BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10338_c0_seq2-m.127 5prime_partial 2-847(+) 282 (+)
         (281 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|328774153|gb|EGF84190.1| hypothetical protein BATDEDRAFT_8492...   219   9e-55   Batrachochytrium dendrobatidis JAM81
gi|321252979|ref|XP_003192584.1| hypothetical protein CGB_C1210W...   214   3e-53   Cryptococcus gattii WM276
gi|511006298|gb|EPB87614.1| hypothetical protein HMPREF1544_0559...   212   8e-53   Mucor circinelloides f. circinelloides 1006PhL
gi|405122993|gb|AFR97758.1| CORD and CS domain-containing protei...   212   1e-52   Cryptococcus neoformans var. grubii H99
gi|345562204|gb|EGX45276.1| hypothetical protein AOL_s00173g377 ...   211   1e-52   Arthrobotrys oligospora ATCC 24927
gi|392573395|gb|EIW66535.1| hypothetical protein TREMEDRAFT_4566...   211   2e-52   Tremella mesenterica DSM 1558
gi|296417140|ref|XP_002838219.1| hypothetical protein [Tuber mel...   209   5e-52   Tuber melanosporum Mel28
gi|336367710|gb|EGN96054.1| hypothetical protein SERLA73DRAFT_58...   204   2e-50   Serpula lacrymans var. lacrymans S7.3
gi|472587860|gb|EMS25356.1| CORD and CS domain containing protei...   201   1e-49   Rhodotorula toruloides NP11
gi|401888408|gb|EJT52366.1| hypothetical protein A1Q1_04577 [Tri...   201   2e-49   Trichosporon asahii var. asahii CBS 2479
gi|392566884|gb|EIW60059.1| chord-domain-containing protein [Tra...   201   2e-49   Trametes versicolor FP-101664 SS1
gi|409045989|gb|EKM55469.1| hypothetical protein PHACADRAFT_9471...   201   2e-49   Phanerochaete carnosa HHB-10118-sp
gi|406696457|gb|EKC99745.1| hypothetical protein A1Q2_05966 [Tri...   201   3e-49   Trichosporon asahii var. asahii CBS 8904
gi|393220298|gb|EJD05784.1| chord-domain-containing protein [Fom...   200   4e-49   Fomitiporia mediterranea MF3/22
gi|402225636|gb|EJU05697.1| chord-domain-containing protein [Dac...   200   4e-49   Dacryopinax primogenitus
gi|384501633|gb|EIE92124.1| hypothetical protein RO3G_16835 [Rhi...   198   1e-48   Rhizopus delemar RA 99-880
gi|121701713|ref|XP_001269121.1| CORD and CS domain protein [Asp...   195   9e-48   Aspergillus clavatus NRRL 1
gi|389749377|gb|EIM90554.1| hypothetical protein STEHIDRAFT_5089...   194   2e-47   Stereum hirsutum FP-91666 SS1
gi|58265466|ref|XP_569889.1| hypothetical protein [Cryptococcus ...   194   2e-47   Cryptococcus neoformans var. neoformans JEC21
gi|70995530|ref|XP_752520.1| CORD and CS domain protein [Aspergi...   194   3e-47   Aspergillus fumigatus Af293
gi|340517392|gb|EGR47636.1| predicted protein [Trichoderma reese...   193   5e-47   Trichoderma reesei QM6a
gi|358388785|gb|EHK26378.1| hypothetical protein TRIVIDRAFT_8641...   193   5e-47   Trichoderma virens Gv29-8
gi|119495659|ref|XP_001264609.1| CORD and CS domain protein [Neo...   193   5e-47   Aspergillus fischeri NRRL 181
gi|425779334|gb|EKV17401.1| hypothetical protein PDIG_15250 [Pen...   192   7e-47   Penicillium digitatum PHI26
gi|255936493|ref|XP_002559273.1| Pc13g08480 [Penicillium chrysog...   192   1e-46   Penicillium rubens Wisconsin 54-1255
gi|494830946|gb|EON67457.1| hypothetical protein W97_06711 [Coni...   190   3e-46   Coniosporium apollinis CBS 100218
gi|403412626|emb|CCL99326.1| predicted protein [Fibroporia radic...   190   3e-46   Fibroporia radiculosa
gi|331243814|ref|XP_003334549.1| hypothetical protein PGTG_15978...   190   4e-46   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|46108680|ref|XP_381398.1| hypothetical protein FG01222.1 [Fus...   188   1e-45   
gi|353238059|emb|CCA70016.1| related to diploid state maintenanc...   187   3e-45   Serendipita indica DSM 11827
gi|408398874|gb|EKJ78000.1| hypothetical protein FPSE_01788 [Fus...   187   4e-45   Fusarium pseudograminearum CS3096
gi|238498286|ref|XP_002380378.1| CORD and CS domain protein [Asp...   185   1e-44   Aspergillus flavus NRRL3357
gi|451999161|gb|EMD91624.1| hypothetical protein COCHEDRAFT_1136...   185   1e-44   Bipolaris maydis C5
gi|169781504|ref|XP_001825215.1| CORD and CS domain protein [Asp...   185   1e-44   Aspergillus oryzae RIB40
gi|396462286|ref|XP_003835754.1| similar to cysteine and histidi...   185   1e-44   Leptosphaeria maculans JN3
gi|38489215|gb|AAR21293.1| ChpA [Emericella nidulans] >gi|385320...   184   2e-44   Aspergillus nidulans
gi|342876141|gb|EGU77799.1| hypothetical protein FOXB_11663 [Fus...   184   2e-44   Fusarium oxysporum Fo5176
gi|475664532|gb|EMT62327.1| Cysteine and histidine-rich domain-c...   184   3e-44   Fusarium oxysporum f. sp. cubense race 4
gi|392596105|gb|EIW85428.1| chord-domain-containing protein [Con...   182   8e-44   Coniophora puteana RWD-64-598 SS2
gi|443920789|gb|ELU40630.1| CHORD domain-containing protein [Rhi...   182   1e-43   Rhizoctonia solani AG-1 IA
gi|395333641|gb|EJF66018.1| chord-domain-containing protein [Dic...   181   2e-43   Dichomitus squalens LYAD-421 SS1
gi|258568870|ref|XP_002585179.1| hypothetical protein UREG_05868...   181   2e-43   Uncinocarpus reesii 1704
gi|358395849|gb|EHK45236.1| hypothetical protein TRIATDRAFT_2999...   181   2e-43   Trichoderma atroviride IMI 206040
gi|171687839|ref|XP_001908860.1| hypothetical protein [Podospora...   181   2e-43   Podospora anserina S mat+
gi|346320893|gb|EGX90493.1| CORD and CS domain protein [Cordycep...   181   2e-43   Cordyceps militaris CM01
gi|330916180|ref|XP_003297323.1| hypothetical protein PTT_07684 ...   181   3e-43   Pyrenophora teres f. teres 0-1
gi|169623510|ref|XP_001805162.1| hypothetical protein SNOG_14997...   181   3e-43   Parastagonospora nodorum SN15
gi|189189136|ref|XP_001930907.1| CORD and CS domain containing p...   181   3e-43   Pyrenophora tritici-repentis Pt-1C-BFP
gi|212542623|ref|XP_002151466.1| CORD and CS domain protein [Tal...   179   5e-43   Talaromyces marneffei ATCC 18224
gi|322697940|gb|EFY89714.1| CORD and CS domain containing protei...   179   6e-43   Metarhizium acridum CQMa 102
gi|400601428|gb|EJP69071.1| copper amine oxidase [Beauveria bass...   179   7e-43   Beauveria bassiana ARSEF 2860
gi|358372826|dbj|GAA89427.1| CORD and CS domain protein [Aspergi...   179   7e-43   Aspergillus kawachii IFO 4308
gi|346979500|gb|EGY22952.1| integrin beta-1-binding protein [Ver...   179   8e-43   Verticillium dahliae VdLs.17
gi|407926307|gb|EKG19274.1| hypothetical protein MPH_03137 [Macr...   179   1e-42   Macrophomina phaseolina MS6
gi|326475808|gb|EGD99817.1| CORD and CS domain-containing protei...   178   1e-42   Trichophyton tonsurans CBS 112818
gi|326479168|gb|EGE03178.1| diploid state maintenance protein ch...   178   1e-42   Trichophyton equinum CBS 127.97
gi|115491611|ref|XP_001210433.1| hypothetical protein ATEG_00347...   178   1e-42   Aspergillus terreus NIH2624
gi|350629616|gb|EHA17989.1| hypothetical protein ASPNIDRAFT_4759...   178   1e-42   Aspergillus niger ATCC 1015
gi|302496214|ref|XP_003010110.1| hypothetical protein ARB_03677 ...   178   1e-42   Arthroderma benhamiae CBS 112371
gi|302664631|ref|XP_003023943.1| hypothetical protein TRV_01884 ...   178   1e-42   Trichophyton verrucosum HKI 0517
gi|302692292|ref|XP_003035825.1| hypothetical protein SCHCODRAFT...   178   2e-42   Schizophyllum commune H4-8
gi|327293954|ref|XP_003231673.1| CORD and CS domain-containing p...   178   2e-42   Trichophyton rubrum CBS 118892
gi|119184351|ref|XP_001243096.1| hypothetical protein CIMG_06992...   178   2e-42   Coccidioides immitis RS
gi|145239673|ref|XP_001392483.1| CORD and CS domain protein [Asp...   177   3e-42   Aspergillus niger CBS 513.88
gi|303320331|ref|XP_003070165.1| CHORD family protein [Coccidioi...   177   3e-42   Coccidioides posadasii C735 delta SOWgp
gi|482805003|gb|EOA82102.1| hypothetical protein SETTUDRAFT_1655...   176   5e-42   Setosphaeria turcica Et28A
gi|451848200|gb|EMD61506.1| hypothetical protein COCSADRAFT_1483...   176   7e-42   Bipolaris sorokiniana ND90Pr
gi|358056186|dbj|GAA97926.1| hypothetical protein E5Q_04606 [Mix...   175   1e-41   Mixia osmundae IAM 14324
gi|116180402|ref|XP_001220050.1| hypothetical protein CHGG_00829...   175   2e-41   Chaetomium globosum CBS 148.51
gi|296816483|ref|XP_002848578.1| diploid state maintenance prote...   174   2e-41   Arthroderma otae CBS 113480
gi|512207497|gb|EPE36315.1| HSP20-like chaperone [Glarea lozoyen...   174   2e-41   Glarea lozoyensis ATCC 20868
gi|320591275|gb|EFX03714.1| cord and cs domain containing protei...   174   2e-41   Grosmannia clavigera kw1407
gi|328860798|gb|EGG09903.1| hypothetical protein MELLADRAFT_3410...   174   3e-41   Melampsora larici-populina 98AG31
gi|170094796|ref|XP_001878619.1| predicted protein [Laccaria bic...   174   3e-41   Laccaria bicolor S238N-H82
gi|406862834|gb|EKD15883.1| CORD and CS domain containing protei...   173   4e-41   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|322705627|gb|EFY97211.1| CORD and CS domain containing protei...   173   6e-41   
gi|429848165|gb|ELA23679.1| cord and cs domain protein [Colletot...   172   8e-41   Colletotrichum gloeosporioides Nara gc5
gi|239608220|gb|EEQ85207.1| CORD and CS domain-containing protei...   172   9e-41   Blastomyces dermatitidis ER-3
gi|485917275|gb|EOD44308.1| putative cord and cs domain protein ...   172   1e-40   Neofusicoccum parvum UCRNP2
gi|315050021|ref|XP_003174385.1| diploid state maintenance prote...   171   2e-40   Microsporum gypseum CBS 118893
gi|336267110|ref|XP_003348321.1| hypothetical protein SMAC_02818...   171   2e-40   Sordaria macrospora k-hell
gi|440482082|gb|ELQ62604.1| CORD and CS domain-containing protei...   171   2e-40   Magnaporthe oryzae P131
gi|399166054|emb|CCE33095.1| related to zinc-binding protein [Cl...   171   3e-40   Claviceps purpurea 20.1
gi|380475580|emb|CCF45181.1| CORD and CS domain-containing prote...   170   4e-40   Colletotrichum higginsianum
gi|453088822|gb|EMF16862.1| chord-domain-containing protein [Myc...   170   4e-40   Sphaerulina musiva SO2202
gi|378729041|gb|EHY55500.1| hypothetical protein HMPREF1120_0363...   169   7e-40   Exophiala dermatitidis NIH/UT8656
gi|389633065|ref|XP_003714185.1| CORD and CS domain-containing p...   169   8e-40   Magnaporthe oryzae 70-15
gi|261203499|ref|XP_002628963.1| CORD and CS domain-containing p...   169   1e-39   Blastomyces gilchristii SLH14081
gi|302925638|ref|XP_003054134.1| hypothetical protein NECHADRAFT...   169   1e-39   Nectria haematococca mpVI 77-13-4
gi|452847327|gb|EME49259.1| hypothetical protein DOTSEDRAFT_6813...   168   1e-39   Dothistroma septosporum NZE10
gi|242768532|ref|XP_002341589.1| CORD and CS domain protein [Tal...   167   3e-39   Talaromyces stipitatus ATCC 10500
gi|471574562|gb|EMR72386.1| putative cord and cs domain-containi...   167   4e-39   Eutypa lata UCREL1
gi|347837628|emb|CCD52200.1| similar to CORD and CS domain-conta...   166   5e-39   Botrytis cinerea T4
gi|440633022|gb|ELR02941.1| hypothetical protein GMDG_01162 [Geo...   166   6e-39   Pseudogymnoascus destructans 20631-21
gi|367043696|ref|XP_003652228.1| hypothetical protein THITE_2113...   166   7e-39   Thielavia terrestris NRRL 8126
gi|156053031|ref|XP_001592442.1| hypothetical protein SS1G_06683...   165   1e-38   Sclerotinia sclerotiorum 1980 UF-70
gi|398411184|ref|XP_003856935.1| hypothetical protein MYCGRDRAFT...   165   1e-38   Zymoseptoria tritici IPO323
gi|452987540|gb|EME87295.1| hypothetical protein MYCFIDRAFT_1260...   165   1e-38   Cercospora fijiensis CIRAD86
gi|225560074|gb|EEH08356.1| CORD and CS domain-containing protei...   165   2e-38   Histoplasma capsulatum G186AR
gi|225679587|gb|EEH17871.1| CORD and CS domain-containing protei...   164   2e-38   Paracoccidioides brasiliensis Pb03
gi|500259256|gb|EOO02086.1| putative cord and cs domain-containi...   164   3e-38   Phaeoacremonium minimum UCRPA7
gi|226291319|gb|EEH46747.1| integrin beta-1-binding protein [Par...   163   4e-38   Paracoccidioides brasiliensis Pb18
gi|330794004|ref|XP_003285071.1| hypothetical protein DICPUDRAFT...   163   5e-38   Dictyostelium purpureum
gi|367020152|ref|XP_003659361.1| hypothetical protein MYCTH_2313...   163   6e-38   Myceliophthora thermophila ATCC 42464
gi|240278824|gb|EER42330.1| CORD and CS protein [Ajellomyces cap...   162   7e-38   Histoplasma capsulatum H143
gi|295667758|ref|XP_002794428.1| diploid state maintenance prote...   162   8e-38   Paracoccidioides lutzii Pb01
gi|164427312|ref|XP_964180.2| hypothetical protein NCU03087 [Neu...   162   8e-38   
gi|336464494|gb|EGO52734.1| hypothetical protein NEUTE1DRAFT_126...   162   1e-37   Neurospora tetrasperma FGSC 2508
gi|477537008|gb|ENH88468.1| cord and cs domain protein [Colletot...   160   3e-37   Colletotrichum orbiculare MAFF 240422
gi|512186481|gb|EPE02273.1| cord and cs domain protein [Ophiosto...   160   3e-37   Ophiostoma piceae UAMH 11346
gi|340914653|gb|EGS17994.1| hypothetical protein CTHT_0060070 [C...   159   8e-37   Chaetomium thermophilum var. thermophilum DSM 1495
gi|449304691|gb|EMD00698.1| hypothetical protein BAUCODRAFT_6133...   158   1e-36   Baudoinia panamericana UAMH 10762
gi|310790918|gb|EFQ26451.1| CORD and CS domain-containing protei...   157   3e-36   Colletotrichum graminicola M1.001
gi|67517941|ref|XP_658745.1| hypothetical protein AN1141.2 [Aspe...   154   3e-35   Aspergillus nidulans FGSC A4
gi|281210930|gb|EFA85096.1| predicted protein [Polysphondylium p...   151   2e-34   Polysphondylium pallidum PN500
gi|470249919|ref|XP_004367191.1| hypothetical protein DFA_07328 ...   148   2e-33   Dictyostelium fasciculatum
gi|402072105|gb|EJT68059.1| CORD and CS domain-containing protei...   147   3e-33   Gaeumannomyces graminis var. tritici R3-111a-1
gi|501304723|dbj|GAC94017.1| hypothetical protein PHSY_001586 [P...   144   2e-32   Pseudozyma hubeiensis SY62
gi|71017293|ref|XP_758971.1| hypothetical protein UM02824.1 [Ust...   143   5e-32   
gi|465793934|emb|CCU98832.1| unnamed protein product [Malassezia...   143   7e-32   Malassezia sympodialis ATCC 42132
gi|443898867|dbj|GAC76201.1| Zn2+-binding protein Melusin/RAR1 [...   139   9e-31   Moesziomyces antarcticus T-34
gi|343429635|emb|CBQ73207.1| related to diploid state maintenanc...   135   1e-29   Sporisorium reilianum SRZ2
gi|242024533|ref|XP_002432682.1| Integrin beta-1-binding protein...   134   4e-29   Pediculus humanus corporis [human body lice]
gi|358335563|dbj|GAA27687.2| cysteine and histidine-rich domain-...   134   4e-29   Clonorchis sinensis [oriental liver fluke]
gi|426370096|ref|XP_004052009.1| PREDICTED: cysteine and histidi...   132   7e-29   Gorilla gorilla gorilla [lowland gorilla]
gi|388853900|emb|CCF52398.1| related to diploid state maintenanc...   132   1e-28   Ustilago hordei
gi|118404486|ref|NP_001072688.1| integrin beta 1 binding protein...   131   2e-28   Xenopus tropicalis [western clawed frog]
gi|167517191|ref|XP_001742936.1| hypothetical protein [Monosiga ...   131   2e-28   Monosiga brevicollis MX1
gi|332207896|ref|XP_003253031.1| PREDICTED: cysteine and histidi...   130   3e-28   Nomascus leucogenys [White-cheeked Gibbon]
gi|426370094|ref|XP_004052008.1| PREDICTED: cysteine and histidi...   130   4e-28   Gorilla gorilla gorilla [lowland gorilla]
gi|426370098|ref|XP_004052010.1| PREDICTED: cysteine and histidi...   130   4e-28   Gorilla gorilla gorilla [lowland gorilla]
gi|241626044|ref|XP_002409601.1| cysteine and histidine-rich dom...   130   4e-28   Ixodes scapularis [blacklegged tick]
gi|307199859|gb|EFN80256.1| Cysteine and histidine-rich domain-c...   130   5e-28   Harpegnathos saltator
gi|75076829|sp|Q4R7U2.1|CHRD1_MACFA RecName: Full=Cysteine and h...   130   5e-28   Macaca fascicularis [crab eating macaque]
gi|332024062|gb|EGI64279.1| Cysteine and histidine-rich domain-c...   130   5e-28   Acromyrmex echinatior
gi|402896523|ref|XP_003911346.1| PREDICTED: cysteine and histidi...   130   6e-28   
gi|383873111|ref|NP_001244685.1| cysteine and histidine-rich dom...   130   6e-28   Macaca mulatta [rhesus macaque]
gi|21355187|ref|NP_651226.1| CHORD [Drosophila melanogaster] >gi...   129   6e-28   Drosophila melanogaster
gi|350535042|ref|NP_001233351.1| cysteine and histidine-rich dom...   129   1e-27   Pan troglodytes
gi|148231071|ref|NP_001091174.1| integrin beta 1 binding protein...   129   1e-27   Xenopus laevis [clawed frog]
gi|397485374|ref|XP_003813823.1| PREDICTED: cysteine and histidi...   129   1e-27   
gi|221316570|ref|NP_001137545.1| cysteine and histidine-rich dom...   128   1e-27   Homo sapiens [man]
gi|12002207|gb|AAG43237.1|AF123249_1 chymotrypsin-like protein [...   128   1e-27   Homo sapiens [man]
gi|221316566|ref|NP_036256.2| cysteine and histidine-rich domain...   128   1e-27   Homo sapiens [man]
gi|119587274|gb|EAW66870.1| cysteine and histidine-rich domain (...   128   1e-27   Homo sapiens [man]
gi|403301745|ref|XP_003941543.1| PREDICTED: cysteine and histidi...   128   1e-27   
gi|209969825|ref|NP_001123267.2| cysteine and histidine-rich dom...   128   1e-27   Nasonia vitripennis
gi|149719233|ref|XP_001488703.1| PREDICTED: cysteine and histidi...   128   2e-27   Equus caballus [domestic horse]
gi|403301743|ref|XP_003941542.1| PREDICTED: cysteine and histidi...   128   2e-27   Saimiri boliviensis boliviensis
gi|440895125|gb|ELR47394.1| Cysteine and histidine-rich domain-c...   127   2e-27   Bos mutus
gi|114052382|ref|NP_001039377.1| cysteine and histidine-rich dom...   127   2e-27   Bos taurus [bovine]
gi|194909877|ref|XP_001982027.1| GG11265 [Drosophila erecta] >gi...   127   2e-27   Drosophila erecta
gi|6581054|gb|AAF18436.1|AF192465_1 CHORD containing protein [Dr...   127   3e-27   Drosophila melanogaster
gi|206597559|ref|NP_001125118.1| cysteine and histidine-rich dom...   127   3e-27   Pongo abelii [Orang-utan]
gi|195400040|ref|XP_002058626.1| GJ14211 [Drosophila virilis] >g...   127   4e-27   Drosophila virilis
gi|164664460|ref|NP_001106917.1| cysteine and histidine-rich dom...   127   4e-27   Sus scrofa [pigs]
gi|443702188|gb|ELU00349.1| hypothetical protein CAPTEDRAFT_1656...   127   4e-27   Capitella teleta
gi|426252197|ref|XP_004019802.1| PREDICTED: cysteine and histidi...   127   4e-27   
gi|281337340|gb|EFB12924.1| hypothetical protein PANDA_005065 [A...   127   4e-27   Ailuropoda melanoleuca
gi|119587271|gb|EAW66867.1| cysteine and histidine-rich domain (...   127   4e-27   Homo sapiens [man]
gi|301763016|ref|XP_002916922.1| PREDICTED: cysteine and histidi...   127   5e-27   Ailuropoda melanoleuca
gi|301763018|ref|XP_002916923.1| PREDICTED: cysteine and histidi...   126   5e-27   
gi|472385242|ref|XP_004411984.1| PREDICTED: cysteine and histidi...   126   5e-27   Odobenus rosmarus divergens
gi|472385244|ref|XP_004411985.1| PREDICTED: cysteine and histidi...   126   5e-27   Odobenus rosmarus divergens
gi|507556478|ref|XP_004661994.1| PREDICTED: cysteine and histidi...   126   6e-27   Jaculus jaculus
gi|466019580|ref|XP_004271933.1| PREDICTED: cysteine and histidi...   126   6e-27   Orcinus orca [Orca]
gi|466019585|ref|XP_004271934.1| PREDICTED: cysteine and histidi...   126   6e-27   
gi|498981622|ref|XP_004550105.1| PREDICTED: cysteine and histidi...   126   7e-27   
gi|498957342|ref|XP_004524138.1| PREDICTED: cysteine and histidi...   126   8e-27   Ceratitis capitata
gi|478506428|ref|XP_004427509.1| PREDICTED: cysteine and histidi...   126   8e-27   
gi|478506426|ref|XP_004427508.1| PREDICTED: cysteine and histidi...   125   9e-27   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|507691288|ref|XP_004641969.1| PREDICTED: cysteine and histidi...   125   9e-27   Octodon degus
gi|507691284|ref|XP_004641968.1| PREDICTED: cysteine and histidi...   125   9e-27   Octodon degus
gi|507690663|ref|XP_004641822.1| PREDICTED: cysteine and histidi...   125   1e-26   Octodon degus
gi|13385324|ref|NP_080120.1| cysteine and histidine-rich domain-...   125   1e-26   Mus musculus [mouse]
gi|157822247|ref|NP_001101598.1| cysteine and histidine-rich dom...   125   1e-26   Rattus norvegicus [brown rat]
gi|345787903|ref|XP_003432986.1| PREDICTED: cysteine and histidi...   125   1e-26   
gi|345787901|ref|XP_533979.3| PREDICTED: cysteine and histidine-...   125   1e-26   Canis lupus familiaris [dogs]
gi|355752534|gb|EHH56654.1| hypothetical protein EGM_06111 [Maca...   125   1e-26   Macaca fascicularis [crab eating macaque]
gi|403269836|ref|XP_003926916.1| PREDICTED: cysteine and histidi...   125   1e-26   
gi|348565659|ref|XP_003468620.1| PREDICTED: cysteine and histidi...   125   1e-26   Cavia porcellus [guinea pig]
gi|354498594|ref|XP_003511400.1| PREDICTED: cysteine and histidi...   125   1e-26   Cricetulus griseus [Chinese hamsters]
gi|512874918|ref|XP_004893558.1| PREDICTED: cysteine and histidi...   125   2e-26   
gi|328714834|ref|XP_001946683.2| PREDICTED: cysteine and histidi...   125   2e-26   
gi|512874914|ref|XP_004893557.1| PREDICTED: cysteine and histidi...   125   2e-26   
gi|511887716|ref|XP_004763624.1| PREDICTED: cysteine and histidi...   124   2e-26   
gi|511887714|ref|XP_004763623.1| PREDICTED: cysteine and histidi...   124   2e-26   Mustela putorius furo [black ferret]
gi|195504892|ref|XP_002099274.1| GE23458 [Drosophila yakuba] >gi...   124   2e-26   Drosophila yakuba
gi|308322439|gb|ADO28357.1| cysteine and histidine-rich domain-c...   124   2e-26   Ictalurus furcatus
gi|318054646|ref|NP_001188062.1| cysteine and histidine-rich dom...   124   2e-26   Ictalurus punctatus
gi|505788594|ref|XP_004605239.1| PREDICTED: cysteine and histidi...   124   2e-26   Sorex araneus [Eurasian shrew]
gi|348518674|ref|XP_003446856.1| PREDICTED: cysteine and histidi...   124   3e-26   Oreochromis niloticus
gi|195331552|ref|XP_002032465.1| GM26571 [Drosophila sechellia] ...   124   3e-26   Drosophila sechellia
gi|410972473|ref|XP_003992683.1| PREDICTED: cysteine and histidi...   124   4e-26   Felis catus [cat]
gi|291384094|ref|XP_002708685.1| PREDICTED: cysteine and histidi...   124   4e-26   Oryctolagus cuniculus [European rabbit]
gi|195573393|ref|XP_002104678.1| GD21075 [Drosophila simulans] >...   123   4e-26   Drosophila simulans
gi|260789534|ref|XP_002589801.1| hypothetical protein BRAFLDRAFT...   123   4e-26   Branchiostoma floridae
gi|410972475|ref|XP_003992684.1| PREDICTED: cysteine and histidi...   123   5e-26   
gi|380020848|ref|XP_003694289.1| PREDICTED: cysteine and histidi...   123   5e-26   Apis florea [dwarf honeybee]
gi|41056073|ref|NP_956633.1| cysteine and histidine-rich domain-...   123   5e-26   Danio rerio [leopard danio]
gi|149635154|ref|XP_001512381.1| PREDICTED: cysteine and histidi...   123   5e-26   Ornithorhynchus anatinus [duck-billed platypus]
gi|68448475|ref|NP_001020346.1| cysteine and histidine-rich doma...   123   5e-26   Danio rerio [leopard danio]
gi|66507739|ref|XP_395533.2| PREDICTED: cysteine and histidine-r...   123   6e-26   Apis mellifera [European honey bee]
gi|327287046|ref|XP_003228240.1| PREDICTED: cysteine and histidi...   122   7e-26   
gi|6581056|gb|AAF18437.1|AF192466_1 CHORD containing protein-1 [...   122   7e-26   Homo sapiens [man]
gi|395814695|ref|XP_003780879.1| PREDICTED: cysteine and histidi...   122   9e-26   Otolemur garnettii
gi|224043653|ref|XP_002186547.1| PREDICTED: cysteine and histidi...   122   1e-25   Taeniopygia guttata
gi|395520569|ref|XP_003764400.1| PREDICTED: cysteine and histidi...   122   1e-25   Sarcophilus harrisii
gi|195444282|ref|XP_002069796.1| GK11385 [Drosophila willistoni]...   122   1e-25   Drosophila willistoni
gi|326427601|gb|EGD73171.1| hypothetical protein PTSG_04884 [Sal...   121   2e-25   Salpingoeca rosetta
gi|504145632|ref|XP_004585237.1| PREDICTED: cysteine and histidi...   121   2e-25   Ochotona princeps [southern American pika]
gi|357622949|gb|EHJ74291.1| hypothetical protein KGM_22001 [Dana...   121   2e-25   Danaus plexippus [American monarch]
gi|363732737|ref|XP_420200.3| PREDICTED: cysteine and histidine-...   121   3e-25   Gallus gallus [bantam]
gi|344287779|ref|XP_003415630.1| PREDICTED: cysteine and histidi...   120   3e-25   
gi|291227043|ref|XP_002733497.1| PREDICTED: cysteine and histidi...   120   3e-25   Saccoglossus kowalevskii
gi|513180394|ref|XP_004940688.1| PREDICTED: cysteine and histidi...   120   3e-25   
gi|471418084|ref|XP_004390542.1| PREDICTED: cysteine and histidi...   120   3e-25   Trichechus manatus latirostris
gi|483493278|gb|EOA93338.1| Cysteine and histidine-rich domain-c...   120   3e-25   Anas platyrhynchos [duck]
gi|194746448|ref|XP_001955692.1| GF16113 [Drosophila ananassae] ...   120   3e-25   Drosophila ananassae
gi|471418082|ref|XP_004390541.1| PREDICTED: cysteine and histidi...   120   3e-25   Trichechus manatus latirostris
gi|344287777|ref|XP_003415629.1| PREDICTED: cysteine and histidi...   120   3e-25   Loxodonta africana [African bush elephant]
gi|449267899|gb|EMC78790.1| Cysteine and histidine-rich domain-c...   120   4e-25   Columba livia [carrier pigeon]
gi|512919933|ref|XP_004929505.1| PREDICTED: cysteine and histidi...   120   4e-25   Bombyx mori [silk moth]
gi|321472345|gb|EFX83315.1| hypothetical protein DAPPUDRAFT_1951...   120   4e-25   Daphnia pulex
gi|488580804|ref|XP_004475845.1| PREDICTED: cysteine and histidi...   120   4e-25   
gi|410915800|ref|XP_003971375.1| PREDICTED: cysteine and histidi...   120   5e-25   
gi|405958045|gb|EKC24211.1| Cysteine and histidine-rich domain-c...   120   5e-25   Crassostrea gigas
gi|340713157|ref|XP_003395114.1| PREDICTED: cysteine and histidi...   120   5e-25   Bombus terrestris [large earth bumblebee]
gi|410915798|ref|XP_003971374.1| PREDICTED: cysteine and histidi...   120   5e-25   
gi|336380423|gb|EGO21576.1| hypothetical protein SERLADRAFT_4101...   120   5e-25   Serpula lacrymans var. lacrymans S7.9
gi|488580802|ref|XP_004475844.1| PREDICTED: cysteine and histidi...   120   5e-25   Dasypus novemcinctus
gi|51010995|ref|NP_001003457.1| uncharacterized protein LOC44506...   119   6e-25   Danio rerio [leopard danio]
gi|47227100|emb|CAG00462.1| unnamed protein product [Tetraodon n...   119   6e-25   Tetraodon nigroviridis
gi|307172259|gb|EFN63764.1| Cysteine and histidine-rich domain-c...   119   7e-25   Camponotus floridanus
gi|148224594|ref|NP_001084590.1| cysteine and histidine-rich dom...   119   7e-25   Xenopus laevis [clawed frog]
gi|47213470|emb|CAF91127.1| unnamed protein product [Tetraodon n...   119   8e-25   Tetraodon nigroviridis
gi|91077034|ref|XP_967567.1| PREDICTED: similar to CHORD CG6198-...   119   8e-25   Tribolium castaneum [rust-red flour beetle]
gi|71895117|ref|NP_001026003.1| cysteine and histidine-rich doma...   119   1e-24   Gallus gallus [bantam]
gi|410956946|ref|XP_003985097.1| PREDICTED: cysteine and histidi...   119   1e-24   
gi|350417087|ref|XP_003491250.1| PREDICTED: cysteine and histidi...   119   1e-24   
gi|327269263|ref|XP_003219414.1| PREDICTED: cysteine and histidi...   118   2e-24   
gi|326914526|ref|XP_003203576.1| PREDICTED: cysteine and histidi...   118   2e-24   
gi|327269265|ref|XP_003219415.1| PREDICTED: cysteine and histidi...   118   2e-24   
gi|391332709|ref|XP_003740773.1| PREDICTED: cysteine and histidi...   117   3e-24   Metaseiulus occidentalis
gi|410931133|ref|XP_003978950.1| PREDICTED: cysteine and histidi...   117   4e-24   
gi|195108471|ref|XP_001998816.1| GI24177 [Drosophila mojavensis]...   117   5e-24   Drosophila mojavensis
gi|195036428|ref|XP_001989672.1| GH18665 [Drosophila grimshawi] ...   116   6e-24   Drosophila grimshawi
gi|383865839|ref|XP_003708380.1| PREDICTED: cysteine and histidi...   116   6e-24   
gi|225717222|gb|ACO14457.1| Cysteine and histidine-rich domain-c...   116   7e-24   Esox lucius
gi|402890696|ref|XP_003908615.1| PREDICTED: cysteine and histidi...   116   8e-24   
gi|156386846|ref|XP_001634122.1| predicted protein [Nematostella...   115   9e-24   Nematostella vectensis
gi|326918752|ref|XP_003205652.1| PREDICTED: cysteine and histidi...   115   1e-23   
gi|195144882|ref|XP_002013425.1| GL23415 [Drosophila persimilis]...   114   2e-23   Drosophila persimilis
gi|125775143|ref|XP_001358823.1| GA19433 [Drosophila pseudoobscu...   114   2e-23   Drosophila pseudoobscura pseudoobscura
gi|499025807|ref|XP_004563650.1| PREDICTED: cysteine and histidi...   114   3e-23   
gi|390344220|ref|XP_797726.3| PREDICTED: cysteine and histidine-...   114   3e-23   Strongylocentrotus purpuratus [purple urchin]
gi|449269579|gb|EMC80340.1| Cysteine and histidine-rich domain-c...   114   3e-23   Columba livia [carrier pigeon]
gi|507707540|ref|XP_004716722.1| PREDICTED: integrin beta-1-bind...   114   4e-23   Echinops telfairi [lesser hedgehog tenrec]
gi|483516671|gb|EOB03448.1| Cysteine and histidine-rich domain-c...   113   4e-23   Anas platyrhynchos [duck]
gi|395851939|ref|XP_003798505.1| PREDICTED: cysteine and histidi...   113   5e-23   Otolemur garnettii
gi|348532995|ref|XP_003453991.1| PREDICTED: cysteine and histidi...   113   7e-23   
gi|170057517|ref|XP_001864518.1| integrin beta-1-binding protein...   112   7e-23   Culex quinquefasciatus
gi|256074434|ref|XP_002573530.1| cysteine and histidine-rich dom...   112   9e-23   
gi|504171448|ref|XP_004595310.1| PREDICTED: integrin beta-1-bind...   112   1e-22   Ochotona princeps [southern American pika]
gi|340375423|ref|XP_003386234.1| PREDICTED: LOW QUALITY PROTEIN:...   112   1e-22   
gi|471391187|ref|XP_004380194.1| PREDICTED: integrin beta-1-bind...   112   2e-22   Trichechus manatus latirostris
gi|444727536|gb|ELW68023.1| Integrin beta-1-binding protein 2 [T...   111   2e-22   Tupaia chinensis
gi|257206202|emb|CAX82752.1| Integrin beta-1-binding protein 2 [...   111   2e-22   Schistosoma japonicum
gi|198433494|ref|XP_002129382.1| PREDICTED: cysteine and histidi...   110   3e-22   Ciona intestinalis [sea vase]
gi|157818035|ref|NP_001101715.1| integrin beta-1-binding protein...   110   4e-22   Rattus norvegicus [brown rat]
gi|7305191|ref|NP_038740.1| integrin beta-1-binding protein 2 [M...   110   4e-22   Mus musculus [mouse]
gi|290561016|gb|ADD37910.1| Cysteine and histidine-rich domain-c...   110   4e-22   Lepeophtheirus salmonis
gi|291407671|ref|XP_002720146.1| PREDICTED: integrin beta 1 bind...   110   5e-22   Oryctolagus cuniculus [European rabbit]
gi|226484766|emb|CAX74292.1| Integrin beta-1-binding protein 2 [...   110   5e-22   Schistosoma japonicum
gi|478531503|ref|XP_004439905.1| PREDICTED: integrin beta-1-bind...   110   5e-22   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|76156795|gb|AAX27924.2| SJCHGC05923 protein [Schistosoma japo...   110   5e-22   Schistosoma japonicum
gi|226469016|emb|CAX69987.1| Integrin beta-1-binding protein 2 [...   110   6e-22   Schistosoma japonicum
gi|348570522|ref|XP_003471046.1| PREDICTED: integrin beta-1-bind...   110   6e-22   Cavia porcellus [guinea pig]
gi|512908055|ref|XP_004901249.1| PREDICTED: integrin beta-1-bind...   109   6e-22   
gi|119625701|gb|EAX05296.1| integrin beta 1 binding protein (mel...   109   7e-22   
gi|403305178|ref|XP_003943147.1| PREDICTED: integrin beta-1-bind...   109   9e-22   
gi|507554445|ref|XP_004660999.1| PREDICTED: integrin beta-1-bind...   109   9e-22   
gi|332247218|ref|XP_003272751.1| PREDICTED: integrin beta-1-bind...   109   1e-21   
gi|301787373|ref|XP_002929100.1| PREDICTED: integrin beta-1-bind...   108   1e-21   
gi|507982266|ref|XP_004694535.1| PREDICTED: integrin beta-1-bind...   108   1e-21   
gi|74007660|ref|XP_538074.2| PREDICTED: integrin beta-1-binding ...   108   1e-21   
gi|281340178|gb|EFB15762.1| hypothetical protein PANDA_019198 [A...   108   1e-21   
gi|470636072|ref|XP_004323456.1| PREDICTED: integrin beta-1-bind...   108   1e-21   
gi|466038317|ref|XP_004275797.1| PREDICTED: integrin beta-1-bind...   108   1e-21   
gi|344282026|ref|XP_003412776.1| PREDICTED: integrin beta-1-bind...   108   1e-21   
gi|194228014|ref|XP_001915337.1| PREDICTED: integrin beta-1-bind...   108   1e-21   
gi|431914408|gb|ELK15665.1| Integrin beta-1-binding protein 2 [P...   108   2e-21   
gi|80477904|gb|AAI08902.1| ITGB1BP2 protein [Homo sapiens]            108   2e-21   
gi|432096329|gb|ELK27090.1| Integrin beta-1-binding protein 2 [M...   108   2e-21   
gi|6912438|ref|NP_036410.1| integrin beta-1-binding protein 2 [H...   108   2e-21   
gi|354497964|ref|XP_003511087.1| PREDICTED: integrin beta-1-bind...   108   2e-21   
gi|402910490|ref|XP_003917909.1| PREDICTED: integrin beta-1-bind...   108   2e-21   
gi|109131169|ref|XP_001091670.1| PREDICTED: integrin beta-1-bind...   108   2e-21   
gi|329664540|ref|NP_001192661.1| integrin beta-1-binding protein...   108   2e-21   
gi|507710142|ref|XP_004646844.1| PREDICTED: integrin beta-1-bind...   107   3e-21   
gi|428167453|gb|EKX36412.1| hypothetical protein GUITHDRAFT_1657...   107   3e-21   
gi|344246848|gb|EGW02952.1| Non-POU domain-containing octamer-bi...   107   3e-21   
gi|472353975|ref|XP_004396650.1| PREDICTED: integrin beta-1-bind...   107   4e-21   
gi|478251770|gb|ENN72218.1| hypothetical protein YQE_11133, part...   106   5e-21   
gi|157115086|ref|XP_001658106.1| integrin beta 1 binding protein...   106   7e-21   
gi|410988800|ref|XP_004000665.1| PREDICTED: integrin beta-1-bind...   106   7e-21   
gi|332375727|gb|AEE63004.1| unknown [Dendroctonus ponderosae]         106   8e-21   
gi|511915967|ref|XP_004777285.1| PREDICTED: integrin beta-1-bind...   106   8e-21   
gi|426257208|ref|XP_004022224.1| PREDICTED: integrin beta-1-bind...   105   1e-20   
gi|229893767|gb|ACQ90241.1| melusin trancript variant 1 [Sus scr...   104   2e-20   
gi|118783063|ref|XP_562821.2| AGAP003064-PA [Anopheles gambiae s...   104   3e-20   
gi|347969183|ref|XP_312747.5| AGAP003061-PA [Anopheles gambiae s...   103   4e-20   
gi|312385742|gb|EFR30167.1| hypothetical protein AND_00397 [Anop...   103   4e-20   
gi|397526077|ref|XP_003832966.1| PREDICTED: LOW QUALITY PROTEIN:...   103   6e-20   
gi|238914601|gb|ACR78150.1| melusin [Sus scrofa]                      103   7e-20   
gi|74136751|ref|NP_001028181.1| integrin beta-1-binding protein ...   102   9e-20   
gi|449499312|ref|XP_002187746.2| PREDICTED: cysteine and histidi...   102   9e-20   
gi|334350451|ref|XP_001367602.2| PREDICTED: integrin beta-1-bind...   102   1e-19   
gi|164655004|ref|XP_001728634.1| hypothetical protein MGL_4233 [...   102   2e-19   
gi|505856357|ref|XP_004621584.1| PREDICTED: integrin beta-1-bind...   101   3e-19   
gi|355745370|gb|EHH49995.1| hypothetical protein EGM_00749, part...    99   9e-19   
gi|355558103|gb|EHH14883.1| hypothetical protein EGK_00878, part...    99   1e-18   
gi|395546215|ref|XP_003774985.1| PREDICTED: integrin beta-1-bind...    99   1e-18   
gi|154318401|ref|XP_001558519.1| hypothetical protein BC1G_03368...    99   1e-18   
gi|110774352|ref|XP_001123035.1| PREDICTED: cysteine and histidi...    99   1e-18   
gi|297710293|ref|XP_002831831.1| PREDICTED: LOW QUALITY PROTEIN:...    98   2e-18   
gi|328710099|ref|XP_003244165.1| PREDICTED: cysteine and histidi...    97   5e-18   
gi|196005965|ref|XP_002112849.1| hypothetical protein TRIADDRAFT...    97   6e-18   
gi|313227225|emb|CBY22372.1| unnamed protein product [Oikopleura...    96   1e-17   
gi|339252562|ref|XP_003371504.1| chord superfamily [Trichinella ...    96   1e-17   
gi|86279688|gb|ABC94499.1| putative chymotrypsin-like protein [I...    95   2e-17   
gi|259488543|tpe|CBF88062.1| TPA: ChpADiploid state maintenance ...    95   2e-17   
gi|313241653|emb|CBY33878.1| unnamed protein product [Oikopleura...    94   4e-17   
gi|312077228|ref|XP_003141211.1| hypothetical protein LOAG_05626...    92   1e-16   
gi|393910997|gb|EJD76117.1| hypothetical protein, variant [Loa loa]    92   2e-16   
gi|393910996|gb|EFO22861.2| hypothetical protein LOAG_05626 [Loa...    92   2e-16   
gi|465993333|gb|EMP39162.1| Cysteine and histidine-rich domain-c...    92   2e-16   
gi|12834857|dbj|BAB23069.1| unnamed protein product [Mus musculus]     91   4e-16   
gi|334330427|ref|XP_001363967.2| PREDICTED: cysteine and histidi...    91   5e-16   
gi|318087198|gb|ADV40191.1| putative cysteine and histidine-rich...    90   5e-16   
gi|341891845|gb|EGT47780.1| hypothetical protein CAEBREN_24777 [...    89   1e-15   
gi|341898191|gb|EGT54126.1| CBN-CHP-1 protein [Caenorhabditis br...    89   2e-15   
gi|507672114|ref|XP_004709016.1| PREDICTED: cysteine and histidi...    88   2e-15   
gi|395858901|ref|XP_003801793.1| PREDICTED: LOW QUALITY PROTEIN:...    88   3e-15   
gi|170590606|ref|XP_001900063.1| CHORD family protein [Brugia ma...    87   7e-15   
gi|62859241|ref|NP_001016156.1| SGT1, suppressor of G2 allele of...    86   2e-14   
gi|308474055|ref|XP_003099250.1| CRE-CHP-1 protein [Caenorhabdit...    84   5e-14   
gi|432920882|ref|XP_004080014.1| PREDICTED: cysteine and histidi...    84   6e-14   
gi|268567422|ref|XP_002639984.1| C. briggsae CBR-CHP-1 protein [...    83   7e-14   
gi|296235737|ref|XP_002763027.1| PREDICTED: integrin beta-1-bind...    83   8e-14   
gi|17506293|ref|NP_491519.1| Protein CHP-1 [Caenorhabditis elega...    82   2e-13   
gi|390466070|ref|XP_003733514.1| PREDICTED: LOW QUALITY PROTEIN:...    82   2e-13   
gi|511915969|ref|XP_004777286.1| PREDICTED: integrin beta-1-bind...    82   2e-13   
gi|148222280|ref|NP_001085215.1| SGT1, suppressor of G2 allele o...    81   4e-13   
gi|395820868|ref|XP_003783780.1| PREDICTED: cysteine and histidi...    81   4e-13   
gi|410947471|ref|XP_003980470.1| PREDICTED: suppressor of G2 all...    80   5e-13   
gi|224587011|gb|ACN58591.1| Suppressor of G2 allele of SKP1 homo...    80   5e-13   
gi|47228022|emb|CAF97651.1| unnamed protein product [Tetraodon n...    80   6e-13   
gi|504128985|ref|XP_004577706.1| PREDICTED: suppressor of G2 all...    79   2e-12   
gi|507534001|ref|XP_004651058.1| PREDICTED: suppressor of G2 all...    78   2e-12   
gi|472371788|ref|XP_004405390.1| PREDICTED: suppressor of G2 all...    78   3e-12   
gi|12841721|dbj|BAB25326.1| unnamed protein product [Mus musculus]     77   4e-12   
gi|281349092|gb|EFB24676.1| hypothetical protein PANDA_003941 [A...    77   5e-12   
gi|291393039|ref|XP_002713019.1| PREDICTED: suppressor of G2 all...    77   6e-12   
gi|501292986|dbj|BAN20545.1| chaperone binding protein [Riptortu...    77   6e-12   
gi|148703812|gb|EDL35759.1| SGT1, suppressor of G2 allele of SKP...    77   6e-12   
gi|194221935|ref|XP_001492983.2| PREDICTED: suppressor of G2 all...    77   7e-12   
gi|351711167|gb|EHB14086.1| Suppressor of G2 allele of SKP1-like...    76   8e-12   
gi|23956176|ref|NP_080750.1| suppressor of G2 allele of SKP1 hom...    76   9e-12   
gi|466032386|ref|XP_004274593.1| PREDICTED: suppressor of G2 all...    76   1e-11   
gi|345788596|ref|XP_851986.2| PREDICTED: suppressor of G2 allele...    76   1e-11   
gi|478518886|ref|XP_004433667.1| PREDICTED: suppressor of G2 all...    75   1e-11   
gi|149050042|gb|EDM02366.1| SGT1, suppressor of G2 allele of SKP...    75   2e-11   
gi|511878821|ref|XP_004759353.1| PREDICTED: suppressor of G2 all...    75   2e-11   
gi|505786102|ref|XP_004604660.1| PREDICTED: suppressor of G2 all...    75   2e-11   
gi|507684574|ref|XP_004640313.1| PREDICTED: suppressor of G2 all...    75   2e-11   
gi|344281758|ref|XP_003412644.1| PREDICTED: suppressor of G2 all...    75   3e-11   
gi|221126843|ref|XP_002156624.1| PREDICTED: suppressor of G2 all...    75   3e-11   
gi|198278555|ref|NP_001013069.1| suppressor of G2 allele of SKP1...    75   3e-11   
gi|350589913|ref|XP_003482948.1| PREDICTED: suppressor of G2 all...    75   3e-11   
gi|441614459|ref|XP_003257444.2| PREDICTED: suppressor of G2 all...    74   3e-11   
gi|109120863|ref|XP_001084394.1| PREDICTED: suppressor of G2 all...    74   3e-11   
gi|158256240|dbj|BAF84091.1| unnamed protein product [Homo sapiens]    74   4e-11   
gi|301760213|ref|XP_002915920.1| PREDICTED: suppressor of G2 all...    74   4e-11   
gi|395834414|ref|XP_003790199.1| PREDICTED: suppressor of G2 all...    74   4e-11   
gi|195963398|ref|NP_001124384.1| suppressor of G2 allele of SKP1...    74   4e-11   
gi|328908703|gb|AEB61019.1| suppressor of g2 allele of SKP1-like...    74   4e-11   
gi|33286853|gb|AAQ01749.1| SGT1B protein [Homo sapiens]                74   4e-11   
gi|426375584|ref|XP_004054610.1| PREDICTED: suppressor of G2 all...    74   4e-11   
gi|158257688|dbj|BAF84817.1| unnamed protein product [Homo sapiens]    74   4e-11   
gi|109120861|ref|XP_001084516.1| PREDICTED: suppressor of G2 all...    74   4e-11   
gi|402576674|gb|EJW70632.1| CHORD family protein, partial [Wuche...    74   4e-11   
gi|488542554|ref|XP_004462850.1| PREDICTED: suppressor of G2 all...    74   4e-11   
gi|328909225|gb|AEB61280.1| suppressor of g2 allele of SKP1-like...    74   4e-11   
gi|5730041|ref|NP_006695.1| suppressor of G2 allele of SKP1 homo...    74   5e-11   
gi|426375582|ref|XP_004054609.1| PREDICTED: suppressor of G2 all...    74   5e-11   
gi|402902109|ref|XP_003913965.1| PREDICTED: suppressor of G2 all...    74   5e-11   
gi|507939245|ref|XP_004680175.1| PREDICTED: suppressor of G2 all...    74   6e-11   
gi|321471341|gb|EFX82314.1| hypothetical protein DAPPUDRAFT_3025...    73   7e-11   
gi|512964175|ref|XP_004844321.1| PREDICTED: suppressor of G2 all...    73   7e-11   
gi|471377740|ref|XP_004376679.1| PREDICTED: suppressor of G2 all...    73   7e-11   
gi|512889015|ref|XP_004896808.1| PREDICTED: suppressor of G2 all...    73   8e-11   
gi|395527530|ref|XP_003765897.1| PREDICTED: suppressor of G2 all...    73   8e-11   
gi|351707771|gb|EHB10690.1| Suppressor of G2 allele of SKP1-like...    73   8e-11   
gi|308809267|ref|XP_003081943.1| Zn2+-binding protein Melusin/RA...    73   1e-10   


