
          Length = 314

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 80/126 (63%), Gaps = 8/126 (6%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ + +   C+R  C  KY        E    +C +H G P+FHEGSKGWSCC R+V
Sbjct: 120 DDPSLAIEAGAACRRRGCNGKYSPCVPRDDE----KCEHHPGLPIFHEGSKGWSCCKRRV 175

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GCK + +HLF+G   + K  E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 176 LEFDEFMKIAGCKQRSRHLFIG---KAKKTEEKVDNIRTDFYQTATSIMATLYLKKIDKA 232

Query: 182 NSSVTF 187
           N+ V F
Sbjct: 233 NAKVNF 238



 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 51/102 (50%), Gaps = 15/102 (14%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   SCGK + D        P+  C+YH G P FHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHKSCGKVFTD--------PDEVCVYHPGPPEFHEGHKGWKCCKPRVLSFDEFLAIPP 55

Query: 134 CKKGKHLFV--GSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           C  GKH  V      E KN   EI         TP HI ++I
Sbjct: 56  CTTGKHSAVDNAPAPESKNDAPEIAP-----DTTPKHIPIAI 92



>gi|347837628|emb|CCD52200.1| similar to CORD and CS domain-containing protein [Botryotinia
           fuckeliana T4]
 gi|472244406|gb|EMR89023.1| putative cord and cs domain-containing protein [Botryotinia
           fuckeliana BcDW1]
          Length = 319

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 90/134 (67%), Gaps = 11/134 (8%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSC 117
           E E+DD ++ +     C+R +CG++Y       G+  E E C++H G P+FHEGSKG++C
Sbjct: 113 ESEDDDASLEIPVGKTCRRKACGQQY------EGKSREGEKCVFHPGVPIFHEGSKGYTC 166

Query: 118 CSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKE---IVQCRHDWYQTPTHIIMSI 173
           C R+VLEF+EF+KI+GCK KG HLF+GSG + K  E     +   RHD+YQT T +I S 
Sbjct: 167 CKRRVLEFDEFMKIEGCKTKGSHLFIGSGGKGKAKEGGEEILDTVRHDFYQTATSVIASF 226

Query: 174 FAKKVDKQNSSVTF 187
           F KK+ K+++ V+F
Sbjct: 227 FLKKIKKEDAVVSF 240



 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   SC K Y D        PE +C+YH G PVFHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHQSCTKVYTD--------PEEDCLYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIPP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|367020152|ref|XP_003659361.1| hypothetical protein MYCTH_2313667 [Myceliophthora thermophila ATCC
           42464]
 gi|347006628|gb|AEO54116.1| hypothetical protein MYCTH_2313667 [Myceliophthora thermophila ATCC
           42464]
          Length = 324

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 88/131 (67%), Gaps = 13/131 (9%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R +CG  Y   ++  GE    +C++H G P+FHEGSKG+SCC R+VLEF++F+KI+GC
Sbjct: 129 CRRRACGAIYKKGSSREGE----KCVHHPGVPIFHEGSKGYSCCKRRVLEFDQFMKIEGC 184

Query: 135 K-KGKHLFVGSGKEVKNV--------EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSV 185
           K K +HLFVGSGK+            E+ +   R+D+YQT T +I S F KK+DK  + V
Sbjct: 185 KTKDRHLFVGSGKKDAAAKAPAGPDGEELLETVRNDFYQTATSVIASFFLKKIDKDAAKV 244

Query: 186 TFREKEVMICL 196
            F+E+++++ L
Sbjct: 245 EFQERKLVLDL 255



 Score = 72.8 bits (177), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 39/65 (60%), Gaps = 8/65 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK+Y D        P+  C YH G PVFHEG KGW CC  +VL FEEF+ I+ C
Sbjct: 8   CVHSGCGKEYTD--------PDEVCRYHPGPPVFHEGQKGWKCCKPRVLTFEEFMAIEPC 59

Query: 135 KKGKH 139
            +GKH
Sbjct: 60  TEGKH 64



>gi|388853900|emb|CCF52398.1| related to diploid state maintenance protein chpA [Ustilago hordei]
          Length = 365

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 81/139 (58%), Gaps = 10/139 (7%)

Query: 64  DLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVL 123
           D ++P      CKR  CG K+   A  R +     C +H G+P+FHEGSKGWSCC R+VL
Sbjct: 160 DASLPAG--LVCKRGGCGFKFEGGARDRSK---ETCKHHKGSPIFHEGSKGWSCCKRRVL 214

Query: 124 EFEEFLKIKGCKKGK--HLFVGSGKEVKNVE---KEIVQCRHDWYQTPTHIIMSIFAKKV 178
           +F +FL+I  C   K  HLFVG+ K   +     +E V CR D Y+TP  + ++++AK V
Sbjct: 215 DFNDFLQIVPCTTAKSGHLFVGAPKTAADGSADGEESVDCRMDHYETPNDVRLTVYAKAV 274

Query: 179 DKQNSSVTFREKEVMICLY 197
           D  NSS+ F E  V+  L 
Sbjct: 275 DAANSSIEFNEDGVVFSLL 293



>gi|477537008|gb|ENH88468.1| cord and cs domain protein [Colletotrichum orbiculare MAFF 240422]
          Length = 320

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 85/139 (61%), Gaps = 9/139 (6%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ +     C+R +C   Y   A   GE     C++H G P+FHEGSKG+SCC R+V
Sbjct: 117 DDASLEIPDGATCRRKTCSATYRKGAARDGES----CVHHPGVPIFHEGSKGYSCCKRRV 172

Query: 123 LEFEEFLKIKGCK-KGKHLFV----GSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
           LEF++F+KI+GC+ K +HLF+      G      E+++   R+D+YQTP+ +I S F KK
Sbjct: 173 LEFDQFMKIEGCQTKTRHLFIGSGKKKGSSGNGQEEKVESVRNDFYQTPSTVIASFFLKK 232

Query: 178 VDKQNSSVTFREKEVMICL 196
           + K ++ + F+ + + + L
Sbjct: 233 IVKDSAKIEFKAQSIAVDL 251



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D        PE  C+YH G P+FHEG KGW CC  +VL FEEF+ I  
Sbjct: 4   KCVHQGCGKTYSD--------PEEPCVYHPGPPIFHEGQKGWKCCKPRVLTFEEFMTIPP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|378729041|gb|EHY55500.1| hypothetical protein HMPREF1120_03634 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 331

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 85/154 (55%), Gaps = 20/154 (12%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E ++ D +  +     CKR  CGK   D    R E    EC+YH G P+FHEGSKGW+CC
Sbjct: 113 ESDDPDADASIPPGATCKRRGCGKSR-DPNIPRDE---EECVYHPGVPIFHEGSKGWTCC 168

Query: 119 SRKVLEFEEFLKIKGCKKGK-HLFVGSGKEVKNVEKE---------------IVQCRHDW 162
            R+VLEF+EFLKI+GCK+ K H ++G  ++ K                    +   R+D+
Sbjct: 169 KRRVLEFDEFLKIQGCKRRKRHCYIGKKRDDKKGAGANGVVNGNGGGEEEELLSTVRNDF 228

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           YQTPT +I S + KK+ K+ + V FR   + I L
Sbjct: 229 YQTPTSVIASFYLKKIVKERAKVEFRGNGLEIDL 262



 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+ EC+YH G P FHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHKGCGKTFTD--------PDEECVYHPGPPEFHEGQKGWKCCKPRVLTFDEFLAIPP 55

Query: 134 CKKGKHLFV 142
           C KGKH  V
Sbjct: 56  CTKGKHSTV 64



>gi|310790918|gb|EFQ26451.1| CORD and CS domain-containing protein [Glomerella graminicola
           M1.001]
          Length = 322

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 86/138 (62%), Gaps = 8/138 (5%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ +   T C+R +C   +   A+  GE     C++H G P+FHEGSKG+SCC R+V
Sbjct: 120 DDASLEIPDGTTCRRKACSATFHKGASRDGE----SCVHHPGVPIFHEGSKGYSCCKRRV 175

Query: 123 LEFEEFLKIKGCK-KGKHLFV---GSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKV 178
           LEF++F+KI+GCK K +HLF+            E+++   R D+YQTP+ +I S F KK+
Sbjct: 176 LEFDQFMKIEGCKTKNRHLFIGSGKKKAAAAGGEEKLDTVRTDFYQTPSTVIASFFLKKI 235

Query: 179 DKQNSSVTFREKEVMICL 196
            K+++ + F+ + + + L
Sbjct: 236 VKESAKIDFKPQSIALDL 253



>gi|167517191|ref|XP_001742936.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778035|gb|EDQ91650.1| predicted protein [Monosiga brevicollis MX1]
          Length = 312

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 91/170 (53%), Gaps = 20/170 (11%)

Query: 30  IYDSGPKISY----TQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYV 85
           + D  PK+      T ++ + + ++ + A  E E +E      V     C   +C   YV
Sbjct: 101 MRDGAPKVELPLKTTASLERALAQQAETAAKEIESQE------VQPGQACTHNACKGSYV 154

Query: 86  DDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCS-RKVLEFEEFLKIKGCKKGKHLFVGS 144
           D++++     E +C +H GTPVFHEG K WSCC  +K  EF+EFL  KGC  GKH +   
Sbjct: 155 DESSN-----EEDCFHHPGTPVFHEGYKYWSCCPKKKTYEFDEFLDFKGCTVGKHRWFKP 209

Query: 145 GKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMI 194
            +E    +    QCR+DW+Q+ TH+++++FAK ++   +SV      + I
Sbjct: 210 AEESAKAK----QCRYDWFQSDTHVVLTVFAKCIEPSRTSVKANADSITI 255



>gi|402072105|gb|EJT68059.1| CORD and CS domain-containing protein [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 330

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 86/148 (58%), Gaps = 22/148 (14%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R +CG  Y    +  GE    +C++H G P+FHEGSKG+SCC R+VLEF++F+KI+GC
Sbjct: 128 CRRKACGATYSKVGSRDGE----KCVHHPGAPIFHEGSKGYSCCKRRVLEFDQFMKIEGC 183

Query: 135 K-KGKHLFV--------------GSGKEVKNVEKEIVQ---CRHDWYQTPTHIIMSIFAK 176
           + K +HLF+              G     +   +E+++    RHD+YQT T +I S F K
Sbjct: 184 ETKDRHLFIGSGKKKGKAGANGGGGAAGGQEGGEELLEPGSVRHDYYQTATTVIASFFLK 243

Query: 177 KVDKQNSSVTFREKEVMICLYKKGRNIY 204
           K+DK ++ V+F  + +++ L       Y
Sbjct: 244 KIDKDHAKVSFETQSILLDLPTAAATRY 271



 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 38/65 (58%), Gaps = 7/65 (10%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C   SCGK Y        EG E  C+YH G PVFHEG KGW CC  +VL FEEFL I  C
Sbjct: 5   CVHQSCGKSY-------NEGEEDGCVYHPGPPVFHEGQKGWKCCKPRVLTFEEFLSIPPC 57

Query: 135 KKGKH 139
             G+H
Sbjct: 58  TDGRH 62



>gi|326427601|gb|EGD73171.1| hypothetical protein PTSG_04884 [Salpingoeca sp. ATCC 50818]
          Length = 305

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 92/180 (51%), Gaps = 15/180 (8%)

Query: 28  VEIYDSGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDD 87
            ++ D+ PK+     ++ ++    +     +  EE D    V     C   +C   YVD+
Sbjct: 98  AQVRDAAPKVDLDVKVTPSLERALEKFRARQAEEETD---EVKPGQPCTNNACNATYVDE 154