>gi|328774153|gb|EGF84190.1| hypothetical protein BATDEDRAFT_84922 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 338

 Score =  219 bits (557), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 112/226 (49%), Positives = 149/226 (65%), Gaps = 7/226 (3%)

Query: 54  APIEKEPE-EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGS 112
           AP+  E +  D  +  VA  T CKR +CG+ ++DD TSR +    ECI+H G PVFHEGS
Sbjct: 114 APVFLEKDMHDPADAIVAPGTLCKRKTCGQSFLDD-TSRSQ----ECIHHPGAPVFHEGS 168

Query: 113 KGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMS 172
           KGWSCC+R+VLEF+EFLKIKGC   KH F     E  ++ K++V+CR DWYQTP  +I+S
Sbjct: 169 KGWSCCTRRVLEFDEFLKIKGCSTSKHRFTNVHLESTDI-KQVVECRRDWYQTPDTVILS 227

Query: 173 IFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKL 232
           IFAKKVDK  ++V F +  L VD+   D         L+Q ID   S FE+L+TK+EI L
Sbjct: 228 IFAKKVDKLATTVVFDKTSLKVDILFLDGSSSQYHTDLFQPIDPNASKFEVLSTKLEIVL 287

Query: 233 KKANGISWPSLKSDENLGIATTFGVQGGAATVGGKQYTLATDSPLY 278
           KKAN +SW +++  EN+   TTFG+ G   TVGGK+  +  D+PL+
Sbjct: 288 KKANSLSWVAIEPKENVTTWTTFGITGSVGTVGGKEAVVGHDAPLH 333



 Score = 72.8 bits (177), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK +        EG   EC+YHSG+ VFHEG KGWSCC+++V +F+ FLKI GC
Sbjct: 6   CANKGCGKPFEPSI----EG-NKECVYHSGSAVFHEGLKGWSCCTKRVTDFDAFLKIPGC 60

Query: 135 KKGKH 139
             G H
Sbjct: 61  TTGTH 65



>gi|321252979|ref|XP_003192584.1| hypothetical protein CGB_C1210W [Cryptococcus gattii WM276]
 gi|317459053|gb|ADV20797.1| conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 377

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 108/217 (49%), Positives = 139/217 (64%), Gaps = 7/217 (3%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DDL+ PV     CKR +CG  +  +  SRGEG +A C YH    +FHEGSKG+ CC R+V
Sbjct: 157 DDLSAPVPDGARCKRLACGATWEGEQVSRGEGEKAVCRYHPQPAIFHEGSKGYLCCKRRV 216

Query: 123 LEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQN 182
           LEF+EF+KI GCK+GKHLFVGS K+    ++E+V CR D YQTPT +I+S FAK  DK  
Sbjct: 217 LEFDEFMKIPGCKEGKHLFVGSKKD--ETKEEVVNCRLDHYQTPTQVIVSAFAKGADKSR 274

Query: 183 SSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPS 242
           S++TF  + L +DL +P  KR + T  LY  ID E S++ IL TKVEI L K    SWP 
Sbjct: 275 STITFTPQTLSLDLSLPSNKRVLKTVTLYGPIDPELSSYRILGTKVEITLVKPKPASWPV 334

Query: 243 LK-----SDENLGIATTFGVQGGAATVGGKQYTLATD 274
           L+     ++   G A TFGV G   T+GGK+  LA +
Sbjct: 335 LELPPAGTELPPGYALTFGVSGRTGTIGGKEIVLAAE 371



>gi|511006298|gb|EPB87614.1| hypothetical protein HMPREF1544_05597 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 348

 Score =  212 bits (540), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 149/211 (70%), Gaps = 6/211 (2%)

Query: 68  PVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEE 127
           PV   T CKR  CG+ + D ATSRG G EA C +H G+P+FHEGSKGWSCCSRKVL+F+E
Sbjct: 139 PVPEGTTCKRRGCGRVWKDQATSRGSGAEATCRHHPGSPIFHEGSKGWSCCSRKVLDFDE 198

Query: 128 FLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTF 187
           FLKI+GCK+GKHLFVG+  +     +E+V CR DWYQT T++I+SIFAK  +K ++ V F
Sbjct: 199 FLKIEGCKEGKHLFVGANSQT----EEMVDCRTDWYQTQTNVILSIFAK--NKDDTKVDF 252

Query: 188 REKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
            E  ++VD+KM   KR+   +PL+  ID   S F +L+TK+EI LKK +GISW SL+ ++
Sbjct: 253 TEDTINVDIKMKGNKRYKKAFPLFATIDAAASKFTVLSTKIEINLKKTSGISWASLEPND 312

Query: 248 NLGIATTFGVQGGAATVGGKQYTLATDSPLY 278
            +   TTFGV GG  TVGG +     DSPL+
Sbjct: 313 QVKTWTTFGVSGGGGTVGGTEMYYNADSPLH 343



>gi|405122993|gb|AFR97758.1| CORD and CS domain-containing protein [Cryptococcus neoformans var.
           grubii H99]
          Length = 375

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/275 (41%), Positives = 158/275 (57%), Gaps = 28/275 (10%)

Query: 26  NGVEIYDSGPKISY-----TQTISKTITEEPKLAPIE----------------KEPEEDD 64
           +GVE Y +    +      +  +S T T  P + P                  KE E+DD
Sbjct: 97  DGVETYGTAAPTAKLPAAESSKLSNTATSSPSVVPSALTAVTPSQHNTEQKEAKEVEQDD 156

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
            ++PV     CKR +CG  +  +  SRG+G +A C YH    +FHEGSKG+ CC R+VLE
Sbjct: 157 PSVPVPKGARCKRLACGATWEGEEVSRGDGEKAICRYHPQAAIFHEGSKGYLCCKRRVLE 216

Query: 125 FEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSS 184
           F+EF+KI GCK+G+HLFVGS K+    ++E+V CR D YQTPT +I+S FAK  DK  S+
Sbjct: 217 FDEFMKIPGCKEGRHLFVGSKKD--ETKEEVVNCRLDHYQTPTQVIVSAFAKGADKSRST 274

Query: 185 VTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLK 244
           +TF  + L + L +P  KR + T  LY  ID + S++ IL+TKVEI L K    SWP L+
Sbjct: 275 ITFTPQTLTLSLSLPSNKRVLKTVTLYGPIDPDVSSYRILSTKVEITLVKPKPASWPVLE 334

Query: 245 -----SDENLGIATTFGVQGGAATVGGKQYTLATD 274
                ++   G A TFGV G   T+GGK+  LA +
Sbjct: 335 LPPAGTELPPGYALTFGVSGRTGTIGGKEIVLAAE 369



>gi|345562204|gb|EGX45276.1| hypothetical protein AOL_s00173g377 [Arthrobotrys oligospora ATCC
           24927]
          Length = 326

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 106/208 (50%), Positives = 138/208 (66%), Gaps = 3/208 (1%)

Query: 43  ISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           IS+        AP E+ PEED+  + V +  +CKR  C   YV +  SR  G    C++H
Sbjct: 111 ISQARINPQPAAPKEQVPEEDEPGVTVPAGAKCKRNGCEITYVSEEESRKPG---SCVHH 167

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G  +FHEGSKGWSCC R+VLEF EFLKI GC +G H +VG+ K+ +   +EIV CR D+
Sbjct: 168 PGVAIFHEGSKGWSCCKRRVLEFSEFLKIGGCSEGNHCYVGTQKKDEAGGEEIVTCRTDF 227

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFE 222
           YQT T+I  SIF KK DK  S++TFR  E+DVDLK  D KR+ TT PLY  I  + STF+
Sbjct: 228 YQTYTNINASIFLKKTDKDKSTITFRPTEIDVDLKTTDNKRYQTTIPLYATITPDESTFK 287

Query: 223 ILTTKVEIKLKKANGISWPSLKSDENLG 250
           ++ TKVE+ LKKA+G SWP+L++DE  G
Sbjct: 288 VMGTKVEMSLKKADGTSWPALRNDEATG 315



 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 39/69 (56%), Gaps = 8/69 (11%)

Query: 71  SDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLK 130
           S  +C    CGK + D        PE EC +H G PVFHEG KGW CC  +VL F+EFL 
Sbjct: 2   SSQKCTHQGCGKTFSD--------PEEECCFHPGPPVFHEGQKGWKCCKPRVLTFDEFLT 53

Query: 131 IKGCKKGKH 139
           I  C  G+H
Sbjct: 54  IPPCATGRH 62



>gi|392573395|gb|EIW66535.1| hypothetical protein TREMEDRAFT_45668 [Tremella mesenterica DSM
           1558]
          Length = 365

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/224 (48%), Positives = 144/224 (64%), Gaps = 8/224 (3%)

Query: 56  IEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGW 115
           IE E EEDDL++PV   T CKR +CG  +  +  SRG G +++C YH   P+FHEGSKG+
Sbjct: 139 IEIETEEDDLSLPVPEGTRCKRTTCGAIWEGEEISRGNGIKSKCKYHPQPPIFHEGSKGY 198

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
            CC R+VLEF+EF+KI+GC +G HLFVGS K  K   +E V+CR D YQTP  + +S FA
Sbjct: 199 LCCKRRVLEFDEFMKIQGCTEGNHLFVGSDKGEK---EERVECRLDHYQTPMQVHVSAFA 255

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K  DK  S VTF  ++L +DL +P  KR + +  LY  +D   STF IL+TKV+I L+K 
Sbjct: 256 KGADKNKSKVTFETQQLHLDLFLPGNKRVVKSVTLYGPVDPTTSTFRILSTKVDIILQKP 315

Query: 236 NGISWPSLK-----SDENLGIATTFGVQGGAATVGGKQYTLATD 274
              SWP L+     ++   G A TFGV G   T+GGK + LA +
Sbjct: 316 APASWPLLELPPPGTELPPGYALTFGVSGRTGTIGGKDFVLAPE 359



>gi|296417140|ref|XP_002838219.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634141|emb|CAZ82410.1| unnamed protein product [Tuber melanosporum]
          Length = 326

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 103/200 (51%), Positives = 138/200 (69%), Gaps = 5/200 (2%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           EK  E+DD ++P      C+R  C   Y  D  SR E  + +C +H G P+FHEGSKG+S
Sbjct: 127 EKPLEQDDPSVPAPPGARCRRLGCEATY--DGGSR-EDEDEKCEFHPGVPIFHEGSKGYS 183

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC R+VLEF++FLKI GC   +HLFVG+ K     ++E+V CR+D+YQT T +I+SIFAK
Sbjct: 184 CCKRRVLEFDQFLKIPGCATDRHLFVGAPK--PGDDEELVSCRNDFYQTYTDVIVSIFAK 241

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           KVDK  + V F EK+LDVDL MPD KR+  ++PLY  ID     +++LTTK+E+KLKKA+
Sbjct: 242 KVDKTRAEVHFSEKQLDVDLPMPDNKRYKVSFPLYGAIDPAGCEYKVLTTKIELKLKKAD 301

Query: 237 GISWPSLKSDENLGIATTFG 256
           G+SWP+L+SDE  G     G
Sbjct: 302 GLSWPTLRSDEVSGEIIQIG 321



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        PE EC YH G P+FHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCAHKGCGKTFTD--------PEEECHYHPGAPIFHEGQKGWQCCKTRVLTFDEFLTIPP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CSVGKH 61



>gi|336367710|gb|EGN96054.1| hypothetical protein SERLA73DRAFT_58926 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 341

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 109/224 (48%), Positives = 143/224 (63%), Gaps = 8/224 (3%)

Query: 54  APIEKEP---EEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFH 109
           AP E  P   EEDDL++PV +   C+   CG  +V D  +R G G EA C YH  +P+F 
Sbjct: 114 APKEPAPVVEEEDDLSVPVQTGAPCRHTGCGVAFVSDEVNRIGNGEEATCTYHPASPIFR 173

Query: 110 EGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHI 169
           EGSKG+ CC R+VLEFEEFLKI+GCK+G+H+FV   K      +E  +CR D YQTP+ +
Sbjct: 174 EGSKGYLCCKRRVLEFEEFLKIEGCKRGRHVFV--PKVSNKAAEEFTECRVDHYQTPSEV 231

Query: 170 IMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVE 229
            +S+FAK+VDK+ S+V   E ++  DL +P  KRF  T  L+  +D E S  +   TKVE
Sbjct: 232 HVSVFAKQVDKERSTVRIEENKVHFDLYLPASKRFQRTIDLFGQVDPEASLHKYYGTKVE 291

Query: 230 IKLKKANGISWPSL-KSDENLG-IATTFGVQGGAATVGGKQYTL 271
           + LKKA+  SW  L K+D+NLG I+ TFGV G   TVGGK   L
Sbjct: 292 VSLKKADNRSWTLLEKTDKNLGNISLTFGVSGRTGTVGGKTVHL 335



>gi|472587860|gb|EMS25356.1| CORD and CS domain containing protein [Rhodosporidium toruloides
           NP11]
          Length = 356

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 137/216 (63%), Gaps = 11/216 (5%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           E+DD  + V     CKR +CGK+Y  +   R EG   EC YH+G P+FHEGSKG+SCC R
Sbjct: 138 EQDDPEVEVKKGMRCKRRACGKEY--EGEDRQEG---ECKYHAGVPIFHEGSKGYSCCKR 192

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           +VLEF+EFL+I+GC+ G+HLFVG+ KE    E E+V  R D YQTP  +I+S+F K+ DK
Sbjct: 193 RVLEFDEFLRIEGCRTGRHLFVGAKKEDDGKE-ELVDLRTDHYQTPRQVIVSVFGKQADK 251

Query: 181 QNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
           + S V F  + + VDL +P  KRF  ++PLY  ID   S+++IL TK EI L KA+  SW
Sbjct: 252 EASVVKFESEAMHVDLVLPSRKRFTKSFPLYGPIDPSASSYKILGTKCEITLAKADARSW 311

Query: 241 PSLKS-DENLG----IATTFGVQGGAATVGGKQYTL 271
           PS+ + D  L     I   F   GG  TVG K+  L
Sbjct: 312 PSITTLDPELASKFQIQLAFSAGGGRGTVGAKEMVL 347



>gi|401888408|gb|EJT52366.1| hypothetical protein A1Q1_04577 [Trichosporon asahii var. asahii
           CBS 2479]
          Length = 361

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/270 (43%), Positives = 150/270 (55%), Gaps = 26/270 (9%)

Query: 25  ENGVEIYDSGPKISYTQTISKTITEEP------------KLAPIEKEPEEDDLNIPVASD 72
           + GVE Y S P  +          EEP            K  P  +  EEDD +IPV   
Sbjct: 89  KGGVETYGSAPATAPASGTGTPAPEEPADQTPAVTVATQKQEPEPQVEEEDDPDIPVPDG 148

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
             CK   C   +     SRG+GPEA C YH   P+FHEGSKG+ CC R+VLEF++FLKI 
Sbjct: 149 AHCKHLGCNAVWKGQDISRGDGPEAVCTYHPQKPIFHEGSKGYLCCKRRVLEFDDFLKIP 208

Query: 133 GCKKGKHLFVG---SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
           GC KGKHLFVG   SG+E      E+V+ R D YQTPT + +S++AK VDK  S VTF  
Sbjct: 209 GCTKGKHLFVGPKPSGRE------ELVEARVDHYQTPTEVFVSVYAKGVDKATSKVTFGP 262

Query: 190 KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLK----- 244
           + +D+DL +P  KR   T  LY  I  E  ++ IL TKV+I+L K    SWP L+     
Sbjct: 263 QSIDLDLHLPGNKRVKRTLTLYGPIVPEKCSYRILGTKVDIELTKPQPASWPLLELPPPG 322

Query: 245 SDENLGIATTFGVQGGAATVGGKQYTLATD 274
           ++   G A TFGV G   TVGGK+  L+ +
Sbjct: 323 TELPPGYAITFGVSGRTGTVGGKEIVLSAE 352



>gi|392566884|gb|EIW60059.1| chord-domain-containing protein [Trametes versicolor FP-101664 SS1]
          Length = 342

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 112/250 (44%), Positives = 149/250 (59%), Gaps = 9/250 (3%)

Query: 25  ENGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKY 84
           + G E Y S P    +   S+  T  PK      E EEDDL+ PV   T C+   C  +Y
Sbjct: 91  QGGAETYSSAPVNMPSAAASREATPAPKF-----EEEEDDLSAPVTVGTTCRHSGCNVEY 145

Query: 85  VDDATSRGEG-PEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVG 143
             D   R EG   AEC YH   P+FHEGSKG+ CC R+VLEF+EFLKI+GCKKG+H+FV 
Sbjct: 146 ESDELHRTEGGAAAECTYHPKPPIFHEGSKGYLCCKRRVLEFDEFLKIEGCKKGRHVFVP 205

Query: 144 SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKR 203
             K     E+E  +CR D YQTP+ +  S+FAKK D   S+VT  E ++ +DL +P +KR
Sbjct: 206 KQK-ADPQEEEFTECRIDHYQTPSEVHASVFAKKADADTSTVTIEENQVFLDLYLPAKKR 264

Query: 204 FITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL-KSDENLG-IATTFGVQGGA 261
           F  T  L+  I+ E S+++   TK+E++LKK +  SW  L K+D +LG I  TFGV G  
Sbjct: 265 FRKTLNLWGPINPEESSYKFFGTKLELRLKKKDIRSWTLLEKTDRDLGNINFTFGVGGRT 324

Query: 262 ATVGGKQYTL 271
            T+G K+  L
Sbjct: 325 GTIGAKELVL 334



 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 46/72 (63%), Gaps = 8/72 (11%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCS---RKVLEFEEFLKI 131
           C    CGK Y    +    GPE+ C YH+G PVFHEGSK WSCCS   + VL+F++FLKI
Sbjct: 4   CTHKGCGKDY----SPENNGPES-CTYHTGAPVFHEGSKSWSCCSDVNKPVLDFDDFLKI 58

Query: 132 KGCKKGKHLFVG 143
            GC KG+H  V 
Sbjct: 59  PGCTKGQHTDVA 70



>gi|409045989|gb|EKM55469.1| hypothetical protein PHACADRAFT_94710 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 343

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/211 (49%), Positives = 135/211 (63%), Gaps = 3/211 (1%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           DDL++ V   T C+   CGK ++    SR GEG EA CIYH   P+FHEGSKG+ CC R+
Sbjct: 124 DDLSVDVPVGTACRHKGCGKTFISSEVSRLGEGEEAVCIYHPKQPIFHEGSKGYLCCRRR 183

Query: 122 VLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           VLEFEEFLKI+GCK+GKHLF    K   N E+E V CR D YQTPT I +S+FAK+ D+ 
Sbjct: 184 VLEFEEFLKIEGCKRGKHLFAPKDKP-SNQEEEHVTCRIDHYQTPTEIHVSVFAKQADRD 242

Query: 182 NSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWP 241
            S+V     E+  DL +P  KRF  +  L+  ID E S+++   TKVE+ L+KA+  SW 
Sbjct: 243 RSAVKIASNEIAFDLVLPGPKRFRRSIELFGPIDPEASSYKYYGTKVELILRKADNRSWA 302

Query: 242 SL-KSDENLGIATTFGVQGGAATVGGKQYTL 271
            L K+D  L I+ TFGV G   T+G K+  L
Sbjct: 303 VLEKTDRTLPISFTFGVGGRTGTIGAKELIL 333



>gi|406696457|gb|EKC99745.1| hypothetical protein A1Q2_05966 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 362

 Score =  201 bits (510), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 118/271 (43%), Positives = 153/271 (56%), Gaps = 27/271 (9%)

Query: 25  ENGVEIYDSGPKIS-------------YTQTISKTITEEPKLAPIEKEPEEDDLNIPVAS 71
           + GVE Y S P  +               QT + T+  + +  P  +  EEDD +IPV  
Sbjct: 89  KGGVETYGSAPATAPASGTGTPAPEEPANQTPAVTVATQKQPEPEPQVEEEDDPDIPVPD 148

Query: 72  DTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKI 131
              CK   C   +     SRG+GPEA C YH   P+FHEGSKG+ CC R+VLEF++FLKI
Sbjct: 149 GAHCKHLGCNAVWKGQDISRGDGPEAVCTYHPQKPIFHEGSKGYLCCKRRVLEFDDFLKI 208

Query: 132 KGCKKGKHLFVG---SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
            GC KGKHLFVG   SGKE      E+V+ R D YQTPT + +S++AK VDK  S VTF 
Sbjct: 209 PGCTKGKHLFVGPKPSGKE------ELVEARVDHYQTPTEVFVSVYAKGVDKATSKVTFG 262

Query: 189 EKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLK---- 244
            + +D+DL +P  KR   T  LY  I  E  ++ IL TKV+I+L K    SWP L+    
Sbjct: 263 PQSIDLDLHLPGNKRVKRTLTLYGPIVPEKCSYRILGTKVDIELTKPQPASWPLLELPPP 322

Query: 245 -SDENLGIATTFGVQGGAATVGGKQYTLATD 274
            ++   G A TFGV G   TVGGK+  L+ +
Sbjct: 323 GTELPPGYAITFGVSGRTGTVGGKEIVLSAE 353



>gi|393220298|gb|EJD05784.1| chord-domain-containing protein [Fomitiporia mediterranea MF3/22]
          Length = 347

 Score =  200 bits (508), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 150/245 (61%), Gaps = 4/245 (1%)

Query: 26  NGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYV 85
           +G E + +G   S+  T+     +    AP   E EEDDL++PV S TEC+R  CG K++
Sbjct: 90  DGTETFTTGMSASFLSTLPPAPPKPSTPAPPPVEEEEDDLSVPVDSGTECRRKGCGVKFI 149

Query: 86  DDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGS 144
               SR G+G  A C YH   P+FHEGSKG+ CC R+VLEFEEFLKI+GCK GKHLF   
Sbjct: 150 SQQESRLGDGENAVCTYHPSPPIFHEGSKGYLCCKRRVLEFEEFLKIEGCKTGKHLFAPK 209

Query: 145 GKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRF 204
                  E +   CR D YQTPT++ +SIFAK+ DK  S+V   E E+ +DL +PD KRF
Sbjct: 210 KNGYLKAEVQTT-CRIDHYQTPTNVCVSIFAKQADKSRSTVNLEENEVYLDLFLPDSKRF 268

Query: 205 ITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL-KSDENLGIAT-TFGVQGGAA 262
             +  L+  I  E S + ++ TKVE+ LKK +  SW  L K++++LG+   TFGV G   
Sbjct: 269 TRSLILFGPIVPEESRYTVMGTKVELNLKKKDNRSWNLLEKTEQDLGVFNLTFGVGGRTG 328

Query: 263 TVGGK 267
           T+G +
Sbjct: 329 TIGSR 333



>gi|402225636|gb|EJU05697.1| chord-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 360

 Score =  200 bits (508), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 151/259 (58%), Gaps = 16/259 (6%)

Query: 27  GVEIYDSG---PKISYTQTISKTITEEPKLA-----PIEKEPEEDDLNIPVASDTECKRP 78
           G E+Y +    P ++   ++ K +   PK       P+  E E+D+  + V   T+CKR 
Sbjct: 89  GKEVYTTAAASPTLAAQTSLPKPVPAVPKAPKEPAKPVPIEIEDDEPGVKVEPGTKCKRN 148

Query: 79  SCGKKYVDDATSRGEG-PEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKG 137
            C   YVDD T R EG  EA C++H   P+FHEGSKG+ CC R+VLEF+EFL+I GC  G
Sbjct: 149 GCNAVYVDDETHRTEGGKEAVCVFHPAPPIFHEGSKGYMCCKRRVLEFDEFLRITGCTTG 208

Query: 138 KHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLK 197
           KHLFVG  K     E+E+VQCR D YQTP  + +S+FAKK  K+ S V F E+ +++DL 
Sbjct: 209 KHLFVGKPKS-PEAEEELVQCRIDHYQTPKTVQVSVFAKKTGKE-SMVRFGEQSVELDLH 266

Query: 198 MPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDEN-----LGIA 252
           +P+ KRF  T  LY  I+ E S + IL TKVE+KL KA+  SW  L+          G  
Sbjct: 267 LPERKRFTKTLRLYGPINAEESGYTILATKVELKLVKADTRSWNMLEQPREGTPVPEGFN 326

Query: 253 TTFGVQGGAATVGGKQYTL 271
            TFGV G   T+G K   L
Sbjct: 327 LTFGVGGRTGTIGAKDVIL 345



>gi|384501633|gb|EIE92124.1| hypothetical protein RO3G_16835 [Rhizopus delemar RA 99-880]
          Length = 339

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/209 (52%), Positives = 141/209 (67%), Gaps = 8/209 (3%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CKR  CG  + D   SRG  P+A+C YH G P+FHEGSKGWSCCSRKVL+F+EFLKI+
Sbjct: 138 TICKRRGCGHVFKDQEISRG--PDAKCRYHPGAPIFHEGSKGWSCCSRKVLDFDEFLKIE 195

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GCK+G+H+FV       N  +E+V CR DWYQT T++I SIFAK  +K+++ V F E  +
Sbjct: 196 GCKEGRHVFVSKS----NNGEEMVDCRTDWYQTQTNVIFSIFAK--NKEDTQVKFNENSI 249

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDENLGIA 252
           D+D+KM   KR+   +PL+Q ID   S F  L+TKVEI LKK +GISW S +  + +   
Sbjct: 250 DIDIKMKGNKRYKKNFPLFQTIDVNASKFTALSTKVEINLKKTSGISWASFEPTDEVKTW 309

Query: 253 TTFGVQGGAATVGGKQYTLATDSPLYANK 281
           TTFGV GG  TVG K+     DSPL  N+
Sbjct: 310 TTFGVSGGGGTVGAKEMHYNADSPLNYNQ 338



>gi|121701713|ref|XP_001269121.1| CORD and CS domain protein [Aspergillus clavatus NRRL 1]
 gi|119397264|gb|EAW07695.1| CORD and CS domain protein [Aspergillus clavatus NRRL 1]
          Length = 316

 Score =  195 bits (496), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 136/207 (65%), Gaps = 7/207 (3%)

Query: 42  TISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIY 101
            IS  I      AP+ +E E DD ++ ++++T C+R  C   Y   A+      E +C++
Sbjct: 101 AISPAIAPPSTAAPVAEESESDDPSLEISANTTCRRRGCNAGYNPSASRD----EEKCVH 156

Query: 102 HSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRH 160
           H G P+FHEGSKGWSCC ++VLEF+EFLKI+GCK K KHLF+G GK     + E V  R+
Sbjct: 157 HPGQPIFHEGSKGWSCCKKRVLEFDEFLKIQGCKEKKKHLFIGKGKPPGEEKVETV--RN 214

Query: 161 DWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENST 220
           D+YQTP+ + +S++ KK+DK N+ V F    ++ DL   D KR+  TYPL+  ID E S+
Sbjct: 215 DFYQTPSTVNVSLYLKKIDKDNAKVNFAPTSVEFDLPTTDNKRYKDTYPLFAPIDPEQSS 274

Query: 221 FEILTTKVEIKLKKANGISWPSLKSDE 247
           F +L TK+E+KL KA+G SWP L+SD+
Sbjct: 275 FRVLGTKLELKLAKADGTSWPVLRSDD 301



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK++ D         + +C+YH G PVFHEG KGW CC  +VL FEEFL+I 
Sbjct: 3   SKCVHKGCGKEFTDA--------DEQCVYHPGPPVFHEGQKGWKCCKPRVLTFEEFLEIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|389749377|gb|EIM90554.1| hypothetical protein STEHIDRAFT_50891 [Stereum hirsutum FP-91666
           SS1]
          Length = 337

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/210 (48%), Positives = 138/210 (65%), Gaps = 4/210 (1%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           EDDL+ PV   T+CK   C  +YV D  +R G+G  A C YH  +P+FHEGSKG+ CC R
Sbjct: 126 EDDLDAPVPPGTKCKHNGCDIEYVSDEENRKGDGEGAICTYHPQSPIFHEGSKGYLCCKR 185

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           +VLEF+EFLKI+GCKKG+H+FV    +   V+ E+V CR D YQTP+ + +S+FAK+ D 
Sbjct: 186 RVLEFDEFLKIEGCKKGRHVFVPKKSDEDEVQ-ELVNCRIDHYQTPSAVHVSVFAKQADS 244

Query: 181 QNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
             S V F + ++ +DL +P  KRF  +  L+  I  E S+F+   TKVE  LKK +G SW
Sbjct: 245 SRSVVRFEQDQIHLDLFLPGSKRFTRSLVLFGPISVEASSFKFYGTKVECTLKKMDGRSW 304

Query: 241 PSL-KSDENLG-IATTFGVQGGAATVGGKQ 268
             L K+D++LG IA TFGV G   T+G K+
Sbjct: 305 TLLEKTDQDLGNIALTFGVGGRTGTIGAKE 334



>gi|58265466|ref|XP_569889.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134108963|ref|XP_776596.1| hypothetical protein CNBC0890 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259276|gb|EAL21949.1| hypothetical protein CNBC0890 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57226121|gb|AAW42582.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 375

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 138/218 (63%), Gaps = 7/218 (3%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           +DD ++PV     CKR +CG  +  +  SRG+G +A C YH    +FHEGSKG+ CC R+
Sbjct: 154 QDDPSVPVPEGARCKRLACGATWEGEEVSRGDGEKAVCRYHPQAAIFHEGSKGYLCCKRR 213

Query: 122 VLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           VLEF+EF+KI GCK+GKHLF+G  K+    ++E+V CR D YQTPT +I+S FAK  DK 
Sbjct: 214 VLEFDEFMKIPGCKEGKHLFMGPKKD--ETKEEVVNCRLDHYQTPTQVIVSAFAKGADKS 271