Query: 88  ATSRGEGPEAECIYHSGTPVFHEGSKGWSCC-SRKVLEFEEFLKIKGCKKGKHLFVGSGK 146
            ++     E EC+YH G PVFHEG K WSCC  +K  EF+EFL+ KGC  GKH +     
Sbjct: 155 MSN-----EEECLYHPGAPVFHEGYKYWSCCPKKKTYEFDEFLEFKGCTTGKHCW----- 204

Query: 147 EVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIYYM 206
            VK    ++ +CRHDW+Q+   + +SI+AK +D +  SV      + + +  +  N Y M
Sbjct: 205 -VKPKTAQVRKCRHDWFQSDDRVSVSIYAKCIDPEKCSVKANSDSLTVDIVYEDINKYTM 263



>gi|67517941|ref|XP_658745.1| hypothetical protein AN1141.2 [Aspergillus nidulans FGSC A4]
 gi|40747103|gb|EAA66259.1| hypothetical protein AN1141.2 [Aspergillus nidulans FGSC A4]
          Length = 739

 Score =  103 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 55/157 (35%), Positives = 83/157 (52%), Gaps = 26/157 (16%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +EPE DD  + +  +  C+R  CG  Y  D +      E  C+YH G PVFHEGSKG
Sbjct: 114 PVPEEPESDDPELAIPENATCRRRGCGGTYKPDVSR----DEERCVYHPGQPVFHEGSKG 169

Query: 115 WSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIF 174
           W+C  +K                +HLFVG GK     E+++   R+D+YQT T + +S++
Sbjct: 170 WACAEKK----------------RHLFVGKGKPAG--EEKVESVRNDFYQTATSVNVSLY 211

Query: 175 AKKVDKQNSSVTFREKEVMICL----YKKGRNIYYMF 207
            KK+DK N+ V F    + + L     K+ ++ Y +F
Sbjct: 212 LKKIDKDNAKVEFTSTGIALDLPTTDNKRYKDSYELF 248



 Score = 80.1 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/67 (50%), Positives = 41/67 (61%), Gaps = 8/67 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T+C    CGK + D        PE  C+YH G PVFHEG KGW+CC  +VL FEEF++I 
Sbjct: 3   TKCVHKGCGKVFTD--------PEEPCVYHPGPPVFHEGQKGWNCCKPRVLTFEEFMEIP 54

Query: 133 GCKKGKH 139
            C  GKH
Sbjct: 55  PCTTGKH 61



>gi|426370096|ref|XP_004052009.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Gorilla gorilla gorilla]
          Length = 218

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 71/121 (58%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 27  ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGPESLEEVCVYHSGVPIFHEGMKYW 78

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 79  SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 133

Query: 176 K 176
           K
Sbjct: 134 K 134



>gi|443702188|gb|ELU00349.1| hypothetical protein CAPTEDRAFT_165685 [Capitella teleta]
          Length = 318

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 68/116 (58%), Gaps = 12/116 (10%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSR 120
           EDD +  V   T CK   C K+Y       GE  + E C++HSG PVFHEG K WSCC R
Sbjct: 143 EDDKDGSVKIGTSCKNKGCKKEY------EGENSDKEVCVFHSGVPVFHEGMKYWSCCQR 196

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           K  +F  FL  +GC  G HL+V      K  E + V+CR+DW+QT T + MS+FAK
Sbjct: 197 KTSDFNNFLDQEGCTNGTHLWVA-----KESESQKVKCRYDWHQTATFVTMSVFAK 247



>gi|209969825|ref|NP_001123267.2| cysteine and histidine-rich domain (CHORD)-containing 1 [Nasonia
           vitripennis]
          Length = 340

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 90/174 (51%), Gaps = 12/174 (6%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P+++   T+S  + E+ +   +    ++D  +I +     CK  SC + Y   A++   
Sbjct: 111 SPQVTLKPTVSPALLEQIQGLTVLDSTKKDVNSIAIGQ--SCKNNSCKRTYQGPASN--- 165

Query: 94  GPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
             +  C YH G P+FHEG K WSCC +K  +F  FL+  GC +G H++V  G   K    
Sbjct: 166 --DEVCTYHPGVPIFHEGLKYWSCCQKKTTDFAVFLEQPGCSQGNHVWVQKGASNKK--- 220

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIYYMF 207
             V+CR DW+QT TH+I+S++AKK +  +S +      + + LY    N  Y  
Sbjct: 221 --VKCRMDWHQTGTHVIVSVYAKKYNPDSSFIKLNPVHLTVDLYFPEENSRYNL 272



>gi|164655004|ref|XP_001728634.1| hypothetical protein MGL_4233 [Malassezia globosa CBS 7966]
 gi|159102515|gb|EDP41420.1| hypothetical protein MGL_4233 [Malassezia globosa CBS 7966]
          Length = 262

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 85/149 (57%), Gaps = 9/149 (6%)

Query: 50  EPKLAPIEKEPE--EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPV 107
           +P  AP+   PE  + D  + V++ T C+R  CG    +D   R    E  C +H GTP+
Sbjct: 117 KPTNAPMPPAPEPCDPDTLVKVSAGTTCRRTGCGYVVPEDIHERDRTKET-CKFHKGTPI 175

Query: 108 FHEGSKGWSCCSRKVLEFEEFLKIKGCKKGK--HLFVGSGKEVKNVEKEIVQCRHDWYQT 165
           FHEGSKG++CC R+VL F++FL+I+ C   +  HLF       K  +   V CR D Y+T
Sbjct: 176 FHEGSKGYTCCKRRVLHFDDFLQIEPCSTAEHGHLFAAP----KPADDTQVDCRIDHYET 231

Query: 166 PTHIIMSIFAKKVDKQNSSVTFREKEVMI 194
           P+ + ++++AK V+   S +  R+ EV +
Sbjct: 232 PSDVRVTVYAKGVEADKSVIEIRDNEVRM 260



>gi|194909877|ref|XP_001982027.1| GG11265 [Drosophila erecta]
 gi|190656665|gb|EDV53897.1| GG11265 [Drosophila erecta]
          Length = 353

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 83/154 (53%), Gaps = 17/154 (11%)

Query: 50  EPKLAP-------IEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           +P +AP       +EK P     +  +   T CK   C   Y   ++  GE     C YH
Sbjct: 109 QPAVAPALKEIVFVEKTPGAPKSSDAIEVGTSCKNNGCTYIYAGTSSDFGE-----CTYH 163

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G P+FHEG K WSCC ++  +F +F+  KGC  G+H +V      +N +K++VQCR+DW
Sbjct: 164 PGVPIFHEGMKFWSCCQKRTSDFAQFMAQKGCAYGEHKWVK-----ENDDKKVVQCRYDW 218

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           +QT T+++++I+AKK D   S V      + + L
Sbjct: 219 HQTATNVVVAIYAKKYDYSQSVVELNPIRLHVNL 252



>gi|321472345|gb|EFX83315.1| hypothetical protein DAPPUDRAFT_195101 [Daphnia pulex]
          Length = 355

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 73/115 (63%), Gaps = 8/115 (6%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           CK   C + YV+++++     ++ C YH+G P+FHEG K W+CC+R+  +F+ FL  +GC
Sbjct: 155 CKNGGCKQTYVNESSN-----DSTCTYHAGVPIFHEGLKYWTCCTRRTSDFQAFLDQEGC 209

Query: 135 KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
             G H++    +E     K+ VQCR DW QT TH+I++I+ KK D  N S+T+ E
Sbjct: 210 STGTHVWKTEKEEQI---KKSVQCRQDWMQTGTHVIVNIYCKKPDPTNDSLTYVE 261



>gi|6581054|gb|AAF18436.1|AF192465_1 CHORD containing protein [Drosophila melanogaster]
          Length = 354

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 83/154 (53%), Gaps = 17/154 (11%)

Query: 50  EPKLAPIEKE-------PEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           +P +AP  K+       P     +  +   T CK   C   +  +++  GE     C YH
Sbjct: 108 QPTVAPALKDMVFAVKTPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGE-----CTYH 162

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G P+FHEG K WSCC ++  +F +F+  KGC  G+H +V      +N +K++VQCR+DW
Sbjct: 163 PGVPIFHEGMKFWSCCQKRTSDFSQFMAQKGCTYGEHKWVK-----ENDDKKVVQCRYDW 217

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           +QT T+++M+I+AKK D   S +      + + L
Sbjct: 218 HQTATNVVMAIYAKKYDYSQSVIELNPIRLHVNL 251



>gi|195400040|ref|XP_002058626.1| GJ14211 [Drosophila virilis]
 gi|194142186|gb|EDW58594.1| GJ14211 [Drosophila virilis]
          Length = 367

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/128 (37%), Positives = 73/128 (57%), Gaps = 10/128 (7%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           VA  T CK   C   Y + ++  GE     C YH G P+FHEG K WSCC ++  +F +F
Sbjct: 142 VAVGTSCKNNGCTYSYTNTSSDFGE-----CTYHPGVPIFHEGMKFWSCCQKRTSDFAQF 196

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
           +  KGC  G+H FV   +     +K++VQCR+DW+QT T+++++++AKK     S V   
Sbjct: 197 MAQKGCVYGQHKFVKDDE-----DKQVVQCRYDWHQTATNVVVTVYAKKFHYAQSVVEVN 251

Query: 189 EKEVMICL 196
              + + L
Sbjct: 252 PIRLHVML 259



>gi|21355187|ref|NP_651226.1| CHORD [Drosophila melanogaster]
 gi|74947746|sp|Q9VCC0.1|CHRD1_DROME RecName: Full=Cysteine and histidine-rich domain-containing
           protein; AltName: Full=Morgana
 gi|7301118|gb|AAF56252.1| CHORD [Drosophila melanogaster]
 gi|17945014|gb|AAL48569.1| RE04143p [Drosophila melanogaster]
 gi|220947790|gb|ACL86438.1| CHORD-PA [synthetic construct]
 gi|220957100|gb|ACL91093.1| CHORD-PA [synthetic construct]
          Length = 354

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 83/154 (53%), Gaps = 17/154 (11%)

Query: 50  EPKLAPIEKE-------PEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           +P +AP  K+       P     +  +   T CK   C   +  +++  GE     C YH
Sbjct: 108 QPTVAPALKDMVFAVKTPAAQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGE-----CTYH 162

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G P+FHEG K WSCC ++  +F +F+  KGC  G+H +V      +N +K++VQCR+DW
Sbjct: 163 PGVPIFHEGMKFWSCCQKRTSDFSQFMAQKGCTYGEHKWVK-----ENDDKKVVQCRYDW 217

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           +QT T+++M+I+AKK D   S +      + + L
Sbjct: 218 HQTATNVVMAIYAKKYDYSQSVIELNPIRLHVNL 251



>gi|241626044|ref|XP_002409601.1| cysteine and histidine-rich domain (chord)-containing, zinc binding
           protein, putative [Ixodes scapularis]
 gi|215503190|gb|EEC12684.1| cysteine and histidine-rich domain (chord)-containing, zinc binding
           protein, putative [Ixodes scapularis]
          Length = 334

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 71/119 (59%), Gaps = 11/119 (9%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSC 117
           E  E + +  V+  T CK   C + Y      +GE    E C+YHSG P+FHEG K W+C
Sbjct: 138 EASESEADTTVSLGTSCKNAGCQQSY------QGEQSNLEICLYHSGFPIFHEGMKYWTC 191

Query: 118 CSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           C RK  +F  FL+ +GC  G HL++    + KN E +   CR+DW+QT +H+++SIF+K
Sbjct: 192 CQRKTSDFANFLEQRGCTSGSHLWI----KKKNAEGDQATCRYDWHQTASHVVVSIFSK 246



>gi|242024533|ref|XP_002432682.1| Integrin beta-1-binding protein, putative [Pediculus humanus
           corporis]
 gi|212518152|gb|EEB19944.1| Integrin beta-1-binding protein, putative [Pediculus humanus
           corporis]
          Length = 316

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 73/136 (53%), Gaps = 10/136 (7%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           E D +  V   T CK   C   Y        E  E EC+YH G PVFHEG K WSCC +K
Sbjct: 137 ESDNSGEVMIGTACKNRGCKSAY-----KGTESNEEECVYHPGVPVFHEGLKSWSCCKKK 191

Query: 122 VLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
             +F  FL+  GC+KG H++V      +N E E   CR+DW+QT +HI+MS++AKK    
Sbjct: 192 TTDFATFLEQLGCEKGNHVWVK-----ENDENERTDCRYDWHQTGSHIVMSVYAKKYHPD 246

Query: 182 NSSVTFREKEVMICLY 197
            S +      + + ++
Sbjct: 247 KSIIELNPIRIKMNIF 262



>gi|332207896|ref|XP_003253031.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Nomascus leucogenys]
          Length = 332

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 71/121 (58%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|426370094|ref|XP_004052008.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Gorilla gorilla gorilla]
          Length = 332

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 71/121 (58%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGPESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|426370098|ref|XP_004052010.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 3 [Gorilla gorilla gorilla]
          Length = 313

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 71/121 (58%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 122 ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGPESLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 K 176
           K
Sbjct: 229 K 229



>gi|307199859|gb|EFN80256.1| Cysteine and histidine-rich domain-containing protein 1
           [Harpegnathos saltator]
          Length = 339

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 92/173 (53%), Gaps = 18/173 (10%)

Query: 35  PKISYTQTISKTITEEPK-LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           P++  + TIS T+ E+ K L  +E +P   ++ I       CK  SC   Y       GE
Sbjct: 112 PQLQLSPTISPTLLEQVKGLTALENKPILGEIQI----GQNCKNNSCKVTY------NGE 161

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVE 152
               E CI+H G P+FHEG K WSCC +K  EF  FL+ +GC  GKH++       K++ 
Sbjct: 162 DSNEEVCIFHPGVPIFHEGLKYWSCCQKKTTEFSVFLEQRGCSLGKHVWFS-----KDIG 216

Query: 153 KEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIYY 205
           K+ VQCR DW+QT T +++S++AKK     S+V      + + L+    N  Y
Sbjct: 217 KK-VQCRMDWHQTGTFVVVSVYAKKYLPSQSAVKLNPVRLTVDLFFIEENSRY 268



 Score = 72.8 bits (177), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C R  CGKK+        +  + +C++H G PVFH+  KGWSCC++K ++F EFL IKGC
Sbjct: 10  CYRRGCGKKF-----DPNDNKDDDCVHHPGQPVFHDAYKGWSCCNKKCIDFTEFLNIKGC 64

Query: 135 KKGKH 139
            K  H
Sbjct: 65  TKATH 69



>gi|260789534|ref|XP_002589801.1| hypothetical protein BRAFLDRAFT_125901 [Branchiostoma floridae]
 gi|229274984|gb|EEN45812.1| hypothetical protein BRAFLDRAFT_125901 [Branchiostoma floridae]
          Length = 324

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 89/154 (57%), Gaps = 10/154 (6%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEG 111
           K  P E+E  E+ +   V+  T CK  +C K + D+ ++     E +C YH GTP FHEG
Sbjct: 128 KQKPSEEESAENAVAGGVSLGTTCKNNACKKTFEDENSN-----EEDCWYHPGTPTFHEG 182

Query: 112 SKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIM 171
            K WSCC+++  +F EFL   GC KGKH+++   KE +   K++  CR DW+QT   +++
Sbjct: 183 YKFWSCCTKRTTDFNEFLSQAGCSKGKHVWI---KEEEGDTKKVA-CRFDWHQTGALVVI 238

Query: 172 SIFAKKVDKQNSSVTFREKEV-MICLYKKGRNIY 204
           SI+AK  D + + V   +  V M  ++ +G + +
Sbjct: 239 SIYAKVCDPEKTFVEANKVRVKMNVVFDQGNSQF 272



>gi|75076829|sp|Q4R7U2.1|CHRD1_MACFA RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHP-1; AltName: Full=Morgana
 gi|67968947|dbj|BAE00830.1| unnamed protein product [Macaca fascicularis]
          Length = 332

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 71/121 (58%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KG+H++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGRHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|383873111|ref|NP_001244685.1| cysteine and histidine-rich domain-containing protein 1 [Macaca
           mulatta]
 gi|355566938|gb|EHH23317.1| hypothetical protein EGK_06763 [Macaca mulatta]
          Length = 332

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 71/121 (58%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KG+H++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGRHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|195504892|ref|XP_002099274.1| GE23458 [Drosophila yakuba]
 gi|194185375|gb|EDW98986.1| GE23458 [Drosophila yakuba]
          Length = 353

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 82/154 (53%), Gaps = 17/154 (11%)

Query: 50  EPKLAPIEKE-------PEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           +P +AP  KE       P     +  +   T CK   C   +   ++  GE     C YH
Sbjct: 109 QPAVAPALKEIVFAAKTPAVQKSSDAIEVGTSCKNNGCTYSFTGTSSDFGE-----CTYH 163

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G P+FHEG K WSCC ++  +F +F+  KGC  G+H +V      +N +K++VQCR+DW
Sbjct: 164 PGVPIFHEGMKFWSCCQKRTSDFAQFMAQKGCAYGEHKWVK-----ENDDKKVVQCRYDW 218

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           +QT T+++++I+AKK D   S V      + + L
Sbjct: 219 HQTATNVVVAIYAKKYDYSQSVVELNPIRLHVYL 252



>gi|402896523|ref|XP_003911346.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Papio anubis]
          Length = 353

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 71/121 (58%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 162 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 213

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KG+H++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 214 SCCRRKTSDFNTFLAQEGCTKGRHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 268

Query: 176 K 176
           K
Sbjct: 269 K 269



>gi|195573393|ref|XP_002104678.1| GD21075 [Drosophila simulans]
 gi|194200605|gb|EDX14181.1| GD21075 [Drosophila simulans]
          Length = 354

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 83/154 (53%), Gaps = 17/154 (11%)

Query: 50  EPKLAPIEKE-------PEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           +P +AP  KE       P     +  +   T CK   C   +  +++  GE     C YH
Sbjct: 108 QPTVAPALKEIVFAAKTPAVQKSSDAIEVGTTCKNNGCTYSFTGNSSDFGE-----CTYH 162

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G P+FHEG K WSCC ++  +F +F+  KGC  G+H +V      +N +K++VQCR+DW
Sbjct: 163 PGVPIFHEGLKFWSCCQKRTSDFAQFMAQKGCTYGEHKWVK-----ENDDKKVVQCRYDW 217

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           +QT T+++++I+AKK D   S +      + + L
Sbjct: 218 HQTATNVVVAIYAKKYDYSQSVIELNPIRLHVNL 251



>gi|397485374|ref|XP_003813823.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Pan paniscus]
          Length = 313

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 71/121 (58%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      +G E  E  C+YHSG P+FHEG K W
Sbjct: 122 ENKKEEDNDEIKIG--TSCKNGGCSKTY------QGLESLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 K 176
           K
Sbjct: 229 K 229



>gi|195331552|ref|XP_002032465.1| GM26571 [Drosophila sechellia]
 gi|194121408|gb|EDW43451.1| GM26571 [Drosophila sechellia]
          Length = 364

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 82/154 (53%), Gaps = 17/154 (11%)

Query: 50  EPKLAPIEKE-------PEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           +P +AP  KE       P     +  +   T CK   C   +  + +  GE     C YH
Sbjct: 108 QPTVAPALKEIVFAAKTPAAQKSSDAIEVGTTCKNNGCTYSFTGNNSDFGE-----CTYH 162

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G P+FHEG K WSCC ++  +F +F+  KGC  G+H +V      +N +K++VQCR+DW
Sbjct: 163 PGVPIFHEGLKFWSCCQKRTSDFAQFMAQKGCTYGEHKWVK-----ENDDKKVVQCRYDW 217

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           +QT T+++++I+AKK D   S +      + + L
Sbjct: 218 HQTATNVVVAIYAKKYDYSQSVIELNPIRLHVNL 251



>gi|195444282|ref|XP_002069796.1| GK11385 [Drosophila willistoni]
 gi|194165881|gb|EDW80782.1| GK11385 [Drosophila willistoni]
          Length = 366

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 65/105 (61%), Gaps = 10/105 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C   Y   ++  GE     C YH G P+FHEG K WSCC ++  +F +F+  K
Sbjct: 144 TTCKNSGCTYTYTGTSSDYGE-----CNYHPGVPIFHEGMKFWSCCQKRTSDFAQFMAQK 198

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
           GC  G+H +V       N +K++VQCRHDW+QT T+++++I+AKK
Sbjct: 199 GCVYGQHKWVND-----NEDKKVVQCRHDWHQTATNVVVTIYAKK 238



>gi|350535042|ref|NP_001233351.1| cysteine and histidine-rich domain-containing protein 1 [Pan
           troglodytes]
 gi|397485372|ref|XP_003813822.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Pan paniscus]
 gi|343962081|dbj|BAK62628.1| cysteine and histidine-rich domain-containing protein [Pan
           troglodytes]
          Length = 332

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (57%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248



>gi|119587274|gb|EAW66870.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_c [Homo sapiens]
 gi|119587275|gb|EAW66871.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_c [Homo sapiens]
 gi|189069207|dbj|BAG35545.1| unnamed protein product [Homo sapiens]
          Length = 332

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (57%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248



>gi|221316566|ref|NP_036256.2| cysteine and histidine-rich domain-containing protein 1 isoform a
           [Homo sapiens]
 gi|167008724|sp|Q9UHD1.2|CHRD1_HUMAN RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHORD-containing protein 1; Short=CHP-1; AltName:
           Full=Protein morgana
 gi|47940672|gb|AAH72461.1| Cysteine and histidine-rich domain (CHORD)-containing 1 [Homo
           sapiens]
 gi|158261485|dbj|BAF82920.1| unnamed protein product [Homo sapiens]
 gi|312151106|gb|ADQ32065.1| cysteine and histidine-rich domain (CHORD)-containing 1 [synthetic
           construct]
          Length = 332

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (57%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248



>gi|221316570|ref|NP_001137545.1| cysteine and histidine-rich domain-containing protein 1 isoform b
           [Homo sapiens]
          Length = 313

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (57%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 122 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 174

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 175 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 229



>gi|12002207|gb|AAG43237.1|AF123249_1 chymotrypsin-like protein [Homo sapiens]
 gi|119587272|gb|EAW66868.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_b [Homo sapiens]
 gi|119587273|gb|EAW66869.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_b [Homo sapiens]
          Length = 313

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 69/120 (57%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 122 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 174

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 175 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 229



>gi|403301743|ref|XP_003941542.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Saimiri boliviensis boliviensis]
          Length = 332

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 70/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|403301745|ref|XP_003941543.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Saimiri boliviensis boliviensis]
          Length = 313

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 70/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 122 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 K 176
           K
Sbjct: 229 K 229



>gi|149719233|ref|XP_001488703.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Equus caballus]
          Length = 332

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/128 (40%), Positives = 74/128 (57%), Gaps = 16/128 (12%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVF 108
           KL+   +E +++D +  +   T CK   C K Y        +GP   E  C+YHSG P+F
Sbjct: 134 KLSSGNEENKKEDDSDEIKIGTPCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIF 185

Query: 109 HEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTH 168
           HEG K WSCC RK  +F  FL  +GC  GKH++       K+V K++V CRHDW+QT   
Sbjct: 186 HEGMKYWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDVGKKVVACRHDWHQTGGE 240

Query: 169 IIMSIFAK 176
           + +S++AK
Sbjct: 241 VTISVYAK 248



>gi|358335563|dbj|GAA27687.2| cysteine and histidine-rich domain-containing protein 1, partial
           [Clonorchis sinensis]
          Length = 322