Query: 182 NSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWP 241
            S++TF  + L + L +P  KR + T  LY  ID   S++ IL+TKVEI L K    SWP
Sbjct: 272 RSTITFTPQTLSLSLSLPSNKRVLKTVTLYGPIDPNVSSYRILSTKVEITLVKPKPASWP 331

Query: 242 SLK-----SDENLGIATTFGVQGGAATVGGKQYTLATD 274
            L+     ++   G A TFGV G   T+GGK+  LA +
Sbjct: 332 VLELPPAGTELPPGYALTFGVSGRTGTIGGKEIVLAAE 369



>gi|70995530|ref|XP_752520.1| CORD and CS domain protein [Aspergillus fumigatus Af293]
 gi|41581230|emb|CAE47879.1| chord containing protein homologue, putative [Aspergillus
           fumigatus]
 gi|66850155|gb|EAL90482.1| CORD and CS domain protein [Aspergillus fumigatus Af293]
 gi|159131275|gb|EDP56388.1| CORD and CS domain protein [Aspergillus fumigatus A1163]
          Length = 314

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 134/194 (69%), Gaps = 7/194 (3%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P  ++ EEDD  + + ++  C+R  C K Y D + SR E    +C+YH G P+FHEGSKG
Sbjct: 112 PAVEDTEEDDPALEIPANATCRRRGCNKGY-DPSISRDE---EKCVYHPGQPIFHEGSKG 167

Query: 115 WSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC R+VLEF+EF+KI+GCK K +HLFVG GK     + E V  R+D+YQTP+ + +S+
Sbjct: 168 WSCCKRRVLEFDEFMKIQGCKEKTRHLFVGKGKPAGEEKVETV--RNDFYQTPSTVNVSL 225

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           + KK+DK N+ VTF    ++ DL   D KR+  TYPL+  ID E S+F++L TK+E+KL 
Sbjct: 226 YLKKIDKDNAKVTFSSTSVEFDLPTTDNKRYKDTYPLFAPIDPEGSSFKVLGTKLELKLV 285

Query: 234 KANGISWPSLKSDE 247
           KA+G SWP L+SD+
Sbjct: 286 KADGTSWPVLRSDD 299



 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK++ D        P+ +C+YH G PVFHEG KGW CC  +VL FEEFL I 
Sbjct: 3   SKCVHKGCGKEFTD--------PDEDCLYHPGPPVFHEGQKGWKCCKTRVLTFEEFLTIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|340517392|gb|EGR47636.1| predicted protein [Trichoderma reesei QM6a]
          Length = 319

 Score =  193 bits (490), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 149/246 (60%), Gaps = 29/246 (11%)

Query: 24  VENGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPE--------------EDDLNIPV 69
           VE G + +D     +  Q IS+     P   PI+                  +  L+IP 
Sbjct: 70  VEEGPQQFDEA---ALAQKISEASVSAPTRRPIQPAQHVPTPPPPPPDSEDDDPSLDIPD 126

Query: 70  ASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
            +  EC+R +C  KY   +   GE    +C++H G P+FHEGSKG+SCC R+VLEF++F+
Sbjct: 127 GA--ECRRKACSAKYKKGSAREGE----KCVHHPGVPIFHEGSKGYSCCKRRVLEFDQFM 180

Query: 130 KIKGCK-KGKHLFVGSGKEVK---NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSV 185
           KI+GCK K KHLFVGSGK+ K     E+ +   RHD+YQTPT +I S+F KK++K  S V
Sbjct: 181 KIEGCKTKDKHLFVGSGKKDKAESGSEEILTTVRHDFYQTPTQVIASLFLKKINKDTSKV 240

Query: 186 TFREKELDVDLKM--PDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
             +EKE+D+DL    P  KR+  T+PLY  ++ E S+F++L TK+E+ L KA+G SWP L
Sbjct: 241 DIKEKEVDLDLTTSDPTPKRYTATFPLYGTVNPEGSSFKVLGTKLELLLAKADGASWPVL 300

Query: 244 KSDENL 249
           +SDE L
Sbjct: 301 RSDEQL 306



>gi|358388785|gb|EHK26378.1| hypothetical protein TRIVIDRAFT_86413 [Trichoderma virens Gv29-8]
          Length = 318

 Score =  193 bits (490), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 132/191 (69%), Gaps = 12/191 (6%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L+IP  +D  C+R +CG KY   A+   E    +C++H G P+FHEGSKG+SCC R+VLE
Sbjct: 121 LDIPDGAD--CRRKACGAKYSKGASREDE----QCVHHPGVPIFHEGSKGYSCCKRRVLE 174

Query: 125 FEEFLKIKGCK-KGKHLFVGSGKEVK---NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           F+EF+KI GCK K KHLF+GSGK+ K     E+ +   RHD+YQTPT +I S+F KK++K
Sbjct: 175 FDEFMKIVGCKTKDKHLFIGSGKKDKAEAGNEEILTTVRHDFYQTPTQVIASLFLKKINK 234

Query: 181 QNSSVTFREKELDVDLKM--PDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGI 238
           + + V F+ KE+D+DL    P  KR+  T PL+  ID E S F+IL TK+E+ L KA+G 
Sbjct: 235 EIAKVVFKAKEIDLDLTTSDPTPKRYTATLPLFGEIDTEKSAFKILGTKMELTLVKADGA 294

Query: 239 SWPSLKSDENL 249
           SWP L+SDE L
Sbjct: 295 SWPVLRSDEQL 305



>gi|119495659|ref|XP_001264609.1| CORD and CS domain protein [Neosartorya fischeri NRRL 181]
 gi|119412771|gb|EAW22712.1| CORD and CS domain protein [Neosartorya fischeri NRRL 181]
          Length = 314

 Score =  193 bits (490), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 137/194 (70%), Gaps = 7/194 (3%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ ++ E+DD ++ + ++  C+R  C K Y + + SR E    +C+YH G P+FHEGSKG
Sbjct: 112 PVVEDTEDDDPSLEIPANATCRRRGCNKGY-NPSISRDE---EKCVYHPGQPIFHEGSKG 167

Query: 115 WSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC R+VLEF+EF+KI+GCK K +HLFVG G+     E+++   R+D+YQTP+ + +S+
Sbjct: 168 WSCCKRRVLEFDEFMKIQGCKEKTRHLFVGKGRPAG--EEKVQTVRNDFYQTPSTVNVSL 225

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           + KK+DK N+ VTF    ++ DL   D KR+  TYPL+  ID E S+F++L TK+E+KL 
Sbjct: 226 YLKKIDKDNAKVTFSSTSVEFDLPTTDNKRYKDTYPLFAPIDPERSSFKVLGTKLELKLV 285

Query: 234 KANGISWPSLKSDE 247
           KA+G SWP L+SD+
Sbjct: 286 KADGTSWPVLRSDD 299



 Score = 76.6 bits (187), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK++ D        P+ +C+YH G PVFHEG KGW CC  +VL FEEFL I 
Sbjct: 3   SKCVHKGCGKEFTD--------PDEDCLYHPGPPVFHEGQKGWKCCKTRVLTFEEFLTIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|425779334|gb|EKV17401.1| hypothetical protein PDIG_15250 [Penicillium digitatum PHI26]
 gi|425779619|gb|EKV17664.1| hypothetical protein PDIP_30770 [Penicillium digitatum Pd1]
          Length = 311

 Score =  192 bits (489), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 98/212 (46%), Positives = 138/212 (65%), Gaps = 10/212 (4%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           IS T TI+   T  P   P+  EPE DD ++ + ++  C+R SCG  Y   +T+R E   
Sbjct: 94  ISATPTIA---TAAPPAKPVIDEPESDDPDVEIPANATCRRRSCGASYTG-STARDE--- 146

Query: 97  AECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEI 155
            +C++H G PVFHEGSKGWSCC R+VLEF+EFLKI GC +K +H+FVG  K     E+++
Sbjct: 147 EKCVHHPGQPVFHEGSKGWSCCKRRVLEFDEFLKIPGCTEKTRHMFVGKAKPAG--EEKV 204

Query: 156 VQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLID 215
              R+D+YQTPT + +S++ KK+DKQ + V F    +  DL   D KR+  TY L+  ID
Sbjct: 205 DSVRNDFYQTPTAVNVSLYLKKIDKQRAKVQFAANSIIFDLPTTDNKRYQDTYSLFAPID 264

Query: 216 KENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
            + STF +L TK+++ L KA+G SWP L+SD+
Sbjct: 265 ADKSTFRVLGTKLDLSLIKADGASWPVLRSDD 296



 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   +CGK + D        PE +C+YH G PVFHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCIHKACGKTFTD--------PEEDCVYHPGPPVFHEGQKGWKCCKPRVLTFEEFLGIPP 55

Query: 134 CKKGKHLFV 142
           C  GKH  V
Sbjct: 56  CTTGKHSTV 64



>gi|255936493|ref|XP_002559273.1| Pc13g08480 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583893|emb|CAP91917.1| Pc13g08480 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 312

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/212 (46%), Positives = 138/212 (65%), Gaps = 10/212 (4%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           IS T TI+   T  P   P+ +EPE DD ++ + ++  C+R  CG  Y   +T R E   
Sbjct: 95  ISATPTIA---TAAPPEKPVIEEPESDDPDVEIPANATCRRRGCGASYTG-STVRDE--- 147

Query: 97  AECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEI 155
            +C++H G PVFHEGSKGWSCC R+VLEF+EFLKI GC +K +H+FVG  K     E+++
Sbjct: 148 EKCVHHPGQPVFHEGSKGWSCCKRRVLEFDEFLKIPGCTEKKRHMFVGKAKPPG--EEKV 205

Query: 156 VQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLID 215
              R+D+YQTPT + +S++ KK+DKQ + V F    +  DL   D KR+  TYPL+  ID
Sbjct: 206 DTVRNDFYQTPTAVNVSLYLKKIDKQRAKVEFAANSIIFDLPTTDNKRYQDTYPLFAPID 265

Query: 216 KENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
            E STF +L TK+++ L KA+G SWP L+SD+
Sbjct: 266 PEKSTFRVLGTKLDLSLIKADGTSWPVLRSDD 297



 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   +CGK + D        PE +C+YH G PVFHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCVHKACGKTFTD--------PEEDCVYHPGPPVFHEGQKGWKCCKPRVLTFEEFLAIPP 55

Query: 134 CKKGKHLFV 142
           C  GKH  V
Sbjct: 56  CTTGKHSTV 64



>gi|494830946|gb|EON67457.1| hypothetical protein W97_06711 [Coniosporium apollinis CBS 100218]
          Length = 335

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/221 (44%), Positives = 139/221 (62%), Gaps = 23/221 (10%)

Query: 48  TEEPKLA-PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTP 106
           T+ P+ A P   E E DD ++P+ +   C+R  C  +YV   +   E    +CI+H G  
Sbjct: 106 TQTPQSASPAPPEDESDDPSLPIPAGQTCRRRGCKAEYVPGTSREDE----KCIHHPGQA 161

Query: 107 VFHEGSKGWSCCSRKVLEFEEFLKIKGCKKG-KHLFVGSGKE-----VKNVEKE------ 154
           +FHEGSKGW+CC R+VLEFEEF+KI+GCK   +HLFVGSGK+     + +V  E      
Sbjct: 162 LFHEGSKGWTCCKRRVLEFEEFMKIEGCKTNDRHLFVGSGKKRGEENLDSVRYETSRAPY 221

Query: 155 -----IVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKE-LDVDLKMPDEKRFITTY 208
                +  C HD+YQTP+ +I S+F KK+DK+ S+V F     +D+DL+  D KR++   
Sbjct: 222 SATWSLTTCSHDFYQTPSSVIASLFLKKIDKEKSTVKFASSSTIDLDLRTSDNKRYLQNV 281

Query: 209 PLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDENL 249
           PLY  ID E STF+I+ TK+E+ L KA+G SWP L++DE L
Sbjct: 282 PLYAPIDPEQSTFKIMGTKLELTLAKADGSSWPVLRADERL 322



>gi|403412626|emb|CCL99326.1| predicted protein [Fibroporia radiculosa]
          Length = 348

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 155/254 (61%), Gaps = 20/254 (7%)

Query: 36  KISYTQTISKTITEEPK---LAPIEKEP------------EEDDLNIPVASDTECKRPSC 80
           K++ +QTI++T    P    + P++ +P            +EDDL++PV   T CKR  C
Sbjct: 86  KMTESQTITETYVSGPSESAMPPLKAQPPVTTAPPAPVVEDEDDLSVPVQPGTSCKRNGC 145

Query: 81  GKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKH 139
              +  D  +R G+GP A C YH  TP+FHEGSKG+ CC R+VLEF+EFLKI+GCK G+H
Sbjct: 146 KTVFESDDINRVGDGPGALCTYHPKTPIFHEGSKGYLCCKRRVLEFDEFLKIEGCKTGRH 205

Query: 140 LFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMP 199
           +FV   +E ++  ++   CR D YQTP  + +S+FAKK D+  S+V   E  + +DL +P
Sbjct: 206 VFVPINRESES--EQFTDCRIDHYQTPREVHVSVFAKKADEGRSTVKIEENAIHLDLYLP 263

Query: 200 DEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL-KSDENLG-IATTFGV 257
             KRF  +  L+  +D   S+++   TKVE+ LKK +  SW  L K+ ++LG I+ TFGV
Sbjct: 264 ASKRFRKSLELFGPVDASASSYKFYGTKVEVLLKKQDTRSWAILEKTTKDLGPISLTFGV 323

Query: 258 QGGAATVGGKQYTL 271
            G   T+GGK+  L
Sbjct: 324 GGRTGTIGGKEIIL 337



 Score = 72.8 bits (177), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 43/69 (62%), Gaps = 10/69 (14%)

Query: 75  CKRPSCGKKY-VDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCS---RKVLEFEEFLK 130
           C R  CGK Y V+D  S G      C YH G P+FHEG K WSCCS   + VL+F+EF+K
Sbjct: 4   CTRRGCGKDYNVEDNASDG------CTYHPGGPIFHEGLKSWSCCSDVNKPVLDFDEFMK 57

Query: 131 IKGCKKGKH 139
           + GC +G H
Sbjct: 58  LPGCARGPH 66



>gi|331243814|ref|XP_003334549.1| hypothetical protein PGTG_15978 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309313539|gb|EFP90130.1| hypothetical protein PGTG_15978 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 348

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/224 (45%), Positives = 143/224 (63%), Gaps = 5/224 (2%)

Query: 35  PKISYTQTISKTITEEPKL--APIEKEPE-EDDLNIPVASDTECKRPSCGKKYVDDATS- 90
           P    TQ + + I  E  +   P+  +PE +DD    V   ++CKR +CG  +       
Sbjct: 108 PTHQTTQDVFQPIKPEQAIESQPVIPKPELQDDPESIVTEGSKCKRLACGITWHGLGNCK 167

Query: 91  RGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKN 150
           RGE  + EC YH GTPVFHEGSKG+SCC R+VL+F++FL+++GCKK  HLF        N
Sbjct: 168 RGELDKEECTYHPGTPVFHEGSKGYSCCKRRVLDFDDFLRLRGCKKSSHLFTEVSGSTMN 227

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPL 210
            ++E V+ R D+YQTPT +I+SIFAKKVD++ S + F    +DVDLK+P  KRF  T+ L
Sbjct: 228 DQEESVESRFDFYQTPTSVIVSIFAKKVDQEKSLIKFNTSTVDVDLKLPSNKRFRRTFNL 287

Query: 211 YQLIDKENSTFEILTTKVEIKLKKANGISWPSL-KSDENLGIAT 253
           + LID + ST++IL+TK E+ L K++G SW +L K D  +G  T
Sbjct: 288 FGLIDPDQSTYKILSTKCEMVLIKSDGRSWSNLEKGDAFVGTVT 331



 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 75/148 (50%), Gaps = 29/148 (19%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC---SRKVLEFEEFLKI 131
           C R  CGKK+  D   +     +EC++H G PVFHEG K WSCC   ++ V+EF++F+KI
Sbjct: 4   CTRLGCGKKFDPDHNLK-----SECVFHPGQPVFHEGLKSWSCCKEMNKPVMEFDQFMKI 58

Query: 132 KGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKE 191
           +GC  G H          ++EK +VQ       TP   +  +    VD  N ++TF   +
Sbjct: 59  EGCATGVH----------SLEKPVVQ------TTPAAQV-ELKESSVDA-NGTMTFTTVD 100

Query: 192 LDVDLKMPDEKRFITTYPLYQLIDKENS 219
             +   MP  +   TT  ++Q I  E +
Sbjct: 101 QTMPALMPTHQ---TTQDVFQPIKPEQA 125



>gi|46108680|ref|XP_381398.1| hypothetical protein FG01222.1 [Fusarium graminearum PH-1]
          Length = 316

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/195 (47%), Positives = 130/195 (66%), Gaps = 8/195 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD ++ +A    CKR +CG  Y   ++   E    EC++H G P+FHEGSKG+SCC
Sbjct: 113 ESEDDDPSLEIADGVGCKRRACGATYKKSSSRDNE----ECVHHPGVPIFHEGSKGYSCC 168

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIV-QCRHDWYQTPTHIIMSIFAK 176
            R+VLEF++F+KI+GCK K KHLFVGSGK+     +E+V   RHD+YQTP ++I S F K
Sbjct: 169 KRRVLEFDQFMKIEGCKTKDKHLFVGSGKKDDATSEEVVSNVRHDFYQTPVNVIASFFLK 228

Query: 177 KVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           K+DK  + +  + K+L++DL   D   KR+ T  PLY  ID E S++ +L TK+E  L K
Sbjct: 229 KIDKGTAKIELQPKQLNLDLTTTDSPPKRYATEVPLYASIDPEKSSYRVLGTKLEFVLAK 288

Query: 235 ANGISWPSLKSDENL 249
           ++G SWP L+ DE L
Sbjct: 289 SDGTSWPVLRGDEAL 303



>gi|353238059|emb|CCA70016.1| related to diploid state maintenance protein chpA [Piriformospora
           indica DSM 11827]
          Length = 358

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 137/212 (64%), Gaps = 7/212 (3%)

Query: 51  PKLAPIEKEP---EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPV 107
           PK AP   +P   +EDD ++ V   T+C+R  C   +V D  SRG+GP++ CIYH   P+
Sbjct: 123 PKPAPSTPQPLVEDEDDTSVKVEPGTKCQRNGCKHLFVSDEESRGDGPQSTCIYHPRQPL 182

Query: 108 FHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGK-EVKNV-EKEIVQCRHDWYQT 165
           FHEGSKG+ CC R+VLEF+EFLKI+GCK GKHLFV     +   V ++E+VQCR D YQT
Sbjct: 183 FHEGSKGYLCCKRRVLEFDEFLKIEGCKTGKHLFVKKKPIDTDGVPQEELVQCRIDHYQT 242

Query: 166 PTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILT 225
           P  +  S++AKKVDK  S+V F  +++ +DL +PD KRF  T  LY  +  E  ++ +L 
Sbjct: 243 PGQVRASVYAKKVDKDKSTVIFETEQVHLDLILPDSKRFKRTLQLYGPVKPEECSYSVLG 302

Query: 226 TKVEIKLKKANGISWPSL-KSDENL-GIATTF 255
           TKV++ L K +  SW  L K+D +L G   TF
Sbjct: 303 TKVDLVLAKQDTRSWNLLEKTDADLQGFTLTF 334



>gi|408398874|gb|EKJ78000.1| hypothetical protein FPSE_01788 [Fusarium pseudograminearum CS3096]
          Length = 316

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 129/195 (66%), Gaps = 8/195 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD ++ +A    CKR +CG  Y   ++   E    EC++H G P+FHEGSKG+SCC
Sbjct: 113 ESEDDDPSLEIADGVGCKRRACGATYKKSSSRDNE----ECVHHPGVPIFHEGSKGYSCC 168

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIV-QCRHDWYQTPTHIIMSIFAK 176
            R+VLEF++F+KI+GCK K KHLFVGSGK+     +E+V   RHD+YQTP ++I S F K
Sbjct: 169 KRRVLEFDQFMKIEGCKTKDKHLFVGSGKKDDTTSEEVVSNVRHDFYQTPVNVIASFFLK 228

Query: 177 KVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           K+DK  + +  + K+L++DL   D   KR+    PLY  ID E S++ +L TK+E  L K
Sbjct: 229 KIDKGTAKIELQPKQLNLDLTTTDSPPKRYAAEVPLYASIDPEKSSYRVLGTKLEFVLAK 288

Query: 235 ANGISWPSLKSDENL 249
           ++G SWP L+ DE L
Sbjct: 289 SDGTSWPVLRGDEAL 303



>gi|238498286|ref|XP_002380378.1| CORD and CS domain protein [Aspergillus flavus NRRL3357]
 gi|220693652|gb|EED49997.1| CORD and CS domain protein [Aspergillus flavus NRRL3357]
          Length = 316

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/220 (42%), Positives = 143/220 (65%), Gaps = 11/220 (5%)

Query: 30  IYDSG-PKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDA 88
           + DSG P+ +Y+  I+          P  +E E DD ++ + ++  C+R  CG  Y + +
Sbjct: 91  VADSGVPRPTYSPAIAPPSN---AATPAPEESESDDPSLEIPANATCRRKGCGANY-NSS 146

Query: 89  TSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGK-HLFVGSGKE 147
            SR E    +C++H G P+FHEGSKGWSCC ++VL+F++FLKI+GCK+ + HLFVG GK 
Sbjct: 147 VSREE---EKCVHHPGQPIFHEGSKGWSCCKKRVLDFDDFLKIEGCKEKRGHLFVGKGKP 203

Query: 148 VKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITT 207
               E+++   R+D+YQTP  + +S++ KK+DK  + V F EK +D+DL   D KR+  T
Sbjct: 204 AG--EEKVESVRNDFYQTPHSVNVSLYLKKIDKNQAKVEFSEKSIDLDLPTTDNKRYKDT 261

Query: 208 YPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
           Y L+  I+ E S F++L TK+E+ L KA+G SWP L+SD+
Sbjct: 262 YQLFAPINPEKSQFKVLGTKLELTLSKADGTSWPVLRSDD 301



 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 41/70 (58%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK + D        PE  C+YH G PVFHEG KGW CC  +VL F+EFL+I 
Sbjct: 2   SKCVHKGCGKVFTD--------PEEPCVYHPGPPVFHEGQKGWKCCKPRVLTFDEFLEIP 53

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 54  PCTTGKHSTV 63



>gi|451999161|gb|EMD91624.1| hypothetical protein COCHEDRAFT_1136358 [Bipolaris maydis C5]
 gi|477591547|gb|ENI08619.1| hypothetical protein COCC4DRAFT_37323 [Bipolaris maydis ATCC 48331]
          Length = 316

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 135/216 (62%), Gaps = 13/216 (6%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P++   Q   K  T  P   P   E E+DD +I V     C+R  CG      A  +G 
Sbjct: 97  APRVPTAQAAPKP-TASPAPPP---ESEDDDPSIAVKEGMACRRKGCG------AVHKGG 146

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
             + E C++H G P+FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ K  
Sbjct: 147 DRQGESCVHHPGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKDRHLFVGSGKK-KEG 205

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLY 211
           E+++   RHD+YQT T ++ S++ KK+DK  +SV F+   + +DL   D KR+ T +PL+
Sbjct: 206 EEKLDTVRHDYYQTATLVVASLYLKKIDKATASVEFQPSSVKLDLPTSDSKRYQTEFPLF 265

Query: 212 QLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
             I  E S F IL TK+E+ L KA+G SWP L+SDE
Sbjct: 266 STIKPEESKFRILGTKLEMTLVKADGASWPVLRSDE 301



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D+          EC+YH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDE--------NEECVYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C KGKH
Sbjct: 56  CTKGKH 61



>gi|169781504|ref|XP_001825215.1| CORD and CS domain protein [Aspergillus oryzae RIB40]
 gi|83773957|dbj|BAE64082.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391865326|gb|EIT74610.1| Zn2+-binding protein Melusin/RAR1 [Aspergillus oryzae 3.042]
          Length = 316

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/220 (42%), Positives = 143/220 (65%), Gaps = 11/220 (5%)

Query: 30  IYDSG-PKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDA 88
           + DSG P+ +Y+  I+          P  +E E DD ++ + ++  C+R  CG  Y + +
Sbjct: 91  VADSGVPRPTYSPAIAPPSN---AATPAPEESESDDPSLEIPANATCRRKGCGANY-NSS 146

Query: 89  TSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGK-HLFVGSGKE 147
            SR E    +C++H G P+FHEGSKGWSCC ++VL+F++FLKI+GCK+ + HLFVG GK 
Sbjct: 147 VSREE---EKCVHHPGQPIFHEGSKGWSCCKKRVLDFDDFLKIEGCKEKRGHLFVGKGKP 203

Query: 148 VKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITT 207
               E+++   R+D+YQTP  + +S++ KK+DK  + V F EK +D+DL   D KR+  T
Sbjct: 204 AG--EEKVESVRNDFYQTPHSVNVSLYLKKIDKNQAKVEFSEKSIDLDLPTTDNKRYKDT 261

Query: 208 YPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
           Y L+  I+ E S F++L TK+E+ L KA+G SWP L+SD+
Sbjct: 262 YQLFAPINPEKSQFKVLGTKMELTLSKADGTSWPVLRSDD 301



 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 41/70 (58%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK + D        PE  C+YH G PVFHEG KGW CC  +VL F+EFL+I 
Sbjct: 2   SKCVHKGCGKVFTD--------PEEPCVYHPGPPVFHEGQKGWKCCKPRVLTFDEFLEIP 53

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 54  PCTTGKHSTV 63



>gi|396462286|ref|XP_003835754.1| similar to cysteine and histidine-rich domain-containing protein 1
           [Leptosphaeria maculans JN3]
 gi|312212306|emb|CBX92389.1| similar to cysteine and histidine-rich domain-containing protein 1
           [Leptosphaeria maculans JN3]
          Length = 341

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 133/202 (65%), Gaps = 11/202 (5%)

Query: 48  TEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTP 106
           TE P  +P   E E+DD +I +     C+R  CG      AT +G   E E C++H G P
Sbjct: 110 TEAPAPSP---ESEDDDPSIALKEGMTCRRRGCG------ATHKGGDREGESCVHHPGAP 160

Query: 107 VFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQT 165
           +FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ K  E+++   R+D+YQT
Sbjct: 161 IFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKERHLFVGSGKKNKEGEEKVDTVRNDFYQT 220

Query: 166 PTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILT 225
            T ++ S+F KK+DK  + + F+  ++ +DL+  D KR+ T  PL+  I  E S F IL 
Sbjct: 221 STSVVASLFLKKIDKDTAVIDFQPAQVKLDLRTTDSKRYQTEIPLFSTIKPEESKFRILG 280

Query: 226 TKVEIKLKKANGISWPSLKSDE 247
           TK+E+ L KA+G SWP L+SD+
Sbjct: 281 TKLEMTLVKADGASWPVLRSDD 302



 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D+        E  CIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDE--------EETCIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|38489215|gb|AAR21293.1| ChpA [Emericella nidulans]
 gi|38532003|gb|AAR23267.1| diploid state maintenance protein chpA [Emericella nidulans]
          Length = 315

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 126/195 (64%), Gaps = 7/195 (3%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +EPE DD  + +  +  C+R  CG  Y  D +      E  C+YH G PVFHEGSKG
Sbjct: 113 PVPEEPESDDPELAIPENATCRRRGCGGTYKPDVSRD----EERCVYHPGQPVFHEGSKG 168

Query: 115 WSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC R+VLEF+EFLKI+GC +K +HLFVG GK     E+++   R+D+YQT T + +S+
Sbjct: 169 WSCCKRRVLEFDEFLKIEGCAEKKRHLFVGKGKPAG--EEKVESVRNDFYQTATSVNVSL 226

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           + KK+DK N+ V F    + +DL   D KR+  +Y L+  ID E STF++L TK+E+ L 
Sbjct: 227 YLKKIDKDNAKVEFTSTGIALDLPTTDNKRYKDSYELFAPIDPEKSTFKVLGTKLELMLV 286

Query: 234 KANGISWPSLKSDEN 248
           K +G SWP L+ D+ 
Sbjct: 287 KGDGTSWPVLRKDDR 301



>gi|342876141|gb|EGU77799.1| hypothetical protein FOXB_11663 [Fusarium oxysporum Fo5176]
          Length = 621

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 127/195 (65%), Gaps = 8/195 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD ++ +A    CKR +CG  Y   ++   E    EC++H G P+FHEGSKG+SCC
Sbjct: 418 ESEDDDPSLEIADGVGCKRRACGATYKKGSSRDDE----ECVHHPGVPIFHEGSKGYSCC 473

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSG-KEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
            R+VLEF++F+KI+GCK K +HLFVGSG K+  N E+ +   RHD+YQTP ++I S F K
Sbjct: 474 KRRVLEFDQFMKIEGCKTKNRHLFVGSGKKDGANSEEVVSNVRHDFYQTPVNVIASFFLK 533

Query: 177 KVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           K+DK  + +    K+L +DL   D   KR+    PLY  ID + S++ +L TK+E  L K
Sbjct: 534 KIDKSTAKIELEPKQLSLDLTTTDSPPKRYTAEVPLYASIDPKKSSYRVLGTKLEFVLAK 593

Query: 235 ANGISWPSLKSDENL 249
           ++G SWP L+ DE L
Sbjct: 594 SDGTSWPVLRGDEAL 608



>gi|475664532|gb|EMT62327.1| Cysteine and histidine-rich domain-containing protein [Fusarium
           oxysporum f. sp. cubense race 4]
          Length = 336

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 128/195 (65%), Gaps = 8/195 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD ++ +A    CKR +CG  Y   ++   E    EC++H G P+FHEGSKG+SCC
Sbjct: 133 ESEDDDPSLEIADGVGCKRRACGATYKKGSSRDDE----ECVHHPGVPIFHEGSKGYSCC 188

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSG-KEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
            R+VLEF++F+KI+GCK K +HLFVGSG K+  N E+ +   RHD+YQTP ++I S F K
Sbjct: 189 KRRVLEFDQFMKIEGCKTKNRHLFVGSGKKDGANSEEVVSNVRHDFYQTPVNVIASFFLK 248

Query: 177 KVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           K+DK  + +    K+L++DL   D   KR+    PLY  ID + S++ +L TK+E  L K
Sbjct: 249 KIDKSTAKIELEPKQLNLDLTTTDSPPKRYTAEVPLYASIDPKKSSYRVLGTKLEFVLAK 308

Query: 235 ANGISWPSLKSDENL 249
           ++G SWP L+ DE L
Sbjct: 309 SDGTSWPVLRGDEAL 323



>gi|392596105|gb|EIW85428.1| chord-domain-containing protein [Coniophora puteana RWD-64-598 SS2]
          Length = 350

 Score =  182 bits (462), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 133/214 (62%), Gaps = 4/214 (1%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCS 119
           +EDD +IPV + T C+R  CG ++V D   R G+G +  C YH   P+FHEGSKG+ CC 
Sbjct: 128 DEDDTSIPVTAGTICRRTGCGAEFVSDEVHRVGDGEDTVCTYHPAPPIFHEGSKGYLCCK 187

Query: 120 RKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVD 179
            +VLEF++FLKI GCK G+H+F    +++    +E+  CR D YQTP  + +++FAK+ D
Sbjct: 188 PRVLEFDQFLKIPGCKTGRHVF-APKRKLNTPSEELTDCRVDHYQTPQEVHVTVFAKQAD 246

Query: 180 KQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGIS 239
           K+ S V   E ++  DL +P+ KRF  T  L+  +D E S+ +   TKVE+ LKK +  S
Sbjct: 247 KEKSLVKIEESQVHFDLVLPNSKRFKKTITLFGPVDPEVSSHKFYGTKVEVVLKKLDNRS 306

Query: 240 WPSL-KSDENLG-IATTFGVQGGAATVGGKQYTL 271
           W  L ++  +LG I+ TFGV G   T+G K   L
Sbjct: 307 WTVLERTTHDLGNISLTFGVGGRTGTIGAKNVVL 340



>gi|443920789|gb|ELU40630.1| CHORD domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 319

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 135/220 (61%), Gaps = 4/220 (1%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSK 113
           P E   +EDD ++ VA  T CKRP C K +V D  SR G+G +A+C YH+  P+FHEGSK
Sbjct: 94  PAEIIEDEDDPSVAVAPGTLCKRPGCRKPFVSDEESRQGDGEDAQCKYHANQPLFHEGSK 153

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           G+ CC + VL+F++FL I GCK GKH+F    +  K  E EIV+ R D YQTPT + +SI
Sbjct: 154 GYVCCKKHVLDFDDFLAIPGCKTGKHVFAPKARADKPTE-EIVKSRIDHYQTPTEVRVSI 212

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK+ D+  S+V     ++ +DL +P  KR   T  L+  ID   S+++   TK+++ L 
Sbjct: 213 YAKQADQSRSTVVLETDKIIIDLFLPAGKRDKRTIALFGTIDTTASSYKFYGTKLDVILA 272

Query: 234 KANGISWPSLKSDENL--GIATTFGVQGGAATVGGKQYTL 271
           K++  SW +L++D  +  G   TFGV G   TVG K   L
Sbjct: 273 KSDNRSWNALQADTAIPDGYQLTFGVTGRTGTVGAKAPVL 312



>gi|395333641|gb|EJF66018.1| chord-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 363

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 151/269 (56%), Gaps = 29/269 (10%)

Query: 27  GVEIYDSGPKISYTQTI-SKTITEEPKLAPIEK-EPEEDDLNIPVASDTECKRPSCGKKY 84
             E Y S P  S T T  SK+++E    A + K E EEDDL   V   T C+   C   Y
Sbjct: 92  AAETYSSVPAGSSTSTPGSKSVSE----AVVTKFEEEEDDLEASVPPGTTCRHKGCNVVY 147

Query: 85  VDDATSRGEGPEA-ECIYHSGTPVFHEGSK-------------------GWSCCSRKVLE 124
            +D   R EG  A EC YH   P+FHEGSK                   G+ CC R+VLE
Sbjct: 148 ENDDLHRKEGGAASECTYHPKPPIFHEGSKVRLQSRPDQSIAPVLTVAKGYLCCKRRVLE 207

Query: 125 FEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSS 184
           F+EFLKI+GC KG H+FV   ++    ++E  QCR D YQTP+ +  S+FAKK D + S+
Sbjct: 208 FDEFLKIEGCTKGSHVFVPK-RKANTQQEEFTQCRIDHYQTPSEVHASVFAKKADPEAST 266

Query: 185 VTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL- 243
           +  +E E+ +D+ +PD KRF  T  L+  +D + S+F+   TKVE+KLKK +  SW  L 
Sbjct: 267 IKIQETEVFLDIYLPDSKRFRKTLQLWGPVDVDASSFKFYGTKVELKLKKKDNRSWTLLE 326

Query: 244 KSDENLG-IATTFGVQGGAATVGGKQYTL 271
           K+D +LG I  TFGV G   T+G K+  L
Sbjct: 327 KTDRDLGNINFTFGVGGRTGTIGAKELVL 355



>gi|258568870|ref|XP_002585179.1| hypothetical protein UREG_05868 [Uncinocarpus reesii 1704]
 gi|237906625|gb|EEP81026.1| hypothetical protein UREG_05868 [Uncinocarpus reesii 1704]
          Length = 547

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/227 (40%), Positives = 137/227 (60%), Gaps = 10/227 (4%)

Query: 24  VENGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKK 83
           V   V I  + P    +   +  +   P  +P   E E DD ++ + ++TEC+R  C   
Sbjct: 315 VRKTVPISQTRPSHPPSTLGATGVQTPPSGSPAPPESESDDPSLEIPANTECRRRGCKAT 374

Query: 84  YVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFV 142
           Y   A+   E    EC++H G P+FHEGSKGWSCC R+VLEF+EF+KI GC  K +HLF+
Sbjct: 375 YNPGASRDAE----ECVHHPGQPIFHEGSKGWSCCKRRVLEFDEFMKIPGCATKARHLFI 430

Query: 143 GSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREK-ELDVDLKMPDE 201
           G GK+    E+++   R D+YQTP+ +++S + KK+DK  + V F     +  DL   D 
Sbjct: 431 GKGKK----EEKVDTVRTDFYQTPSTVMVSFYLKKIDKDTAKVDFSSPTTIKFDLPTTDN 486

Query: 202 KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDEN 248
           KRF+ TY L+  ID + ST++I+ TK+E+ L KA+G SWP L+S++ 
Sbjct: 487 KRFLDTYELFAPIDTQKSTYKIMGTKMELTLVKADGSSWPVLRSNDQ 533



>gi|358395849|gb|EHK45236.1| hypothetical protein TRIATDRAFT_299931 [Trichoderma atroviride IMI
           206040]
          Length = 318

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/187 (49%), Positives = 124/187 (66%), Gaps = 10/187 (5%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           +    EC+R  C  KY   +   GE    EC++H G P+FHEGSKG+SCC R+VLEF++F
Sbjct: 123 IPDGAECRRKGCTIKYKKGSAREGE----ECVHHPGVPIFHEGSKGYSCCKRRVLEFDQF 178

Query: 129 LKIKGCK-KGKHLFVGSGKE---VKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSS 184
           +K++GCK K KHLFVGSGK+       E+ +   RHD+YQT T +I S F KK+ K+ + 
Sbjct: 179 MKMEGCKTKDKHLFVGSGKKDTPESGSEEILTTVRHDFYQTSTQVIASYFLKKIKKETAK 238

Query: 185 VTFREKELDVDLKM--PDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPS 242
           V F+ KELD+DL    P  KR+  T PL+  ID E S+F+IL TK+E+ L KA+G SWP 
Sbjct: 239 VDFKGKELDLDLTTSDPTPKRYTATVPLFGEIDTEKSSFKILGTKLELILVKADGASWPV 298

Query: 243 LKSDENL 249
           L+SDE L
Sbjct: 299 LRSDEQL 305



 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 8/65 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C R  CGK+Y D        PE EC YH G PVFHEG KGW CC  +VL F+EF+ I  C
Sbjct: 5   CVRQGCGKEYTD--------PEEECHYHPGPPVFHEGQKGWKCCKPRVLTFDEFMDIPPC 56

Query: 135 KKGKH 139
             G H
Sbjct: 57  TTGTH 61



>gi|171687839|ref|XP_001908860.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943881|emb|CAP69533.1| unnamed protein product [Podospora anserina S mat+]
          Length = 319

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 129/201 (64%), Gaps = 14/201 (6%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD  I +     C+R  CG  Y   ++  GE     C++H G P+FHEGSKG+SCC
Sbjct: 110 ESEDDDATIEIPDGRVCRRKGCGVAYKKGSSREGE----SCVHHPGAPIFHEGSKGYSCC 165

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVK------NVEKEIVQCRHDWYQTPTHIIM 171
            R+VLEF++F+KI+GCK K +HLFVGSG++ K        E+ +   R D+YQTPT +I 
Sbjct: 166 KRRVLEFDQFMKIEGCKTKDRHLFVGSGEKDKAKTSSAGGEEVLETVRTDFYQTPTSVIA 225

Query: 172 SIFAKKVDKQNSSVTFREKELDVDL---KMPDEKRFITTYPLYQLIDKENSTFEILTTKV 228
           S F KK+DK+ S V F++K +D+DL     P  KR+    PL+  ID   STF+IL TK+
Sbjct: 226 SFFLKKIDKEASKVEFQDKTIDLDLLTTDAPVPKRYKAQVPLFGTIDAAKSTFKILGTKL 285

Query: 229 EIKLKKANGISWPSLKSDENL 249
           E+ L KA+G SWP L+SD+ L
Sbjct: 286 EVTLVKADGSSWPVLRSDDRL 306



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 39/65 (60%), Gaps = 8/65 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK+Y D        PE  C YH G PVFHEG KGW CC  +VL FEEF+ I+ C
Sbjct: 5   CVHQGCGKEYTD--------PEEVCRYHPGPPVFHEGQKGWKCCKPRVLTFEEFMAIEPC 56

Query: 135 KKGKH 139
            +GKH
Sbjct: 57  TEGKH 61



>gi|346320893|gb|EGX90493.1| CORD and CS domain protein [Cordyceps militaris CM01]
          Length = 320

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/187 (46%), Positives = 125/187 (66%), Gaps = 8/187 (4%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           +A    C+R +CG++Y  +A +   G    C++H G P+FHEGSKG+SCC R+VLEF++F
Sbjct: 123 IADGATCRRRTCGQQYKKNAAAARTG--ESCVHHPGVPIFHEGSKGYSCCKRRVLEFDQF 180