 Score = 98.6 bits (244), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 68/129 (52%), Gaps = 10/129 (7%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           EED  N+ V   T CK   C   Y   A          C+YH G P+FHEG K W+CC+R
Sbjct: 127 EEDTGNVAVG--TSCKNSGCKATYSGTAADNDL-----CLYHPGVPIFHEGMKYWTCCNR 179

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQ---CRHDWYQTPTHIIMSIFAKK 177
           K  EFE F++  GC  G+H +        N+   I     CRHDW+Q P  +I++++AK 
Sbjct: 180 KTSEFESFMEQIGCATGRHNWTEKAARATNLAVSIAAQATCRHDWFQLPGQVIITVYAKA 239

Query: 178 VDKQNSSVT 186
           V  ++ +VT
Sbjct: 240 VIPESVNVT 248



>gi|118404486|ref|NP_001072688.1| integrin beta 1 binding protein (melusin) 2 [Xenopus (Silurana)
           tropicalis]
 gi|115312970|gb|AAI24022.1| hypothetical protein MGC147501 [Xenopus (Silurana) tropicalis]
          Length = 359

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 97/171 (56%), Gaps = 19/171 (11%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           +  +Q++ K + E+ K+ P EKE ++ + +  +   T CK   C + Y        +GPE
Sbjct: 121 LKVSQSLEKEL-EKLKIKPQEKEVQKVETD-QIGVGTTCKHAGCKEVY--------QGPE 170

Query: 97  AE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
           ++   CI+H G PVFHEG K WSCC+ K  +F EFL  +GC  GKHL+      +K   +
Sbjct: 171 SDAGTCIHHPGVPVFHEGMKFWSCCNIKTSDFNEFLDQRGCASGKHLW------IKTTGR 224

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIY 204
           + V CR+DW+QT + ++++I+AK    + S V   +  + I +  +G++ +
Sbjct: 225 QAVSCRYDWHQTSSVVVITIYAKTAIPELSHVLANQTALDIQISFQGQSEF 275



>gi|206597559|ref|NP_001125118.1| cysteine and histidine-rich domain-containing protein 1 [Pongo
           abelii]
 gi|75042295|sp|Q5RD91.1|CHRD1_PONAB RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHP-1; AltName: Full=Protein morgana
 gi|55727018|emb|CAH90266.1| hypothetical protein [Pongo abelii]
          Length = 332

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 70/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+ HEG K W
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPISHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|498957342|ref|XP_004524138.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Ceratitis capitata]
          Length = 363

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%), Gaps = 12/111 (10%)

Query: 67  IPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFE 126
           IP+   T CK   C   Y   AT        EC+YH G P+FHEG K WSCC RK  +F 
Sbjct: 139 IPIG--TSCKNKGCTYSYTGTATDN-----EECVYHPGAPIFHEGMKYWSCCQRKTSDFA 191

Query: 127 EFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            F+  KGC  G+H++    +     ++++V CR+DW+QTP+++I+SI+AKK
Sbjct: 192 VFIAQKGCACGEHMWFKEDQ-----DRKVVICRYDWHQTPSNVIVSIYAKK 237



>gi|281337340|gb|EFB12924.1| hypothetical protein PANDA_005065 [Ailuropoda melanoleuca]
          Length = 275

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 84  ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 133

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 134 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 188

Query: 174 FAK 176
           +AK
Sbjct: 189 YAK 191



>gi|301763016|ref|XP_002916922.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Ailuropoda melanoleuca]
          Length = 332

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAK 176
           +AK
Sbjct: 246 YAK 248



>gi|119587271|gb|EAW66867.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_a [Homo sapiens]
          Length = 331

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 69/120 (57%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E+  +ED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 140 EENKKEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 192

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 193 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 247



>gi|403269836|ref|XP_003926916.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Saimiri boliviensis boliviensis]
          Length = 359

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 68/117 (58%), Gaps = 14/117 (11%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGWSCCS 119
           EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K WSCC 
Sbjct: 143 EEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGIKYWSCCR 194

Query: 120 RKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 195 RKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 246



>gi|114052382|ref|NP_001039377.1| cysteine and histidine-rich domain-containing protein 1 [Bos
           taurus]
 gi|122135277|sp|Q29RL2.1|CHRD1_BOVIN RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHP-1; AltName: Full=Protein morgana
 gi|88954376|gb|AAI14126.1| Cysteine and histidine-rich domain (CHORD)-containing 1 [Bos
           taurus]
 gi|296471971|tpg|DAA14086.1| TPA: cysteine and histidine-rich domain-containing protein 1 [Bos
           taurus]
          Length = 332

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAK 176
           +AK
Sbjct: 246 YAK 248



>gi|301763018|ref|XP_002916923.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Ailuropoda melanoleuca]
          Length = 313

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 171

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 172 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 226

Query: 174 FAK 176
           +AK
Sbjct: 227 YAK 229



>gi|507556478|ref|XP_004661994.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Jaculus jaculus]
          Length = 332

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEETCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAK 176
           +AK
Sbjct: 246 YAK 248



>gi|440895125|gb|ELR47394.1| Cysteine and histidine-rich domain-containing protein 1, partial
           [Bos grunniens mutus]
          Length = 311

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 120 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 169

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 170 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 224

Query: 174 FAK 176
           +AK
Sbjct: 225 YAK 227



>gi|405958045|gb|EKC24211.1| Cysteine and histidine-rich domain-containing protein 1
           [Crassostrea gigas]
          Length = 325

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 78/134 (58%), Gaps = 13/134 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKI 131
           T CK   C   Y      +GE  + E C+YH G PVFHEG K WSCC+RK  EF++FL  
Sbjct: 152 TSCKNNGCKACY------QGEESDTEKCLYHPGYPVFHEGMKFWSCCNRKTSEFDQFLAQ 205

Query: 132 KGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTF-REK 190
           +GC+ G HL++        VE E   CR DW+QTP+ + +SIFAK    +  S+T  R +
Sbjct: 206 EGCETGTHLWIKP-----EVEGEKKSCRFDWHQTPSTVSLSIFAKVAVPEKCSITVNRVR 260

Query: 191 EVMICLYKKGRNIY 204
            V+  ++  G++++
Sbjct: 261 CVIKIVFDGGKSLF 274



>gi|512919933|ref|XP_004929505.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Bombyx mori]
          Length = 350

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 69/126 (54%), Gaps = 18/126 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           +K P  +D N+ +   T CK   C   +        EGP   E+ C YH G P+FHEG K
Sbjct: 132 QKTPVSEDGNVAIG--TSCKNGGCNTAF--------EGPQTNESLCTYHPGCPIFHEGLK 181

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC ++  +F  FL   GC  G H +V   KE  N     VQCR DW+QTP H+I+S+
Sbjct: 182 FWSCCQKRTTDFNTFLNQPGCTTGAHKWV---KESSNA--GTVQCRWDWHQTPEHVIVSV 236

Query: 174 FAKKVD 179
           +AKK D
Sbjct: 237 YAKKYD 242



>gi|312385742|gb|EFR30167.1| hypothetical protein AND_00397 [Anopheles darlingi]
          Length = 834

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 59/162 (36%), Positives = 83/162 (51%), Gaps = 13/162 (8%)

Query: 45  KTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSG 104
           K I E P    ++K+   +   I  A  T CK   C   Y D      E  + ECIYH G
Sbjct: 590 KQIDEMPPTVTVQKKTPSELATI--APGTVCKHGGCNCTYED----ANEQSKHECIYHPG 643

Query: 105 TPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQ 164
            P+FHEG K WSCC RK  +F  F+   GC+ GKHL+    +E K      ++CR DW+Q
Sbjct: 644 VPIFHEGLKFWSCCQRKTSDFTAFMNQAGCETGKHLWTSEEEESK-----AIKCRLDWHQ 698

Query: 165 TPTHIIMSIFAKKVDKQNSSVTFREKEVMICLY--KKGRNIY 204
           T T ++++++AK      S+V      + ICL   ++G N Y
Sbjct: 699 TATTVVVTVYAKNYHYARSTVRVNPIRLAICLLFPQQGGNEY 740



>gi|426252197|ref|XP_004019802.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Ovis aries]
          Length = 495

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 304 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 353

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 354 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 408

Query: 174 FAK 176
           +AK
Sbjct: 409 YAK 411



>gi|195144882|ref|XP_002013425.1| GL23415 [Drosophila persimilis]
 gi|194102368|gb|EDW24411.1| GL23415 [Drosophila persimilis]
          Length = 366

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 67/109 (61%), Gaps = 10/109 (9%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           +A  T CK   C   +    +  G+     C YH G P+FHEG K WSCC ++  +F +F
Sbjct: 144 IAVGTSCKNNGCSYSFTGLDSDDGQ-----CAYHPGVPIFHEGMKFWSCCQKRTSDFTQF 198

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
           +  +GC  GKH +V      +N +K++VQCR+DW+QT T+++++I+AKK
Sbjct: 199 MAQRGCVNGKHKWVK-----ENDDKKVVQCRYDWHQTATNVVVAIYAKK 242



>gi|125775143|ref|XP_001358823.1| GA19433 [Drosophila pseudoobscura pseudoobscura]
 gi|54638564|gb|EAL27966.1| GA19433 [Drosophila pseudoobscura pseudoobscura]
          Length = 365

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 67/109 (61%), Gaps = 10/109 (9%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           +A  T CK   C   +    +  G+     C YH G P+FHEG K WSCC ++  +F +F
Sbjct: 143 IAVGTSCKNNGCSYSFTGLDSDDGQ-----CAYHPGVPIFHEGMKFWSCCQKRTSDFTQF 197

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
           +  +GC  GKH +V      +N +K++VQCR+DW+QT T+++++I+AKK
Sbjct: 198 MAQRGCVNGKHKWVK-----ENDDKKVVQCRYDWHQTATNVVVAIYAKK 241



>gi|332024062|gb|EGI64279.1| Cysteine and histidine-rich domain-containing protein 1 [Acromyrmex
           echinatior]
          Length = 340

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 87/163 (53%), Gaps = 15/163 (9%)

Query: 36  KISYTQTISKTITEEPK-LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEG 94
           ++  + TIS T+ E  K L  +E +   D +   +     CK  SC + Y   A++    
Sbjct: 113 QLVLSPTISPTLLERIKGLTALENDKPIDSV---IQIGQTCKNNSCKRTYTGIASN---- 165

Query: 95  PEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKE 154
            E  C YHSG P+FHEG K WSCC +K  EF  FL   GC +GKH++       KN+ K+
Sbjct: 166 -EEVCNYHSGVPIFHEGLKYWSCCKKKTTEFSLFLDQPGCTQGKHIWFS-----KNMGKK 219

Query: 155 IVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLY 197
             QCR DW+QT +++++SIFAKK     S +      + + L+
Sbjct: 220 -AQCRMDWHQTGSYVVVSIFAKKYLPSQSIIKLNPIHLTVDLF 261



>gi|164664460|ref|NP_001106917.1| cysteine and histidine-rich domain-containing protein 1 [Sus
           scrofa]
 gi|317374808|sp|A9YUB1.1|CHRD1_PIG RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=Chp-1; AltName: Full=Morgana
 gi|162946616|gb|ABY21264.1| CHORD containing protein-1 [Sus scrofa]
          Length = 332

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 68/123 (55%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I V   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKVG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH +       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHTWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAK 176
           +AK
Sbjct: 246 YAK 248



>gi|148231071|ref|NP_001091174.1| integrin beta 1 binding protein (melusin) 2 [Xenopus laevis]
 gi|120537904|gb|AAI29685.1| LOC100036934 protein [Xenopus laevis]
          Length = 357

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 96/171 (56%), Gaps = 19/171 (11%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           +  +Q++ K + E+ ++ P E+E ++ + ++ V   T CK   C + Y        +GPE
Sbjct: 120 LKVSQSLEKEL-EKLRIKPQEEEVKKVETDL-VGVGTSCKHAGCKEVY--------QGPE 169

Query: 97  AE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
           ++   CI+H G PVFHEG K WSCC+ K  +F EFL  +GC  GKHL+      +KN  +
Sbjct: 170 SDAGTCIHHPGVPVFHEGMKFWSCCNIKTSDFNEFLDQRGCASGKHLW------IKNTGR 223

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIY 204
           + V CR+DW+QT   + ++++AK    + S V      + I +  +G++ +
Sbjct: 224 QAVSCRYDWHQTSNIVTITVYAKTAIPELSQVLANRTGLDIQISFQGQSEF 274



>gi|194746448|ref|XP_001955692.1| GF16113 [Drosophila ananassae]
 gi|190628729|gb|EDV44253.1| GF16113 [Drosophila ananassae]
          Length = 360

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 72/124 (58%), Gaps = 12/124 (9%)

Query: 54  APIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSK 113
           AP     E+   +I V   T CK   C   +   ++  GE     C YH G P+FHEG K
Sbjct: 126 APAASTAEKSSDSIEVG--TSCKNNGCTYSFTGTSSDFGE-----CTYHPGVPIFHEGMK 178

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC ++  +F +F+  KGC  G+H +V       N +K++VQCR+DW+QT T+++++I
Sbjct: 179 FWSCCQKRTSDFAQFMAQKGCAYGQHKWVKD-----NEDKKVVQCRYDWHQTATNVVVAI 233

Query: 174 FAKK 177
           +AKK
Sbjct: 234 YAKK 237



>gi|472385242|ref|XP_004411984.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Odobenus rosmarus divergens]
          Length = 332

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC +K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRKKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAK 176
           +AK
Sbjct: 246 YAK 248



>gi|466019580|ref|XP_004271933.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Orcinus orca]
 gi|470626574|ref|XP_004320403.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Tursiops truncatus]
          Length = 332

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 68/123 (55%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH +       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHTWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAK 176
           +AK
Sbjct: 246 YAK 248



>gi|466019585|ref|XP_004271934.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Orcinus orca]
 gi|470626577|ref|XP_004320404.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Tursiops truncatus]
          Length = 313

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 68/123 (55%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 171

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH +       K+  K++V CRHDW+QT   + +S+
Sbjct: 172 YWSCCRRKTSDFNTFLAQEGCTTGKHTWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 226

Query: 174 FAK 176
           +AK
Sbjct: 227 YAK 229



>gi|91077034|ref|XP_967567.1| PREDICTED: similar to CHORD CG6198-PA [Tribolium castaneum]
 gi|270001750|gb|EEZ98197.1| hypothetical protein TcasGA2_TC000627 [Tribolium castaneum]
          Length = 336

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 66/112 (58%), Gaps = 16/112 (14%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEF 125
           +A  T CK   CG+ Y        +GPE     C +H G P+FHEG K WSCC ++  +F
Sbjct: 140 IAIGTTCKNGGCGQTY--------QGPETNATPCTHHPGVPIFHEGMKFWSCCQKRTTDF 191

Query: 126 EEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
             FL   GCK G+H+++      +N +   VQCR D++QT TH+++SI+AK+
Sbjct: 192 NAFLNQVGCKSGQHVWIK-----ENADNTTVQCRWDYHQTATHVVVSIYAKQ 238



>gi|472385244|ref|XP_004411985.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Odobenus rosmarus divergens]
          Length = 313

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 171

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC +K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 172 YWSCCRKKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 226

Query: 174 FAK 176
           +AK
Sbjct: 227 YAK 229



>gi|224043653|ref|XP_002186547.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Taeniopygia guttata]
          Length = 331

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 76/152 (50%), Gaps = 18/152 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E   EED   I +   T CK   C K Y        EGP   E  CIYHSG P+FHEG K
Sbjct: 141 EGRKEEDGDEIKIG--TACKNSGCSKTY--------EGPHSTEEVCIYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC +G H++       K+   ++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCKRKTSDFNTFLAQEGCTRGTHVWTK-----KDAGTKVVPCRHDWHQTGGEVTVSV 245

Query: 174 FAKKVDKQNSSVTFREKEVMICLYKKGRNIYY 205
           +AK      S V      V I +  +G   ++
Sbjct: 246 YAKNSVPDQSYVEANSTMVNIHIVFEGEKEFH 277



>gi|357622949|gb|EHJ74291.1| hypothetical protein KGM_22001 [Danaus plexippus]
          Length = 352

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 84/165 (50%), Gaps = 23/165 (13%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEP---EEDDLNIP----VASDTECKRPSCGKKYVD 86
           GPK+      S+ +T EP++A   KE     ++++  P    +A  T CK   C   Y  
Sbjct: 100 GPKLDRPPFESQLVTLEPRIADALKEAVYKAKENVAAPNDGTIAIGTSCKNGGCNISY-- 157

Query: 87  DATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVG 143
                 EGP ++   C YH G PVFHEG K W+CC ++  +F  FL   GC  G H ++ 
Sbjct: 158 ------EGPHSDNTICTYHPGCPVFHEGLKFWTCCQKRTTDFNTFLNQPGCTTGTHKWLK 211

Query: 144 SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
                ++     V+CR DW+QTP ++I+S++AKK D   S V   
Sbjct: 212 -----ESAPAGTVKCRWDWHQTPEYVIVSVYAKKYDPFTSHVKLN 251



>gi|13385324|ref|NP_080120.1| cysteine and histidine-rich domain-containing protein 1 [Mus
           musculus]
 gi|81881223|sp|Q9D1P4.1|CHRD1_MOUSE RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHORD-containing protein 1; Short=Chp-1; AltName:
           Full=Protein morgana
 gi|12833816|dbj|BAB22675.1| unnamed protein product [Mus musculus]
 gi|17390873|gb|AAH18374.1| Cysteine and histidine-rich domain (CHORD)-containing, zinc-binding
           protein 1 [Mus musculus]
 gi|74210036|dbj|BAE21307.1| unnamed protein product [Mus musculus]
 gi|148693093|gb|EDL25040.1| cysteine and histidine-rich domain (CHORD)-containing, zinc-binding
           protein 1 [Mus musculus]
          Length = 331

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 70/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC +GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTRGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|157822247|ref|NP_001101598.1| cysteine and histidine-rich domain-containing protein 1 [Rattus
           norvegicus]
 gi|317374809|sp|D4A4T9.1|CHRD1_RAT RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHP-1; AltName: Full=Morgana
 gi|149020614|gb|EDL78419.1| cysteine and histidine-rich domain (CHORD)-containing, zinc-binding
           protein 1 (predicted) [Rattus norvegicus]
          Length = 331

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 68/120 (56%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y        +  E  C+YHSG P+FHEG K WS
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY-----QGLQSLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC +GKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTRGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248



>gi|345787901|ref|XP_533979.3| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Canis lupus familiaris]
          Length = 330

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 ESKKEEDSDEIKIG--TSCKNGGCTKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +SI+A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISIYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|511887714|ref|XP_004763623.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X1 [Mustela putorius furo]
 gi|511955541|ref|XP_004796096.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X1 [Mustela putorius furo]
          Length = 332

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC +K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRKKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAK 176
           +AK
Sbjct: 246 YAK 248



>gi|507691288|ref|XP_004641969.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform X2 [Octodon degus]
          Length = 313

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 122 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWAK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 K 176
           K
Sbjct: 229 K 229



>gi|478506426|ref|XP_004427508.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Ceratotherium simum simum]
          Length = 332

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 67/120 (55%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y        +  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY-----QGLQSLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248



>gi|355752534|gb|EHH56654.1| hypothetical protein EGM_06111 [Macaca fascicularis]
          Length = 332

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 70/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KG+H++       K+  K++V C H+W+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGRHMWTK-----KDAGKKVVPCTHNWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|511887716|ref|XP_004763624.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X2 [Mustela putorius furo]
 gi|511955543|ref|XP_004796097.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X2 [Mustela putorius furo]
          Length = 313

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 18/123 (14%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 171

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC +K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 172 YWSCCRKKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 226

Query: 174 FAK 176
           +AK
Sbjct: 227 YAK 229



>gi|327287046|ref|XP_003228240.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Anolis carolinensis]
          Length = 367

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 90/175 (51%), Gaps = 15/175 (8%)

Query: 35  PKISYTQTISKTI---TEEPKLAPIEKEPEEDDLN--IPVASDTECKRPSCGKKYVDDAT 89
           PK      +SKT+    E+  L+P E+   +D     + V+  T CK   C   +    +
Sbjct: 101 PKQLLPVKVSKTLEQSLEKLDLSPKEEAAGQDSAGAALEVSLGTTCKNSGCKATFQGQES 160

Query: 90  SRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVK 149
           +R       C +H G PVFHEG K WSCC  K  +F  FL+ KGC +G+HL++      K
Sbjct: 161 NR-----ETCTFHPGVPVFHEGMKYWSCCRIKPTDFNAFLEQKGCSRGRHLWI-----KK 210

Query: 150 NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIY 204
             +K +V CR DW+QT + ++++++AK    + SSV      V + +  +G  ++
Sbjct: 211 QQDKRLVSCRQDWHQTSSQVVITVYAKTPLPELSSVKANRTTVDVHIVFEGDKVF 265



>gi|507691284|ref|XP_004641968.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform X1 [Octodon degus]
          Length = 332

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWAK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|348565659|ref|XP_003468620.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Cavia porcellus]
          Length = 332

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|354498594|ref|XP_003511400.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Cricetulus griseus]
 gi|344240723|gb|EGV96826.1| Cysteine and histidine-rich domain-containing protein 1 [Cricetulus
           griseus]
          Length = 332

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 68/120 (56%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y        +  +  C+YHSG P+FHEG K WS
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY-----QGLQSLDEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248



>gi|345787903|ref|XP_003432986.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Canis lupus familiaris]
          Length = 311

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 122 ESKKEEDSDEIKIG--TSCKNGGCTKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +SI+A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISIYA 228

Query: 176 K 176
           K
Sbjct: 229 K 229



>gi|149635154|ref|XP_001512381.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Ornithorhynchus anatinus]
          Length = 336

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 63/107 (58%), Gaps = 16/107 (14%)

Query: 73  TECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K Y        +GP   E  CI+HSG P+FHEG K WSCC RK  +F  FL
Sbjct: 156 TSCKNGGCSKTY--------QGPQSLEEVCIFHSGVPIFHEGMKYWSCCRRKTSDFNTFL 207

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
             +GC  GKHL++      K+  K+++ CRHDW+QT   + +SI+AK
Sbjct: 208 AQEGCTTGKHLWIK-----KDAGKKVIPCRHDWHQTGGEVTISIYAK 249



>gi|507690663|ref|XP_004641822.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Octodon degus]
          Length = 313

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 122 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 K 176
           K
Sbjct: 229 K 229



>gi|478506428|ref|XP_004427509.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Ceratotherium simum simum]
          Length = 313

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 K 176
           K
Sbjct: 229 K 229



>gi|395520569|ref|XP_003764400.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Sarcophilus harrisii]
          Length = 366

 Score = 95.9 bits (237), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 70/123 (56%), Gaps = 20/123 (16%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           +K+ + D++ I     T CK   C K Y        +GP   E  CI+HSG P+FHEG K
Sbjct: 177 KKDEDSDEIKI----GTSCKNGGCVKTY--------QGPQSIEEVCIFHSGVPIFHEGMK 224

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKHL+       K+  K++V CRHDW+QT   + +S+
Sbjct: 225 YWSCCRRKTSDFNTFLAQEGCTTGKHLWTK-----KDAGKKVVPCRHDWHQTGGQVTISV 279