Query: 129 LKIKGCK-KGKHLFVGSGKEVKNV---EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSS 184
           +KI+GC  K +HLF+GSGK++K     E+++   RHD+YQTP  +I S F KK++K+ + 
Sbjct: 181 MKIEGCATKDRHLFIGSGKKIKGAASGEEKLETVRHDFYQTPASVIASFFLKKINKETAK 240

Query: 185 VTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPS 242
           V F++K L +DL   D   KR+    PLY  ID   ST +IL TK+E+ L KA+G SWP 
Sbjct: 241 VEFKDKALALDLVTTDTPPKRYTAEVPLYGAIDAAKSTHKILGTKLELNLVKADGASWPV 300

Query: 243 LKSDENL 249
           L+ DE L
Sbjct: 301 LRGDEAL 307



>gi|330916180|ref|XP_003297323.1| hypothetical protein PTT_07684 [Pyrenophora teres f. teres 0-1]
 gi|311330067|gb|EFQ94580.1| hypothetical protein PTT_07684 [Pyrenophora teres f. teres 0-1]
          Length = 316

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/216 (43%), Positives = 134/216 (62%), Gaps = 13/216 (6%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P++   Q   K  T  P   P   E E+DD ++ +     C+R  CG      A  +G 
Sbjct: 97  APRLPTAQATPKP-TASPAPPP---ESEDDDPSVALKEGMTCRRKGCG------AVHKGG 146

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
             E E C++H G P+FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ K  
Sbjct: 147 NREGESCVHHPGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKDRHLFVGSGKK-KEG 205

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLY 211
           E+++   RHD+YQT T ++ S++ KK+DK  + + F+   + +DL   D KR+ T +PL+
Sbjct: 206 EEKLDTVRHDFYQTATSVVASLYLKKIDKSTAVIDFQPTHVKLDLPTTDSKRYQTEFPLF 265

Query: 212 QLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
             I  E S F IL TK+E+ L KA+G SWP L+SD+
Sbjct: 266 ASIKPEESNFRILGTKLEMTLVKADGTSWPVLRSDD 301



 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D+          ECIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDE--------NEECIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|169623510|ref|XP_001805162.1| hypothetical protein SNOG_14997 [Phaeosphaeria nodorum SN15]
 gi|111056420|gb|EAT77540.1| hypothetical protein SNOG_14997 [Phaeosphaeria nodorum SN15]
          Length = 317

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 127/191 (66%), Gaps = 8/191 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSC 117
           E E+DD +I +     C+R  CG       T +G   + E C++H G P+FHEGSKGWSC
Sbjct: 118 ESEDDDPSIALKDGMTCRRKGCG------VTHKGGDRDGEKCVHHPGAPIFHEGSKGWSC 171

Query: 118 CSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           C R+VLEF++F+ I+GCK K +HLFVGSGK+ K  E+++   RHD+YQT   ++ S++ K
Sbjct: 172 CKRRVLEFDQFMNIEGCKTKDRHLFVGSGKKDKGGEEKLDTVRHDYYQTAVSVVASLYLK 231

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           K+DK  + + F+ K +++DL+  D KR+ T +PL+  I  E S F IL TK+E+ L KA+
Sbjct: 232 KIDKSTAVIDFQPKSVNLDLRTTDGKRYQTEFPLFASIKPEESKFRILGTKLEMTLVKAD 291

Query: 237 GISWPSLKSDE 247
           G SW  L+SD+
Sbjct: 292 GTSWAVLRSDD 302



 Score = 72.8 bits (177), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y        E  + EC+YH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCLHKGCGKTY--------ENEDEECVYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|189189136|ref|XP_001930907.1| CORD and CS domain containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187972513|gb|EDU40012.1| CORD and CS domain containing protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 316

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 95/216 (43%), Positives = 134/216 (62%), Gaps = 13/216 (6%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P++   Q   K       LAP   E E+DD ++ +     C+R  CG      A  +G 
Sbjct: 97  APRLPTAQAAPKPTAS---LAP-PPESEDDDPSVVLKEGMTCRRKGCG------AVHKGG 146

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
             E E C++H G P+FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ K  
Sbjct: 147 NREGESCVHHPGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKDRHLFVGSGKK-KEG 205

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLY 211
           E+++   RHD+YQT T ++ S++ KK+DK  + V F+   + +DL   D KR+ T +PL+
Sbjct: 206 EEKLDTVRHDFYQTATSVVASLYLKKIDKSTAVVDFQLNHVKLDLPTTDSKRYQTEFPLF 265

Query: 212 QLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
             I  E S F IL TK+E+ L KA+G SWP L+SD+
Sbjct: 266 ASIKPEESKFRILGTKLEMTLAKADGTSWPVLRSDD 301



 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D+          ECIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDE--------NEECIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|212542623|ref|XP_002151466.1| CORD and CS domain protein [Talaromyces marneffei ATCC 18224]
 gi|210066373|gb|EEA20466.1| CORD and CS domain protein [Talaromyces marneffei ATCC 18224]
          Length = 315

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 123/190 (64%), Gaps = 7/190 (3%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           EP+ DD ++ + S+  C+R  C   Y  DA+   E     C +H G P+FHEGSKGWSCC
Sbjct: 116 EPDSDDPSLSIPSNATCRRKGCNATYNPDASRDSE----TCEHHPGQPIFHEGSKGWSCC 171

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EF+KI GCK K +HLFVG GK     E+++   R D+YQT T I  S++ KK
Sbjct: 172 KRRVLEFDEFMKIPGCKEKKRHLFVGKGKPAG--EEKVEDVRTDFYQTATTINASLYLKK 229

Query: 178 VDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANG 237
           +DK+ + VTF E  ++ DL   D KRFI T+ L+  ID E S++ I  TK++ KL K +G
Sbjct: 230 IDKEKAKVTFTENTVEFDLPTTDNKRFIKTFNLFGPIDPEASSYSIFGTKMDFKLAKKDG 289

Query: 238 ISWPSLKSDE 247
            SWP L+SD+
Sbjct: 290 QSWPVLRSDD 299



 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 40/70 (57%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T+C    CGK + D         E +CIYH G PVFHEG KGW CC  +VL F+EFL I 
Sbjct: 3   TKCVHKGCGKVFTDL--------EEDCIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLTIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|322697940|gb|EFY89714.1| CORD and CS domain containing protein [Metarhizium acridum CQMa
           102]
          Length = 271

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 131/193 (67%), Gaps = 14/193 (7%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L IP  S   C+R +CG++Y   ++  GE     C+YH G P+FHEGSKG+SCC R+VLE
Sbjct: 71  LEIPDGS--TCRRRTCGQRYKKGSSREGEA----CVYHPGVPIFHEGSKGYSCCKRRVLE 124

Query: 125 FEEFLKIKGCK-KGKHLFVGSGK----EVKNVEKEIVQ-CRHDWYQTPTHIIMSIFAKKV 178
           F++F+KI+GCK K +HLF+GSGK    +  +  +E++   RHD+YQT T +I + F KK+
Sbjct: 125 FDQFMKIEGCKTKDRHLFIGSGKKEDEKTGSAGEEVLSTVRHDFYQTATTVIAAFFLKKI 184

Query: 179 DKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           +K+++ V F++++L +DL   D   KR+    PLY LID   S+++IL TK+E+ L KA+
Sbjct: 185 NKESAKVRFQDRQLALDLVTSDSPPKRYSADVPLYGLIDTTKSSYKILGTKLEVTLVKAD 244

Query: 237 GISWPSLKSDENL 249
           G SWP L+ DE L
Sbjct: 245 GASWPVLRGDEAL 257



>gi|400601428|gb|EJP69071.1| copper amine oxidase [Beauveria bassiana ARSEF 2860]
          Length = 983

 Score =  179 bits (454), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 89/183 (48%), Positives = 122/183 (66%), Gaps = 12/183 (6%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R +CGK Y   A   GE     C+YH G P+FHEGSKG+SCC R+VLEF++F+KI+GC
Sbjct: 792 CRRRTCGKTYTKGAAREGES----CVYHPGAPIFHEGSKGYSCCKRRVLEFDQFMKIEGC 847

Query: 135 -KKGKHLFVGSGKEVK-----NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
             K +HLF+GSGK+ K     + E+++   RHD+YQTP ++I S F KK++K+ + V FR
Sbjct: 848 ASKDRHLFIGSGKKNKGGSGSSGEEKLETVRHDFYQTPANVIASFFLKKINKEAAKVEFR 907

Query: 189 EKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSD 246
           +K + +DL   D   KR+    PLY  ID   ST +IL TK+E+ L KA+G SWP L+ D
Sbjct: 908 DKVVALDLVTTDAPPKRYTAEVPLYGAIDPVKSTHKILGTKLEVTLAKADGASWPVLRGD 967

Query: 247 ENL 249
           E L
Sbjct: 968 EAL 970



>gi|358372826|dbj|GAA89427.1| CORD and CS domain protein [Aspergillus kawachii IFO 4308]
          Length = 315

 Score =  179 bits (454), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 128/194 (65%), Gaps = 7/194 (3%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +EPE DD  + + ++  C+R  C   Y D   SR E    +C+YH G P+FHEGSKG
Sbjct: 113 PVPEEPESDDPELAIPANATCRRRGCNAGY-DANVSRDE---EKCVYHPGQPIFHEGSKG 168

Query: 115 WSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC ++VLEF+EFLKI+GC +K KHLFVG GK     E+++   R+D+YQT + + +S+
Sbjct: 169 WSCCKKRVLEFDEFLKIQGCSEKKKHLFVGKGKPAG--EEKVESVRNDFYQTASSVNVSL 226

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           + KK++K  + V F+   +++DL   D KR+  +Y L+  ID E S F +L TK+E+ L 
Sbjct: 227 YLKKINKDTAKVEFKATSIELDLPTTDNKRYTDSYELFAPIDPEQSKFRVLGTKLELTLV 286

Query: 234 KANGISWPSLKSDE 247
           KA+G SWP L+ D+
Sbjct: 287 KADGTSWPVLRRDD 300



>gi|346979500|gb|EGY22952.1| integrin beta-1-binding protein [Verticillium dahliae VdLs.17]
          Length = 324

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 138/201 (68%), Gaps = 15/201 (7%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+DD  + + +D  C+R +CG KY   A SR +G E+ C++H G P+FHEGSKG+SCC
Sbjct: 114 ESEDDDPTLAIPADAVCRRKACGAKY---AGSR-DGDES-CVHHPGVPIFHEGSKGYSCC 168

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVK--NVE---KEIVQ-CRHDWYQTPTHIIM 171
            R+VLEF++F+KI+GCK K +HLFVGSGK+ K  NVE   +E+++  R D+YQTP+ +I 
Sbjct: 169 KRRVLEFDQFMKIEGCKTKERHLFVGSGKKNKDGNVETGGEEVLETVRTDFYQTPSTVIA 228

Query: 172 SIFAKKVDKQNSSVTFREKELDVDL---KMPDEKRFITTYPLYQLIDKENSTFEILTTKV 228
           S F KK+ K ++ ++F E+ L +DL     P  KR+    PL+  ID   S+F++L TK+
Sbjct: 229 SFFLKKIRKDDAKISFAERTLTLDLPTSDAPTPKRYRAEVPLFAPIDTAKSSFKVLGTKL 288

Query: 229 EIKLKKANGISWPSLKSDENL 249
           E+   KA+G SWP L+SD+ L
Sbjct: 289 EVTFVKADGASWPVLRSDDRL 309



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D        PE  C+YH G PVFHEG KGW CC  + L FEEFL I  
Sbjct: 4   KCVHQGCGKLYTD--------PEEVCVYHPGPPVFHEGQKGWKCCKPRFLTFEEFLAIPP 55

Query: 134 CKKGKH 139
           C +GKH
Sbjct: 56  CTEGKH 61



>gi|407926307|gb|EKG19274.1| hypothetical protein MPH_03137 [Macrophomina phaseolina MS6]
          Length = 314

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 129/191 (67%), Gaps = 5/191 (2%)

Query: 58  KEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSC 117
           +E E+DD ++P+     CKR +C  KY  DA++ G   + +C++H G P+FHEGSKG+SC
Sbjct: 113 QEDEDDDPSLPIPDGAPCKRKACNAKY--DASA-GRQDDEQCVHHPGAPIFHEGSKGYSC 169

Query: 118 CSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           C R+VLEF+EF+KI+GC  K +HLFVG  K+ +  E  +   R D+YQT T +I S+F K
Sbjct: 170 CKRRVLEFDEFMKIEGCATKARHLFVGKKKD-EGAEDVVESVRSDFYQTSTTVIASLFLK 228

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           K+DK  S+V      + +DL+  D+KR+ T   L+  ID   S F+I+ TK+E++L+KA+
Sbjct: 229 KIDKATSTVELSASNIKLDLRTTDKKRYTTDMTLFAPIDPAASAFKIMGTKLELELRKAD 288

Query: 237 GISWPSLKSDE 247
           G SWP L++D+
Sbjct: 289 GSSWPVLRADD 299



>gi|326475808|gb|EGD99817.1| CORD and CS domain-containing protein [Trichophyton tonsurans CBS
           112818]
          Length = 322

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 126/191 (65%), Gaps = 8/191 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYSGSGSREGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRTDYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTFRE-KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           +DK+ + V F     +++DL   D KR+  T+ L+  ID E S+++I+ TK+E  L KAN
Sbjct: 237 IDKEAAKVDFASPTTIELDLPTADNKRYKETWTLFAPIDTEKSSYKIMGTKLEFSLAKAN 296

Query: 237 GISWPSLKSDE 247
           G SW +L+S +
Sbjct: 297 GESWQTLRSTD 307



>gi|326479168|gb|EGE03178.1| diploid state maintenance protein chpA [Trichophyton equinum CBS
           127.97]
          Length = 322

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 126/191 (65%), Gaps = 8/191 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYSGSGSREGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRTDYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTFRE-KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           +DK+ + V F     +++DL   D KR+  T+ L+  ID E S+++I+ TK+E  L KAN
Sbjct: 237 IDKEAAKVDFASPTTIELDLPTADNKRYKETWTLFAPIDTEKSSYKIMGTKLEFSLAKAN 296

Query: 237 GISWPSLKSDE 247
           G SW +L+S +
Sbjct: 297 GESWQTLRSTD 307



>gi|115491611|ref|XP_001210433.1| hypothetical protein ATEG_00347 [Aspergillus terreus NIH2624]
 gi|114197293|gb|EAU38993.1| hypothetical protein ATEG_00347 [Aspergillus terreus NIH2624]
          Length = 424

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/223 (41%), Positives = 135/223 (60%), Gaps = 13/223 (5%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +E E DD +  + ++  C+R  C   Y    +   E     C++H G P+FHEGSKG
Sbjct: 114 PVPEESESDDPSQEIPANATCRRKGCNASYNPSGSREDE----TCVHHPGQPIFHEGSKG 169

Query: 115 WSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC ++VLEF+EFLKI+GCK K KHLFVG GK     E+++   R+D+YQTP  + +S+
Sbjct: 170 WSCCKKRVLEFDEFLKIQGCKEKKKHLFVGKGKPPG--EEKVESVRNDFYQTPHSVNVSL 227

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           + KK+DK  + V F E  +D+DL   D KR+  TY L+  ID E S F +L TK+E+ L 
Sbjct: 228 YLKKIDKTKAGVKFAENSIDLDLPTTDNKRYTDTYELFAPIDPEKSQFRVLGTKLELTLV 287

Query: 234 KANGISWPSLKSDENLGIATTFGVQGGAATVGGKQYTLATDSP 276
           KA+G SWP L+ ++         +Q G A   G+ Y +++  P
Sbjct: 288 KADGTSWPVLRKEDKWSGER---IQVGKA---GRVYLISSTHP 324



 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           ++C    CGK++ D        P+  C+YH G PVFHEG KGW CC  +VL F+EFL I 
Sbjct: 3   SKCVHKGCGKEFSD--------PDEPCVYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSTV 64



>gi|350629616|gb|EHA17989.1| hypothetical protein ASPNIDRAFT_47594 [Aspergillus niger ATCC 1015]
          Length = 314

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 129/194 (66%), Gaps = 7/194 (3%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +EP+ DD  + + ++  C+R  C   Y D + SR E    +C+YH G P+FHEGSKG
Sbjct: 112 PVPEEPDSDDPELAIPANATCRRRGCNAGY-DASVSRDE---EKCVYHPGQPIFHEGSKG 167

Query: 115 WSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC ++VLEF+EFLKI+GC +K KHLFVG GK     E+++   R+D+YQT + + +S+
Sbjct: 168 WSCCKKRVLEFDEFLKIQGCSEKKKHLFVGKGKPPG--EEKVESVRNDFYQTASSVNVSL 225

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           + KK++K  + V F+   +++DL   D KR+  +Y L+  ID E S F +L TK+E+ L 
Sbjct: 226 YLKKINKDTAKVEFKATSIELDLPTTDNKRYTDSYELFAPIDPEQSKFRVLGTKLELTLV 285

Query: 234 KANGISWPSLKSDE 247
           KA+G SWP L+ D+
Sbjct: 286 KADGTSWPVLRRDD 299



>gi|302496214|ref|XP_003010110.1| hypothetical protein ARB_03677 [Arthroderma benhamiae CBS 112371]
 gi|291173648|gb|EFE29470.1| hypothetical protein ARB_03677 [Arthroderma benhamiae CBS 112371]
          Length = 322

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 126/191 (65%), Gaps = 8/191 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYGGSGSREGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRTDYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTFRE-KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           +DK+ + V F     +++DL   D KR+  T+ L+  ID E S+++I+ TK+E  L KAN
Sbjct: 237 IDKEAAKVDFASPTTIELDLPTADNKRYKETWTLFAPIDTEKSSYKIMGTKLEFSLAKAN 296

Query: 237 GISWPSLKSDE 247
           G SW +L+S +
Sbjct: 297 GESWQTLRSTD 307



>gi|302664631|ref|XP_003023943.1| hypothetical protein TRV_01884 [Trichophyton verrucosum HKI 0517]
 gi|291187966|gb|EFE43325.1| hypothetical protein TRV_01884 [Trichophyton verrucosum HKI 0517]
          Length = 322

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 125/189 (66%), Gaps = 8/189 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYSGSGSRDGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRTDYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTFRE-KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           +DK+ + V F     +++DL   D KR+  T+ L+  ID E S+++I+ TK+E  L KAN
Sbjct: 237 IDKEAAKVDFASPTTIELDLPTADNKRYKETWTLFAPIDTEKSSYKIMGTKLEFSLAKAN 296

Query: 237 GISWPSLKS 245
           G SW +L+S
Sbjct: 297 GESWQTLRS 305



>gi|302692292|ref|XP_003035825.1| hypothetical protein SCHCODRAFT_105310 [Schizophyllum commune H4-8]
 gi|300109521|gb|EFJ00923.1| hypothetical protein SCHCODRAFT_105310, partial [Schizophyllum
           commune H4-8]
          Length = 331

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 125/198 (63%), Gaps = 4/198 (2%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFHEGSKGWSCCS 119
           EEDDL+ PV S T C+   C   +V D  +R G+G    C YH G P+FHEGSKG+ CC 
Sbjct: 119 EEDDLSAPVPSGTVCRHKGCNTVFVSDEVNRQGDGEGTICTYHPGVPIFHEGSKGYLCCK 178

Query: 120 RKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVD 179
           R+VLEF+EFLKI+GCKKG+H+FV        VE E   CR D YQT   + +S+F KK D
Sbjct: 179 RRVLEFDEFLKIEGCKKGRHVFVPKKDPSAPVE-EQTDCRVDHYQTADKVYVSVFGKKAD 237

Query: 180 KQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGIS 239
           K  SSV F  +++ +DL +P+ KRF  T  L+  I  + ST +   TKVE+ L+KA+G S
Sbjct: 238 KDKSSVKFEPEKVHIDLILPNSKRFTRTLDLFGPIADDKSTIQFFGTKVELCLQKADGRS 297

Query: 240 WPSL-KSDENLG-IATTF 255
           W  L K+D +LG I  TF
Sbjct: 298 WTLLEKTDRDLGNIQYTF 315



>gi|327293954|ref|XP_003231673.1| CORD and CS domain-containing protein [Trichophyton rubrum CBS
           118892]
 gi|326466301|gb|EGD91754.1| CORD and CS domain-containing protein [Trichophyton rubrum CBS
           118892]
          Length = 322

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 126/191 (65%), Gaps = 8/191 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    ECI+HSG PVFHEGSKGWSCC
Sbjct: 123 ESESDDPSLEIQQGATCRRKGCGKTYGGSGSREGE----ECIHHSGYPVFHEGSKGWSCC 178

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GCK K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 179 KRRVLEFDEFLKMPGCKTKNRHLFIGKGK--KSAEEKVNDVRADYYQTSSTVIASVYLKK 236

Query: 178 VDKQNSSVTF-REKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           +DK+ + V F     +++DL   D KR+  T+ L+  ID E S+++I+ TK+E  L KAN
Sbjct: 237 IDKEAAKVDFVSPTTIELDLPTADNKRYKETWTLFAPIDTEKSSYKIMGTKLEFSLAKAN 296

Query: 237 GISWPSLKSDE 247
           G SW +L+S +
Sbjct: 297 GESWQTLRSTD 307



>gi|119184351|ref|XP_001243096.1| hypothetical protein CIMG_06992 [Coccidioides immitis RS]
 gi|392865982|gb|EAS31840.2| CORD and CS domain-containing protein [Coccidioides immitis RS]
          Length = 321

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 135/218 (61%), Gaps = 12/218 (5%)

Query: 48  TEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPV 107
           T  P   P   E E DD ++ +A+++ C+R  C +KY   A+      E EC+ H G P+
Sbjct: 112 TPTPSGTPAPPESESDDPSLEIAANSVCRRRGCNEKYSPGASRD----EEECVNHPGQPI 167

Query: 108 FHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTP 166
           FHEGSKGWSCC R+VLEF+EF+KI GC  K +HLF+G GK+    E+++   R D+YQTP
Sbjct: 168 FHEGSKGWSCCKRRVLEFDEFMKIPGCNTKKRHLFIGKGKK---GEEKVDTVRTDFYQTP 224

Query: 167 THIIMSIFAKKVDKQNSSVTFREKE-LDVDLKMPDEKRFITTYPLYQLIDKENSTFEILT 225
           + +I+S + KK+DK  + V F     ++ DL   D KRF  TY L+  ID E S ++I+ 
Sbjct: 225 STVIVSFYLKKIDKDTAKVNFSSPNTIEFDLPTTDNKRFRDTYELFAPIDTEKSQYKIMG 284

Query: 226 TKVEIKLKKANGISWPSLKSDENLGIATTFGVQGGAAT 263
           TK+E+ L KA+G SWP L+SD+     T   +Q G AT
Sbjct: 285 TKMELTLVKADGSSWPVLRSDDR---RTGEIIQTGRAT 319



>gi|145239673|ref|XP_001392483.1| CORD and CS domain protein [Aspergillus niger CBS 513.88]
 gi|134076994|emb|CAK45403.1| unnamed protein product [Aspergillus niger]
          Length = 314

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/194 (43%), Positives = 129/194 (66%), Gaps = 7/194 (3%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +EP+ DD  + + ++  C+R  C   Y D + SR E    +C+YH G P+FHEGSKG
Sbjct: 112 PVPEEPDSDDPELAIPANATCRRRGCNAGY-DASVSRDE---EKCVYHPGQPIFHEGSKG 167

Query: 115 WSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           WSCC ++VLEF+EFLKI+GC +K KHLFVG GK     E+++   R+D+YQT + + +S+
Sbjct: 168 WSCCKKRVLEFDEFLKIQGCSEKKKHLFVGKGKPPG--EEKVESVRNDFYQTASSVNVSL 225

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           + KK++K  + V F+   +++DL   D KR+  +Y L+  ID E S F ++ TK+E+ L 
Sbjct: 226 YLKKINKDTAKVEFKATSIELDLPTTDNKRYTDSYELFAPIDPEQSKFRVMGTKLELTLV 285

Query: 234 KANGISWPSLKSDE 247
           KA+G SWP L+ D+
Sbjct: 286 KADGTSWPVLRRDD 299



>gi|303320331|ref|XP_003070165.1| CHORD family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|240109851|gb|EER28020.1| CHORD family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|320041220|gb|EFW23153.1| CORD and CS domain-containing protein [Coccidioides posadasii str.
           Silveira]
          Length = 321

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 134/218 (61%), Gaps = 12/218 (5%)

Query: 48  TEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPV 107
           T  P   P   E E DD  + +A+++ C+R  C  KY   A+      E EC++H G P+
Sbjct: 112 TPTPSGTPAPPESESDDPLLEIAANSVCRRRGCNDKYSPGASRD----EEECVHHPGQPI 167

Query: 108 FHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTP 166
           FHEGSKGWSCC R+VLEF+EF+KI GC  K +HLF+G GK+    E+++   R D+YQTP
Sbjct: 168 FHEGSKGWSCCKRRVLEFDEFMKIPGCNTKKRHLFIGKGKK---GEEKVDTVRTDFYQTP 224

Query: 167 THIIMSIFAKKVDKQNSSVTFREKEL-DVDLKMPDEKRFITTYPLYQLIDKENSTFEILT 225
           + +I+S + KK+DK  + V F    + + DL   D KRF  TY L+  ID E S ++I+ 
Sbjct: 225 STVIVSFYLKKIDKDTAKVHFSSPNMIEFDLPTTDNKRFRDTYELFAPIDTEKSQYKIMG 284

Query: 226 TKVEIKLKKANGISWPSLKSDENLGIATTFGVQGGAAT 263
           TK+E+ L KA+G SWP L+SD+     T   +Q G AT
Sbjct: 285 TKMELTLVKADGSSWPVLRSDDR---RTGEIIQTGRAT 319



>gi|482805003|gb|EOA82102.1| hypothetical protein SETTUDRAFT_165581 [Setosphaeria turcica Et28A]
          Length = 317

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 94/215 (43%), Positives = 132/215 (61%), Gaps = 10/215 (4%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P++   Q  +      P   P   E E+DD +I +     C+R  CG  Y      +GE
Sbjct: 97  APRVPTAQAAAPKPAGSPAPPP---ESEDDDASIALKEGMTCRRKGCGALY-KGGDRQGE 152

Query: 94  GPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVE 152
                C+YH+G P+FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ +  E
Sbjct: 153 ----SCVYHAGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKDRHLFVGSGKKKEGEE 208

Query: 153 KEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQ 212
           K     RHD+YQT T ++ S++ KK+DK  ++V F+   + +DL   D KR+ T +PL+ 
Sbjct: 209 KLET-VRHDFYQTATSVVASLYLKKIDKATATVDFQSTCVKLDLPTSDSKRYQTEFPLFA 267

Query: 213 LIDKENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
            I  E S F IL TK+E+ L KA+G SWP L+SD+
Sbjct: 268 AIKPEESKFRILGTKLEMTLVKADGASWPVLRSDD 302



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y DD        + ECIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDD--------QEECIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C +G H
Sbjct: 56  CTQGTH 61



>gi|451848200|gb|EMD61506.1| hypothetical protein COCSADRAFT_148323 [Bipolaris sorokiniana
           ND90Pr]
          Length = 316

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 133/216 (61%), Gaps = 13/216 (6%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P++   Q   K  T  P   P   E E+DD +I V     C+R  CG      A  +G 
Sbjct: 97  APRVPTAQAAPKP-TASPAPPP---ESEDDDPSIAVKEGMTCRRKGCG------AVHKGG 146

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV 151
             + E C++H G P+FHEGSKGWSCC R+VLEF++F+ I+GCK K +HLFVGSGK+ +  
Sbjct: 147 DRQGESCVHHPGAPIFHEGSKGWSCCKRRVLEFDQFMNIEGCKTKDRHLFVGSGKKKEGE 206

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLY 211
           EK     RHD+YQT T ++ S++ KK+DK  +SV F+   + +DL   D KR+ T +PL+
Sbjct: 207 EKLET-VRHDYYQTATSVVASLYLKKIDKTTASVEFQPSSVKLDLPTSDSKRYQTEFPLF 265

Query: 212 QLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
             I  E S F IL TK+E+ L KA+G SWP L+SDE
Sbjct: 266 STIKPEESKFRILGTKLEMTLVKADGASWPVLRSDE 301



 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D+          ECIYH G PVFHEG KGW CC  +VL F+EFL I+ 
Sbjct: 4   KCVHKGCGKTYEDE--------NEECIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIEP 55

Query: 134 CKKGKH 139
           C KGKH
Sbjct: 56  CTKGKH 61



>gi|358056186|dbj|GAA97926.1| hypothetical protein E5Q_04606 [Mixia osmundae IAM 14324]
          Length = 390

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/230 (41%), Positives = 132/230 (57%), Gaps = 9/230 (3%)

Query: 44  SKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHS 103
           S    E P+      E E+D ++  V +   CKR  C     DD+  R      EC +H 
Sbjct: 159 SAAADESPRSPEPAAELEQDPIDASVQAGMRCKRKGCPIS-ADDSLDRNAD---ECRFHP 214

Query: 104 GTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWY 163
           G PVFHEGSKG+SCC ++VL+F +FL + GC   +HLFVG  K  K +E   ++ RHD+Y
Sbjct: 215 GDPVFHEGSKGYSCCKKRVLDFGDFLALPGCSTSRHLFVGRPKP-KTIEP--LRLRHDFY 271

Query: 164 QTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEI 223
           QTP  +I S+F KK  K++S V F + ++ VDL++PDE+ +  T+ LY  ID   ST+ +
Sbjct: 272 QTPKTVIASVFGKKASKEDSRVIFEQWQMHVDLRLPDEQHYQKTFSLYGPIDPIASTYVV 331

Query: 224 LTTKVEIKLKKANGISWPSLKSDEN--LGIATTFGVQGGAATVGGKQYTL 271
           L TK+EI L KA+  SWP L+  E        TFGV     +VG KQ  L
Sbjct: 332 LGTKIEINLVKADSRSWPELEEAEGSKTKAQITFGVANKGLSVGQKQMIL 381



>gi|116180402|ref|XP_001220050.1| hypothetical protein CHGG_00829 [Chaetomium globosum CBS 148.51]
 gi|88185126|gb|EAQ92594.1| hypothetical protein CHGG_00829 [Chaetomium globosum CBS 148.51]
          Length = 328

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 120/189 (63%), Gaps = 20/189 (10%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R  CG  Y   ++  GE     C++H G P+FHEGSKG+ CC R+VLEF++F+KI+GC
Sbjct: 133 CRRKGCGATYTKGSSREGEA----CVHHPGAPIFHEGSKGYVCCKRRVLEFDQFMKIEGC 188

Query: 135 K-KGKHLFVGSGKEVKNV----------EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNS 183
           K K +HLFVGSG   KN           E+ +   RHD+YQTPT +I S F KK+DK+ +
Sbjct: 189 KTKNRHLFVGSGS--KNATGKGPTGSGGEELLETVRHDFYQTPTAVIASFFLKKIDKEAA 246

Query: 184 SVTFREKELDVDL---KMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
            V F E+ L +DL     P  KR+ T  PLY  ID   STF+IL TK+E+ L KA+G SW
Sbjct: 247 KVEFEEQALVLDLPTTDAPVPKRYKTQVPLYGPIDPAKSTFKILGTKLEVSLAKADGSSW 306

Query: 241 PSLKSDENL 249
           P L+SD+ L
Sbjct: 307 PVLRSDDRL 315



>gi|296816483|ref|XP_002848578.1| diploid state maintenance protein chpA [Arthroderma otae CBS
           113480]
 gi|238839031|gb|EEQ28693.1| diploid state maintenance protein chpA [Arthroderma otae CBS
           113480]
          Length = 320

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 127/200 (63%), Gaps = 8/200 (4%)

Query: 48  TEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPV 107
           T  P+  P   E E DD ++ +     C+R  CGK Y       GE    EC++H G P+
Sbjct: 110 TPTPRGTPAPPESESDDPSLEIQQGATCRRKGCGKTYSGSGAREGE----ECVHHPGQPI 165

Query: 108 FHEGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTP 166
           FHEGSKGW+CC R+VLEF+EFL + GCK K +HLF+G+G  VK+ E+++   R D+YQT 
Sbjct: 166 FHEGSKGWTCCKRRVLEFDEFLNLPGCKTKDRHLFIGNG--VKSAEEKVKDVRTDFYQTS 223

Query: 167 THIIMSIFAKKVDKQNSSVTFREK-ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILT 225
           + +I S++ KK+ +++S V+F     +D+DL   D KR+  T+ L+  ID E S ++I++
Sbjct: 224 STVIASVYLKKIIREDSRVSFSSPTTIDLDLPTADHKRYEDTFTLFAPIDTEKSFYKIMS 283

Query: 226 TKVEIKLKKANGISWPSLKS 245
           TK+E  L KA   SWP+L+S
Sbjct: 284 TKLEFTLVKATEDSWPALRS 303



>gi|512207497|gb|EPE36315.1| HSP20-like chaperone [Glarea lozoyensis ATCC 20868]
          Length = 286

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/193 (47%), Positives = 127/193 (65%), Gaps = 12/193 (6%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R +CG+ Y    T   EG   +C+YH G P+FHEGSKG++CC R+VLEF+EF+KI+GC
Sbjct: 99  CRRKACGQSY----TGNREG--EKCVYHPGAPIFHEGSKGYTCCKRRVLEFDEFMKIEGC 152

Query: 135 K-KGKHLFVGSGKEVK---NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREK 190
           K K +HLFVGSG++ K     E+ +   RHD+YQTPT  I S F KK++K+ + V F + 
Sbjct: 153 KTKDRHLFVGSGEKSKAKTGGEEVLETVRHDFYQTPTSAIASFFLKKINKEKAVVEFSKT 212

Query: 191 ELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDEN 248
           EL++DL   D   KR+ T  PL+  ID E S+F+I+ TK+E+   KA+G SWP L+SDE 
Sbjct: 213 ELNLDLVTTDALPKRYKTVVPLFGSIDTEASSFKIMGTKLEVNFVKADGSSWPVLRSDEP 272

Query: 249 LGIATTFGVQGGA 261
           +      G  G A
Sbjct: 273 VREIIQMGKAGRA 285



>gi|320591275|gb|EFX03714.1| cord and cs domain containing protein [Grosmannia clavigera kw1407]
          Length = 341

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 93/204 (45%), Positives = 133/204 (65%), Gaps = 14/204 (6%)

Query: 53  LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEG 111
           +AP E E +E  L IPV     C+R  CG  Y     ++G   EAE C++H G P+FHEG
Sbjct: 132 VAPPESEDDEPSLEIPVGR--VCRRRGCGVAY-----AKGGSREAESCVHHPGAPIFHEG 184

Query: 112 SKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV---EKEIVQCRHDWYQTPT 167
           SKG++CC R+VLEF++F+KI+GC+ KG+HLFVGSG++ K     E+ +   R D+YQ+ T
Sbjct: 185 SKGYTCCKRRVLEFDQFMKIEGCQTKGRHLFVGSGRKDKGSGAGEELLETVRTDFYQSST 244

Query: 168 HIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILT 225
            + +S F KK+DK  + + F E+ +D+DL   D   KR+ T  PLY  ID   S+F++L 
Sbjct: 245 VLTVSFFLKKIDKDKAVIRFLEEAIDLDLPTTDSPVKRYKTVVPLYAAIDPARSSFKVLG 304

Query: 226 TKVEIKLKKANGISWPSLKSDENL 249
           TK+E+ L KA+  SWP L+SD+ L
Sbjct: 305 TKLEVVLAKADVSSWPVLRSDDRL 328



>gi|328860798|gb|EGG09903.1| hypothetical protein MELLADRAFT_34100 [Melampsora larici-populina
           98AG31]
          Length = 325

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/188 (45%), Positives = 125/188 (66%), Gaps = 2/188 (1%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATS-RGEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           DD  + V   ++CKR SCG+++   + S RGE    EC+YH GTP+FHEGSKG+SCC ++
Sbjct: 135 DDPELIVPEGSKCKRLSCGQEWKGGSGSKRGELNHDECLYHPGTPIFHEGSKGYSCCKKR 194

Query: 122 VLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           VL+F+EFLK+ GCKK  HLF+    +  + E E V CR D+YQTPT +I+S+F K V K+
Sbjct: 195 VLDFDEFLKLSGCKKSSHLFLIQESKPTDQE-ESVNCRFDYYQTPTSVIISVFGKGVIKE 253

Query: 182 NSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWP 241
            S V F  + + V+LK+P  KRF  ++ L+  I+   S+++ L+TK E+ L K +GISW 
Sbjct: 254 QSQVVFENQVMKVNLKLPGNKRFDKSFNLFGKINTTESSYKFLSTKCEVILVKLDGISWS 313

Query: 242 SLKSDENL 249
           +L+  E  
Sbjct: 314 NLEQGETF 321



>gi|170094796|ref|XP_001878619.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647073|gb|EDR11318.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 344

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 139/227 (61%), Gaps = 12/227 (5%)

Query: 36  KISYTQTISKTIT--EEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           K +Y  T+ ++ T    P  API +E  EDDL I V+  T C+R  C  K+++     G+
Sbjct: 94  KETYGTTLQRSTTPASAPVAAPIVEE--EDDLTIQVSVGTPCRRKGCETKFINRI---GD 148

Query: 94  GPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGK---EVKN 150
              A CIYH   P+F EGSKG+ CC R+VLEF+EFLKIKGCKKG+HLF    +     K 
Sbjct: 149 EEGAVCIYHPAPPIFREGSKGYLCCKRRVLEFDEFLKIKGCKKGRHLFSPPPELKVTFKK 208

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPL 210
             +E+V CR D YQT   + +SIFAK+VDK  S+V F E E+ +DL +P  KRF  T  L
Sbjct: 209 DTEELVTCRVDHYQTIEQVHVSIFAKQVDKDRSTVQFFESEVTLDLFLPGSKRFKHTLNL 268

Query: 211 YQLIDKENSTFEILTTKVEIKLKKANGISWPSL-KSDENLG-IATTF 255
           +  ID   S F +  TKVE+ L+K++  SW  L K++ +LG I+ TF
Sbjct: 269 FGPIDPTRSHFSVFGTKVELHLQKSDTRSWTILEKTNRDLGNISLTF 315



>gi|406862834|gb|EKD15883.1| CORD and CS domain containing protein [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 319

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 93/190 (48%), Positives = 125/190 (65%), Gaps = 15/190 (7%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSRKVL 123
           L IP      C+R +CG+ Y       GEG E E C++H G P+FHEGSKG++CC R+VL
Sbjct: 122 LEIPAGK--LCRRKACGQSY------NGEGREGEKCVFHPGVPIFHEGSKGYTCCKRRVL 173

Query: 124 EFEEFLKIKGCK-KGKHLFVGSGKEV-KNVEKEIV--QCRHDWYQTPTHIIMSIFAKKVD 179
           EF+EF++I+GC+ K +HLFVGSGK+   N E E V    RHD+YQTPT  I S F KK++
Sbjct: 174 EFDEFMRIEGCETKDRHLFVGSGKKKGGNSEGEEVLETVRHDFYQTPTTAIASFFLKKIN 233

Query: 180 KQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANG 237
           K+N+ + F   E+ +DL   D   KR+ +  PL+  ID   STF+IL TK+E+   KA+G
Sbjct: 234 KENAKIEFSSSEISLDLVTTDATPKRYKSVIPLFGTIDTAASTFKILGTKLEVTFVKADG 293

Query: 238 ISWPSLKSDE 247
            SWP L+SDE
Sbjct: 294 SSWPVLRSDE 303



>gi|322705627|gb|EFY97211.1| CORD and CS domain containing protein [Metarhizium anisopliae ARSEF
           23]
          Length = 445

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/194 (45%), Positives = 128/194 (65%), Gaps = 15/194 (7%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L IP  S   C+R +CG++Y   +   GE     C++H G P+FHEGSKG+SCC R+VLE
Sbjct: 123 LEIPDGS--TCRRRTCGQRYKKGSLREGEA----CVHHPGVPIFHEGSKGYSCCKRRVLE 176

Query: 125 FEEFLKIKGCK-KGKHLFVGSGKEVKNV------EKEIVQCRHDWYQTPTHIIMSIFAKK 177
           F++F+KI+GCK K +HLF+GSGK+ +        E+ +   RHD+YQT T +I + F KK
Sbjct: 177 FDQFMKIEGCKTKDRHLFIGSGKKEEEEKTGSAGEEVLSTVRHDFYQTATTVIAAFFLKK 236

Query: 178 VDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           ++K+++ V F EK+L +DL   D   KR+    PLY+ ID   S+++I+ TK+E+ L KA
Sbjct: 237 INKESAKVEFLEKQLVLDLVTSDSPPKRYSADVPLYEQIDTAKSSYKIMGTKLEVTLVKA 296

Query: 236 NGISWPSLKSDENL 249
           +G SWP L+ DE L
Sbjct: 297 DGASWPVLRGDEAL 310



>gi|429848165|gb|ELA23679.1| cord and cs domain protein [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 321

 Score =  172 bits (436), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 85/195 (43%), Positives = 127/195 (65%), Gaps = 13/195 (6%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSRK 121
           DD ++ +A    C+R +C   Y      +G   +AE C++H G P+FHEGSKG+SCC R+
Sbjct: 118 DDASLEIADGATCRRKACSATY-----RKGSSRDAESCVHHPGVPIFHEGSKGYSCCKRR 172

Query: 122 VLEFEEFLKIKGCK-KGKHLFVGSGKE----VKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           VLEF++F+KI+GCK K +HLF+GSGK+        E+++   R+D+YQTP+ +I S F K
Sbjct: 173 VLEFDQFMKIEGCKTKNRHLFIGSGKKKGAAADGGEEKLDTVRNDFYQTPSTVIASFFLK 232

Query: 177 KVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           K+ K ++ + F+ + + +DL   D   KR+    PL+  ID E STF++L TK+E+ L K
Sbjct: 233 KIVKDSAKIEFKSQSIALDLPTSDSPPKRYTAEVPLFAPIDAEKSTFKVLGTKLEVTLAK 292

Query: 235 ANGISWPSLKSDENL 249
           A G SWP L+SD+ L
Sbjct: 293 AGGESWPVLRSDDRL 307



>gi|239608220|gb|EEQ85207.1| CORD and CS domain-containing protein [Ajellomyces dermatitidis
           ER-3]
 gi|327349404|gb|EGE78261.1| diploid state maintenance protein chpA [Ajellomyces dermatitidis
           ATCC 18188]
          Length = 315

 Score =  172 bits (436), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 125/191 (65%), Gaps = 8/191 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ + +   C+R  C  KY    +   E    +C++H G P+FHEGSKGWSCC
Sbjct: 116 ESESDDPSLAIKAGATCRRRGCNAKYSPSVSRDDE----KCVHHPGQPIFHEGSKGWSCC 171

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EF+KI GCK K +HLF+G GK  K+ E+++   R D+YQT T I+ +++ KK
Sbjct: 172 KRRVLEFDEFMKIIGCKEKARHLFLGKGK--KSGEEKVDNIRTDFYQTATSIMATLYLKK 229

Query: 178 VDKQNSSVTFREK-ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           +DK ++ V F     +++DL   D KRF  T+ LY  ID E S+F+I+ TK+++ L KA+
Sbjct: 230 IDKASAKVNFSSPTTIELDLPTADNKRFKETFNLYAPIDVEKSSFQIMGTKMDLNLAKAD 289

Query: 237 GISWPSLKSDE 247
           G SWP L+ D+
Sbjct: 290 GTSWPVLRKDD 300



>gi|485917275|gb|EOD44308.1| putative cord and cs domain protein [Neofusicoccum parvum UCRNP2]
          Length = 310

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 128/190 (67%), Gaps = 7/190 (3%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E EEDD  +PV +   CKR +CG  Y   + SR +G EA C++H G P+FHEGSKG+SCC
Sbjct: 112 EDEEDDPAVPVPAGATCKRKACGATY---SGSR-DGDEA-CVHHPGFPIFHEGSKGYSCC 166

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EF++I+GC  K +HLFVG  K+ +  E  +   R D+YQT T +I S+F KK
Sbjct: 167 KRRVLEFDEFMRIEGCATKDRHLFVGRKKD-EAAEDVVESVRSDFYQTTTTVIASLFLKK 225

Query: 178 VDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANG 237
           +DK  S++      + +DL   D+KR+ T   L+  ID   S+F+++ TK+E++L+KA+G
Sbjct: 226 IDKATSTIELGATSIKLDLHTSDKKRYTTDMQLFAPIDPAASSFKVMGTKLELELQKADG 285

Query: 238 ISWPSLKSDE 247
            SWP L++D+
Sbjct: 286 SSWPVLRADD 295



>gi|315050021|ref|XP_003174385.1| diploid state maintenance protein chpA [Arthroderma gypseum CBS
           118893]
 gi|311342352|gb|EFR01555.1| diploid state maintenance protein chpA [Arthroderma gypseum CBS
           118893]
          Length = 323

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 123/191 (64%), Gaps = 8/191 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ +     C+R  CGK Y    +  GE    EC++H G PVFHEGSKGWSCC
Sbjct: 124 ESESDDPSLEIQQGATCRRKGCGKTYSGSGSREGE----ECVHHPGYPVFHEGSKGWSCC 179

Query: 119 SRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EFLK+ GC  K +HLF+G GK  K+ E+++   R D+YQT + +I S++ KK
Sbjct: 180 KRRVLEFDEFLKMPGCTTKNRHLFIGKGK--KSAEEKVNHVRTDYYQTSSTVIASVYLKK 237

Query: 178 VDKQNSSVTFR-EKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           +DK  + V F     +++DL   + KR+  T+ L+  ID E S+++I+ TK+E  L KA+
Sbjct: 238 IDKDTAKVEFSTPTTIELDLPTAENKRYTETWTLFAPIDTEKSSYKIMGTKLEFSLAKAD 297

Query: 237 GISWPSLKSDE 247
           G SW SL+S +
Sbjct: 298 GESWQSLRSTD 308



>gi|336267110|ref|XP_003348321.1| hypothetical protein SMAC_02818 [Sordaria macrospora k-hell]
 gi|380091974|emb|CCC10241.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 321

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 128/197 (64%), Gaps = 11/197 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E+D+  I +     C+R +CG  Y   A+  GE    +C++H G P+FHEGSKG+SCC
Sbjct: 114 ESEDDEEGIEIPEGRVCRRKTCGAAYQKGASREGE----KCVHHPGAPIFHEGSKGYSCC 169

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKE----VKNVEKEIVQCRHDWYQTPTHIIMSI 173
            R+VLEF++F+KI+GCK K +HLFVGSGK+        E+ +   R D+YQTPT +I S 
Sbjct: 170 KRRVLEFDQFMKIEGCKTKDRHLFVGSGKKEAAAASGGEEILETVRTDFYQTPTSVIASF 229

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIK 231
           F KK++K  ++V F+   +D+DL   D   KR+ T  PL+  I  + S+F+IL TK+E+ 
Sbjct: 230 FLKKINKDVATVEFKPNAIDLDLPTTDSPVKRYKTEVPLFGSIVPDKSSFKILGTKLEVT 289

Query: 232 LKKANGISWPSLKSDEN 248
           L KA+G SWP L+SD+ 
Sbjct: 290 LWKADGSSWPVLRSDDR 306



 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 38/65 (58%), Gaps = 8/65 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK Y D        PE  C YH G PVFHEG KGW CC  +VL FEEF+ I+ C
Sbjct: 7   CVHQGCGKVYTD--------PEEVCRYHPGPPVFHEGQKGWKCCKPRVLTFEEFMTIEPC 58

Query: 135 KKGKH 139
            +GKH
Sbjct: 59  TEGKH 63



>gi|440482082|gb|ELQ62604.1| CORD and CS domain-containing protein, partial [Magnaporthe oryzae
           P131]
          Length = 255

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 123/197 (62%), Gaps = 13/197 (6%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           E+DD  + +     C+R +CG  Y   A   GE    +C++H G P+FHEGSKG+SCC R
Sbjct: 47  EDDDPALEIPDGKTCRRKTCGATYKKGAAREGE----QCVHHPGVPIFHEGSKGYSCCKR 102

Query: 121 KVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV--------EKEIVQCRHDWYQTPTHIIM 171
           +VLEF++F+KI+GC  KG+HLF+GSG + K          E+ +   RHD+YQT T +I 
Sbjct: 103 RVLEFDQFMKIEGCATKGRHLFIGSGGKKKGAGANGAGDGEQLLESVRHDYYQTATTVIA 162

Query: 172 SIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIK 231
           S F KK+DK  + V F  + + +DL   D  R+ T  PL+  +D E S+++IL TK+E+ 
Sbjct: 163 SFFLKKIDKDRAKVIFNAQSITLDLPTADATRYRTEVPLFAAVDPEKSSYKILGTKLEVN 222

Query: 232 LKKANGISWPSLKSDEN 248
           L KA+  SWP L+SDE 
Sbjct: 223 LAKADVASWPVLRSDER 239



>gi|399166054|emb|CCE33095.1| related to zinc-binding protein [Claviceps purpurea 20.1]
          Length = 323

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 127/193 (65%), Gaps = 11/193 (5%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           +DD  + +     C+R +CG+KY   A+   E    +C++H G P+FHEGSKG+ CC R+
Sbjct: 120 DDDPALEIPQGATCRRRTCGQKYNKGASRDDE----KCVHHPGAPIFHEGSKGYLCCKRR 175

Query: 122 VLEFEEFLKIKGC-KKGKHLFVGSGKEVK---NVEKEIV-QCRHDWYQTPTHIIMSIFAK 176
           VLEF++FL I+GC  K +HLF+GS K+      V +EI+   RHD+YQT T++I S F K
Sbjct: 176 VLEFDQFLNIEGCTTKNRHLFIGSAKKKDKEGTVGEEILTTVRHDFYQTATNVIASFFLK 235

Query: 177 KVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           K+DK+ + V F++K++ +DL   D   KR+    PLY  ID   STF+IL TK+E+ + K
Sbjct: 236 KIDKETAKVEFQDKQIVLDLVTTDSPPKRYKADVPLYGAIDPAKSTFKILGTKLEVSMVK 295

Query: 235 ANGISWPSLKSDE 247
           A+G SWP L+SD+
Sbjct: 296 ADGASWPVLRSDD 308



>gi|380475580|emb|CCF45181.1| CORD and CS domain-containing protein [Colletotrichum higginsianum]
          Length = 323

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 126/195 (64%), Gaps = 13/195 (6%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ +   T C+R +C   Y    +  GE     C++H G P+FHEGSKG+SCC R+V
Sbjct: 120 DDASLEIPDGTTCRRKACSVTYRKGTSRDGE----SCVHHPGVPIFHEGSKGYSCCKRRV 175

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNV-----EKEIVQCRHDWYQTPTHIIMSIFAK 176
           LEF++F+KI+GCK K +HLF+GSGK+ KN      E+++   R D+YQTP+ +I S F K
Sbjct: 176 LEFDQFMKIEGCKTKDRHLFIGSGKK-KNAAAAGGEEKLDTVRTDFYQTPSTVIASFFLK 234

Query: 177 KVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           K+ K ++ + F+ + + +DL   D   KR+ T  PL+  ID   STF++L TK+E+ L K
Sbjct: 235 KIVKDSAKIEFKPQSIALDLPTSDSPPKRYTTEVPLFAPIDVGKSTFKVLGTKLEVNLAK 294

Query: 235 ANGISWPSLKSDENL 249
           A G SWP L+SD+ L
Sbjct: 295 AGGESWPVLRSDDRL 309



>gi|453088822|gb|EMF16862.1| chord-domain-containing protein [Mycosphaerella populorum SO2202]
          Length = 325

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 123/196 (62%), Gaps = 8/196 (4%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P   E E+DD +IP+     CKR SCG  Y D     GE    EC++H G  +FHEGSKG
Sbjct: 120 PAPPEDEDDDPSIPIPQGATCKRKSCGVVYQDGKDREGE----ECVHHPGQALFHEGSKG 175

Query: 115 WSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           W+CC R+VLEF++F+KI GC+ K +HLFVG  K   + E+ + + R+D+YQT T +I S+
Sbjct: 176 WTCCKRRVLEFDQFMKIAGCRTKSRHLFVGRAK-APDEEEALKEVRNDFYQTATSVIASL 234

Query: 174 FAKKVDKQNSSVTFREK--ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIK 231
           + KK+DK+ S V F E    +++DL   D K + T   LY  I    S F+++ TK+E+ 
Sbjct: 235 YLKKIDKERSKVIFDESGGTVELDLHTSDAKSYQTRMELYGPIKPGESKFKVMGTKLELT 294

Query: 232 LKKANGISWPSLKSDE 247
           L KA+G  WP L++D+
Sbjct: 295 LAKADGQGWPVLRADD 310



>gi|378729041|gb|EHY55500.1| hypothetical protein HMPREF1120_03634 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 331

 Score =  169 bits (428), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 130/222 (58%), Gaps = 25/222 (11%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E ++ D +  +     CKR  CGK   D    R E    EC+YH G P+FHEGSKGW+CC
Sbjct: 113 ESDDPDADASIPPGATCKRRGCGKSR-DPNIPRDE---EECVYHPGVPIFHEGSKGWTCC 168

Query: 119 SRKVLEFEEFLKIKGCKKGK-HLFVGSGKEVKNVEKE---------------IVQCRHDW 162
            R+VLEF+EFLKI+GCK+ K H ++G  ++ K                    +   R+D+
Sbjct: 169 KRRVLEFDEFLKIQGCKRRKRHCYIGKKRDDKKGAGANGVVNGNGGGEEEELLSTVRNDF 228

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMP--DEKRFITTYPLYQLIDKENST 220
           YQTPT +I S + KK+ K+ + V FR   L++DL +P  D KRF +T PL+  ID E ST
Sbjct: 229 YQTPTSVIASFYLKKIVKERAKVEFRGNGLEIDLDLPTSDHKRFKSTIPLFAPIDPEKST 288

Query: 221 FEILTTKVEIKLKKANGISWPSLKSDENLGIATTFGVQGGAA 262
           F I+ TK+E++L K +G SW +L+SDE    AT   +Q G A
Sbjct: 289 FRIMGTKLELELAKKDGTSWATLRSDEK---ATGERIQVGRA 327



 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+ EC+YH G P FHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHKGCGKTFTD--------PDEECVYHPGPPEFHEGQKGWKCCKPRVLTFDEFLAIPP 55

Query: 134 CKKGKHLFV 142
           C KGKH  V
Sbjct: 56  CTKGKHSTV 64



>gi|389633065|ref|XP_003714185.1| CORD and CS domain-containing protein [Magnaporthe oryzae 70-15]
 gi|351646518|gb|EHA54378.1| CORD and CS domain-containing protein [Magnaporthe oryzae 70-15]
 gi|440473693|gb|ELQ42475.1| CORD and CS domain-containing protein [Magnaporthe oryzae Y34]
          Length = 325

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 123/197 (62%), Gaps = 13/197 (6%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           E+DD  + +     C+R +CG  Y   A   GE    +C++H G P+FHEGSKG+SCC R
Sbjct: 117 EDDDPALEIPDGKTCRRKTCGATYKKGAAREGE----QCVHHPGVPIFHEGSKGYSCCKR 172

Query: 121 KVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNV--------EKEIVQCRHDWYQTPTHIIM 171
           +VLEF++F+KI+GC  KG+HLF+GSG + K          E+ +   RHD+YQT T +I 
Sbjct: 173 RVLEFDQFMKIEGCATKGRHLFIGSGGKKKGAGANGAGDGEQLLESVRHDYYQTATTVIA 232

Query: 172 SIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIK 231
           S F KK+DK  + V F  + + +DL   D  R+ T  PL+  +D E S+++IL TK+E+ 
Sbjct: 233 SFFLKKIDKDRAKVIFNAQSITLDLPTADATRYRTEVPLFAAVDPEKSSYKILGTKLEVN 292

Query: 232 LKKANGISWPSLKSDEN 248
           L KA+  SWP L+SDE 
Sbjct: 293 LAKADVASWPVLRSDER 309



>gi|261203499|ref|XP_002628963.1| CORD and CS domain-containing protein [Ajellomyces dermatitidis
           SLH14081]
 gi|239586748|gb|EEQ69391.1| CORD and CS domain-containing protein [Ajellomyces dermatitidis
           SLH14081]
          Length = 315

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 123/187 (65%), Gaps = 8/187 (4%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ + +   C+R  C  KY    +   E    +C++H G P+FHEGSKGWSCC R+V
Sbjct: 120 DDPSLAIKAGATCRRRGCNAKYSPSVSRDDE----KCVHHPGQPIFHEGSKGWSCCKRRV 175

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GCK + +HLF+G GK  K+ E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 176 LEFDEFMKIIGCKERARHLFLGKGK--KSGEEKVDNIRTDFYQTATSIMATLYLKKIDKA 233

Query: 182 NSSVTFREK-ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
           ++ V F     +++DL   D KRF  T+ LY  ID E S+F+I+ TK+++ L KA+G SW
Sbjct: 234 SAKVNFSSPTTIELDLPTADNKRFKETFNLYAPIDVEKSSFQIMGTKMDLNLAKADGTSW 293

Query: 241 PSLKSDE 247
           P L+ D+
Sbjct: 294 PVLRKDD 300



>gi|302925638|ref|XP_003054134.1| hypothetical protein NECHADRAFT_98694 [Nectria haematococca mpVI
           77-13-4]
 gi|256735075|gb|EEU48421.1| hypothetical protein NECHADRAFT_98694 [Nectria haematococca mpVI
           77-13-4]
          Length = 318

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 124/191 (64%), Gaps = 12/191 (6%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L IP  +   CKR +CG  Y   ++  GE    EC++H G P+FHEGSKG+SCC R+VLE
Sbjct: 121 LEIPDGA--ACKRKTCGAVYKKGSSRDGE----ECVHHPGVPIFHEGSKGYSCCKRRVLE 174

Query: 125 FEEFLKIKGCK-KGKHLFV---GSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           F++F+KI+GCK K KHLFV    +G      E+ +   RHD+YQTP ++I S F KK++K
Sbjct: 175 FDQFMKIEGCKTKTKHLFVGSGKNGNGNGGAEEVLTTVRHDFYQTPANVIASFFLKKINK 234

Query: 181 QNSSVTFREKELDVDLKM--PDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGI 238
           + + V  + K++++DL    P  KR+    PL+  ID E S+F+IL TK+E+ L K++G 
Sbjct: 235 ETAKVELQAKQVNLDLTTTDPTPKRYTAEVPLFATIDTEKSSFKILGTKLELVLAKSDGS 294

Query: 239 SWPSLKSDENL 249
           SWP L+ DE L
Sbjct: 295 SWPVLRGDEAL 305



>gi|452847327|gb|EME49259.1| hypothetical protein DOTSEDRAFT_68130 [Dothistroma septosporum
           NZE10]
          Length = 320

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 126/205 (61%), Gaps = 8/205 (3%)

Query: 46  TITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGT 105
           T    P  +P   E EEDD +I VA    CKR +CG  +     S     E EC++H G 
Sbjct: 106 TAAPRPSPSPALPEEEEDDPSIVVADGASCKRRACGASF----KSGQNRDEEECVHHPGQ 161

Query: 106 PVFHEGSKGWSCCSRKVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQ 164
            +FHEGSKGW+CC R+VLEF+EF+KI GC  K +HLFVG  K+    EK + + R+D+YQ
Sbjct: 162 ALFHEGSKGWTCCKRRVLEFDEFMKIPGCTTKSRHLFVGKTKDPDEEEK-LSEVRNDFYQ 220

Query: 165 TPTHIIMSIFAKKVDKQNSSVTFREK--ELDVDLKMPDEKRFITTYPLYQLIDKENSTFE 222
           T T +I S++ KKVD+  S V F     ++D+DL   D+KR+ T+  L+  I    S F+
Sbjct: 221 TATTVIASLYLKKVDQDRSKVDFSADGTKIDLDLHTSDKKRYQTSMTLFATIKPRESKFK 280

Query: 223 ILTTKVEIKLKKANGISWPSLKSDE 247
           I+ TK+E+ L KA+G  WP L++D+
Sbjct: 281 IMGTKLELTLVKASGSGWPVLRADD 305



>gi|242768532|ref|XP_002341589.1| CORD and CS domain protein [Talaromyces stipitatus ATCC 10500]
 gi|218724785|gb|EED24202.1| CORD and CS domain protein [Talaromyces stipitatus ATCC 10500]
          Length = 315

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 118/184 (64%), Gaps = 9/184 (4%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L+IP  ++  C+R  C   Y  D +   E     C +H G P+FHEGSKGWSCC R+VLE
Sbjct: 124 LSIP--ANATCRRRGCNATYNPDISRDNE----TCAHHPGQPIFHEGSKGWSCCKRRVLE 177

Query: 125 FEEFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNS 183
           F+EF+KI GC +K +HLFVG GK     E+++   R D+YQT T +  S++ KK+DK+ +
Sbjct: 178 FDEFMKIPGCTEKKRHLFVGKGKAAG--EEKVEDVRTDFYQTATTVNASLYLKKIDKEKA 235

Query: 184 SVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           +VTF    +D DL   D KRF  T+ L+  ID E S++ I  TK++IKL K +G SWP L
Sbjct: 236 NVTFTSNTVDFDLPTTDNKRFTKTFNLFGPIDPEASSYNIFGTKMDIKLVKKDGQSWPVL 295

Query: 244 KSDE 247
           +SD+
Sbjct: 296 RSDD 299



 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 40/67 (59%), Gaps = 8/67 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T+C    CGK + D        PE +CIYH G PVFHEG KGW CC  +VL F+EFL I 
Sbjct: 3   TKCVHKGCGKVFTD--------PEEDCIYHPGPPVFHEGQKGWKCCKPRVLTFDEFLNIP 54

Query: 133 GCKKGKH 139
            C  GKH
Sbjct: 55  PCTTGKH 61



>gi|471574562|gb|EMR72386.1| putative cord and cs domain-containing protein [Eutypa lata UCREL1]
          Length = 329

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 123/195 (63%), Gaps = 15/195 (7%)

Query: 65  LNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLE 124
           L IP  +   C+R +CG  Y     SR +  + +C+YH G P+FHEGSKG+SCC R+VLE
Sbjct: 127 LEIPDGA--TCRRKTCGASY-KKGQSRSD--DEQCVYHPGVPIFHEGSKGYSCCKRRVLE 181

Query: 125 FEEFLKIKGCKKG-KHLFVGSGKE-------VKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           F++F+KI+GCK   +HLF+GSGKE         + E+ +   R D+YQTP  +I S F K
Sbjct: 182 FDQFMKIEGCKTSPRHLFIGSGKEKSKSKAGASSGEELLETVRSDFYQTPAAVIASFFLK 241

Query: 177 KVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           K+D   ++V F  + L VDL   D   KR+  + PL+  ID E ST++IL TK+E+   K
Sbjct: 242 KIDSSKATVEFEPQTLVVDLPTTDAQPKRYKASVPLFSRIDTEKSTYKILGTKLEVSFYK 301

Query: 235 ANGISWPSLKSDENL 249
           A+G SWP L+SD+ +
Sbjct: 302 ADGGSWPVLRSDDRV 316



>gi|347837628|emb|CCD52200.1| similar to CORD and CS domain-containing protein [Botryotinia
           fuckeliana T4]
 gi|472244406|gb|EMR89023.1| putative cord and cs domain-containing protein [Botryotinia
           fuckeliana BcDW1]
          Length = 319

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 131/198 (66%), Gaps = 14/198 (7%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSC 117
           E E+DD ++ +     C+R +CG++Y       G+  E E C++H G P+FHEGSKG++C
Sbjct: 113 ESEDDDASLEIPVGKTCRRKACGQQY------EGKSREGEKCVFHPGVPIFHEGSKGYTC 166

Query: 118 CSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKE---IVQCRHDWYQTPTHIIMSI 173
           C R+VLEF+EF+KI+GCK KG HLF+GSG + K  E     +   RHD+YQT T +I S 
Sbjct: 167 CKRRVLEFDEFMKIEGCKTKGSHLFIGSGGKGKAKEGGEEILDTVRHDFYQTATSVIASF 226

Query: 174 FAKKVDKQNSSVTFR-EKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEI 230
           F KK+ K+++ V+F   +EL +DL   D   KR+ T  PL+  ID E S+F+I+ TK+E+
Sbjct: 227 FLKKIKKEDAVVSFSASQELTLDLPTTDAVPKRYKTVVPLFGAIDTEASSFKIMGTKLEV 286

Query: 231 KLKKANGISWPSLKSDEN 248
            L KA+G SWP L+SDE 
Sbjct: 287 TLVKADGASWPVLRSDEQ 304



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   SC K Y D        PE +C+YH G PVFHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHQSCTKVYTD--------PEEDCLYHPGPPVFHEGQKGWKCCKPRVLTFDEFLAIPP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|440633022|gb|ELR02941.1| hypothetical protein GMDG_01162 [Geomyces destructans 20631-21]
          Length = 317

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 127/193 (65%), Gaps = 12/193 (6%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           D+ ++ ++    C+R +CG  Y    +  GE    +C +H G P+FHEGSKG+SCC R+V
Sbjct: 114 DNQSLEISEGKTCRRKACGATYKKGQSREGE----KCTHHPGAPIFHEGSKGYSCCKRRV 169

Query: 123 LEFEEFLKIKGC-KKGKHLFVGSGK-----EVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           LEF+EF++I+GC KK +HLF+GSGK     E+   E+++   RHD+YQT   +I S+F K
Sbjct: 170 LEFDEFMRIEGCKKKDRHLFIGSGKKDKKDELSGGEEKVETVRHDYYQTGATVIASLFLK 229

Query: 177 KVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           K+ K+ S+V F  + ++++LK  D   KR+  T  L+  ID E S+F+I+ TK+E+ L K
Sbjct: 230 KIVKEESTVKFTPQAVELNLKTSDALPKRYAKTLELFGPIDPEASSFKIMGTKLELTLVK 289

Query: 235 ANGISWPSLKSDE 247
            +G +WP L++DE
Sbjct: 290 GDGQAWPVLRADE 302



>gi|367043696|ref|XP_003652228.1| hypothetical protein THITE_2113476 [Thielavia terrestris NRRL 8126]
 gi|346999490|gb|AEO65892.1| hypothetical protein THITE_2113476 [Thielavia terrestris NRRL 8126]
          Length = 320

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 122/196 (62%), Gaps = 16/196 (8%)

Query: 66  NIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEF 125
            + +   + C+R  CG  Y   ++  GE     C++H G P+FHEGSKG+SCC R+VLEF
Sbjct: 116 TVEIPDGSVCRRKGCGAVYKKGSSREGE----TCVHHPGVPIFHEGSKGYSCCKRRVLEF 171

Query: 126 EEFLKIKGCK-KGKHLFVGSGKEV--------KNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           ++F+KI+GCK K +HLFVGSGK+            E+ +   R D+YQT T +I S F K
Sbjct: 172 DQFMKIEGCKTKQRHLFVGSGKKAAGGKGSGTSGGEELLETVRSDFYQTLTTVIASFFLK 231

Query: 177 KVDKQNSSVTFREKELDVDL---KMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           K+DK+ + V F+E+ L +DL     P  KR+    PLY  ID   STF++L TK+E+ L 
Sbjct: 232 KIDKEAAKVEFQEQALVLDLPTTDTPVPKRYKAQVPLYGTIDPAKSTFKVLGTKLEVSLA 291

Query: 234 KANGISWPSLKSDENL 249
           KA+G SWP L+SD+ +
Sbjct: 292 KADGSSWPVLRSDDPI 307



 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D        P+  C YH G PVFHEG KGW CC  +VL FEEF+KI+ 
Sbjct: 4   KCVHQGCGKLYTD--------PDEVCRYHPGPPVFHEGQKGWKCCKPRVLTFEEFMKIEP 55

Query: 134 CKKGKH 139
           C +GKH
Sbjct: 56  CTEGKH 61



>gi|156053031|ref|XP_001592442.1| hypothetical protein SS1G_06683 [Sclerotinia sclerotiorum 1980]
 gi|154704461|gb|EDO04200.1| hypothetical protein SS1G_06683 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 318

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 133/202 (65%), Gaps = 14/202 (6%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSK 113
           P   E E+DD ++ +     C+R +CGK+Y       G+G E E C++H G P+FHEGSK
Sbjct: 108 PPPAESEDDDASLEIPVGKTCRRKACGKQY------EGKGREGEKCVFHPGVPIFHEGSK 161

Query: 114 GWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKE---IVQCRHDWYQTPTHI 169
           G++CC R+VLEF+EF+KI+GCK K  HLF+GSG + K+ E     +   R+D+YQT + +
Sbjct: 162 GYTCCKRRVLEFDEFMKIEGCKSKDAHLFIGSGGKGKSKEGGEEILETVRYDFYQTASSV 221

Query: 170 IMSIFAKKVDKQNSSVTFR-EKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTT 226
           I S F KK++K N+ V+F   +EL +DL   D   KR+ +  PL+  ID E S+F+I+ T
Sbjct: 222 IASFFLKKINKDNAVVSFSASQELTLDLPTTDAIPKRYKSIVPLFGAIDTEASSFKIMGT 281

Query: 227 KVEIKLKKANGISWPSLKSDEN 248
           K+EI L KA+G SWP L+SDE 
Sbjct: 282 KLEITLVKADGASWPVLRSDEQ 303



 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   SCGK Y D         E +C+YH G PVFHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHQSCGKVYTDS--------EEDCLYHPGPPVFHEGQKGWKCCKPRVLTFDEFLSIPP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|398411184|ref|XP_003856935.1| hypothetical protein MYCGRDRAFT_84253 [Zymoseptoria tritici IPO323]
 gi|339476820|gb|EGP91911.1| hypothetical protein MYCGRDRAFT_84253 [Zymoseptoria tritici IPO323]
          Length = 318

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 124/187 (66%), Gaps = 8/187 (4%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           +DD ++P+  +  CKR  CG +Y     S     E +C++H G  +FHEGSKGW+CC R+
Sbjct: 120 DDDPSLPIPDNASCKRKGCGVQY----RSGQNRDEEQCVHHPGQAIFHEGSKGWTCCKRR 175

Query: 122 VLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           VLEF+EF+KI+GCK K +HLFVG  K+  + E+ + + R+D+YQT T +I S++ KK+DK
Sbjct: 176 VLEFDEFMKIQGCKTKSRHLFVGKKKDA-DAEELVNEVRNDFYQTATTVIASLYLKKIDK 234

Query: 181 QNSSVTFRE--KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGI 238
             S V F E  K +++DL   D+KR+ TT  L+  ID + S F+I+ TK+E+ L KA+  
Sbjct: 235 DRSKVEFSEDGKAVELDLVTSDKKRYQTTMLLFGPIDLKESKFKIMGTKLELTLAKASTA 294

Query: 239 SWPSLKS 245
            WP L++
Sbjct: 295 GWPVLRA 301



 Score = 73.2 bits (178), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 39/69 (56%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        PE  C+YH G PVFHEG KGW CC  +VL F+EF+ I  
Sbjct: 4   KCVHKGCGKLFSD--------PEDPCVYHPGPPVFHEGQKGWKCCKPRVLTFDEFMTIPP 55

Query: 134 CKKGKHLFV 142
           C  GKH  V
Sbjct: 56  CTTGKHTTV 64



>gi|452987540|gb|EME87295.1| hypothetical protein MYCFIDRAFT_126098 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 330

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 126/201 (62%), Gaps = 9/201 (4%)

Query: 51  PKLA-PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFH 109
           P+ A P   E E+DD +IPV     CKR +CGK Y        E    EC++H G  +FH
Sbjct: 120 PRAATPAPPEDEDDDPSIPVPDGATCKRKTCGKSYKAGQNRDDE----ECVHHPGAALFH 175

Query: 110 EGSKGWSCCSRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTH 168
           EGSKGW+CC R+VLEF+EF+KI+GCK K +HLFVG  K+ +  E+E+   R+D+YQT T 
Sbjct: 176 EGSKGWTCCKRRVLEFDEFMKIQGCKTKSRHLFVGKKKD-QESEEELKDVRNDFYQTATT 234

Query: 169 IIMSIFAKKVDKQNSSVTFREK--ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTT 226
           +I S++ KK+DK  S V F +    +++DL   D+K + +   L+  I    S F+I+ T
Sbjct: 235 VIASLYLKKIDKDRSRVEFSDDGTRVNLDLHTSDKKHYASEMELFGPIKSGESKFKIMGT 294

Query: 227 KVEIKLKKANGISWPSLKSDE 247
           K+E+ L KA+G  W  L++D+
Sbjct: 295 KLELTLAKADGRGWAVLRADD 315



>gi|225560074|gb|EEH08356.1| CORD and CS domain-containing protein [Ajellomyces capsulatus
           G186AR]
          Length = 335

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 118/187 (63%), Gaps = 9/187 (4%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ + +   C+R  C  KY        E    +C +H G P+FHEGSKGWSCC R+V
Sbjct: 141 DDPSLAIEAGAACRRRGCNGKYSPSVPRDDE----KCEHHPGLPIFHEGSKGWSCCKRRV 196

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GCK + +HLF+G   + K  E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 197 LEFDEFMKIAGCKQRSRHLFIG---KAKKTEEKVDNIRTDFYQTATSIMATLYLKKIDKA 253

Query: 182 NSSVTFREK-ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
           N+ V F     +++DL   D KRF  T  LY  ID E S+F+I+ TK+++ L KA+G SW
Sbjct: 254 NAKVNFTSPTTIELDLPTSDNKRFKETLILYAPIDTEKSSFQIMGTKMDLNLAKADGTSW 313

Query: 241 PSLKSDE 247
           P L+ D+
Sbjct: 314 PVLRKDD 320



>gi|225679587|gb|EEH17871.1| CORD and CS domain-containing protein [Paracoccidioides
           brasiliensis Pb03]
          Length = 314

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 123/191 (64%), Gaps = 8/191 (4%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E E DD ++ + +   C+R  C   +   ++   E    +CI+H G P+FHEGSKGWSCC
Sbjct: 115 ESESDDPSVAINAGATCRRRGCNVSHSLSSSRDDE----KCIHHPGQPIFHEGSKGWSCC 170

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
            R+VLEF+EF+KI GC+ K +HLF+G GK+    E+++   R D+YQT T I+ +++ KK
Sbjct: 171 KRRVLEFDEFMKIAGCREKKRHLFIGKGKQAG--EEKVDNIRTDFYQTATTIMATLYLKK 228

Query: 178 VDKQNSSVTFREK-ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           +DK  + V F     +++DL   D KRF  ++ LY  ID E S+F+I+ TK+++ L KA+
Sbjct: 229 IDKATAKVKFSSPTTIELDLPTSDNKRFRESFNLYAPIDVEKSSFQIMGTKMDLNLVKAD 288

Query: 237 GISWPSLKSDE 247
           G SWP L+ D+
Sbjct: 289 GTSWPVLRKDD 299



 Score = 73.2 bits (178), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 43/84 (51%), Gaps = 13/84 (15%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+  C+YH G P FHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCVHKGCGKLFTD--------PDEPCVYHPGPPEFHEGQKGWKCCKPRVLTFEEFLSIPP 55

Query: 134 CKKGKHLFVG-----SGKEVKNVE 152
           C  GKH  V      S KE   +E
Sbjct: 56  CTTGKHSMVDTPALESAKEPPQIE 79



>gi|500259256|gb|EOO02086.1| putative cord and cs domain-containing protein [Togninia minima
           UCRPA7]
          Length = 323

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 123/186 (66%), Gaps = 16/186 (8%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           C+R +CG  Y      +G+  ++E C +H G P+FHEGSKG+SCC R+VLEF++F+KI+G
Sbjct: 128 CRRRACGATY-----KKGQSRDSESCTHHPGVPIFHEGSKGYSCCKRRVLEFDQFMKIEG 182

Query: 134 CK-KGKHLFVGSGKEVKN------VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVT 186
           CK K +HLFVGSGK+ K+       E+ +   R D+YQTP+ +I S F KK++K ++ V 
Sbjct: 183 CKTKDRHLFVGSGKKDKSGKEGGAAEELLETVRTDFYQTPSAVIASFFLKKINKDSAKVI 242

Query: 187 FREKELDVDLKM---PDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           F  + + +DL     P  KR+ T  PL+  I+ + STF+IL TK+E+ L KA+  SWP L
Sbjct: 243 FTSQSIQLDLPTTDSPTPKRYRTDVPLFAPINPDKSTFKILGTKLEVSLAKADVSSWPVL 302

Query: 244 KSDENL 249
           +SD+ L
Sbjct: 303 RSDDRL 308



 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D        P+  C YH G P+FHEG KGW CC  +VL FEEF+ I  
Sbjct: 4   KCVHQGCGKTYTD--------PDEVCTYHPGPPIFHEGQKGWKCCKPRVLTFEEFMSIPP 55

Query: 134 CKKGKH 139
           C +GKH
Sbjct: 56  CTEGKH 61



>gi|226291319|gb|EEH46747.1| integrin beta-1-binding protein [Paracoccidioides brasiliensis
           Pb18]
          Length = 314

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 80/187 (42%), Positives = 121/187 (64%), Gaps = 8/187 (4%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD +I + +   C+R  C   +   ++   E    +CI+H G P+FHEGSKGWSCC R+V
Sbjct: 119 DDPSIAINAGATCRRRGCNASHSLSSSRDDE----KCIHHPGQPIFHEGSKGWSCCKRRV 174

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GC+ K +HLF+G GK+    E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 175 LEFDEFMKIAGCREKKRHLFIGKGKQAG--EEKVDNIRTDFYQTATTIMATLYLKKIDKA 232

Query: 182 NSSVTFREK-ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
            + V F     +++DL   D KRF  ++ LY  ID E S+F+I+ TK+++ L KA+G SW
Sbjct: 233 TAKVKFSSPTTIELDLPTSDNKRFRESFNLYAPIDVEKSSFQIMGTKMDLNLVKADGTSW 292

Query: 241 PSLKSDE 247
           P L+ D+
Sbjct: 293 PVLRKDD 299



 Score = 73.2 bits (178), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 38/69 (55%), Gaps = 8/69 (11%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+  C+YH G P FHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCVHKGCGKLFTD--------PDEPCVYHPGPPEFHEGQKGWKCCKPRVLTFEEFLSIPP 55

Query: 134 CKKGKHLFV 142
           C  GKH  V
Sbjct: 56  CTTGKHSMV 64



>gi|330794004|ref|XP_003285071.1| hypothetical protein DICPUDRAFT_148893 [Dictyostelium purpureum]
 gi|325084994|gb|EGC38410.1| hypothetical protein DICPUDRAFT_148893 [Dictyostelium purpureum]
          Length = 321

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 117/197 (59%), Gaps = 13/197 (6%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEG 111
           KL    +E + +D  IP  +  +C R SC K +  D +SR E    EC YH G PVFHEG
Sbjct: 129 KLPEYVEENDPEDAVIPEGA--QCCRNSC-KAFYKDESSRTE----ECHYHPGEPVFHEG 181

Query: 112 SKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIM 171
           SKGWSCC  K   FEEFLKIKGCK GKH F+   K+   VE     CRHDWYQ    IIM
Sbjct: 182 SKGWSCCKPKAAIFEEFLKIKGCKTGKHKFIPPPKDESKVE-----CRHDWYQQFDAIIM 236

Query: 172 SIFAKKVDKQNSSVTFREKE-LDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEI 230
           +I+AK VDK NS + F + + + V+LK+P+EK F   Y L   ID   S F IL+TKVE 
Sbjct: 237 TIYAKNVDKVNSKIQFVDNQTISVELKLPNEKSFKKVYELAGTIDTAKSNFMILSTKVEF 296

Query: 231 KLKKANGISWPSLKSDE 247
           KL K    SW  L+  E
Sbjct: 297 KLIKDPQESWSRLEKSE 313



>gi|367020152|ref|XP_003659361.1| hypothetical protein MYCTH_2313667 [Myceliophthora thermophila ATCC
           42464]
 gi|347006628|gb|AEO54116.1| hypothetical protein MYCTH_2313667 [Myceliophthora thermophila ATCC
           42464]
          Length = 324

 Score =  163 bits (412), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 85/186 (45%), Positives = 121/186 (65%), Gaps = 16/186 (8%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R +CG  Y   ++  GE    +C++H G P+FHEGSKG+SCC R+VLEF++F+KI+GC
Sbjct: 129 CRRRACGAIYKKGSSREGE----KCVHHPGVPIFHEGSKGYSCCKRRVLEFDQFMKIEGC 184

Query: 135 K-KGKHLFVGSGKEVKNV--------EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSV 185
           K K +HLFVGSGK+            E+ +   R+D+YQT T +I S F KK+DK  + V
Sbjct: 185 KTKDRHLFVGSGKKDAAAKAPAGPDGEELLETVRNDFYQTATSVIASFFLKKIDKDAAKV 244

Query: 186 TFREKELDVDLKMPDE---KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPS 242
            F+E++L +DL   D    KR+    PLY  +D   STF++L TK+E+ L KA+G SWP 
Sbjct: 245 EFQERKLVLDLPTTDSPVPKRYKAEVPLYSSVDPSKSTFKVLGTKLEVSLAKADGASWPV 304