Query: 174 FAK 176
           +AK
Sbjct: 280 YAK 282



>gi|395814695|ref|XP_003780879.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Otolemur garnettii]
          Length = 332

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|498981622|ref|XP_004550105.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform X1 [Maylandia zebra]
 gi|498981626|ref|XP_004550106.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform X2 [Maylandia zebra]
          Length = 343

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (58%), Gaps = 16/109 (14%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K +        EGP ++   C+YH+G P+FHEG K WSCC RK  +F  FL
Sbjct: 155 TSCKNGGCTKSF--------EGPASDSDVCLYHAGFPIFHEGMKYWSCCKRKTSDFNTFL 206

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKV 178
             +GC KG HL+       K+  K++V CR DW+QT T +I+SI+AK  
Sbjct: 207 SQEGCTKGTHLW-----RKKDAGKKVVPCRFDWHQTGTQVIISIYAKNA 250



>gi|348518674|ref|XP_003446856.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Oreochromis niloticus]
          Length = 342

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (58%), Gaps = 16/109 (14%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K +        EGP ++   C+YH+G P+FHEG K WSCC RK  +F  FL
Sbjct: 155 TSCKNGGCTKSF--------EGPASDSDVCLYHAGFPIFHEGMKYWSCCKRKTSDFNTFL 206

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKV 178
             +GC KG HL+       K+  K++V CR DW+QT T +I+SI+AK  
Sbjct: 207 SQEGCTKGTHLW-----RKKDAGKKVVPCRFDWHQTGTQVIISIYAKNA 250



>gi|449269579|gb|EMC80340.1| Cysteine and histidine-rich domain-containing protein 1 [Columba
           livia]
          Length = 346

 Score = 95.5 bits (236), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 68/129 (52%), Gaps = 16/129 (12%)

Query: 73  TECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K Y        EGP   E  CIYHSG P+FHEG K WSCC RK  +F  FL
Sbjct: 155 TACKNAGCSKTY--------EGPHSTEEVCIYHSGVPIFHEGMKYWSCCKRKTSDFNTFL 206

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
             +GC  G H++       K+  K++V CRHDW+QT   + +S++AK    + S V    
Sbjct: 207 AQEGCTTGTHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAKNSVPELSYVEANT 261

Query: 190 KEVMICLYK 198
            +  I L K
Sbjct: 262 IKCFISLTK 270



>gi|505788594|ref|XP_004605239.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Sorex araneus]
          Length = 331

 Score = 95.5 bits (236), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 65/116 (56%), Gaps = 12/116 (10%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           EED   I V   T CK   C K Y        +  E  C+YHSG P+FHEG K WSCC R
Sbjct: 145 EEDSDEIKVG--TSCKNSGCSKTY-----QGLQSLEEVCVYHSGVPIFHEGMKYWSCCRR 197

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 198 KTSDFNTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248



>gi|6581056|gb|AAF18437.1|AF192466_1 CHORD containing protein-1 [Homo sapiens]
          Length = 332

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 68/120 (56%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHD +QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDLHQTGGEVTISVYAK 248



>gi|512874914|ref|XP_004893557.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X1 [Heterocephalus glaber]
 gi|513013775|ref|XP_004868246.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X1 [Heterocephalus glaber]
 gi|351705780|gb|EHB08699.1| Cysteine and histidine-rich domain-containing protein 1
           [Heterocephalus glaber]
          Length = 332

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTE-----KDSGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|512874918|ref|XP_004893558.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X2 [Heterocephalus glaber]
 gi|513013777|ref|XP_004868247.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X2 [Heterocephalus glaber]
          Length = 313

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWTE-----KDSGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 K 176
           K
Sbjct: 229 K 229



>gi|195036428|ref|XP_001989672.1| GH18665 [Drosophila grimshawi]
 gi|193893868|gb|EDV92734.1| GH18665 [Drosophila grimshawi]
          Length = 364

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 67/110 (60%), Gaps = 12/110 (10%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           +A  T CK   C   Y + ++  GE     C +H G P+FHEG K WSCC ++  +F +F
Sbjct: 142 IAVGTNCKNIGCTYSYTNTSSDYGE-----CTHHPGVPIFHEGLKFWSCCQKRTSDFAQF 196

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVE-KEIVQCRHDWYQTPTHIIMSIFAKK 177
           +  KGC  G+H F      VKN E K +V CR+DW+QT T+++++++AKK
Sbjct: 197 MAQKGCVYGQHKF------VKNEEDKNVVTCRYDWHQTATNVVVAVYAKK 240



>gi|291384094|ref|XP_002708685.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Oryctolagus cuniculus]
          Length = 331

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 60/104 (57%), Gaps = 10/104 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        E  E  C+YHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCSKTYQGQ-----ESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           GC  GKHL+       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 210 GCTTGKHLWTK-----KDDGKKVVPCRHDWHQTGGEVTISVYAK 248



>gi|41056073|ref|NP_956633.1| cysteine and histidine-rich domain-containing protein 1 [Danio
           rerio]
 gi|82188263|sp|Q7T3F7.1|CHRD1_DANRE RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           AltName: Full=Morgana
 gi|31419419|gb|AAH53137.1| Cysteine and histidine-rich domain (CHORD)-containing, zinc binding
           protein 1 [Danio rerio]
          Length = 341

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (58%), Gaps = 12/116 (10%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           EED   I +   T CK   C K +   A+      +  C+YH+G P+FHEG K WSCC R
Sbjct: 143 EEDSDEIKIG--TSCKNGGCCKTFAGQASD-----DETCLYHAGVPIFHEGMKYWSCCKR 195

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           K  +F  FL  +GC +GKH +     + K+  K++V CR DW+QT + +I+SI+AK
Sbjct: 196 KTSDFNTFLSQEGCTRGKHQW-----KKKDAGKKVVPCRFDWHQTGSQVIISIYAK 246



>gi|449267899|gb|EMC78790.1| Cysteine and histidine-rich domain-containing protein 1 [Columba
           livia]
          Length = 361

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 88/171 (51%), Gaps = 18/171 (10%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           I  ++T+ + + E+  L+  ++EPE       V + T CK  +C   Y        +GPE
Sbjct: 117 IKVSRTLEQAL-EKLNLSSKDEEPEGSCAAAQVRAGTTCKNTACKAIY--------QGPE 167

Query: 97  AE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
           +    C +H G PVFHEG K WSCC  K  +F  FL+  GC  G+H +   G      +K
Sbjct: 168 SNTEVCTFHPGVPVFHEGMKYWSCCGVKTTDFSAFLEQPGCSSGRHCWTVKG------DK 221

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIY 204
           + V CR DW+QT + ++++++AK     +SSV      + + +  +G  I+
Sbjct: 222 KAVSCRQDWHQTSSQMVVTVYAKNPLPAHSSVKANRTTLEVHIVFEGNKIF 272



>gi|410972473|ref|XP_003992683.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Felis catus]
          Length = 332

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  +  C+YHSG P+FHEG K W
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLDEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 K 176
           K
Sbjct: 248 K 248



>gi|291227043|ref|XP_002733497.1| PREDICTED: cysteine and histidine-rich domain (CHORD)-containing,
           zinc-binding protein 1-like [Saccoglossus kowalevskii]
          Length = 320

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 72/128 (56%), Gaps = 12/128 (9%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           V   T CK   CG+ Y D++++        C++H G PVFHEG K WSCC RK  +F+ F
Sbjct: 148 VKVGTICKNGGCGQPYQDESSNFNS-----CVHHPGVPVFHEGMKYWSCCQRKTSDFDNF 202

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
           L+  GC  GKHL++      K+ +K +  CR+DW+QT   + +S+FAK    Q + V   
Sbjct: 203 LQQAGCSNGKHLWIK-----KDFKKTL--CRYDWHQTGNFVFISVFAKVACPQLTYVEAN 255

Query: 189 EKEVMICL 196
           +  V I +
Sbjct: 256 QTSVFISI 263



>gi|259488543|tpe|CBF88062.1| TPA: ChpADiploid state maintenance protein chpA ;
           [Source:UniProtKB/TrEMBL;Acc:Q69BT6] [Aspergillus
           nidulans FGSC A4]
          Length = 209

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (54%), Gaps = 18/133 (13%)

Query: 24  VENGVEIYDSG-PK-ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCG 81
           V   V + DSG P+ ++++  I           P+ +EPE DD  + +  +  C+R  CG
Sbjct: 84  VAAPVPVRDSGVPRPVAHSPAIPPPSN---APTPVPEEPESDDPELAIPENATCRRRGCG 140

Query: 82  KKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG-------- 133
             Y  D +      E  C+YH G PVFHEGSKGWSCC R+VLEF+EFLKI+G        
Sbjct: 141 GTYKPDVSRD----EERCVYHPGQPVFHEGSKGWSCCKRRVLEFDEFLKIEGLRGEEEAS 196

Query: 134 -CKKGKHLFVGSG 145
            C++G+  + G G
Sbjct: 197 FCREGQACWRGEG 209



 Score = 75.5 bits (184), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T+C    CGK + D        PE  C+YH G PVFHEG KGW+CC  +VL FEEF++I 
Sbjct: 3   TKCVHKGCGKVFTD--------PEEPCVYHPGPPVFHEGQKGWNCCKPRVLTFEEFMEIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSAV 64



>gi|380020848|ref|XP_003694289.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Apis florea]
          Length = 341

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 89/174 (51%), Gaps = 19/174 (10%)

Query: 35  PKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEG 94
           P+++ T  +S  + E+  +  +     +   +  V     CK  SC   Y         G
Sbjct: 112 PQMTLTPNVSPNLLEQ--IKGLISNVSKTTFDTKVQIGQSCKNNSCKATY--------NG 161

Query: 95  PEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNV 151
           P +E   C +H GTP+FHEG K WSCC +K  +F  FL+  GC +GKH+++      KN 
Sbjct: 162 PASEDEICNHHPGTPIFHEGMKYWSCCQKKTTDFSTFLEQPGCTQGKHIWIS-----KNT 216

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIYY 205
           +K+ V+CR DW+QT + +++SI+AKK +   S V      + + L+    N  Y
Sbjct: 217 DKK-VKCRMDWHQTGSFVVVSIYAKKYEPDQSFVKLNPIRLSVDLFFIEENSRY 269



>gi|410972475|ref|XP_003992684.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Felis catus]
          Length = 313

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 69/121 (57%), Gaps = 14/121 (11%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  +  C+YHSG P+FHEG K W
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLDEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 K 176
           K
Sbjct: 229 K 229



>gi|391332709|ref|XP_003740773.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Metaseiulus occidentalis]
          Length = 354

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 79/144 (54%), Gaps = 16/144 (11%)

Query: 37  ISYTQTISKTIT----EEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG 92
           +   QT+  ++T    +   +A I+K+ +E    +P    T CK  +C   Y  + T+  
Sbjct: 107 VRLPQTVGASLTPLLEKLRDVADIKKDDQEKTNGVPYG--TPCKNSACKATYCGEQTN-- 162

Query: 93  EGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVE 152
              E  C YH G PVFHEG K WSCC RK  +F  FL+ +GC  G H +V   KE K+  
Sbjct: 163 ---EETCNYHEGFPVFHEGMKYWSCCQRKTSDFNSFLEQEGCASGSHCWV--KKETKD-- 215

Query: 153 KEIVQCRHDWYQTPTHIIMSIFAK 176
              V CR+DW+QT + +I+S+FAK
Sbjct: 216 -SAVACRYDWHQTGSQVIISVFAK 238



>gi|483493278|gb|EOA93338.1| Cysteine and histidine-rich domain-containing protein 1, partial
           [Anas platyrhynchos]
          Length = 282

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 60/104 (57%), Gaps = 10/104 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y    ++     E  CIYHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 108 TACKNAGCSKTYQGLHST-----EDVCIYHSGVPIFHEGMKYWSCCKRKTSDFNTFLAQE 162