Query: 243 LKSDEN 248
           L+SD+ 
Sbjct: 305 LRSDDR 310



 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 39/65 (60%), Gaps = 8/65 (12%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK+Y D        P+  C YH G PVFHEG KGW CC  +VL FEEF+ I+ C
Sbjct: 8   CVHSGCGKEYTD--------PDEVCRYHPGPPVFHEGQKGWKCCKPRVLTFEEFMAIEPC 59

Query: 135 KKGKH 139
            +GKH
Sbjct: 60  TEGKH 64



>gi|240278824|gb|EER42330.1| CORD and CS protein [Ajellomyces capsulatus H143]
 gi|325090078|gb|EGC43388.1| CORD and CS domain-containing protein [Ajellomyces capsulatus H88]
          Length = 314

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 118/187 (63%), Gaps = 9/187 (4%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ + +   C+R  C  KY        E    +C +H G P+FHEGSKGWSCC R+V
Sbjct: 120 DDPSLAIEAGAACRRRGCNGKYSPCVPRDDE----KCEHHPGLPIFHEGSKGWSCCKRRV 175

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GCK + +HLF+G   + K  E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 176 LEFDEFMKIAGCKQRSRHLFIG---KAKKTEEKVDNIRTDFYQTATSIMATLYLKKIDKA 232

Query: 182 NSSVTFREK-ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
           N+ V F     +++DL   D KRF  T  LY  ID E S+F+I+ TK+++ L KA+G SW
Sbjct: 233 NAKVNFTSPTTIELDLPTSDNKRFKETLILYAPIDTEKSSFQIMGTKMDLNLAKADGTSW 292

Query: 241 PSLKSDE 247
           P L+ D+
Sbjct: 293 PVLRKDD 299



 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 51/102 (50%), Gaps = 15/102 (14%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C   SCGK + D        P+  C+YH G P FHEG KGW CC  +VL F+EFL I  
Sbjct: 4   KCVHKSCGKVFTD--------PDEVCVYHPGPPEFHEGHKGWKCCKPRVLSFDEFLAIPP 55

Query: 134 CKKGKHLFV--GSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
           C  GKH  V      E KN   EI         TP HI ++I
Sbjct: 56  CTTGKHSAVDNAPAPESKNDAPEIAP-----DTTPKHIPIAI 92



>gi|295667758|ref|XP_002794428.1| diploid state maintenance protein chpA [Paracoccidioides sp.
           'lutzii' Pb01]
 gi|226285844|gb|EEH41410.1| diploid state maintenance protein chpA [Paracoccidioides sp.
           'lutzii' Pb01]
          Length = 317

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 121/187 (64%), Gaps = 8/187 (4%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ + +   C+R  C   +   ++   E    +CI+H G P+FHEGSKGWSCC R+V
Sbjct: 122 DDPSVAINAGATCRRRGCNASHSLSSSRDDE----KCIHHPGQPIFHEGSKGWSCCKRRV 177

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
           LEF+EF+KI GC+ K +HLF+G GK+    E+++   R D+YQT T I+ +++ KK+DK 
Sbjct: 178 LEFDEFMKIAGCREKKRHLFIGKGKQAG--EEKVDNIRTDFYQTATTIMATLYLKKIDKA 235

Query: 182 NSSVTFREK-ELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
            + V F     +++DL   D KRF  ++ LY  +D E S+F+I+ TK+++ L KA+G SW
Sbjct: 236 AAKVNFSSPTTIELDLPTSDNKRFKESFNLYAPVDVEKSSFQIMGTKMDLNLVKADGTSW 295

Query: 241 PSLKSDE 247
           P L+ D+
Sbjct: 296 PVLRKDD 302



 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 44/86 (51%), Gaps = 15/86 (17%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK + D        P+  C+YH G P FHEG KGW CC  +VL FEEFL I  
Sbjct: 4   KCVHKGCGKLFTD--------PDEPCVYHPGPPEFHEGQKGWKCCKPRVLTFEEFLSIPP 55

Query: 134 CKKGKHLFVG-------SGKEVKNVE 152
           C  GKH  V        S +EV  +E
Sbjct: 56  CTTGKHSMVDTPAPESESAREVPRIE 81



>gi|164427312|ref|XP_964180.2| hypothetical protein NCU03087 [Neurospora crassa OR74A]
 gi|157071690|gb|EAA34944.2| hypothetical protein NCU03087 [Neurospora crassa OR74A]
 gi|350296586|gb|EGZ77563.1| CS-domain-containing protein [Neurospora tetrasperma FGSC 2509]
          Length = 299

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 125/197 (63%), Gaps = 11/197 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E ++D+  I +     C+R +CG  Y   A+  GE    +C++H G P+FHEGSKG+SCC
Sbjct: 93  ESDDDEEGIEIPDGRVCRRKACGATYQKGASREGE----KCVHHPGAPIFHEGSKGYSCC 148

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKE----VKNVEKEIVQCRHDWYQTPTHIIMSI 173
            R+VLEF++F+KI+GCK K +HLFVGSGK+        E+ +   R D+YQTP+ +I S 
Sbjct: 149 KRRVLEFDQFMKIEGCKTKDRHLFVGSGKKEAAAASGGEEILETVRTDFYQTPSSVIASF 208

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIK 231
           F KK++K  + V F+   + +DL   D   KR+ T   L+  I  E S+++IL TK+E+ 
Sbjct: 209 FLKKINKDAAKVEFKPNSIVLDLPTTDSPVKRYKTEVSLFGPIVPEKSSYKILGTKLEVT 268

Query: 232 LKKANGISWPSLKSDEN 248
           L KA+G SWP L+SD+ 
Sbjct: 269 LWKADGSSWPVLRSDDR 285



>gi|336464494|gb|EGO52734.1| hypothetical protein NEUTE1DRAFT_126191 [Neurospora tetrasperma
           FGSC 2508]
          Length = 299

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 124/197 (62%), Gaps = 11/197 (5%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC 118
           E ++D+  I +     C+R +CG  Y   A   GE    +C++H G P+FHEGSKG+SCC
Sbjct: 93  ESDDDEEGIEIPDGRVCRRKACGATYQKGANREGE----KCVHHPGAPIFHEGSKGYSCC 148

Query: 119 SRKVLEFEEFLKIKGCK-KGKHLFVGSGKE----VKNVEKEIVQCRHDWYQTPTHIIMSI 173
            R+VLEF++F+KI+GCK K +HLFVGSGK+        E+ +   R D+YQTP+ +I S 
Sbjct: 149 KRRVLEFDQFMKIEGCKTKDRHLFVGSGKKEAAAASGGEEILEMVRTDFYQTPSSVIASF 208

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIK 231
           F KK++K  + V F+   + +DL   D   KR+ T   L+  I  E S+++IL TK+E+ 
Sbjct: 209 FLKKINKDAAKVEFKPNSIVLDLPTTDSPVKRYKTEVSLFGPIVPEKSSYKILGTKLEVT 268

Query: 232 LKKANGISWPSLKSDEN 248
           L KA+G SWP L+SD+ 
Sbjct: 269 LWKADGSSWPVLRSDDR 285



>gi|477537008|gb|ENH88468.1| cord and cs domain protein [Colletotrichum orbiculare MAFF 240422]
          Length = 320

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 125/194 (64%), Gaps = 11/194 (5%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ +     C+R +C   Y   A   GE     C++H G P+FHEGSKG+SCC R+V
Sbjct: 117 DDASLEIPDGATCRRKTCSATYRKGAARDGES----CVHHPGVPIFHEGSKGYSCCKRRV 172

Query: 123 LEFEEFLKIKGCK-KGKHLFVGSGKEVKNV----EKEIVQCRHDWYQTPTHIIMSIFAKK 177
           LEF++F+KI+GC+ K +HLF+GSGK+  +     E+++   R+D+YQTP+ +I S F KK
Sbjct: 173 LEFDQFMKIEGCQTKTRHLFIGSGKKKGSSGNGQEEKVESVRNDFYQTPSTVIASFFLKK 232

Query: 178 VDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           + K ++ + F+ + + VDL   D   KR+    PL+  ID E S++++L TK+E+ L KA
Sbjct: 233 IVKDSAKIEFKAQSIAVDLPTSDSPPKRYTAEVPLFAPIDAEKSSYKVLGTKLEVTLAKA 292

Query: 236 NGISWPSLKSDENL 249
            G SWP L+SD+ L
Sbjct: 293 GGESWPVLRSDDRL 306



 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 74  ECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           +C    CGK Y D        PE  C+YH G P+FHEG KGW CC  +VL FEEF+ I  
Sbjct: 4   KCVHQGCGKTYSD--------PEEPCVYHPGPPIFHEGQKGWKCCKPRVLTFEEFMTIPP 55

Query: 134 CKKGKH 139
           C  GKH
Sbjct: 56  CTTGKH 61



>gi|512186481|gb|EPE02273.1| cord and cs domain protein [Ophiostoma piceae UAMH 11346]
          Length = 347

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 113/198 (57%), Gaps = 10/198 (5%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           EEDD  + +     C+R  C   Y   A      P+  C +H G P+FHEGSKG+SCC R
Sbjct: 134 EEDDPTLEIPDGRTCQRRGCNATYTKGADRSATAPDENCEHHPGAPIFHEGSKGYSCCKR 193

Query: 121 KVLEFEEFLKIKGC-KKGKHLFVGSGKEVKNVEK---------EIVQCRHDWYQTPTHII 170
           +VLEF++F+KI+GC KK +HLFVG  K   N +          E+   R D+YQ+ T + 
Sbjct: 194 RVLEFDQFMKIEGCHKKPRHLFVGRKKAPANAQNTEGGEAGEEEVKDVRFDFYQSATSLT 253

Query: 171 MSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEI 230
           +S F KK+DK+ + V F E+ + +DL   D KR+     LY  ID   S + I+ TK+E+
Sbjct: 254 VSFFLKKIDKERAVVMFEEQSVSLDLPTTDAKRYRKVVSLYGPIDTAKSRYSIMGTKLEV 313

Query: 231 KLKKANGISWPSLKSDEN 248
            L KA   SWP L+SD+ 
Sbjct: 314 VLAKAAVSSWPVLRSDDR 331



>gi|340914653|gb|EGS17994.1| hypothetical protein CTHT_0060070 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 339

 Score =  159 bits (402), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 119/183 (65%), Gaps = 13/183 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R  CG  Y   ++   E    +C++H G P+FHEGSKG++CC R+VLEF++F+KI+GC
Sbjct: 147 CRRRGCGAVYKKGSSREDE----KCVHHPGAPIFHEGSKGYTCCKRRVLEFDQFMKIEGC 202

Query: 135 K-KGKHLFVGSGKEVKNV------EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTF 187
           K K +HLFVGSG + KN       E+ +   R D+YQT T +I S F KK+DK  + V F
Sbjct: 203 KTKNRHLFVGSGNKDKNKNTNADGEEVLDTVRTDFYQTQTSVIASFFLKKIDKDKAKVEF 262

Query: 188 REKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKS 245
           +++ +D+DL+  D   KR+     L+  ID   STF++L TK+E+ L KA+G SWP L++
Sbjct: 263 QDRAVDLDLRTTDTPVKRYKKLVQLWGAIDPAKSTFKVLGTKLEVSLAKADGASWPVLRA 322

Query: 246 DEN 248
           ++ 
Sbjct: 323 EDR 325



>gi|449304691|gb|EMD00698.1| hypothetical protein BAUCODRAFT_61337 [Baudoinia compniacensis UAMH
           10762]
          Length = 332

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 120/183 (65%), Gaps = 7/183 (3%)

Query: 67  IPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFE 126
           +PV     CKR +CG  Y    +  GE    +C++H G  +FHEGSKGW+CC R+VLEF+
Sbjct: 140 LPVPEGAACKRKACGASYKAGQSREGE----DCVHHPGRALFHEGSKGWTCCKRRVLEFD 195

Query: 127 EFLKIKGC-KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSV 185
           EF+KI GC  K +HLFVG+ K+  N E+ + + R+D+YQT + +I S++ KK++K  S V
Sbjct: 196 EFMKIPGCTTKKRHLFVGAKKD-PNAEELVNEVRNDFYQTASTVIASLYLKKIEKDRSRV 254

Query: 186 TFR-EKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLK 244
            F  ++ +++DL   D K++ T    +  I  + S+F+I+ TK+E+ L KA+G+ WP L+
Sbjct: 255 VFADDRTVELDLHTSDHKQYKTNLSTFGTIVPDKSSFKIMGTKLELTLAKADGVGWPVLR 314

Query: 245 SDE 247
           +D+
Sbjct: 315 ADD 317



>gi|310790918|gb|EFQ26451.1| CORD and CS domain-containing protein [Glomerella graminicola
           M1.001]
          Length = 322

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/193 (40%), Positives = 120/193 (62%), Gaps = 10/193 (5%)

Query: 63  DDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKV 122
           DD ++ +   T C+R +C   +   A+  GE     C++H G P+FHEGSKG+SCC R+V
Sbjct: 120 DDASLEIPDGTTCRRKACSATFHKGASRDGES----CVHHPGVPIFHEGSKGYSCCKRRV 175

Query: 123 LEFEEFLKIKGCK-KGKHLFV---GSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKV 178
           LEF++F+KI+GCK K +HLF+            E+++   R D+YQTP+ +I S F KK+
Sbjct: 176 LEFDQFMKIEGCKTKNRHLFIGSGKKKAAAAGGEEKLDTVRTDFYQTPSTVIASFFLKKI 235

Query: 179 DKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
            K+++ + F+ + + +DL   D   KR+    PL+  ID E STF++L TK+E+ L KA 
Sbjct: 236 VKESAKIDFKPQSIALDLPTSDSPPKRYTAEVPLFAPIDVEKSTFKVLGTKLEVNLAKAG 295

Query: 237 GISWPSLKSDENL 249
             SWP L+SD+ L
Sbjct: 296 SESWPVLRSDDRL 308



>gi|67517941|ref|XP_658745.1| hypothetical protein AN1141.2 [Aspergillus nidulans FGSC A4]
 gi|40747103|gb|EAA66259.1| hypothetical protein AN1141.2 [Aspergillus nidulans FGSC A4]
          Length = 739

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 121/222 (54%), Gaps = 27/222 (12%)

Query: 55  PIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKG 114
           P+ +EPE DD  + +  +  C+R  CG  Y  D +      E  C+YH G PVFHEGSKG
Sbjct: 114 PVPEEPESDDPELAIPENATCRRRGCGGTYKPDVSRD----EERCVYHPGQPVFHEGSKG 169

Query: 115 WSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIF 174
           W+C  +K                +HLFVG GK     E+++   R+D+YQT T + +S++
Sbjct: 170 WACAEKK----------------RHLFVGKGKPAG--EEKVESVRNDFYQTATSVNVSLY 211

Query: 175 AKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
            KK+DK N+ V F    + +DL   D KR+  +Y L+  ID E STF++L TK+E+ L K
Sbjct: 212 LKKIDKDNAKVEFTSTGIALDLPTTDNKRYKDSYELFAPIDPEKSTFKVLGTKLELMLVK 271

Query: 235 ANGISWPSLKSD-----ENLGIATTFGVQGGAATVGGKQYTL 271
            +G SWP L+ D     E + I TT      A T  GKQ ++
Sbjct: 272 GDGTSWPVLRKDDRWTGERIQIETTTHPTKPANTTKGKQNSV 313



 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 8/70 (11%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T+C    CGK + D        PE  C+YH G PVFHEG KGW+CC  +VL FEEF++I 
Sbjct: 3   TKCVHKGCGKVFTD--------PEEPCVYHPGPPVFHEGQKGWNCCKPRVLTFEEFMEIP 54

Query: 133 GCKKGKHLFV 142
            C  GKH  V
Sbjct: 55  PCTTGKHSAV 64



>gi|281210930|gb|EFA85096.1| predicted protein [Polysphondylium pallidum PN500]
          Length = 307

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/225 (40%), Positives = 130/225 (57%), Gaps = 15/225 (6%)

Query: 26  NGVEIYDSGPKISYTQTISKTITEEPKLAPIEKEPEE--DDLNIPVASDTECKRPSCGKK 83
           NG E+Y +  K  +     K +T +PK     KE  E  D+ N  +    +C R  C   
Sbjct: 87  NGREVYGTHDKERF---YPKPVTTQPKPQITVKEYIELNDEPNAIIKEGAKCTRNGCTAT 143

Query: 84  YVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVG 143
           YV++ +      E  C YH G  VFHEGSKGW+CC  K   FEEFLKIKGC++GKH F+ 
Sbjct: 144 YVNEQSR-----EETCTYHPGDAVFHEGSKGWACCKPKAALFEEFLKIKGCREGKHKFIP 198

Query: 144 SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKE-LDVDLKMPDEK 202
           +  EVKN  +  V+CR+DWYQ+   +  +I++K V+K+ S V F ++  + VDL +P++K
Sbjct: 199 T--EVKN--ENFVECRNDWYQSFDCVHFTIYSKNVNKEKSVVEFVDRNTVSVDLVLPNDK 254

Query: 203 RFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDE 247
            +  T+ L   I    S+F IL+TKVEIKL K    SW  L+ +E
Sbjct: 255 YYKKTFKLANSISTTKSSFSILSTKVEIKLYKDPQDSWSKLEENE 299



 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 43/65 (66%), Gaps = 7/65 (10%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGK+Y ++          +C YH G+ +FHEG KGWSCCS++V++F++FL+I GC
Sbjct: 3   CGNNGCGKEYTEETV-------GQCCYHPGSAIFHEGMKGWSCCSKRVVDFDDFLQIPGC 55

Query: 135 KKGKH 139
             G+H
Sbjct: 56  STGQH 60



>gi|470249919|ref|XP_004367191.1| hypothetical protein DFA_07328 [Dictyostelium fasciculatum]
 gi|328871838|gb|EGG20208.1| hypothetical protein DFA_07328 [Dictyostelium fasciculatum]
          Length = 309

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 115/196 (58%), Gaps = 10/196 (5%)

Query: 53  LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGS 112
           L P E     D  N  +A +  C R  C   YVD+++      + ECIYHSG PVFH+GS
Sbjct: 115 LPPKEYVEVNDPENAVIAVNGPCLRQGCKSVYVDESSR-----QQECIYHSGEPVFHDGS 169

Query: 113 KGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMS 172
           KG+SCC  K   FEEFLKIKGCK GKH FVG     K V++  + C++DWYQ+   + ++
Sbjct: 170 KGYSCCKPKAAIFEEFLKIKGCKTGKHRFVGE----KKVQENSIVCKYDWYQSYDAVHLT 225

Query: 173 IFAKKVDKQNSSVTFREKE-LDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIK 231
           I+AK+ + Q S + F + + +D+ + + D K F     L   ID + ST   L+TK+E+K
Sbjct: 226 IYAKQANTQLSKIEFTDNQTIDIHIVLRDNKEFNKVLHLAGTIDTQKSTITFLSTKIELK 285

Query: 232 LKKANGISWPSLKSDE 247
           L K   +S+  L+ DE
Sbjct: 286 LIKDPQVSFSKLEQDE 301



 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 7/65 (10%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C   SC K+Y  D T+  +     C YH G+ +FH+G KGWSCCS++V+EFE+FL+I GC
Sbjct: 4   CGNNSCDKEY--DETTLDQ-----CCYHPGSAIFHDGMKGWSCCSKRVIEFEDFLQISGC 56

Query: 135 KKGKH 139
             G+H
Sbjct: 57  ASGRH 61



>gi|402072105|gb|EJT68059.1| CORD and CS domain-containing protein [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 330

 Score =  147 bits (372), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 118/192 (61%), Gaps = 22/192 (11%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C+R +CG  Y    +  GE    +C++H G P+FHEGSKG+SCC R+VLEF++F+KI+GC
Sbjct: 128 CRRKACGATYSKVGSRDGE----KCVHHPGAPIFHEGSKGYSCCKRRVLEFDQFMKIEGC 183

Query: 135 K-KGKHLFVGSGKEVKNVE--------------KEIVQ---CRHDWYQTPTHIIMSIFAK 176
           + K +HLF+GSGK+                   +E+++    RHD+YQT T +I S F K
Sbjct: 184 ETKDRHLFIGSGKKKGKAGANGGGGAAGGQEGGEELLEPGSVRHDYYQTATTVIASFFLK 243

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           K+DK ++ V+F  + + +DL      R+ T  PL+  I  +  TF+IL TK+E+ L KA+
Sbjct: 244 KIDKDHAKVSFETQSILLDLPTAAATRYRTEVPLFAPISPDKCTFKILGTKLEVSLAKAD 303

Query: 237 GISWPSLKSDEN 248
             SWP L+SD+ 
Sbjct: 304 VASWPVLRSDDR 315



 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 38/65 (58%), Gaps = 7/65 (10%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C   SCGK Y        EG E  C+YH G PVFHEG KGW CC  +VL FEEFL I  C
Sbjct: 5   CVHQSCGKSY-------NEGEEDGCVYHPGPPVFHEGQKGWKCCKPRVLTFEEFLSIPPC 57

Query: 135 KKGKH 139
             G+H
Sbjct: 58  TDGRH 62



>gi|501304723|dbj|GAC94017.1| hypothetical protein PHSY_001586 [Pseudozyma hubeiensis SY62]
          Length = 368

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 117/213 (54%), Gaps = 18/213 (8%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E++P E D  +P      CKR  CG K+   A  R       C +H G+P+FHEGSKGWS
Sbjct: 156 EQDPVETDATLPAG--LACKRGGCGYKHQGGARDRSS---ETCKHHKGSPIFHEGSKGWS 210

Query: 117 CCSRKVLEFEEFLKIKGCKKGK--HLFVGSGKEVKNVE---KEIVQCRHDWYQTPTHIIM 171
           CC R+VL+F +FL+I+ C   K  HLFVG+ K   + E   +E V CR D Y+TP  I +
Sbjct: 211 CCKRRVLDFNDFLQIEPCTTAKSGHLFVGAPKAAADGELDGEESVDCRMDHYETPNDIRL 270

Query: 172 SIFAKKVDKQNSSVTFREKELDVDLKMPDE------KRFITTYPLYQLIDKENSTFEILT 225
           +++AK VD  NSS+ F E  +   L +P        +RF      +  I   +S+F I  
Sbjct: 271 TVYAKAVDAANSSIEFNEDSVVFSLLLPPASGSARGRRFKKMLKPFAPIVPTDSSFNITK 330

Query: 226 TKVEIKL-KKANGISWPSLK-SDENLGIATTFG 256
            KV++ L K+  G SWP L+ SD  +G   TFG
Sbjct: 331 FKVDLVLTKQRKGQSWPCLESSDRVIGYGLTFG 363



>gi|71017293|ref|XP_758971.1| hypothetical protein UM02824.1 [Ustilago maydis 521]
 gi|46098637|gb|EAK83870.1| hypothetical protein UM02824.1 [Ustilago maydis 521]
          Length = 368

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 119/213 (55%), Gaps = 18/213 (8%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E++P + D  +  +    CKR  CG K+  D   R    E+ C +H G+P+FHEGSKGWS
Sbjct: 156 EQDPADADATL--SPGVVCKRAGCGYKH--DGGVRDRSSES-CKHHKGSPIFHEGSKGWS 210

Query: 117 CCSRKVLEFEEFLKIKGCKKGK--HLFVGSGKEV---KNVEKEIVQCRHDWYQTPTHIIM 171
           CC R+VL+F +FL+I+ C   K  HLFVG+ K        ++E V CR D Y+TP  I +
Sbjct: 211 CCKRRVLDFNDFLQIQPCTTSKFGHLFVGAAKPAALDATDDEERVDCRMDHYETPNDIRL 270

Query: 172 SIFAKKVDKQNSSVTFREKELDVDLKMP------DEKRFITTYPLYQLIDKENSTFEILT 225
           S++AK VD  NSS+ F++  +   L MP        +RF      +  I   +S+F I  
Sbjct: 271 SVYAKAVDAANSSIEFKQDAVVFSLSMPPTNASSRPRRFRKLLKPFAPIVPADSSFNITK 330

Query: 226 TKVEIKL-KKANGISWPSLKS-DENLGIATTFG 256
            KV++ L K+  G SWP L+S D  +G   TFG
Sbjct: 331 FKVDLVLTKQQKGHSWPCLESGDRVIGYGLTFG 363



>gi|465793934|emb|CCU98832.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 309

 Score =  143 bits (360), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 123/222 (55%), Gaps = 14/222 (6%)

Query: 44  SKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYH 102
           ++T    PK      EP + +    +A+ T C+RP CG  +V +A        AE C YH
Sbjct: 91  TRTAPAPPKATEPAPEPRDPETLTSIAAGTACRRPGCG--FVAEAAIPARDRTAESCRYH 148

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            GTP+FHEGSKG++CC R+VL F++FL+I+ C   +H   G    V   +K  V CR D 
Sbjct: 149 RGTPIFHEGSKGYTCCKRRVLHFDDFLQIEPCTTAEH---GHLFAVPEPDKAQVSCRVDH 205

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDL------KMPDEKRFITTYPLYQLIDK 216
           Y+TP  + ++++AK VD + S++  RE E+ + L       +P  +RF  T   +  +D 
Sbjct: 206 YETPADVRVTVYAKNVDAEQSTIEIRESEVVLSLLLAPTPSVPHARRFERTLQPFGDVDA 265

Query: 217 ENSTFEILTTKVEIKL-KKANGISWPSLKSDENL-GIATTFG 256
             S++ +   K+++ L KK  G SWP+L+ DE + G   TFG
Sbjct: 266 AASSYTLGKMKLDMVLVKKEQGTSWPALERDEPVYGYGVTFG 307



>gi|443898867|dbj|GAC76201.1| Zn2+-binding protein Melusin/RAR1 [Pseudozyma antarctica T-34]
          Length = 369

 Score =  139 bits (350), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 122/220 (55%), Gaps = 16/220 (7%)

Query: 48  TEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPV 107
            + PK    E++P E D N+P      CKR  CG K+  +  SR    E  C +H GTP+
Sbjct: 150 AQAPKEPVEEEDPVESDANLPAG--LTCKRGGCGFKF--EGGSRDRSSET-CNHHKGTPI 204

Query: 108 FHEGSKGWSCCSRKVLEFEEFLKIKGCKKGK--HLFVGSGK-EVKNVEKEIVQCRHDWYQ 164
           FHEGSKGWSCC R+VL+F++FLKI+ C   K  HLFVG+ K +     +E V CR D Y+
Sbjct: 205 FHEGSKGWSCCKRRVLDFDDFLKIEPCSTAKSGHLFVGAPKTDAGAGGEESVDCRMDHYE 264

Query: 165 TPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDE------KRFITTYPLYQLIDKEN 218
           TP  + ++++AK VD   SS+ F+E+ +   L +P        +RF      +  I    
Sbjct: 265 TPNDVRLTVYAKAVDAGQSSIEFQEQGVVFSLLLPPAPGSTRPRRFRKVLTPFAPIVPAE 324

Query: 219 STFEILTTKVEIKLKK-ANGISWPSLKS-DENLGIATTFG 256
           S+F I   KV++ L K   G SWP L+S D  +G   TFG
Sbjct: 325 SSFNITKFKVDLVLAKHVKGQSWPCLESGDRVVGYGLTFG 364



>gi|343429635|emb|CBQ73207.1| related to diploid state maintenance protein chpA [Sporisorium
           reilianum SRZ2]
          Length = 367

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/238 (34%), Positives = 124/238 (52%), Gaps = 18/238 (7%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEP--EEDDLNIPVASDTECKRPSCGKKYVDDATSR 91
           G  +   Q  +++ + + K A   KE   EED  +  +A+   CKR  CG K+   A  R
Sbjct: 128 GMSLLAAQNAAQSTSTDSKEARASKEAVEEEDPTDAALAAGLVCKRGGCGYKHPGGARDR 187

Query: 92  GEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGK--HLFV---GSGK 146
                  C +H G+P+FHEGSKGWSCC R+VL+F +FL+I+ C   +  HLFV    +  
Sbjct: 188 AT---ETCNHHKGSPIFHEGSKGWSCCKRRVLDFNDFLQIQPCSTAQSGHLFVGAPKAAA 244

Query: 147 EVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDE----- 201
                 +E V CR D Y+TP  + ++++AK VD  NSS+ F++  +   L +P       
Sbjct: 245 GGGADGEESVDCRMDHYETPNDVRLTVYAKAVDAANSSIEFQQDGVVFSLALPPASGSTR 304

Query: 202 -KRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN-GISWPSLKS-DENLGIATTFG 256
            +RF      +  I    S+F +   KV++ L K + G SWP L+S D  +G   TFG
Sbjct: 305 PRRFRKVLKPFAPIVPAESSFNMTKFKVDLVLTKLHKGQSWPCLESGDRVIGYGLTFG 362



>gi|242024533|ref|XP_002432682.1| Integrin beta-1-binding protein, putative [Pediculus humanus
           corporis]
 gi|212518152|gb|EEB19944.1| Integrin beta-1-binding protein, putative [Pediculus humanus
           corporis]
          Length = 316

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 101/184 (54%), Gaps = 11/184 (5%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRK 121
           E D +  V   T CK   C   Y        E  E EC+YH G PVFHEG K WSCC +K
Sbjct: 137 ESDNSGEVMIGTACKNRGCKSAY-----KGTESNEEECVYHPGVPVFHEGLKSWSCCKKK 191

Query: 122 VLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQ 181
             +F  FL+  GC+KG H++V      +N E E   CR+DW+QT +HI+MS++AKK    
Sbjct: 192 TTDFATFLEQLGCEKGNHVWVK-----ENDENERTDCRYDWHQTGSHIVMSVYAKKYHPD 246

Query: 182 NSSVTFREKELDVDLKMPDEKR-FITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
            S +      + +++  P+    F     L+ ++D E S  ++L TKVEIKLKKA   +W
Sbjct: 247 KSIIELNPIRIKMNIFFPENNSAFNKDLELFGIVDVEKSEIKMLQTKVEIKLKKAEPANW 306

Query: 241 PSLK 244
           P L+
Sbjct: 307 PKLE 310



>gi|358335563|dbj|GAA27687.2| cysteine and histidine-rich domain-containing protein 1, partial
           [Clonorchis sinensis]
          Length = 322

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 98/188 (52%), Gaps = 11/188 (5%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           EED  N+ V   T CK   C   Y   A          C+YH G P+FHEG K W+CC+R
Sbjct: 127 EEDTGNVAVG--TSCKNSGCKATYSGTAADNDL-----CLYHPGVPIFHEGMKYWTCCNR 179

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQ---CRHDWYQTPTHIIMSIFAKK 177
           K  EFE F++  GC  G+H +        N+   I     CRHDW+Q P  +I++++AK 
Sbjct: 180 KTSEFESFMEQIGCATGRHNWTEKAARATNLAVSIAAQATCRHDWFQLPGQVIITVYAKA 239

Query: 178 VDKQNSSVTFREKELDVDLKM-PDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
           V  ++ +VT     L    +   D +RF  T+ L   +D E S  +++ TKVEI LKK  
Sbjct: 240 VIPESVNVTANRVRLHAIFEFGSDRQRFDKTFELCGTVDPEASVIKLMGTKVEIVLKKGE 299

Query: 237 GISWPSLK 244
            +SWP L+
Sbjct: 300 AMSWPRLE 307



>gi|426370096|ref|XP_004052009.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Gorilla gorilla gorilla]
          Length = 218

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 102/188 (54%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 27  ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGPESLEEVCVYHSGVPIFHEGMKYW 78

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 79  SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 133

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 134 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKA 193

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 194 EPMQWASL 201



>gi|388853900|emb|CCF52398.1| related to diploid state maintenance protein chpA [Ustilago hordei]
          Length = 365

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 107/195 (54%), Gaps = 16/195 (8%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           CKR  CG K+   A  R +     C +H G+P+FHEGSKGWSCC R+VL+F +FL+I  C
Sbjct: 169 CKRGGCGFKFEGGARDRSK---ETCKHHKGSPIFHEGSKGWSCCKRRVLDFNDFLQIVPC 225

Query: 135 KKGK--HLFVGSGKEVKNVE---KEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
              K  HLFVG+ K   +     +E V CR D Y+TP  + ++++AK VD  NSS+ F E
Sbjct: 226 TTAKSGHLFVGAPKTAADGSADGEESVDCRMDHYETPNDVRLTVYAKAVDAANSSIEFNE 285

Query: 190 KELDVDLKMPDE------KRFITTYPLYQLIDKENSTFEILTTKVEIKL-KKANGISWPS 242
             +   L +P        +RF      +  I    S+F I   KV++ L KKA   SWP 
Sbjct: 286 DGVVFSLLLPPATGSSRGRRFKKILKPFAPILPAESSFNITKFKVDLVLTKKAKCQSWPC 345

Query: 243 LKS-DENLGIATTFG 256
           L+S +  +G   TFG
Sbjct: 346 LESGNRPIGYGLTFG 360



>gi|118404486|ref|NP_001072688.1| integrin beta 1 binding protein (melusin) 2 [Xenopus (Silurana)
           tropicalis]
 gi|115312970|gb|AAI24022.1| hypothetical protein MGC147501 [Xenopus (Silurana) tropicalis]
          Length = 359

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 119/211 (56%), Gaps = 19/211 (9%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           +  +Q++ K + E+ K+ P EKE ++ + +  +   T CK   C + Y        +GPE
Sbjct: 121 LKVSQSLEKEL-EKLKIKPQEKEVQKVETD-QIGVGTTCKHAGCKEVY--------QGPE 170

Query: 97  AE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
           ++   CI+H G PVFHEG K WSCC+ K  +F EFL  +GC  GKHL++      K   +
Sbjct: 171 SDAGTCIHHPGVPVFHEGMKFWSCCNIKTSDFNEFLDQRGCASGKHLWI------KTTGR 224

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQL 213
           + V CR+DW+QT + ++++I+AK    + S V   +  LD+ +    +  F     L+ +
Sbjct: 225 QAVSCRYDWHQTSSVVVITIYAKTAIPELSHVLANQTALDIQISFQGQSEFRKQVELWGV 284

Query: 214 IDKENSTFEILTTKVEIKLKKANGISWPSLK 244
           ID   ST  +L TKVEI +KKA+ ++W  L+
Sbjct: 285 IDIGKSTVSLLPTKVEITMKKADPVTWGRLE 315



>gi|167517191|ref|XP_001742936.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778035|gb|EDQ91650.1| predicted protein [Monosiga brevicollis MX1]
          Length = 312

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 118/222 (53%), Gaps = 20/222 (9%)

Query: 30  IYDSGPKISY----TQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYV 85
           + D  PK+      T ++ + + ++ + A  E E +E      V     C   +C   YV
Sbjct: 101 MRDGAPKVELPLKTTASLERALAQQAETAAKEIESQE------VQPGQACTHNACKGSYV 154

Query: 86  DDATSRGEGPEAECIYHSGTPVFHEGSKGWSCC-SRKVLEFEEFLKIKGCKKGKHLFVGS 144
           D++++     E +C +H GTPVFHEG K WSCC  +K  EF+EFL  KGC  GKH +   
Sbjct: 155 DESSN-----EEDCFHHPGTPVFHEGYKYWSCCPKKKTYEFDEFLDFKGCTVGKHRWFKP 209

Query: 145 GKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRF 204
            +E    +    QCR+DW+Q+ TH+++++FAK ++   +SV      + +D+       F
Sbjct: 210 AEESAKAK----QCRYDWFQSDTHVVLTVFAKCIEPSRTSVKANADSITIDIVYSKSFTF 265

Query: 205 ITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSD 246
                L   I    ST ++L+TK++IKL KA G +W +L +D
Sbjct: 266 QLELHLGGNIIPAESTVQLLSTKMDIKLAKAPGEAWAALTAD 307



>gi|332207896|ref|XP_003253031.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Nomascus leucogenys]
          Length = 332

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 102/188 (54%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSVPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|426370094|ref|XP_004052008.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Gorilla gorilla gorilla]
          Length = 332

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 102/188 (54%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGPESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|426370098|ref|XP_004052010.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 3 [Gorilla gorilla gorilla]
          Length = 313

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 102/188 (54%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 122 ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGPESLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 229 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKA 288

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 289 EPMQWASL 296



>gi|241626044|ref|XP_002409601.1| cysteine and histidine-rich domain (chord)-containing, zinc binding
           protein, putative [Ixodes scapularis]
 gi|215503190|gb|EEC12684.1| cysteine and histidine-rich domain (chord)-containing, zinc binding
           protein, putative [Ixodes scapularis]
          Length = 334

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 106/187 (56%), Gaps = 12/187 (6%)

Query: 59  EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSC 117
           E  E + +  V+  T CK   C + Y      +GE    E C+YHSG P+FHEG K W+C
Sbjct: 138 EASESEADTTVSLGTSCKNAGCQQSY------QGEQSNLEICLYHSGFPIFHEGMKYWTC 191

Query: 118 CSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
           C RK  +F  FL+ +GC  G HL++    + KN E +   CR+DW+QT +H+++SIF+K 
Sbjct: 192 CQRKTSDFANFLEQRGCTSGSHLWI----KKKNAEGDQATCRYDWHQTASHVVVSIFSKV 247

Query: 178 VDKQNSSVTFREKELDVDLKMPDEK-RFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
              + S V     +L + +   +++  F  T+ L  +ID E S  + L TKVE+KLKKA 
Sbjct: 248 PIPELSRVEANPVKLHLHITFGEDRCLFSQTFLLSGVIDVEKSCVQYLGTKVEVKLKKAE 307

Query: 237 GISWPSL 243
            +SW  L
Sbjct: 308 PMSWRHL 314



>gi|307199859|gb|EFN80256.1| Cysteine and histidine-rich domain-containing protein 1
           [Harpegnathos saltator]
          Length = 339

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 116/212 (54%), Gaps = 19/212 (8%)

Query: 35  PKISYTQTISKTITEEPK-LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           P++  + TIS T+ E+ K L  +E +P   ++ I       CK  SC   Y       GE
Sbjct: 112 PQLQLSPTISPTLLEQVKGLTALENKPILGEIQI----GQNCKNNSCKVTY------NGE 161

Query: 94  GPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVE 152
               E CI+H G P+FHEG K WSCC +K  EF  FL+ +GC  GKH++       K++ 
Sbjct: 162 DSNEEVCIFHPGVPIFHEGLKYWSCCQKKTTEFSVFLEQRGCSLGKHVWFS-----KDIG 216

Query: 153 KEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEK-RFITTYPLY 211
           K+ VQCR DW+QT T +++S++AKK     S+V      L VDL   +E  R+     L 
Sbjct: 217 KK-VQCRMDWHQTGTFVVVSVYAKKYLPSQSAVKLNPVRLTVDLFFIEENSRYNLDIALR 275

Query: 212 QLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
            ++D + S+  +L TKVEIKL+KA   SW  L
Sbjct: 276 GIVDVKQSSVNMLPTKVEIKLRKAEPGSWSEL 307



 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C R  CGKK+        +  + +C++H G PVFH+  KGWSCC++K ++F EFL IKGC
Sbjct: 10  CYRRGCGKKF-----DPNDNKDDDCVHHPGQPVFHDAYKGWSCCNKKCIDFTEFLNIKGC 64

Query: 135 KKGKH 139
            K  H
Sbjct: 65  TKATH 69



>gi|75076829|sp|Q4R7U2.1|CHRD1_MACFA RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHP-1; AltName: Full=Morgana
 gi|67968947|dbj|BAE00830.1| unnamed protein product [Macaca fascicularis]
          Length = 332

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 102/188 (54%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KG+H++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGRHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEINMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|332024062|gb|EGI64279.1| Cysteine and histidine-rich domain-containing protein 1 [Acromyrmex
           echinatior]
          Length = 340

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 114/210 (54%), Gaps = 16/210 (7%)

Query: 36  KISYTQTISKTITEEPK-LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEG 94
           ++  + TIS T+ E  K L  +E +   D +   +     CK  SC + Y   A++    
Sbjct: 113 QLVLSPTISPTLLERIKGLTALENDKPIDSV---IQIGQTCKNNSCKRTYTGIASN---- 165

Query: 95  PEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKE 154
            E  C YHSG P+FHEG K WSCC +K  EF  FL   GC +GKH++       KN+ K+
Sbjct: 166 -EEVCNYHSGVPIFHEGLKYWSCCKKKTTEFSLFLDQPGCTQGKHIWFS-----KNMGKK 219

Query: 155 IVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDE-KRFITTYPLYQL 213
             QCR DW+QT +++++SIFAKK     S +      L VDL   +E  R+     L  +
Sbjct: 220 -AQCRMDWHQTGSYVVVSIFAKKYLPSQSIIKLNPIHLTVDLFFVEEDSRYYLDIELKGI 278

Query: 214 IDKENSTFEILTTKVEIKLKKANGISWPSL 243
           ++ E S+  +L TKVEIKLKKA   SWP L
Sbjct: 279 VNVEQSSVHMLPTKVEIKLKKAEPGSWPKL 308



>gi|402896523|ref|XP_003911346.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Papio anubis]
          Length = 353

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 102/188 (54%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 162 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 213

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KG+H++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 214 SCCRRKTSDFNTFLAQEGCTKGRHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 268

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 269 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEINMRKA 328

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 329 EPMQWASL 336



>gi|383873111|ref|NP_001244685.1| cysteine and histidine-rich domain-containing protein 1 [Macaca
           mulatta]
 gi|355566938|gb|EHH23317.1| hypothetical protein EGK_06763 [Macaca mulatta]
          Length = 332

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 102/188 (54%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KG+H++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGRHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEINMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|21355187|ref|NP_651226.1| CHORD [Drosophila melanogaster]
 gi|74947746|sp|Q9VCC0.1|CHRD1_DROME RecName: Full=Cysteine and histidine-rich domain-containing
           protein; AltName: Full=Morgana
 gi|7301118|gb|AAF56252.1| CHORD [Drosophila melanogaster]
 gi|17945014|gb|AAL48569.1| RE04143p [Drosophila melanogaster]
 gi|220947790|gb|ACL86438.1| CHORD-PA [synthetic construct]
 gi|220957100|gb|ACL91093.1| CHORD-PA [synthetic construct]
          Length = 354

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 98/173 (56%), Gaps = 12/173 (6%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C   +  +++  GE     C YH G P+FHEG K WSCC ++  +F +F+  K
Sbjct: 138 TTCKNNGCTYSFTGNSSDFGE-----CTYHPGVPIFHEGMKFWSCCQKRTSDFSQFMAQK 192

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  G+H +V      +N +K++VQCR+DW+QT T+++M+I+AKK D   S +      L
Sbjct: 193 GCTYGEHKWVK-----ENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRL 247

Query: 193 DVDLKMP--DEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
            V+L  P  D  RF     L  +++  N++  +  TKVEIKL K    SW +L
Sbjct: 248 HVNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEIKLPKLEPGSWSNL 300



>gi|350535042|ref|NP_001233351.1| cysteine and histidine-rich domain-containing protein 1 [Pan
           troglodytes]
 gi|397485372|ref|XP_003813822.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Pan paniscus]
 gi|343962081|dbj|BAK62628.1| cysteine and histidine-rich domain-containing protein [Pan
           troglodytes]
          Length = 332

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 100/187 (53%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 249 NSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 308

Query: 237 GISWPSL 243
            + W SL
Sbjct: 309 PMQWASL 315



>gi|148231071|ref|NP_001091174.1| integrin beta 1 binding protein (melusin) 2 [Xenopus laevis]
 gi|120537904|gb|AAI29685.1| LOC100036934 protein [Xenopus laevis]
          Length = 357

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 117/211 (55%), Gaps = 19/211 (9%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           +  +Q++ K + E+ ++ P E+E ++ + ++ V   T CK   C + Y        +GPE
Sbjct: 120 LKVSQSLEKEL-EKLRIKPQEEEVKKVETDL-VGVGTSCKHAGCKEVY--------QGPE 169

Query: 97  AE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
           ++   CI+H G PVFHEG K WSCC+ K  +F EFL  +GC  GKHL+      +KN  +
Sbjct: 170 SDAGTCIHHPGVPVFHEGMKFWSCCNIKTSDFNEFLDQRGCASGKHLW------IKNTGR 223

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQL 213
           + V CR+DW+QT   + ++++AK    + S V      LD+ +    +  F     L+ +
Sbjct: 224 QAVSCRYDWHQTSNIVTITVYAKTAIPELSQVLANRTGLDIQISFQGQSEFRKQVELWGV 283

Query: 214 IDKENSTFEILTTKVEIKLKKANGISWPSLK 244
           ID   S   +L TKVEI LKKA+ ++W  L+
Sbjct: 284 IDVGASIVNLLPTKVEITLKKADPVTWGRLE 314



>gi|397485374|ref|XP_003813823.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Pan paniscus]
          Length = 313

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 102/188 (54%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      +G E  E  C+YHSG P+FHEG K W
Sbjct: 122 ENKKEEDNDEIKIG--TSCKNGGCSKTY------QGLESLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 229 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKA 288

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 289 EPMQWASL 296



>gi|221316570|ref|NP_001137545.1| cysteine and histidine-rich domain-containing protein 1 isoform b
           [Homo sapiens]
          Length = 313

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 100/187 (53%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 122 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 174

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 175 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 229

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 230 NSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 289

Query: 237 GISWPSL 243
            + W SL
Sbjct: 290 PMQWASL 296



>gi|12002207|gb|AAG43237.1|AF123249_1 chymotrypsin-like protein [Homo sapiens]
 gi|119587272|gb|EAW66868.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_b [Homo sapiens]
 gi|119587273|gb|EAW66869.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_b [Homo sapiens]
          Length = 313

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 100/187 (53%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 122 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 174

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 175 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 229

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 230 NSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 289

Query: 237 GISWPSL 243
            + W SL
Sbjct: 290 PMQWASL 296



>gi|221316566|ref|NP_036256.2| cysteine and histidine-rich domain-containing protein 1 isoform a
           [Homo sapiens]
 gi|167008724|sp|Q9UHD1.2|CHRD1_HUMAN RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHORD-containing protein 1; Short=CHP-1; AltName:
           Full=Protein morgana
 gi|47940672|gb|AAH72461.1| Cysteine and histidine-rich domain (CHORD)-containing 1 [Homo
           sapiens]
 gi|158261485|dbj|BAF82920.1| unnamed protein product [Homo sapiens]
 gi|312151106|gb|ADQ32065.1| cysteine and histidine-rich domain (CHORD)-containing 1 [synthetic
           construct]
          Length = 332

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 100/187 (53%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 249 NSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 308

Query: 237 GISWPSL 243
            + W SL
Sbjct: 309 PMQWASL 315



>gi|119587274|gb|EAW66870.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_c [Homo sapiens]
 gi|119587275|gb|EAW66871.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_c [Homo sapiens]
 gi|189069207|dbj|BAG35545.1| unnamed protein product [Homo sapiens]
          Length = 332

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/187 (38%), Positives = 100/187 (53%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 249 NSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 308

Query: 237 GISWPSL 243
            + W SL
Sbjct: 309 PMQWASL 315



>gi|403301745|ref|XP_003941543.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Saimiri boliviensis boliviensis]
          Length = 313

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 101/188 (53%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 122 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 229 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKA 288

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 289 EPMQWASL 296



>gi|209969825|ref|NP_001123267.2| cysteine and histidine-rich domain (CHORD)-containing 1 [Nasonia
           vitripennis]
          Length = 340

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 113/211 (53%), Gaps = 13/211 (6%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P+++   T+S  + E+ +   +    ++D  +I +     CK  SC + Y   A++   
Sbjct: 111 SPQVTLKPTVSPALLEQIQGLTVLDSTKKDVNSIAIGQ--SCKNNSCKRTYQGPASN--- 165

Query: 94  GPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
             +  C YH G P+FHEG K WSCC +K  +F  FL+  GC +G H++V  G   K    
Sbjct: 166 --DEVCTYHPGVPIFHEGLKYWSCCQKKTTDFAVFLEQPGCSQGNHVWVQKGASNKK--- 220

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEK-RFITTYPLYQ 212
             V+CR DW+QT TH+I+S++AKK +  +S +      L VDL  P+E  R+     L  
Sbjct: 221 --VKCRMDWHQTGTHVIVSVYAKKYNPDSSFIKLNPVHLTVDLYFPEENSRYNLDIELRG 278

Query: 213 LIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           ++D + S+  +L TK EIKL+K    SW  L
Sbjct: 279 IVDVDASSATMLPTKTEIKLRKKEPGSWSKL 309



>gi|149719233|ref|XP_001488703.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Equus caballus]
          Length = 332

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/195 (36%), Positives = 105/195 (53%), Gaps = 16/195 (8%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVF 108
           KL+   +E +++D +  +   T CK   C K Y        +GP   E  C+YHSG P+F
Sbjct: 134 KLSSGNEENKKEDDSDEIKIGTPCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIF 185

Query: 109 HEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTH 168
           HEG K WSCC RK  +F  FL  +GC  GKH++       K+V K++V CRHDW+QT   
Sbjct: 186 HEGMKYWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDVGKKVVACRHDWHQTGGE 240

Query: 169 IIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKV 228
           + +S++AK    + S V      L+V +    EK F     L+ +ID + S   +  TK+
Sbjct: 241 VTISVYAKNSLPELSKVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKI 300

Query: 229 EIKLKKANGISWPSL 243
           EI ++KA  + W SL
Sbjct: 301 EITMRKAEPMQWASL 315



>gi|403301743|ref|XP_003941542.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Saimiri boliviensis boliviensis]
          Length = 332

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 101/188 (53%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|440895125|gb|ELR47394.1| Cysteine and histidine-rich domain-containing protein 1, partial
           [Bos grunniens mutus]
          Length = 311

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 100/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 120 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 169

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 170 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 224

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++
Sbjct: 225 YAKNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMR 284

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 285 KAEPMQWASL 294



>gi|114052382|ref|NP_001039377.1| cysteine and histidine-rich domain-containing protein 1 [Bos
           taurus]
 gi|122135277|sp|Q29RL2.1|CHRD1_BOVIN RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHP-1; AltName: Full=Protein morgana
 gi|88954376|gb|AAI14126.1| Cysteine and histidine-rich domain (CHORD)-containing 1 [Bos
           taurus]
 gi|296471971|tpg|DAA14086.1| TPA: cysteine and histidine-rich domain-containing protein 1 [Bos
           taurus]
          Length = 332

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 100/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++
Sbjct: 246 YAKNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMR 305

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 306 KAEPMQWASL 315



>gi|194909877|ref|XP_001982027.1| GG11265 [Drosophila erecta]
 gi|190656665|gb|EDV53897.1| GG11265 [Drosophila erecta]
          Length = 353

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 108/203 (53%), Gaps = 19/203 (9%)

Query: 50  EPKLAP-------IEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           +P +AP       +EK P     +  +   T CK   C   Y   ++  GE     C YH
Sbjct: 109 QPAVAPALKEIVFVEKTPGAPKSSDAIEVGTSCKNNGCTYIYAGTSSDFGE-----CTYH 163

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G P+FHEG K WSCC ++  +F +F+  KGC  G+H +V      +N +K++VQCR+DW
Sbjct: 164 PGVPIFHEGMKFWSCCQKRTSDFAQFMAQKGCAYGEHKWVK-----ENDDKKVVQCRYDW 218

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEK--RFITTYPLYQLIDKENST 220
           +QT T+++++I+AKK D   S V      L V+L  P++   RF     L  +++  N++
Sbjct: 219 HQTATNVVVAIYAKKYDYSQSVVELNPIRLHVNLVFPEQSNARFDLDLELRGIVNVSNAS 278

Query: 221 FEILTTKVEIKLKKANGISWPSL 243
             +  TKVEI L K    SW +L
Sbjct: 279 AHMFGTKVEITLPKLEPGSWSNL 301



>gi|6581054|gb|AAF18436.1|AF192465_1 CHORD containing protein [Drosophila melanogaster]
          Length = 354

 Score =  127 bits (320), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 97/173 (56%), Gaps = 12/173 (6%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C   +  +++  GE     C YH G P+FHEG K WSCC ++  +F +F+  K
Sbjct: 138 TTCKNNGCTYSFTGNSSDFGE-----CTYHPGVPIFHEGMKFWSCCQKRTSDFSQFMAQK 192

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  G+H +V      +N +K++VQCR+DW+QT T+++M+I+AKK D   S +      L
Sbjct: 193 GCTYGEHKWVK-----ENDDKKVVQCRYDWHQTATNVVMAIYAKKYDYSQSVIELNPIRL 247

Query: 193 DVDLKMP--DEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
            V+L  P  D  RF     L  +++  N++  +  TKVEI L K    SW +L
Sbjct: 248 HVNLVFPEQDNARFDLDLELRGIVNVSNASAHMYGTKVEITLPKLEPGSWSNL 300



>gi|206597559|ref|NP_001125118.1| cysteine and histidine-rich domain-containing protein 1 [Pongo
           abelii]
 gi|75042295|sp|Q5RD91.1|CHRD1_PONAB RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHP-1; AltName: Full=Protein morgana
 gi|55727018|emb|CAH90266.1| hypothetical protein [Pongo abelii]
          Length = 332

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 101/188 (53%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+ HEG K W
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPISHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSLPELSRVEANSTLLNVHIVFEGEKEFEQNVKLWGVIDVKRSYVTMTATKIEITMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|195400040|ref|XP_002058626.1| GJ14211 [Drosophila virilis]
 gi|194142186|gb|EDW58594.1| GJ14211 [Drosophila virilis]
          Length = 367

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/177 (36%), Positives = 99/177 (55%), Gaps = 12/177 (6%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           VA  T CK   C   Y + ++  GE     C YH G P+FHEG K WSCC ++  +F +F
Sbjct: 142 VAVGTSCKNNGCTYSYTNTSSDFGE-----CTYHPGVPIFHEGMKFWSCCQKRTSDFAQF 196

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
           +  KGC  G+H FV   +     +K++VQCR+DW+QT T+++++++AKK     S V   
Sbjct: 197 MAQKGCVYGQHKFVKDDE-----DKQVVQCRYDWHQTATNVVVTVYAKKFHYAQSVVEVN 251

Query: 189 EKELDVDLKMPDEK--RFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
              L V L  P+++  +F     L  +I+ + ++ ++  TKVEI L K    SWP L
Sbjct: 252 PIRLHVMLVFPEQENAKFELDLELRGIINVQTASVQMFGTKVEITLPKLEPGSWPKL 308



>gi|164664460|ref|NP_001106917.1| cysteine and histidine-rich domain-containing protein 1 [Sus
           scrofa]
 gi|317374808|sp|A9YUB1.1|CHRD1_PIG RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=Chp-1; AltName: Full=Morgana
 gi|162946616|gb|ABY21264.1| CHORD containing protein-1 [Sus scrofa]
          Length = 332

 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I V   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKVG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH +       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHTWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++
Sbjct: 246 YAKNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMR 305

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 306 KAEPMQWASL 315



>gi|443702188|gb|ELU00349.1| hypothetical protein CAPTEDRAFT_165685 [Capitella teleta]
          Length = 318

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 100/186 (53%), Gaps = 13/186 (6%)

Query: 62  EDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSR 120
           EDD +  V   T CK   C K+Y       GE  + E C++HSG PVFHEG K WSCC R
Sbjct: 143 EDDKDGSVKIGTSCKNKGCKKEY------EGENSDKEVCVFHSGVPVFHEGMKYWSCCQR 196

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           K  +F  FL  +GC  G HL+V      K  E + V+CR+DW+QT T + MS+FAK    
Sbjct: 197 KTSDFNNFLDQEGCTNGTHLWVA-----KESESQKVKCRYDWHQTATFVTMSVFAKVASP 251

Query: 181 QNSSVTFREKELDVDLKMPDEKR-FITTYPLYQLIDKENSTFEILTTKVEIKLKKANGIS 239
           + + V   +  L++ +     K  F     L   +D   S+ ++L TKVE+ LKKA   S
Sbjct: 252 ELTVVEANQVILNLKIVFDGGKSVFEERISLQHAVDPAKSSVKLLGTKVEVNLKKAEPCS 311

Query: 240 WPSLKS 245
           W  L+S
Sbjct: 312 WSKLES 317



>gi|426252197|ref|XP_004019802.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Ovis aries]
          Length = 495

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 100/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 304 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 353

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 354 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 408

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++
Sbjct: 409 YAKNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMR 468

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 469 KAEPMQWASL 478



>gi|281337340|gb|EFB12924.1| hypothetical protein PANDA_005065 [Ailuropoda melanoleuca]
          Length = 275

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 84  ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 133

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 134 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 188

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++
Sbjct: 189 YAKNSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEITMR 248

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 249 KAEPMQWASL 258



>gi|119587271|gb|EAW66867.1| cysteine and histidine-rich domain (CHORD)-containing 1, isoform
           CRA_a [Homo sapiens]
          Length = 331

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 100/187 (53%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E+  +ED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 140 EENKKEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 192

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 193 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 247

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 248 NSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 307

Query: 237 GISWPSL 243
            + W SL
Sbjct: 308 PMQWASL 314



>gi|301763016|ref|XP_002916922.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Ailuropoda melanoleuca]
          Length = 332

 Score =  127 bits (318), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++
Sbjct: 246 YAKNSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEITMR 305

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 306 KAEPMQWASL 315



>gi|301763018|ref|XP_002916923.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Ailuropoda melanoleuca]
          Length = 313

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 171

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 172 YWSCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 226

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++
Sbjct: 227 YAKNSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEITMR 286

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 287 KAEPMQWASL 296



>gi|472385242|ref|XP_004411984.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Odobenus rosmarus divergens]
          Length = 332

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC +K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRKKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++
Sbjct: 246 YAKNSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEINMR 305

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 306 KAEAMQWASL 315



>gi|472385244|ref|XP_004411985.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Odobenus rosmarus divergens]
          Length = 313

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 171

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC +K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 172 YWSCCRKKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 226

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++
Sbjct: 227 YAKNSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEINMR 286

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 287 KAEAMQWASL 296



>gi|507556478|ref|XP_004661994.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Jaculus jaculus]
          Length = 332

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 100/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEETCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++
Sbjct: 246 YAKNSLPELSRVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMR 305

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 306 KAEPMQWASL 315



>gi|466019580|ref|XP_004271933.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Orcinus orca]
 gi|470626574|ref|XP_004320403.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Tursiops truncatus]
          Length = 332

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH +       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRRKTSDFNTFLAQEGCTTGKHTWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++
Sbjct: 246 YAKNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMR 305

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 306 KAEPMQWASL 315



>gi|466019585|ref|XP_004271934.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Orcinus orca]
 gi|470626577|ref|XP_004320404.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Tursiops truncatus]
          Length = 313

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 171

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKH +       K+  K++V CRHDW+QT   + +S+
Sbjct: 172 YWSCCRRKTSDFNTFLAQEGCTTGKHTWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 226

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++
Sbjct: 227 YAKNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMR 286

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 287 KAEPMQWASL 296



>gi|498981622|ref|XP_004550105.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform X1 [Maylandia zebra]
 gi|498981626|ref|XP_004550106.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform X2 [Maylandia zebra]
          Length = 343

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 94/174 (54%), Gaps = 16/174 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K +        EGP ++   C+YH+G P+FHEG K WSCC RK  +F  FL
Sbjct: 155 TSCKNGGCTKSF--------EGPASDSDVCLYHAGFPIFHEGMKYWSCCKRKTSDFNTFL 206

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
             +GC KG HL+       K+  K++V CR DW+QT T +I+SI+AK    + S V    
Sbjct: 207 SQEGCTKGTHLW-----RKKDAGKKVVPCRFDWHQTGTQVIISIYAKNAVPELSYVDANS 261

Query: 190 KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
             LD+ +    EK F     L+ +ID   S   ++  K+E+ +KK+  +SW  L
Sbjct: 262 TTLDIHIIFDGEKEFEQKISLWGVIDVSKSLVNMMAAKIEVAMKKSEAMSWARL 315



>gi|498957342|ref|XP_004524138.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Ceratitis capitata]
          Length = 363

 Score =  126 bits (316), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 98/179 (54%), Gaps = 14/179 (7%)

Query: 67  IPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFE 126
           IP+   T CK   C   Y   AT        EC+YH G P+FHEG K WSCC RK  +F 
Sbjct: 139 IPIG--TSCKNKGCTYSYTGTATDN-----EECVYHPGAPIFHEGMKYWSCCQRKTSDFA 191

Query: 127 EFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVT 186
            F+  KGC  G+H++    +     ++++V CR+DW+QTP+++I+SI+AKK     S + 
Sbjct: 192 VFIAQKGCACGEHMWFKEDQ-----DRKVVICRYDWHQTPSNVIVSIYAKKYHYLLSKIE 246

Query: 187 FREKELDVDLKMPDEK--RFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
                L V+L  P+++  +F     L  +ID   +T  +  TKVEI + KA   SWP L
Sbjct: 247 VNPIRLHVNLVFPEQEDSQFDLELELRGIIDVNKTTAHMFGTKVEITMPKAEPGSWPKL 305



>gi|478506428|ref|XP_004427509.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Ceratotherium simum simum]
          Length = 313

 Score =  126 bits (316), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 98/187 (52%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y        +  E  C+YHSG P+FHEG K WS
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY-----QGLQSLEEVCVYHSGVPIFHEGMKYWS 174

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 175 CCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 229

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 230 NSLPELSQVVANSTVLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 289

Query: 237 GISWPSL 243
            + W SL
Sbjct: 290 PMQWASL 296



>gi|478506426|ref|XP_004427508.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Ceratotherium simum simum]
          Length = 332

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 98/187 (52%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y        +  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY-----QGLQSLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 249 NSLPELSQVVANSTVLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 308

Query: 237 GISWPSL 243
            + W SL
Sbjct: 309 PMQWASL 315



>gi|507691288|ref|XP_004641969.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform X2 [Octodon degus]
          Length = 313

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 99/188 (52%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 122 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWAK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K      S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 229 KNSLPDLSRVEANSTSLNVHIVFEGEKEFHQNVKLWGVIDVKRSHVTMTATKIEISMRKA 288

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 289 EPMQWASL 296



>gi|507691284|ref|XP_004641968.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform X1 [Octodon degus]
          Length = 332

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 99/188 (52%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWAK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K      S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSLPDLSRVEANSTSLNVHIVFEGEKEFHQNVKLWGVIDVKRSHVTMTATKIEISMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|507690663|ref|XP_004641822.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Octodon degus]
          Length = 313

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 99/188 (52%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 122 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K      S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 229 KNSLPDLSRVEANSTSLNVHIVFEGEKEFHQNVKLWGVIDVKRSHVTMTATKIEISMRKA 288

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 289 EPMQWASL 296



>gi|13385324|ref|NP_080120.1| cysteine and histidine-rich domain-containing protein 1 [Mus
           musculus]
 gi|81881223|sp|Q9D1P4.1|CHRD1_MOUSE RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHORD-containing protein 1; Short=Chp-1; AltName:
           Full=Protein morgana
 gi|12833816|dbj|BAB22675.1| unnamed protein product [Mus musculus]
 gi|17390873|gb|AAH18374.1| Cysteine and histidine-rich domain (CHORD)-containing, zinc-binding
           protein 1 [Mus musculus]
 gi|74210036|dbj|BAE21307.1| unnamed protein product [Mus musculus]
 gi|148693093|gb|EDL25040.1| cysteine and histidine-rich domain (CHORD)-containing, zinc-binding
           protein 1 [Mus musculus]
          Length = 331

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 99/187 (52%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y        +  E  C+YHSG P+FHEG K WS
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY-----QGLQSLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC +GKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTRGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 249 NSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 308

Query: 237 GISWPSL 243
            + W SL
Sbjct: 309 PMQWASL 315



>gi|157822247|ref|NP_001101598.1| cysteine and histidine-rich domain-containing protein 1 [Rattus
           norvegicus]
 gi|317374809|sp|D4A4T9.1|CHRD1_RAT RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           Short=CHP-1; AltName: Full=Morgana
 gi|149020614|gb|EDL78419.1| cysteine and histidine-rich domain (CHORD)-containing, zinc-binding
           protein 1 (predicted) [Rattus norvegicus]
          Length = 331

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 99/187 (52%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y        +  E  C+YHSG P+FHEG K WS
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY-----QGLQSLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC +GKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTRGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 249 NSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 308

Query: 237 GISWPSL 243
            + W SL
Sbjct: 309 PMQWASL 315



>gi|345787903|ref|XP_003432986.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 1 [Canis lupus familiaris]
          Length = 311

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 99/188 (52%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 122 ESKKEEDSDEIKIG--TSCKNGGCTKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +SI+A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISIYA 228

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++KA
Sbjct: 229 KNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEITMRKA 288

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 289 EPMQWASL 296



>gi|345787901|ref|XP_533979.3| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform 2 [Canis lupus familiaris]
          Length = 330

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 99/188 (52%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 ESKKEEDSDEIKIG--TSCKNGGCTKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +SI+A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISIYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++KA
Sbjct: 248 KNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEITMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|355752534|gb|EHH56654.1| hypothetical protein EGM_06111 [Macaca fascicularis]
          Length = 332

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 101/188 (53%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC KG+H++       K+  K++V C H+W+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTKGRHMWTK-----KDAGKKVVPCTHNWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEINMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|403269836|ref|XP_003926916.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Saimiri boliviensis boliviensis]
          Length = 359

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 102/189 (53%), Gaps = 14/189 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED+  I +   T CK   C K Y      RG E  E  C+YHSG P+FHEG K W
Sbjct: 139 EYKKEEDNDEIKIG--TSCKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGIKYW 190

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 191 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 245

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID + S   +  TK+EI +++A
Sbjct: 246 KNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITVRQA 305

Query: 236 NGISWPSLK 244
             + W SL+
Sbjct: 306 EPMQWASLE 314



>gi|348565659|ref|XP_003468620.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Cavia porcellus]
          Length = 332

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 99/188 (52%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K      S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSLPDLSRVEANSTSLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEISMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|354498594|ref|XP_003511400.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Cricetulus griseus]
 gi|344240723|gb|EGV96826.1| Cysteine and histidine-rich domain-containing protein 1 [Cricetulus
           griseus]
          Length = 332

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 99/187 (52%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y        +  +  C+YHSG P+FHEG K WS
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY-----QGLQSLDEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHDW+QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAK 248

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 249 NSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 308

Query: 237 GISWPSL 243
            + W SL
Sbjct: 309 PMQWASL 315



>gi|512874918|ref|XP_004893558.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X2 [Heterocephalus glaber]
 gi|513013777|ref|XP_004868247.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X2 [Heterocephalus glaber]
          Length = 313

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 100/188 (53%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHMWTE-----KDSGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K      S V      L+V +    EK+F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 229 KNSLPDLSRVEANSTSLNVHIVFEGEKQFHQNVKLWGVIDVKRSYVTMTATKIEITMRKA 288

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 289 EPMQWASL 296



>gi|328714834|ref|XP_001946683.2| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Acyrthosiphon pisum]
          Length = 349

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 107/212 (50%), Gaps = 12/212 (5%)

Query: 35  PKISYTQTISKTITEEPKLAPIEK-EPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           P I+   TIS T  ++     I      E   +  +A  T CK   C + Y       G+
Sbjct: 109 PLINIKPTISSTHLQQMTATAISNTNGNETSSSTDIAIGTMCKNNGCKQAY----EGAGK 164

Query: 94  GPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
           G    C +H G P+FHEG K WSCC++K  +F  FL+  GC +GKH ++   KE K   +
Sbjct: 165 G-NLSCDHHPGIPIFHEGMKYWSCCNKKTSDFNAFLEQVGCSQGKHCWI---KETK--IQ 218

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMP-DEKRFITTYPLYQ 212
               CR DW+QT   +++SIFAKK D   S V     +L V+L  P D   F     LY 
Sbjct: 219 GHTNCRLDWHQTGPWVVISIFAKKYDPNTSFVKLSPVKLSVELNFPFDNSVFSKNMELYG 278

Query: 213 LIDKENSTFEILTTKVEIKLKKANGISWPSLK 244
           ++D   S   +  TKVEIKLKKA  +SW  L+
Sbjct: 279 IVDVNTSCVAMFPTKVEIKLKKAEAVSWGLLE 310



>gi|512874914|ref|XP_004893557.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X1 [Heterocephalus glaber]
 gi|513013775|ref|XP_004868246.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X1 [Heterocephalus glaber]
 gi|351705780|gb|EHB08699.1| Cysteine and histidine-rich domain-containing protein 1
           [Heterocephalus glaber]
          Length = 332

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/188 (37%), Positives = 100/188 (53%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTE-----KDSGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K      S V      L+V +    EK+F     L+ +ID + S   +  TK+EI ++KA
Sbjct: 248 KNSLPDLSRVEANSTSLNVHIVFEGEKQFHQNVKLWGVIDVKRSYVTMTATKIEITMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|511887716|ref|XP_004763624.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X2 [Mustela putorius furo]
 gi|511955543|ref|XP_004796097.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X2 [Mustela putorius furo]
          Length = 313

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 171

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC +K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 172 YWSCCRKKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 226

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++
Sbjct: 227 YAKNSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEITMR 286

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 287 KAEPMQWASL 296



>gi|511887714|ref|XP_004763623.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X1 [Mustela putorius furo]
 gi|511955541|ref|XP_004796096.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X1 [Mustela putorius furo]
          Length = 332

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 99/190 (52%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E + EED   I +   T CK   C K Y        +GP   E  C+YHSG P+FHEG K
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY--------QGPQSLEEVCVYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC +K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCRKKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISV 245

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++
Sbjct: 246 YAKNSLPELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEITMR 305

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 306 KAEPMQWASL 315



>gi|195504892|ref|XP_002099274.1| GE23458 [Drosophila yakuba]
 gi|194185375|gb|EDW98986.1| GE23458 [Drosophila yakuba]
          Length = 353

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 105/203 (51%), Gaps = 19/203 (9%)

Query: 50  EPKLAPIEKE-------PEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           +P +AP  KE       P     +  +   T CK   C   +   ++  GE     C YH
Sbjct: 109 QPAVAPALKEIVFAAKTPAVQKSSDAIEVGTSCKNNGCTYSFTGTSSDFGE-----CTYH 163

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G P+FHEG K WSCC ++  +F +F+  KGC  G+H +V      +N +K++VQCR+DW
Sbjct: 164 PGVPIFHEGMKFWSCCQKRTSDFAQFMAQKGCAYGEHKWVK-----ENDDKKVVQCRYDW 218

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMP--DEKRFITTYPLYQLIDKENST 220
           +QT T+++++I+AKK D   S V      L V L  P  D  RF     L  +++  N++
Sbjct: 219 HQTATNVVVAIYAKKYDYSQSVVELNPIRLHVYLVFPEQDNARFDLDLELRGIVNVSNAS 278

Query: 221 FEILTTKVEIKLKKANGISWPSL 243
             +  TKVEI L K    SW +L
Sbjct: 279 AHMFGTKVEITLPKLEPGSWSNL 301



>gi|308322439|gb|ADO28357.1| cysteine and histidine-rich domain-containing protein 1 [Ictalurus
           furcatus]
          Length = 347

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 94/171 (54%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K +     S  E  E  C+YH+G P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCTKTF-----SGTESNEEVCLYHAGVPIFHEGMKYWSCCKRKTSDFNTFLSQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC KGKHL+       K++ K++V CR DW+QT + + ++++AK    + S V     +L
Sbjct: 210 GCTKGKHLW-----RKKDMGKKVVPCRFDWHQTGSQVTITVYAKNSIPELSHVDANSTQL 264

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           D+ +    +K F     L+ +ID   ST  ++  K+EI LKKA  + W  L
Sbjct: 265 DIHIIFDGDKEFEQKIILWGVIDTSKSTLNMMAAKIEIVLKKAEPMFWARL 315



>gi|318054646|ref|NP_001188062.1| cysteine and histidine-rich domain-containing protein 1 [Ictalurus
           punctatus]
 gi|308324723|gb|ADO29496.1| cysteine and histidine-rich domain-containing protein 1 [Ictalurus
           punctatus]
          Length = 347

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 94/171 (54%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K +     S  E  E  C+YH+G P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCTKTF-----SGTESNEEVCLYHAGVPIFHEGMKYWSCCKRKTSDFNTFLSQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC KGKHL+       K++ K++V CR DW+QT + + ++++AK    + S V     +L
Sbjct: 210 GCTKGKHLW-----RKKDMGKKVVPCRFDWHQTGSQVTITVYAKNSIPELSHVDANSTQL 264

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           D+ +    +K F     L+ +ID   ST  ++  K+EI LKKA  + W  L
Sbjct: 265 DIHIIFDGDKEFEQKIILWGVIDTSKSTLNMMAAKIEIVLKKAEPMFWARL 315



>gi|505788594|ref|XP_004605239.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Sorex araneus]
          Length = 331

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 96/183 (52%), Gaps = 12/183 (6%)

Query: 61  EEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSR 120
           EED   I V   T CK   C K Y        +  E  C+YHSG P+FHEG K WSCC R
Sbjct: 145 EEDSDEIKVG--TSCKNSGCSKTY-----QGLQSLEEVCVYHSGVPIFHEGMKYWSCCRR 197

Query: 121 KVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDK 180
           K  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++AK    
Sbjct: 198 KTSDFNTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYAKNSLP 252

Query: 181 QNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
           + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA  + W
Sbjct: 253 ELSQVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQW 312

Query: 241 PSL 243
            SL
Sbjct: 313 ASL 315



>gi|348518674|ref|XP_003446856.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Oreochromis niloticus]
          Length = 342

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 94/174 (54%), Gaps = 16/174 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K +        EGP ++   C+YH+G P+FHEG K WSCC RK  +F  FL
Sbjct: 155 TSCKNGGCTKSF--------EGPASDSDVCLYHAGFPIFHEGMKYWSCCKRKTSDFNTFL 206

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
             +GC KG HL+       K+  K++V CR DW+QT T +I+SI+AK    + S V    
Sbjct: 207 SQEGCTKGTHLW-----RKKDAGKKVVPCRFDWHQTGTQVIISIYAKNAVPELSYVDANS 261

Query: 190 KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
             L++ +    EK F     L+ +ID   S   ++  K+E+ +KK+  +SW  L
Sbjct: 262 TTLNIHIIFDGEKEFEQKISLWGVIDVSKSLVNMMAAKIEVAMKKSEAMSWARL 315



>gi|195331552|ref|XP_002032465.1| GM26571 [Drosophila sechellia]
 gi|194121408|gb|EDW43451.1| GM26571 [Drosophila sechellia]
          Length = 364

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 105/203 (51%), Gaps = 19/203 (9%)

Query: 50  EPKLAPIEKE-------PEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYH 102
           +P +AP  KE       P     +  +   T CK   C   +  + +  GE     C YH
Sbjct: 108 QPTVAPALKEIVFAAKTPAAQKSSDAIEVGTTCKNNGCTYSFTGNNSDFGE-----CTYH 162

Query: 103 SGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDW 162
            G P+FHEG K WSCC ++  +F +F+  KGC  G+H +V      +N +K++VQCR+DW
Sbjct: 163 PGVPIFHEGLKFWSCCQKRTSDFAQFMAQKGCTYGEHKWVK-----ENDDKKVVQCRYDW 217

Query: 163 YQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMP--DEKRFITTYPLYQLIDKENST 220
           +QT T+++++I+AKK D   S +      L V+L  P  D  RF     L  +++  N+ 
Sbjct: 218 HQTATNVVVAIYAKKYDYSQSVIELNPIRLHVNLVFPEQDNARFDLDLELRGIVNVSNAN 277

Query: 221 FEILTTKVEIKLKKANGISWPSL 243
             +  TKVEI L K    SW +L
Sbjct: 278 AHMYGTKVEITLPKLEPGSWSNL 300



>gi|410972473|ref|XP_003992683.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Felis catus]
          Length = 332

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 99/188 (52%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  +  C+YHSG P+FHEG K W
Sbjct: 141 ENKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLDEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++KA
Sbjct: 248 KNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEITMRKA 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|291384094|ref|XP_002708685.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Oryctolagus cuniculus]
          Length = 331

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 91/171 (53%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        E  E  C+YHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCSKTYQGQ-----ESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  GKHL+       K+  K++V CRHDW+QT   + +S++AK    + S V      L
Sbjct: 210 GCTTGKHLWTK-----KDDGKKVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLL 264

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           +V +    EK F     L+ +ID + S   +  TK+EI ++KA  + W SL
Sbjct: 265 NVHIVFEREKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASL 315



>gi|195573393|ref|XP_002104678.1| GD21075 [Drosophila simulans]
 gi|194200605|gb|EDX14181.1| GD21075 [Drosophila simulans]
          Length = 354

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 97/173 (56%), Gaps = 12/173 (6%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C   +  +++  GE     C YH G P+FHEG K WSCC ++  +F +F+  K
Sbjct: 138 TTCKNNGCTYSFTGNSSDFGE-----CTYHPGVPIFHEGLKFWSCCQKRTSDFAQFMAQK 192

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  G+H +V      +N +K++VQCR+DW+QT T+++++I+AKK D   S +      L
Sbjct: 193 GCTYGEHKWVK-----ENDDKKVVQCRYDWHQTATNVVVAIYAKKYDYSQSVIELNPIRL 247

Query: 193 DVDLKMP--DEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
            V+L  P  D  +F     L  +++  N++  +  TKVEI L K    SW +L
Sbjct: 248 HVNLVFPEQDNAKFDLDLELRGIVNVSNASAHMYGTKVEITLPKLEPGSWSNL 300



>gi|260789534|ref|XP_002589801.1| hypothetical protein BRAFLDRAFT_125901 [Branchiostoma floridae]
 gi|229274984|gb|EEN45812.1| hypothetical protein BRAFLDRAFT_125901 [Branchiostoma floridae]
          Length = 324

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 109/193 (56%), Gaps = 10/193 (5%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEG 111
           K  P E+E  E+ +   V+  T CK  +C K + D+ ++     E +C YH GTP FHEG
Sbjct: 128 KQKPSEEESAENAVAGGVSLGTTCKNNACKKTFEDENSN-----EEDCWYHPGTPTFHEG 182

Query: 112 SKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIM 171
            K WSCC+++  +F EFL   GC KGKH+++   KE +   K++  CR DW+QT   +++
Sbjct: 183 YKFWSCCTKRTTDFNEFLSQAGCSKGKHVWI---KEEEGDTKKVA-CRFDWHQTGALVVI 238

Query: 172 SIFAKKVDKQNSSVTFREKELDVDLKMPD-EKRFITTYPLYQLIDKENSTFEILTTKVEI 230
           SI+AK  D + + V   +  + +++       +F     L  +ID E ST  +L TKVE+
Sbjct: 239 SIYAKVCDPEKTFVEANKVRVKMNVVFDQGNSQFQQDVILRGMIDVEKSTVNLLGTKVEV 298

Query: 231 KLKKANGISWPSL 243
           K++K    SW SL
Sbjct: 299 KMRKLEPGSWASL 311



>gi|410972475|ref|XP_003992684.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Felis catus]
          Length = 313

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 99/188 (52%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  +  C+YHSG P+FHEG K W
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLDEVCVYHSGVPIFHEGMKYW 173

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 174 SCCRRKTSDFNTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 228

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K    + S V      L+V +    EK F     L+ +ID   S   +  TK+EI ++KA
Sbjct: 229 KNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTATKIEITMRKA 288

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 289 EPMQWASL 296



>gi|380020848|ref|XP_003694289.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Apis florea]
          Length = 341

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 115/215 (53%), Gaps = 24/215 (11%)

Query: 35  PKISYTQTISKTITEEPK--LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG 92
           P+++ T  +S  + E+ K  ++ + K   +  + I       CK  SC   Y        
Sbjct: 112 PQMTLTPNVSPNLLEQIKGLISNVSKTTFDTKVQI----GQSCKNNSCKATY-------- 159

Query: 93  EGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVK 149
            GP +E   C +H GTP+FHEG K WSCC +K  +F  FL+  GC +GKH+++      K
Sbjct: 160 NGPASEDEICNHHPGTPIFHEGMKYWSCCQKKTTDFSTFLEQPGCTQGKHIWIS-----K 214

Query: 150 NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEK-RFITTY 208
           N +K+ V+CR DW+QT + +++SI+AKK +   S V      L VDL   +E  R+    
Sbjct: 215 NTDKK-VKCRMDWHQTGSFVVVSIYAKKYEPDQSFVKLNPIRLSVDLFFIEENSRYNLDI 273

Query: 209 PLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
            L  ++D   S+  +L TKVEIKLKKA   SW  L
Sbjct: 274 ELRGIVDVTQSSVNMLPTKVEIKLKKAESGSWAKL 308



 Score = 73.6 bits (179), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 42/70 (60%), Gaps = 5/70 (7%)

Query: 70  ASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           A+   C    CGKK+  D     EG   +CIYH G P+FH+  KGWSCC++K  +F EFL
Sbjct: 5   ATLLHCYNRGCGKKF--DPNDNKEG---DCIYHPGHPIFHDAYKGWSCCNKKCTDFTEFL 59

Query: 130 KIKGCKKGKH 139
            IKGC K  H
Sbjct: 60  NIKGCAKSCH 69



>gi|41056073|ref|NP_956633.1| cysteine and histidine-rich domain-containing protein 1 [Danio
           rerio]
 gi|82188263|sp|Q7T3F7.1|CHRD1_DANRE RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           AltName: Full=Morgana
 gi|31419419|gb|AAH53137.1| Cysteine and histidine-rich domain (CHORD)-containing, zinc binding
           protein 1 [Danio rerio]
          Length = 341