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           GC  G H++       K+  K++V CRHDW+QT   + +SI+AK
Sbjct: 163 GCTTGTHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISIYAK 201



>gi|66507739|ref|XP_395533.2| PREDICTED: cysteine and histidine-rich domain-containing protein
           [Apis mellifera]
          Length = 341

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 85/164 (51%), Gaps = 15/164 (9%)

Query: 35  PKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEG 94
           P+++ T  +S  + E+ K           D  I +     CK  SC       AT  G  
Sbjct: 112 PQMTLTPNVSPNLLEQIKGLISNVSKSTFDTKIQIGQ--SCKNNSC------KATYNGPA 163

Query: 95  PEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
            E E C +H GTP+FHEG K WSCC +K  +F  FL+  GC +GKH+++      KN +K
Sbjct: 164 SENEICNHHPGTPIFHEGMKYWSCCQKKTTDFSTFLEQPGCTQGKHIWIS-----KNTDK 218

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLY 197
           + V+CR DW+QT + +++SI+AKK     S +      + + L+
Sbjct: 219 K-VKCRMDWHQTGSFVVVSIYAKKYQPDQSFIKLNPIRLSVDLF 261



 Score = 72.4 bits (176), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 5/70 (7%)

Query: 70  ASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           A+   C    CGKK+  D     EG   +CIYH G PVFH+  KGWSCC++K  +F EFL
Sbjct: 5   ATLLHCYNRGCGKKF--DPNDNKEG---DCIYHPGHPVFHDAYKGWSCCNKKCTDFTEFL 59

Query: 130 KIKGCKKGKH 139
            IKGC K  H
Sbjct: 60  NIKGCAKSCH 69



>gi|148224594|ref|NP_001084590.1| cysteine and histidine-rich domain-containing protein 1 [Xenopus
           laevis]
 gi|82185540|sp|Q6NUA0.1|CHRD1_XENLA RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           AltName: Full=Protein morgana
 gi|46250079|gb|AAH68697.1| MGC81113 protein [Xenopus laevis]
          Length = 334

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 71/135 (52%), Gaps = 16/135 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K +         GP++    C YHSG P+FHEG K WSCC RK  +F  FL
Sbjct: 154 TSCKNGGCLKTFA--------GPQSNEEVCHYHSGVPIFHEGMKYWSCCRRKTSDFNTFL 205

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
            ++GC KG HL+       K+  K++V CRHDW+QT   + +SI+AK    + S V    
Sbjct: 206 SLEGCTKGTHLWTK-----KDDGKKVVPCRHDWHQTGAGVTISIYAKNSMPELSYVEANS 260

Query: 190 KEVMICLYKKGRNIY 204
             V I +  +G   +
Sbjct: 261 TVVNIQVVFEGEKTF 275



>gi|504145632|ref|XP_004585237.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Ochotona princeps]
          Length = 331

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 60/104 (57%), Gaps = 10/104 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  C+YHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCSKTYQGQ-----QSLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           GC  GKH++       K+  K++V CRHDW+QT   + +SI+AK
Sbjct: 210 GCTTGKHMWTK-----KDDGKKVVPCRHDWHQTGGEVTISIYAK 248



>gi|318054646|ref|NP_001188062.1| cysteine and histidine-rich domain-containing protein 1 [Ictalurus
           punctatus]
 gi|308324723|gb|ADO29496.1| cysteine and histidine-rich domain-containing protein 1 [Ictalurus
           punctatus]
          Length = 347

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 69/122 (56%), Gaps = 10/122 (8%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K +     S  E  E  C+YH+G P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCTKTF-----SGTESNEEVCLYHAGVPIFHEGMKYWSCCKRKTSDFNTFLSQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEV 192
           GC KGKHL+       K++ K++V CR DW+QT + + ++++AK    + S V     ++
Sbjct: 210 GCTKGKHLW-----RKKDMGKKVVPCRFDWHQTGSQVTITVYAKNSIPELSHVDANSTQL 264

Query: 193 MI 194
            I
Sbjct: 265 DI 266



>gi|308322439|gb|ADO28357.1| cysteine and histidine-rich domain-containing protein 1 [Ictalurus
           furcatus]
          Length = 347

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 69/122 (56%), Gaps = 10/122 (8%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K +     S  E  E  C+YH+G P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCTKTF-----SGTESNEEVCLYHAGVPIFHEGMKYWSCCKRKTSDFNTFLSQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEV 192
           GC KGKHL+       K++ K++V CR DW+QT + + ++++AK    + S V     ++
Sbjct: 210 GCTKGKHLW-----RKKDMGKKVVPCRFDWHQTGSQVTITVYAKNSIPELSHVDANSTQL 264

Query: 193 MI 194
            I
Sbjct: 265 DI 266



>gi|86279688|gb|ABC94499.1| putative chymotrypsin-like protein [Ictalurus punctatus]
          Length = 202

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 63/104 (60%), Gaps = 10/104 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K +     S  E  E  C+YH+G P+FHEG K WSCC RK  +F  FL  +
Sbjct: 96  TSCKNGGCTKTF-----SGTESNEEVCLYHAGVPIFHEGMKYWSCCKRKTSDFNTFLSQE 150

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           GC KGKHL+       K++ K++V CR DW+QT + + ++++AK
Sbjct: 151 GCTKGKHLW-----RKKDMGKKVVPCRFDWHQTGSQVTITVYAK 189



>gi|344287779|ref|XP_003415630.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Loxodonta africana]
          Length = 313

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 59/104 (56%), Gaps = 10/104 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  C+YHSG PVFHEG K WSCC RK  +F  FL  +
Sbjct: 136 TPCKNGGCSKTY-----QSLQSLEEICVYHSGVPVFHEGMKYWSCCRRKTSDFNTFLAQE 190

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           GC  GKHL+       K+   ++V CRHDW+QT   + +SI+AK
Sbjct: 191 GCTTGKHLWTK-----KDAGGKVVPCRHDWHQTGGEVTISIYAK 229



>gi|344287777|ref|XP_003415629.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Loxodonta africana]
          Length = 332

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 59/104 (56%), Gaps = 10/104 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  C+YHSG PVFHEG K WSCC RK  +F  FL  +
Sbjct: 155 TPCKNGGCSKTY-----QSLQSLEEICVYHSGVPVFHEGMKYWSCCRRKTSDFNTFLAQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           GC  GKHL+       K+   ++V CRHDW+QT   + +SI+AK
Sbjct: 210 GCTTGKHLWTK-----KDAGGKVVPCRHDWHQTGGEVTISIYAK 248



>gi|402890696|ref|XP_003908615.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Papio anubis]
          Length = 331

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 59/103 (57%), Gaps = 12/103 (11%)

Query: 75  CKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           CK   C K Y      RG E  E  C+YHSG P+FHEG K WSCC RK  +F  FL   G
Sbjct: 138 CKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNAFLAQDG 191

Query: 134 CKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           C  GKH++       K+  + +V CRHDW+QT   + +S++AK
Sbjct: 192 CTTGKHMWAK-----KDAGENVVPCRHDWHQTEGEVTISVYAK 229



>gi|326918752|ref|XP_003205652.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Meleagris gallopavo]
          Length = 380

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 88/174 (50%), Gaps = 21/174 (12%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEED---DLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           I  ++++ + + E+  L+P  KEP  D   +    V + T CK  +C   Y        +
Sbjct: 116 IKVSRSLEQAL-EKLSLSPKNKEPRGDCAGEAAAQVRAGTTCKNSACKAIY--------Q 166

Query: 94  GPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKN 150
           GPE+    C +H G PVFHEG K WSCC  +  +F  FL+  GC  G+H ++G       
Sbjct: 167 GPESNTEVCTFHPGVPVFHEGMKYWSCCGIRTTDFSAFLEQPGCSTGRHCWMG------K 220

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIY 204
            +K+ V CR DW+QT + ++++I+ K      SSV      + + +  +G  I+
Sbjct: 221 ADKKAVSCRQDWHQTSSQVVVTIYGKNPLPTLSSVKANRTVLEVHVIFEGNKIF 274



>gi|327269263|ref|XP_003219414.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Anolis carolinensis]
          Length = 332

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 24/138 (17%)

Query: 45  KTITEEPKLAP---IEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAE 98
           K + E+ KL+    I++E + D++ I     T CK   C K +        EGP   E  
Sbjct: 127 KQVLEKLKLSTGNEIKEEEDSDEIKI----GTTCKNAGCAKTF--------EGPHSMEET 174

Query: 99  CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQC 158
           C YH G P+FHEG K WSCC RK  +F  FL  +GC  G H++      +K   K+++ C
Sbjct: 175 CTYHMGVPIFHEGMKYWSCCKRKTSDFNTFLSQEGCSTGTHVW------IKKDAKKVIPC 228

Query: 159 RHDWYQTPTHIIMSIFAK 176
           RHDW+QT   + +SI+AK
Sbjct: 229 RHDWHQTGGEVTISIYAK 246



>gi|363732737|ref|XP_420200.3| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X3 [Gallus gallus]
          Length = 379

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 21/174 (12%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEED---DLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           I  ++++ + + E+  L+P  KEP+ D   +    V + T CK  +C   Y        +
Sbjct: 116 IKVSRSLEQAL-EKLSLSPNNKEPKGDCTGEAAAQVRAGTTCKNATCKAIY--------Q 166

Query: 94  GPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKN 150
           GPE+    C +H G PVFHEG K WSCC  +  +F  FL+  GC  G+H ++G       
Sbjct: 167 GPESNTEVCTFHPGVPVFHEGMKYWSCCGIRTTDFSAFLEQPGCSTGRHCWMG------K 220

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIY 204
            +K+ V CR DW+QT + ++++I+ K      SSV      + + +  +G  I+
Sbjct: 221 ADKKAVSCRQDWHQTSSQVVVTIYGKNPLPTLSSVKANRTVLEVHVIFEGNKIF 274



>gi|170057517|ref|XP_001864518.1| integrin beta-1-binding protein 2 [Culex quinquefasciatus]
 gi|167876916|gb|EDS40299.1| integrin beta-1-binding protein 2 [Culex quinquefasciatus]
          Length = 361

 Score = 92.8 bits (229), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 75/145 (51%), Gaps = 16/145 (11%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEG 111
           ++A    EPE+       A  T CK   C   Y  + T   + P   C++H G P+FHEG
Sbjct: 133 RVAKKTTEPED------TAPGTICKHGGCN--YAFEGTKNDDKP---CVFHPGVPIFHEG 181

Query: 112 SKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIM 171
            K WSCC RK  +F  F+   GC+ G+H +    +E K      V+CR DW+QT T +++
Sbjct: 182 MKFWSCCQRKTSDFTAFMNQAGCETGQHRWTSDEEESKT-----VKCRLDWHQTATQVVV 236

Query: 172 SIFAKKVDKQNSSVTFREKEVMICL 196
           +++AK    + S+V      + +CL
Sbjct: 237 TVYAKMCHYRKSTVRLNPIRLAVCL 261



>gi|327269265|ref|XP_003219415.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Anolis carolinensis]
          Length = 313

 Score = 92.8 bits (229), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 24/138 (17%)

Query: 45  KTITEEPKLAP---IEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAE 98
           K + E+ KL+    I++E + D++ I     T CK   C K +        EGP   E  
Sbjct: 108 KQVLEKLKLSTGNEIKEEEDSDEIKI----GTTCKNAGCAKTF--------EGPHSMEET 155

Query: 99  CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQC 158
           C YH G P+FHEG K WSCC RK  +F  FL  +GC  G H++      +K   K+++ C
Sbjct: 156 CTYHMGVPIFHEGMKYWSCCKRKTSDFNTFLSQEGCSTGTHVW------IKKDAKKVIPC 209

Query: 159 RHDWYQTPTHIIMSIFAK 176
           RHDW+QT   + +SI+AK
Sbjct: 210 RHDWHQTGGEVTISIYAK 227



>gi|51010995|ref|NP_001003457.1| uncharacterized protein LOC445063 [Danio rerio]
 gi|50416931|gb|AAH78394.1| Zgc:92429 [Danio rerio]
          Length = 387

 Score = 92.4 bits (228), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 67/124 (54%), Gaps = 18/124 (14%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKI 131
           CK   C K Y        EGPE     CIYH G PVFHEG K W+CC  K  +F  FL  
Sbjct: 155 CKNTGCRKSY--------EGPETNAEICIYHPGAPVFHEGYKYWNCCCIKTTDFNAFLDQ 206

Query: 132 KGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKE 191
           KGC  GKH +      +   +K+ V CRHDW+QT + ++++I+AK  +  +S V    + 
Sbjct: 207 KGCTSGKHCW------IPKQDKKKVACRHDWHQTGSQVVVTIYAKNCNPDHSYVEAN-RT 259

Query: 192 VMIC 195
           V+ C
Sbjct: 260 VLTC 263



>gi|410956946|ref|XP_003985097.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Felis catus]
          Length = 448

 Score = 92.4 bits (228), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/120 (40%), Positives = 67/120 (55%), Gaps = 12/120 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y    +      +  C+YHSG P+FHEG K WS
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTYQGLQSL-----DEVCVYHSGVPIFHEGMKYWS 174

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F+ FL  +GC  GKH++       K+  K++V CRHDW QT   + +S++AK
Sbjct: 175 CCRRKTSDFKTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWRQTGGEVTISVYAK 229



>gi|513180394|ref|XP_004940688.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X4 [Gallus gallus]
          Length = 445

 Score = 92.4 bits (228), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 21/174 (12%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEED---DLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           I  ++++ + + E+  L+P  KEP+ D   +    V + T CK  +C   Y        +
Sbjct: 182 IKVSRSLEQAL-EKLSLSPNNKEPKGDCTGEAAAQVRAGTTCKNATCKAIY--------Q 232

Query: 94  GPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKN 150
           GPE+    C +H G PVFHEG K WSCC  +  +F  FL+  GC  G+H ++G       
Sbjct: 233 GPESNTEVCTFHPGVPVFHEGMKYWSCCGIRTTDFSAFLEQPGCSTGRHCWMG------K 286

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIY 204
            +K+ V CR DW+QT + ++++I+ K      SSV      + + +  +G  I+
Sbjct: 287 ADKKAVSCRQDWHQTSSQVVVTIYGKNPLPTLSSVKANRTVLEVHVIFEGNKIF 340



>gi|340713157|ref|XP_003395114.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Bombus terrestris]
          Length = 340

 Score = 92.4 bits (228), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 88/180 (48%), Gaps = 23/180 (12%)

Query: 35  PKISYTQTISKTITEEPK--LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG 92
           P++S T  +S  + E+ K   + I +   E+ + I       CK  SC   Y        
Sbjct: 112 PQVSLTPDVSPALLEQIKGLTSNISQNICENKVQI----GQSCKNNSCKATY-------- 159

Query: 93  EGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVK 149
            GP ++   C +H G P+FHEG K WSCC +K  +F  FL+  GC +GKH ++      K
Sbjct: 160 NGPASDDEVCNHHPGVPIFHEGMKYWSCCQKKTTDFSTFLEQPGCAQGKHTWIS-----K 214

Query: 150 NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRNIYYMFYL 209
           N  K   +CR DW+QT T +++S++AKK     SS+      + + L+    N  Y   L
Sbjct: 215 NTGKR-AKCRMDWHQTGTFVVISVYAKKYQPDQSSIKLNPIRLTVDLFFVEENSRYNLDL 273



 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGKK+  D     EG   +CIYHSG PVFH+  KGWSCC++K  +F EFL IKGC
Sbjct: 10  CYNRGCGKKF--DPNDNKEG---DCIYHSGYPVFHDAYKGWSCCNKKCTDFTEFLNIKGC 64

Query: 135 KKGKH 139
            K  H
Sbjct: 65  VKSYH 69



>gi|471418084|ref|XP_004390542.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Trichechus manatus latirostris]
          Length = 313

 Score = 92.4 bits (228), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 59/104 (56%), Gaps = 10/104 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  CIYHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 136 TSCKNGGCSKTY-----QGLQSLEEICIYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQE 190

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           GC  GKH++       K+   ++V CRHDW+QT   + +SI+AK
Sbjct: 191 GCTTGKHMWTK-----KDAGGKVVPCRHDWHQTGGEVTISIYAK 229



>gi|47227100|emb|CAG00462.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 328

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 67/122 (54%), Gaps = 20/122 (16%)

Query: 58  KEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKG 114
           KE + DD+ I     T CK   C K +         GPE+    C YH G P+FHEG K 
Sbjct: 144 KEEDGDDVKI----GTPCKNGGCTKSF--------NGPESNSDACSYHPGVPIFHEGMKY 191

Query: 115 WSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIF 174
           WSCC RK  +F  FL  +GC KG HL+       K + K++  CR DW+QT + +I+SI+
Sbjct: 192 WSCCKRKTSDFNTFLSQEGCTKGTHLW-----RKKVMGKKVAPCRFDWHQTGSQVIISIY 246

Query: 175 AK 176
           AK
Sbjct: 247 AK 248



>gi|471418082|ref|XP_004390541.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Trichechus manatus latirostris]
          Length = 332

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 59/104 (56%), Gaps = 10/104 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  CIYHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCSKTY-----QGLQSLEEICIYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           GC  GKH++       K+   ++V CRHDW+QT   + +SI+AK
Sbjct: 210 GCTTGKHMWTK-----KDAGGKVVPCRHDWHQTGGEVTISIYAK 248



>gi|71895117|ref|NP_001026003.1| cysteine and histidine-rich domain-containing protein 1 [Gallus
           gallus]
 gi|82083024|sp|Q5ZML4.1|CHRD1_CHICK RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           AltName: Full=Protein morgana
 gi|53127292|emb|CAG31029.1| hypothetical protein RCJMB04_1l2 [Gallus gallus]
          Length = 331

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 60/107 (56%), Gaps = 16/107 (14%)

Query: 73  TECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K Y        +GP   E  C YHSG P+FHEG K WSCC RK  +F  FL
Sbjct: 155 TPCKNAGCSKTY--------QGPHSTEEVCQYHSGVPIFHEGMKYWSCCKRKTSDFNTFL 206

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
             +GC  G H++       K+  K++V CRHDW+QT   + +SI+AK
Sbjct: 207 AQEGCTTGTHVWTK-----KDAGKKVVPCRHDWHQTGGEVTVSIYAK 248



>gi|326914526|ref|XP_003203576.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Meleagris gallopavo]
          Length = 328

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 60/107 (56%), Gaps = 16/107 (14%)

Query: 73  TECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K Y        +GP   E  C YHSG P+FHEG K WSCC RK  +F  FL
Sbjct: 152 TPCKNAGCSKTY--------QGPHSTEEVCQYHSGVPIFHEGMKYWSCCKRKTSDFNTFL 203

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
             +GC  G H++       K+  K++V CRHDW+QT   + +SI+AK
Sbjct: 204 AQEGCTTGTHVWTK-----KDAGKKVVPCRHDWHQTGGEVTVSIYAK 245



>gi|350417087|ref|XP_003491250.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Bombus impatiens]
          Length = 341

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 70/138 (50%), Gaps = 16/138 (11%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKI 131
           CK  SC   Y         GP ++   C +H G P+FHEG K WSCC +K  +F  FL+ 
Sbjct: 150 CKNNSCKATY--------NGPASDDEVCNHHPGVPIFHEGMKYWSCCQKKTTDFSTFLEQ 201

Query: 132 KGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKE 191
            GC +GKH ++      KN   +  +CR DW+QT T +++S++AKK     SS+      
Sbjct: 202 PGCAQGKHTWIS-----KNNNSKRAKCRMDWHQTGTFVVISVYAKKYQPDQSSIKLNPIR 256

Query: 192 VMICLYKKGRNIYYMFYL 209
           + + L+    N  Y   L
Sbjct: 257 LTVDLFFIEENSRYNLDL 274



 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGKK+  D     EG   +CIYHSG PVFH+  KGWSCC++K  +F EFL IKGC
Sbjct: 10  CYNRGCGKKF--DPNDNKEG---DCIYHSGYPVFHDAYKGWSCCNKKCTDFTEFLNIKGC 64

Query: 135 KKGKH 139
            K  H
Sbjct: 65  VKSYH 69



>gi|110774352|ref|XP_001123035.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like, partial [Apis mellifera]
          Length = 233

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 88/165 (53%), Gaps = 19/165 (11%)

Query: 35  PKISYTQTISKTITEEPK--LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG 92
           P+++ T  +S  + E+ K  ++ + K   +  + I       CK  SC       AT  G
Sbjct: 85  PQMTLTPNVSPNLLEQIKGLISNVSKSTFDTKIQI----GQSCKNNSC------KATYNG 134

Query: 93  EGPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNV 151
              E E C +H GTP+FHEG K WSCC +K  +F  FL+  GC +GKH+++      KN 
Sbjct: 135 PASENEICNHHPGTPIFHEGMKYWSCCQKKTTDFSTFLEQPGCTQGKHIWIS-----KNT 189

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICL 196
           +K+ V+CR DW+QT + +++SI+AKK     S +      + + L
Sbjct: 190 DKK-VKCRMDWHQTGSFVVVSIYAKKYQPDQSFIKLNPIRLSVDL 233



>gi|68448475|ref|NP_001020346.1| cysteine and histidine-rich domain-containing protein 1 [Danio
           rerio]
 gi|67678096|gb|AAH97168.1| Zgc:114108 [Danio rerio]
          Length = 339

 Score = 92.0 bits (227), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 67/132 (50%), Gaps = 11/132 (8%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           V   T CK   C K Y    T      E  C+YHSG P+FHEG K WSCC RK  +F  F
Sbjct: 153 VKVGTACKNGGCMKTYNGPKTD-----EEMCLYHSGVPIFHEGMKYWSCCKRKTSDFNTF 207

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
           L  +GC KG H +       K+   ++  CR DW+QT + + +SI+AK  + Q  SV   
Sbjct: 208 LSQEGCNKGSHQW------RKDTGNKVAPCRFDWHQTGSQVTLSIYAKNSNPQLCSVEAN 261

Query: 189 EKEVMICLYKKG 200
              + + L  +G
Sbjct: 262 SVSLKVHLIFEG 273



>gi|157115086|ref|XP_001658106.1| integrin beta 1 binding protein (melusin) [Aedes aegypti]
 gi|108877042|gb|EAT41267.1| AAEL007077-PA [Aedes aegypti]
          Length = 366

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 81/171 (47%), Gaps = 22/171 (12%)

Query: 44  SKTITEEPKLAP-----IEKEPEEDDLNIPVASD-------TECKRPSCGKKYVDDATSR 91
           S   T EP +AP     I++ P   D     A+D       T CK   C   Y  + T  
Sbjct: 108 SPMTTMEPIVAPAFKKQIDELPVGPDAAKKQATDPTEIKPGTACKNGGCTYSY--EGTKS 165

Query: 92  GEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNV 151
              P   C+YH G PVFHEG K WSCC R+  +F  F+   GC+ G H +    +E K  
Sbjct: 166 DSKP---CVYHPGVPVFHEGLKFWSCCQRRTSDFTAFMNQAGCETGNHKWTMDEEESK-- 220

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEVMICLYKKGRN 202
               V+CR DW+QT T ++++++AK    Q S V      + +CL    +N
Sbjct: 221 ---AVKCRMDWHQTATQVVVTVYAKMYHYQRSVVRLNPIRLSMCLVFPQQN 268