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 100/186 (53%), Gaps = 14/186 (7%)

Query: 58  KEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSC 117
           KE + D++ I     T CK   C K +   A+      +  C+YH+G P+FHEG K WSC
Sbjct: 142 KEEDSDEIKI----GTSCKNGGCCKTFAGQASD-----DETCLYHAGVPIFHEGMKYWSC 192

Query: 118 CSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKK 177
           C RK  +F  FL  +GC +GKH +     + K+  K++V CR DW+QT + +I+SI+AK 
Sbjct: 193 CKRKTSDFNTFLSQEGCTRGKHQW-----KKKDAGKKVVPCRFDWHQTGSQVIISIYAKN 247

Query: 178 VDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANG 237
              + S V      L + +    EK F     L+ +ID   S   ++ TK+EI LKKA  
Sbjct: 248 SVPELSLVEGNSTVLKIHIIFEGEKEFEKQISLWGVIDPSKSLVNMMATKIEIVLKKAEP 307

Query: 238 ISWPSL 243
           +SW  L
Sbjct: 308 MSWARL 313



>gi|149635154|ref|XP_001512381.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Ornithorhynchus anatinus]
          Length = 336

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 93/174 (53%), Gaps = 16/174 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K Y        +GP   E  CI+HSG P+FHEG K WSCC RK  +F  FL
Sbjct: 156 TSCKNGGCSKTY--------QGPQSLEEVCIFHSGVPIFHEGMKYWSCCRRKTSDFNTFL 207

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
             +GC  GKHL++      K+  K+++ CRHDW+QT   + +SI+AK    + S V    
Sbjct: 208 AQEGCTTGKHLWIK-----KDAGKKVIPCRHDWHQTGGEVTISIYAKNSLPELSHVEANS 262

Query: 190 KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
             L++ +    EK F     L+ +ID + S   +  TK+EI +KKA  + W  L
Sbjct: 263 TLLNIHIVFEGEKEFHQHVKLWGVIDVKRSCVNMTATKIEISMKKAEPMLWARL 316



>gi|68448475|ref|NP_001020346.1| cysteine and histidine-rich domain-containing protein 1 [Danio
           rerio]
 gi|67678096|gb|AAH97168.1| Zgc:114108 [Danio rerio]
          Length = 339

 Score =  123 bits (309), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 90/175 (51%), Gaps = 11/175 (6%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           V   T CK   C K Y    T      E  C+YHSG P+FHEG K WSCC RK  +F  F
Sbjct: 153 VKVGTACKNGGCMKTYNGPKTD-----EEMCLYHSGVPIFHEGMKYWSCCKRKTSDFNTF 207

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
           L  +GC KG H +       K+   ++  CR DW+QT + + +SI+AK  + Q  SV   
Sbjct: 208 LSQEGCNKGSHQW------RKDTGNKVAPCRFDWHQTGSQVTLSIYAKNSNPQLCSVEAN 261

Query: 189 EKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
              L V L    EK F  +  L+ +ID   S   ++ +KVE+ +KKA  +SW  L
Sbjct: 262 SVSLKVHLIFEGEKEFELSLSLWGVIDVSKSVVNMMASKVEVVMKKAEPMSWARL 316



>gi|66507739|ref|XP_395533.2| PREDICTED: cysteine and histidine-rich domain-containing protein
           [Apis mellifera]
          Length = 341

 Score =  123 bits (308), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 114/213 (53%), Gaps = 20/213 (9%)

Query: 35  PKISYTQTISKTITEEPK--LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG 92
           P+++ T  +S  + E+ K  ++ + K   +  + I       CK  SC       AT  G
Sbjct: 112 PQMTLTPNVSPNLLEQIKGLISNVSKSTFDTKIQI----GQSCKNNSC------KATYNG 161

Query: 93  EGPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNV 151
              E E C +H GTP+FHEG K WSCC +K  +F  FL+  GC +GKH+++      KN 
Sbjct: 162 PASENEICNHHPGTPIFHEGMKYWSCCQKKTTDFSTFLEQPGCTQGKHIWIS-----KNT 216

Query: 152 EKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEK-RFITTYPL 210
           +K+ V+CR DW+QT + +++SI+AKK     S +      L VDL   +E  R+     L
Sbjct: 217 DKK-VKCRMDWHQTGSFVVVSIYAKKYQPDQSFIKLNPIRLSVDLFFIEENSRYNLDIEL 275

Query: 211 YQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
             ++D   S+  +L TKVEIKLKKA   SW  L
Sbjct: 276 RGIVDVTQSSVNMLPTKVEIKLKKAESGSWAKL 308



 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 5/70 (7%)

Query: 70  ASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           A+   C    CGKK+  D     EG   +CIYH G PVFH+  KGWSCC++K  +F EFL
Sbjct: 5   ATLLHCYNRGCGKKF--DPNDNKEG---DCIYHPGHPVFHDAYKGWSCCNKKCTDFTEFL 59

Query: 130 KIKGCKKGKH 139
            IKGC K  H
Sbjct: 60  NIKGCAKSCH 69



>gi|327287046|ref|XP_003228240.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Anolis carolinensis]
          Length = 367

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 115/219 (52%), Gaps = 15/219 (6%)

Query: 35  PKISYTQTISKTI---TEEPKLAPIEKEPEEDDLN--IPVASDTECKRPSCGKKYVDDAT 89
           PK      +SKT+    E+  L+P E+   +D     + V+  T CK   C   +    +
Sbjct: 101 PKQLLPVKVSKTLEQSLEKLDLSPKEEAAGQDSAGAALEVSLGTTCKNSGCKATFQGQES 160

Query: 90  SRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVK 149
           +R       C +H G PVFHEG K WSCC  K  +F  FL+ KGC +G+HL++      K
Sbjct: 161 NR-----ETCTFHPGVPVFHEGMKYWSCCRIKPTDFNAFLEQKGCSRGRHLWIK-----K 210

Query: 150 NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYP 209
             +K +V CR DW+QT + ++++++AK    + SSV      +DV +    +K F     
Sbjct: 211 QQDKRLVSCRQDWHQTSSQVVITVYAKTPLPELSSVKANRTTVDVHIVFEGDKVFQAELE 270

Query: 210 LYQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDEN 248
           L+ +I+ + S   +L +KVEI L+KA  ++W  L+  ++
Sbjct: 271 LWGVINVQKSAVSLLPSKVEITLQKAPPLTWARLEHPQS 309



>gi|6581056|gb|AAF18437.1|AF192466_1 CHORD containing protein-1 [Homo sapiens]
          Length = 332

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 99/187 (52%), Gaps = 12/187 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED+  I +   T CK   C K Y        E  E  C+YHSG P+FHEG K WS
Sbjct: 141 ENKKEEDNDEIKIG--TSCKNGGCSKTY-----QGLESLEEVCVYHSGVPIFHEGMKYWS 193

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F  FL  +GC KGKH++       K+  K++V CRHD +QT   + +S++AK
Sbjct: 194 CCRRKTSDFNTFLAQEGCTKGKHMWTK-----KDAGKKVVPCRHDLHQTGGEVTISVYAK 248

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++KA 
Sbjct: 249 NSLPELSRVEANSTLLNVIIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKIEITMRKAE 308

Query: 237 GISWPSL 243
            + W SL
Sbjct: 309 PMQWASL 315



>gi|395814695|ref|XP_003780879.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Otolemur garnettii]
          Length = 332

 Score =  122 bits (307), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 99/188 (52%), Gaps = 14/188 (7%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGW 115
           E + EED   I +   T CK   C K Y      +G +  E  C+YHSG P+FHEG K W
Sbjct: 141 EDKKEEDSDEIKIG--TSCKNGGCSKTY------QGLQSLEEVCVYHSGVPIFHEGMKYW 192

Query: 116 SCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFA 175
           SCC RK  +F  FL  +GC  GKH++       K+  K++V CRHDW+QT   + +S++A
Sbjct: 193 SCCRRKTSDFNTFLAQEGCTTGKHMWTK-----KDAGKKVVPCRHDWHQTGGEVTISVYA 247

Query: 176 KKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKA 235
           K      S V      L+V +    EK F     L+ +ID + S   +  TK+EI ++K+
Sbjct: 248 KNSLPDLSRVEANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKS 307

Query: 236 NGISWPSL 243
             + W SL
Sbjct: 308 EPMQWASL 315



>gi|224043653|ref|XP_002186547.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Taeniopygia guttata]
          Length = 331

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 98/190 (51%), Gaps = 18/190 (9%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           E   EED   I +   T CK   C K Y        EGP   E  CIYHSG P+FHEG K
Sbjct: 141 EGRKEEDGDEIKIG--TACKNSGCSKTY--------EGPHSTEEVCIYHSGVPIFHEGMK 190

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC +G H++       K+   ++V CRHDW+QT   + +S+
Sbjct: 191 YWSCCKRKTSDFNTFLAQEGCTRGTHVWTK-----KDAGTKVVPCRHDWHQTGGEVTVSV 245

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK      S V      +++ +    EK F  +  L+ +ID + S   +  TK+E+ ++
Sbjct: 246 YAKNSVPDQSYVEANSTMVNIHIVFEGEKEFHRSVKLWGVIDVKRSYVNMTATKIELTMR 305

Query: 234 KANGISWPSL 243
           KA  + W SL
Sbjct: 306 KAEPLLWASL 315



>gi|395520569|ref|XP_003764400.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Sarcophilus harrisii]
          Length = 366

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 100/190 (52%), Gaps = 20/190 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           +K+ + D++ I     T CK   C K Y        +GP   E  CI+HSG P+FHEG K
Sbjct: 177 KKDEDSDEIKI----GTSCKNGGCVKTY--------QGPQSIEEVCIFHSGVPIFHEGMK 224

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC RK  +F  FL  +GC  GKHL+       K+  K++V CRHDW+QT   + +S+
Sbjct: 225 YWSCCRRKTSDFNTFLAQEGCTTGKHLWTK-----KDAGKKVVPCRHDWHQTGGQVTISV 279

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLK 233
           +AK    + S V      L++ +    EK F     L+ +ID + S   +  TK+EI ++
Sbjct: 280 YAKNSLPELSHVKANSTVLNIHIVFEGEKEFHQNVKLWGVIDVKRSFVNMTATKIEITMR 339

Query: 234 KANGISWPSL 243
           KA  + W  L
Sbjct: 340 KAEPMQWARL 349



>gi|195444282|ref|XP_002069796.1| GK11385 [Drosophila willistoni]
 gi|194165881|gb|EDW80782.1| GK11385 [Drosophila willistoni]
          Length = 366

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 95/173 (54%), Gaps = 12/173 (6%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C   Y   ++  GE     C YH G P+FHEG K WSCC ++  +F +F+  K
Sbjct: 144 TTCKNSGCTYTYTGTSSDYGE-----CNYHPGVPIFHEGMKFWSCCQKRTSDFAQFMAQK 198

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  G+H +V       N +K++VQCRHDW+QT T+++++I+AKK     S V      L
Sbjct: 199 GCVYGQHKWVND-----NEDKKVVQCRHDWHQTATNVVVTIYAKKYHYAQSIVEVNPIRL 253

Query: 193 DVDLKMPDEK--RFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
            V+L  P+++  +F     L  +ID + ++  +  TK+EI L K    SW  L
Sbjct: 254 HVNLVFPEQENAQFNLDLELRGIIDVDKASAHMYGTKIEITLPKKEPGSWTKL 306



>gi|326427601|gb|EGD73171.1| hypothetical protein PTSG_04884 [Salpingoeca sp. ATCC 50818]
          Length = 305

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 114/221 (51%), Gaps = 18/221 (8%)

Query: 28  VEIYDSGPKISYTQTISKTITEE-PKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVD 86
            ++ D+ PK+     ++ ++     K    + E E D+    V     C   +C   YVD
Sbjct: 98  AQVRDAAPKVDLDVKVTPSLERALEKFRARQAEEETDE----VKPGQPCTNNACNATYVD 153

Query: 87  DATSRGEGPEAECIYHSGTPVFHEGSKGWSCC-SRKVLEFEEFLKIKGCKKGKHLFVGSG 145
           + ++     E EC+YH G PVFHEG K WSCC  +K  EF+EFL+ KGC  GKH +V   
Sbjct: 154 EMSN-----EEECLYHPGAPVFHEGYKYWSCCPKKKTYEFDEFLEFKGCTTGKHCWV--- 205

Query: 146 KEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFI 205
              K    ++ +CRHDW+Q+   + +SI+AK +D +  SV      L VD+   D  ++ 
Sbjct: 206 ---KPKTAQVRKCRHDWFQSDDRVSVSIYAKCIDPEKCSVKANSDSLTVDIVYEDINKYT 262

Query: 206 TTYPLYQLIDKENSTFEILTTKVEIKLKKAN-GISWPSLKS 245
               L   ID   S+  +  TK+++ L KA+ G +W  L++
Sbjct: 263 MELHLGGKIDPSKSSATLTGTKLDLNLVKASPGDTWADLEA 303



>gi|504145632|ref|XP_004585237.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           [Ochotona princeps]
          Length = 331

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 90/171 (52%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  C+YHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCSKTYQGQ-----QSLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  GKH++       K+  K++V CRHDW+QT   + +SI+AK    + S V      L
Sbjct: 210 GCTTGKHMWTK-----KDDGKKVVPCRHDWHQTGGEVTISIYAKNSLPELSRVEANSTLL 264

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
            V +    EK F     L+ +ID + S   +  TK+EI ++KA  + W SL
Sbjct: 265 SVHIVFEREKEFHQNVKLWGVIDVKRSYVTMTATKIEIIMRKAEPMQWASL 315



>gi|357622949|gb|EHJ74291.1| hypothetical protein KGM_22001 [Danaus plexippus]
          Length = 352

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 110/222 (49%), Gaps = 25/222 (11%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEP---EEDDLNIP----VASDTECKRPSCGKKYVD 86
           GPK+      S+ +T EP++A   KE     ++++  P    +A  T CK   C   Y  
Sbjct: 100 GPKLDRPPFESQLVTLEPRIADALKEAVYKAKENVAAPNDGTIAIGTSCKNGGCNISY-- 157

Query: 87  DATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVG 143
                 EGP ++   C YH G PVFHEG K W+CC ++  +F  FL   GC  G H ++ 
Sbjct: 158 ------EGPHSDNTICTYHPGCPVFHEGLKFWTCCQKRTTDFNTFLNQPGCTTGTHKWLK 211

Query: 144 SGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKR 203
                ++     V+CR DW+QTP ++I+S++AKK D   S V      L+  L    E  
Sbjct: 212 -----ESAPAGTVKCRWDWHQTPEYVIVSVYAKKYDPFTSHVKLNPIRLNTKLVFQQEGN 266

Query: 204 --FITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
             F     L  ++D   ST  +L TKVEIKLKKA   +W  L
Sbjct: 267 AVFELDLELRGVVDVSKSTVSMLGTKVEIKLKKAEPGAWAKL 308



>gi|363732737|ref|XP_420200.3| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X3 [Gallus gallus]
          Length = 379

 Score =  121 bits (303), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 114/222 (51%), Gaps = 21/222 (9%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEED---DLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           I  ++++ + + E+  L+P  KEP+ D   +    V + T CK  +C   Y        +
Sbjct: 116 IKVSRSLEQAL-EKLSLSPNNKEPKGDCTGEAAAQVRAGTTCKNATCKAIY--------Q 166

Query: 94  GPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKN 150
           GPE+    C +H G PVFHEG K WSCC  +  +F  FL+  GC  G+H ++G       
Sbjct: 167 GPESNTEVCTFHPGVPVFHEGMKYWSCCGIRTTDFSAFLEQPGCSTGRHCWMG------K 220

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPL 210
            +K+ V CR DW+QT + ++++I+ K      SSV      L+V +     K F     L
Sbjct: 221 ADKKAVSCRQDWHQTSSQVVVTIYGKNPLPTLSSVKANRTVLEVHVIFEGNKIFQAELDL 280

Query: 211 YQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDENLGIA 252
           + +I+ E S   ++ TKVEI L+KAN  +W  L+  ++   A
Sbjct: 281 WGVIEAEKSFVSMVPTKVEITLRKANPGAWARLEHPQSKACA 322



>gi|344287779|ref|XP_003415630.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Loxodonta africana]
          Length = 313

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 89/171 (52%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  C+YHSG PVFHEG K WSCC RK  +F  FL  +
Sbjct: 136 TPCKNGGCSKTY-----QSLQSLEEICVYHSGVPVFHEGMKYWSCCRRKTSDFNTFLAQE 190

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  GKHL+       K+   ++V CRHDW+QT   + +SI+AK      S V      L
Sbjct: 191 GCTTGKHLWTK-----KDAGGKVVPCRHDWHQTGGEVTISIYAKNSLPDLSRVEANSTLL 245

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           +V +    EK F     L+ +ID + S   +  TK+EI ++KA  + W SL
Sbjct: 246 NVLIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASL 296



>gi|291227043|ref|XP_002733497.1| PREDICTED: cysteine and histidine-rich domain (CHORD)-containing,
           zinc-binding protein 1-like [Saccoglossus kowalevskii]
          Length = 320

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 98/173 (56%), Gaps = 13/173 (7%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           V   T CK   CG+ Y D++++        C++H G PVFHEG K WSCC RK  +F+ F
Sbjct: 148 VKVGTICKNGGCGQPYQDESSNFNS-----CVHHPGVPVFHEGMKYWSCCQRKTSDFDNF 202

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
           L+  GC  GKHL++      K+ +K +  CR+DW+QT   + +S+FAK    Q + V   
Sbjct: 203 LQQAGCSNGKHLWIK-----KDFKKTL--CRYDWHQTGNFVFISVFAKVACPQLTYVEAN 255

Query: 189 EKELDVDLKM-PDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISW 240
           +  + + +    +E  F     LY +ID + ST  +L TKVE+KL+K+  +SW
Sbjct: 256 QTSVFISIVFGKEENHFQEEIELYGVIDPKQSTVTMLGTKVEVKLRKSEVVSW 308



>gi|513180394|ref|XP_004940688.1| PREDICTED: cysteine and histidine-rich domain-containing protein 1
           isoform X4 [Gallus gallus]
          Length = 445

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 114/222 (51%), Gaps = 21/222 (9%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEED---DLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           I  ++++ + + E+  L+P  KEP+ D   +    V + T CK  +C   Y        +
Sbjct: 182 IKVSRSLEQAL-EKLSLSPNNKEPKGDCTGEAAAQVRAGTTCKNATCKAIY--------Q 232

Query: 94  GPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKN 150
           GPE+    C +H G PVFHEG K WSCC  +  +F  FL+  GC  G+H ++G       
Sbjct: 233 GPESNTEVCTFHPGVPVFHEGMKYWSCCGIRTTDFSAFLEQPGCSTGRHCWMG------K 286

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPL 210
            +K+ V CR DW+QT + ++++I+ K      SSV      L+V +     K F     L
Sbjct: 287 ADKKAVSCRQDWHQTSSQVVVTIYGKNPLPTLSSVKANRTVLEVHVIFEGNKIFQAELDL 346

Query: 211 YQLIDKENSTFEILTTKVEIKLKKANGISWPSLKSDENLGIA 252
           + +I+ E S   ++ TKVEI L+KAN  +W  L+  ++   A
Sbjct: 347 WGVIEAEKSFVSMVPTKVEITLRKANPGAWARLEHPQSKACA 388



>gi|471418084|ref|XP_004390542.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Trichechus manatus latirostris]
          Length = 313

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 90/171 (52%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  CIYHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 136 TSCKNGGCSKTY-----QGLQSLEEICIYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQE 190

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  GKH++       K+   ++V CRHDW+QT   + +SI+AK    + S V      L
Sbjct: 191 GCTTGKHMWTK-----KDAGGKVVPCRHDWHQTGGEVTISIYAKNSLPELSRVEANSTLL 245

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           +V +    EK F     L+ +ID + S   +  TK+EI ++KA  + W SL
Sbjct: 246 NVLIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASL 296



>gi|483493278|gb|EOA93338.1| Cysteine and histidine-rich domain-containing protein 1, partial
           [Anas platyrhynchos]
          Length = 282

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 90/171 (52%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y    ++     E  CIYHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 108 TACKNAGCSKTYQGLHST-----EDVCIYHSGVPIFHEGMKYWSCCKRKTSDFNTFLAQE 162

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  G H++       K+  K++V CRHDW+QT   + +SI+AK      S V      L
Sbjct: 163 GCTTGTHVWTK-----KDAGKKVVPCRHDWHQTGGEVTISIYAKNSVPDLSYVEANSTML 217

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           ++ +    EK F     L+ +ID + S   +  TK+E+ ++KA  + W SL
Sbjct: 218 NIHIVFEGEKEFHRNVKLWGVIDVKRSYVNMTATKIEVTMRKAEPLLWASL 268



>gi|194746448|ref|XP_001955692.1| GF16113 [Drosophila ananassae]
 gi|190628729|gb|EDV44253.1| GF16113 [Drosophila ananassae]
          Length = 360

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 95/173 (54%), Gaps = 12/173 (6%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C   +   ++  GE     C YH G P+FHEG K WSCC ++  +F +F+  K
Sbjct: 143 TSCKNNGCTYSFTGTSSDFGE-----CTYHPGVPIFHEGMKFWSCCQKRTSDFAQFMAQK 197

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  G+H +V       N +K++VQCR+DW+QT T+++++I+AKK     S V      L
Sbjct: 198 GCAYGQHKWVKD-----NEDKKVVQCRYDWHQTATNVVVAIYAKKYHYAQSLVEINPIRL 252

Query: 193 DVDLKMPDEK--RFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
            V+L  P+++  RF     L  ++D + ++  +  TKVEI L K    SW  L
Sbjct: 253 HVNLVFPEQENARFDLDLELRGIVDVKKASAHMYGTKVEITLPKLEPGSWSKL 305



>gi|471418082|ref|XP_004390541.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Trichechus manatus latirostris]
          Length = 332

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 90/171 (52%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  CIYHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 155 TSCKNGGCSKTY-----QGLQSLEEICIYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  GKH++       K+   ++V CRHDW+QT   + +SI+AK    + S V      L
Sbjct: 210 GCTTGKHMWTK-----KDAGGKVVPCRHDWHQTGGEVTISIYAKNSLPELSRVEANSTLL 264

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           +V +    EK F     L+ +ID + S   +  TK+EI ++KA  + W SL
Sbjct: 265 NVLIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASL 315



>gi|344287777|ref|XP_003415629.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Loxodonta africana]
          Length = 332

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 89/171 (52%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  E  C+YHSG PVFHEG K WSCC RK  +F  FL  +
Sbjct: 155 TPCKNGGCSKTY-----QSLQSLEEICVYHSGVPVFHEGMKYWSCCRRKTSDFNTFLAQE 209

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  GKHL+       K+   ++V CRHDW+QT   + +SI+AK      S V      L
Sbjct: 210 GCTTGKHLWTK-----KDAGGKVVPCRHDWHQTGGEVTISIYAKNSLPDLSRVEANSTLL 264

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           +V +    EK F     L+ +ID + S   +  TK+EI ++KA  + W SL
Sbjct: 265 NVLIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKIEITMRKAEPMQWASL 315



>gi|449267899|gb|EMC78790.1| Cysteine and histidine-rich domain-containing protein 1 [Columba
           livia]
          Length = 361

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 113/216 (52%), Gaps = 18/216 (8%)

Query: 37  ISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPE 96
           I  ++T+ + + E+  L+  ++EPE       V + T CK  +C   Y        +GPE
Sbjct: 117 IKVSRTLEQAL-EKLNLSSKDEEPEGSCAAAQVRAGTTCKNTACKAIY--------QGPE 167

Query: 97  AE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEK 153
           +    C +H G PVFHEG K WSCC  K  +F  FL+  GC  G+H +   G      +K
Sbjct: 168 SNTEVCTFHPGVPVFHEGMKYWSCCGVKTTDFSAFLEQPGCSSGRHCWTVKG------DK 221

Query: 154 EIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQL 213
           + V CR DW+QT + ++++++AK     +SSV      L+V +     K F T   L+ +
Sbjct: 222 KAVSCRQDWHQTSSQMVVTVYAKNPLPAHSSVKANRTTLEVHIVFEGNKIFQTELDLWGV 281

Query: 214 IDKENSTFEILTTKVEIKLKKANGISWPSLKSDENL 249
           I+ E S   ++ TKVEI L KA+  SW  L+  ++L
Sbjct: 282 IEIEKSFVSMVPTKVEITLCKASPGSWARLELPQSL 317



>gi|512919933|ref|XP_004929505.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Bombyx mori]
          Length = 350

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 99/192 (51%), Gaps = 20/192 (10%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSK 113
           +K P  +D N+ +   T CK   C   +        EGP   E+ C YH G P+FHEG K
Sbjct: 132 QKTPVSEDGNVAIG--TSCKNGGCNTAF--------EGPQTNESLCTYHPGCPIFHEGLK 181

Query: 114 GWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSI 173
            WSCC ++  +F  FL   GC  G H +V   KE  N     VQCR DW+QTP H+I+S+
Sbjct: 182 FWSCCQKRTTDFNTFLNQPGCTTGAHKWV---KESSNA--GTVQCRWDWHQTPEHVIVSV 236

Query: 174 FAKKVDKQNSSVTFREKELDVDLKMPDE--KRFITTYPLYQLIDKENSTFEILTTKVEIK 231
           +AKK D   S V      L++ L   ++    F     L  +I+ E S+  +L TKVEIK
Sbjct: 237 YAKKYDPVLSYVKVNPIRLNIKLIFREQGDAAFELDLELRGVINIERSSASMLGTKVEIK 296

Query: 232 LKKANGISWPSL 243
           LKK    SW  L
Sbjct: 297 LKKGEPGSWSKL 308



>gi|321472345|gb|EFX83315.1| hypothetical protein DAPPUDRAFT_195101 [Daphnia pulex]
          Length = 355

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 99/173 (57%), Gaps = 12/173 (6%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           CK   C + YV+++++     ++ C YH+G P+FHEG K W+CC+R+  +F+ FL  +GC
Sbjct: 155 CKNGGCKQTYVNESSN-----DSTCTYHAGVPIFHEGLKYWTCCTRRTSDFQAFLDQEGC 209

Query: 135 KKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREK---E 191
             G H++    +E     K+ VQCR DW QT TH+I++I+ KK D  N S+T+ E     
Sbjct: 210 STGTHVWKTEKEEQI---KKSVQCRQDWMQTGTHVIVNIYCKKPDPTNDSLTYVEVNPIR 266

Query: 192 LDVDLKM-PDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           L V + +      + +   L  +ID  NS+      KVEIKLKKA  +SW  L
Sbjct: 267 LRVRINLFAGGPSYNSDIELRGIIDTVNSSVTFTPNKVEIKLKKAEPMSWNKL 319



>gi|488580804|ref|XP_004475845.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Dasypus novemcinctus]
          Length = 315

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 91/171 (53%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  +  C+YHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 138 TSCKNGGCSKTY-----QGLQSLDEICVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLSQE 192

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  GKH++       K+  +++V CRHDW+QT   + +SI+AK    + S V      L
Sbjct: 193 GCTTGKHVWTK-----KDAGEKVVPCRHDWHQTGGEVTISIYAKNSLPELSQVEANSTLL 247

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           +V +    EK F     L+ +ID + S   +  TK+EI ++KA  + W SL
Sbjct: 248 NVHIVFEGEKEFHQNVKLWGVIDVKRSYVSMTATKIEITMRKAEPMQWASL 298



>gi|410915800|ref|XP_003971375.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Takifugu rubripes]
          Length = 321

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 101/195 (51%), Gaps = 17/195 (8%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVF 108
           KL    +E ++DD +  V   T CK   C K +        +GP +    C YH G P+F
Sbjct: 116 KLTENAEETKDDDCD-EVKIGTACKNGGCTKSF--------DGPSSNSDVCSYHPGVPIF 166

Query: 109 HEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTH 168
           HEG K WSCC RK  +F  FL  +GC KG H++       K+ +K++  CR DW+QT + 
Sbjct: 167 HEGMKYWSCCKRKTSDFNTFLSQEGCIKGTHMW-----RKKDTDKKVAPCRFDWHQTGSQ 221

Query: 169 IIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKV 228
           +I+SI+AK    + S V      L+V +    EK F     L+ +ID   S   ++  K+
Sbjct: 222 VIISIYAKNAIPELSYVDANSTTLNVHVVFEGEKEFEQQISLWGVIDVSKSLVNMMAAKI 281

Query: 229 EIKLKKANGISWPSL 243
           E+ +KK+  +SW  L
Sbjct: 282 EVAMKKSEAMSWARL 296



>gi|405958045|gb|EKC24211.1| Cysteine and histidine-rich domain-containing protein 1
           [Crassostrea gigas]
          Length = 325

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 95/174 (54%), Gaps = 13/174 (7%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKI 131
           T CK   C   Y      +GE  + E C+YH G PVFHEG K WSCC+RK  EF++FL  
Sbjct: 152 TSCKNNGCKACY------QGEESDTEKCLYHPGYPVFHEGMKFWSCCNRKTSEFDQFLAQ 205

Query: 132 KGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKE 191
           +GC+ G HL++        VE E   CR DW+QTP+ + +SIFAK    +  S+T     
Sbjct: 206 EGCETGTHLWIKP-----EVEGEKKSCRFDWHQTPSTVSLSIFAKVAVPEKCSITVNRVR 260

Query: 192 LDVDLKMPDEKR-FITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLK 244
             + +     K  F     L + I  E S+ ++L TKVEI LKKA   SWP+L+
Sbjct: 261 CVIKIVFDGGKSLFEKDLVLREEIIPEKSSVKMLGTKVEINLKKAEAFSWPTLE 314



>gi|340713157|ref|XP_003395114.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Bombus terrestris]
          Length = 340

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 110/215 (51%), Gaps = 24/215 (11%)

Query: 35  PKISYTQTISKTITEEPK--LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRG 92
           P++S T  +S  + E+ K   + I +   E+ + I       CK  SC   Y        
Sbjct: 112 PQVSLTPDVSPALLEQIKGLTSNISQNICENKVQI----GQSCKNNSCKATY-------- 159

Query: 93  EGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVK 149
            GP ++   C +H G P+FHEG K WSCC +K  +F  FL+  GC +GKH ++      K
Sbjct: 160 NGPASDDEVCNHHPGVPIFHEGMKYWSCCQKKTTDFSTFLEQPGCAQGKHTWIS-----K 214

Query: 150 NVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEK-RFITTY 208
           N  K   +CR DW+QT T +++S++AKK     SS+      L VDL   +E  R+    
Sbjct: 215 NTGKR-AKCRMDWHQTGTFVVISVYAKKYQPDQSSIKLNPIRLTVDLFFVEENSRYNLDL 273

Query: 209 PLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
            L  +ID   S+  +L TKVEIKLKKA   SW  L
Sbjct: 274 ELRGIIDITQSSVNMLPTKVEIKLKKAEPGSWAKL 308



 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGKK+  D     EG   +CIYHSG PVFH+  KGWSCC++K  +F EFL IKGC
Sbjct: 10  CYNRGCGKKF--DPNDNKEG---DCIYHSGYPVFHDAYKGWSCCNKKCTDFTEFLNIKGC 64

Query: 135 KKGKH 139
            K  H
Sbjct: 65  VKSYH 69



>gi|410915798|ref|XP_003971374.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Takifugu rubripes]
          Length = 340

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 101/195 (51%), Gaps = 17/195 (8%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVF 108
           KL    +E ++DD +  V   T CK   C K +        +GP +    C YH G P+F
Sbjct: 135 KLTENAEETKDDDCD-EVKIGTACKNGGCTKSF--------DGPSSNSDVCSYHPGVPIF 185

Query: 109 HEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTH 168
           HEG K WSCC RK  +F  FL  +GC KG H++       K+ +K++  CR DW+QT + 
Sbjct: 186 HEGMKYWSCCKRKTSDFNTFLSQEGCIKGTHMW-----RKKDTDKKVAPCRFDWHQTGSQ 240

Query: 169 IIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKV 228
           +I+SI+AK    + S V      L+V +    EK F     L+ +ID   S   ++  K+
Sbjct: 241 VIISIYAKNAIPELSYVDANSTTLNVHVVFEGEKEFEQQISLWGVIDVSKSLVNMMAAKI 300

Query: 229 EIKLKKANGISWPSL 243
           E+ +KK+  +SW  L
Sbjct: 301 EVAMKKSEAMSWARL 315



>gi|336380423|gb|EGO21576.1| hypothetical protein SERLADRAFT_410180 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 300

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 92/156 (58%), Gaps = 22/156 (14%)

Query: 54  APIEKEP---EEDDLNIPVASDTECKRPSCGKKYVDDATSR-GEGPEAECIYHSGTPVFH 109
           AP E  P   EEDDL++PV +        CG  +V D  +R G G EA C YH  + + H
Sbjct: 114 APKEPAPVVEEEDDLSVPVQT-------GCGVAFVSDEVNRIGNGEEATCTYHPASSMTH 166

Query: 110 ---------EGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRH 160
                    E  KG+ CC R+VLEFEEFLKI+GCK+G+H+FV   K      +E  +CR 
Sbjct: 167 SLFSGKEASEMVKGYLCCKRRVLEFEEFLKIEGCKRGRHVFV--PKVSNKAAEEFTECRV 224

Query: 161 DWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDL 196
           D YQTP+ + +S+FAK+VDK+ S+V   E +  +DL
Sbjct: 225 DHYQTPSEVHVSVFAKQVDKERSTVRIEENKRTIDL 260



>gi|488580802|ref|XP_004475844.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Dasypus novemcinctus]
          Length = 334

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 91/171 (53%), Gaps = 10/171 (5%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIK 132
           T CK   C K Y        +  +  C+YHSG P+FHEG K WSCC RK  +F  FL  +
Sbjct: 157 TSCKNGGCSKTY-----QGLQSLDEICVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLSQE 211

Query: 133 GCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKEL 192
           GC  GKH++       K+  +++V CRHDW+QT   + +SI+AK    + S V      L
Sbjct: 212 GCTTGKHVWTK-----KDAGEKVVPCRHDWHQTGGEVTISIYAKNSLPELSQVEANSTLL 266

Query: 193 DVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           +V +    EK F     L+ +ID + S   +  TK+EI ++KA  + W SL
Sbjct: 267 NVHIVFEGEKEFHQNVKLWGVIDVKRSYVSMTATKIEITMRKAEPMQWASL 317



>gi|51010995|ref|NP_001003457.1| uncharacterized protein LOC445063 [Danio rerio]
 gi|50416931|gb|AAH78394.1| Zgc:92429 [Danio rerio]
          Length = 387

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 110/214 (51%), Gaps = 18/214 (8%)

Query: 35  PKISYTQTISKTITE-EPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
           PK      IS ++ +   K+   E+E  E   +  +    +CK   C K Y        E
Sbjct: 114 PKTKLQVKISPSLIQIMEKMEISEREKREKLESQALVVGIKCKNTGCRKSY--------E 165

Query: 94  GPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKN 150
           GPE     CIYH G PVFHEG K W+CC  K  +F  FL  KGC  GKH ++        
Sbjct: 166 GPETNAEICIYHPGAPVFHEGYKYWNCCCIKTTDFNAFLDQKGCTSGKHCWI------PK 219

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPL 210
            +K+ V CRHDW+QT + ++++I+AK  +  +S V      L   ++   +K F     L
Sbjct: 220 QDKKKVACRHDWHQTGSQVVVTIYAKNCNPDHSYVEANRTVLTCHIQFEGDKVFHKDIHL 279

Query: 211 YQLIDKENSTFEILTTKVEIKLKKANGISWPSLK 244
           + +ID ++S   ++ +KVE+ ++KA+ ++W  L+
Sbjct: 280 WGVIDVKSSLVNMVPSKVEVSMRKADAVAWGKLE 313



>gi|47227100|emb|CAG00462.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 328

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 97/189 (51%), Gaps = 20/189 (10%)

Query: 58  KEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKG 114
           KE + DD+ I     T CK   C K +         GPE+    C YH G P+FHEG K 
Sbjct: 144 KEEDGDDVKI----GTPCKNGGCTKSF--------NGPESNSDACSYHPGVPIFHEGMKY 191

Query: 115 WSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIF 174
           WSCC RK  +F  FL  +GC KG HL+       K + K++  CR DW+QT + +I+SI+
Sbjct: 192 WSCCKRKTSDFNTFLSQEGCTKGTHLW-----RKKVMGKKVAPCRFDWHQTGSQVIISIY 246

Query: 175 AKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKK 234
           AK    + S V      L++ +    EK F     L+ +ID   S   ++  K+EI +KK
Sbjct: 247 AKNGIPELSYVDANSTALNIYVVFEGEKEFEQKINLWGVIDVSKSAVNMMAAKIEIAMKK 306

Query: 235 ANGISWPSL 243
           +  +SW  L
Sbjct: 307 SEAMSWARL 315



>gi|307172259|gb|EFN63764.1| Cysteine and histidine-rich domain-containing protein 1 [Camponotus
           floridanus]
          Length = 340

 Score =  119 bits (299), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 119/228 (52%), Gaps = 25/228 (10%)

Query: 24  VENGVEI----YDSGPKISYTQTISKTITEEPK-LAPIEKE-PEEDDLNIPVASDTECKR 77
           V NGV +    +D+  ++  + TIS  + E+ K L  IE + P E  + I       C+ 
Sbjct: 98  VFNGVSLPRPAFDTA-QLVLSPTISPALLEQIKGLTAIESDKPIEGKIQI----GQRCQN 152

Query: 78  PSCGKKYVDDATSRGEGPEAE-CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKK 136
            SC   Y      +G   + E C YH G P+FHEG K WSCC +K  EF  FL   GC +
Sbjct: 153 NSCKGTY------KGITSDEEICHYHPGEPIFHEGMKYWSCCQKKTTEFSVFLDQPGCTQ 206

Query: 137 GKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDL 196
           GKH++       KN EK+  QCR DW+QT  ++ +SI+AKK     S +      L VDL
Sbjct: 207 GKHIWF-----TKNSEKK-AQCRMDWHQTGAYVFISIYAKKYLPNQSVIKLNPVHLTVDL 260

Query: 197 KMPDEK-RFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
              +EK R+     L  ++D + S+  +L TKVEIKLKKA   SW  L
Sbjct: 261 FFIEEKSRYNLDIELRGIVDVKQSSVNMLPTKVEIKLKKAEIGSWSKL 308



 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 40/65 (61%), Gaps = 5/65 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGKK+           + +C+YHSG PVFH+  KGWSCCS+K  +F EFL IKGC
Sbjct: 10  CYHRGCGKKF-----DPNNNKDDDCVYHSGYPVFHDAYKGWSCCSKKCTDFTEFLNIKGC 64

Query: 135 KKGKH 139
            K KH
Sbjct: 65  TKSKH 69



>gi|148224594|ref|NP_001084590.1| cysteine and histidine-rich domain-containing protein 1 [Xenopus
           laevis]
 gi|82185540|sp|Q6NUA0.1|CHRD1_XENLA RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           AltName: Full=Protein morgana
 gi|46250079|gb|AAH68697.1| MGC81113 protein [Xenopus laevis]
          Length = 334

 Score =  119 bits (299), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 93/175 (53%), Gaps = 16/175 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K +         GP++    C YHSG P+FHEG K WSCC RK  +F  FL
Sbjct: 154 TSCKNGGCLKTFA--------GPQSNEEVCHYHSGVPIFHEGMKYWSCCRRKTSDFNTFL 205

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
            ++GC KG HL+       K+  K++V CRHDW+QT   + +SI+AK    + S V    
Sbjct: 206 SLEGCTKGTHLWTK-----KDDGKKVVPCRHDWHQTGAGVTISIYAKNSMPELSYVEANS 260

Query: 190 KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLK 244
             +++ +    EK F     L+ +ID   S   +  TKVE+ LKKA  ++W  L+
Sbjct: 261 TVVNIQVVFEGEKTFQQNVQLWGVIDVAKSYVSLTATKVEVFLKKAEFMTWARLE 315



>gi|47213470|emb|CAF91127.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 340

 Score =  119 bits (298), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 114/237 (48%), Gaps = 34/237 (14%)

Query: 28  VEIYDSGPKISYTQTISKTITEEP------KLAP----------IEKEPEEDDLNIP-VA 70
            EI   GP+ +      +   +EP      K+AP          + ++ E +  + P + 
Sbjct: 83  AEIIYQGPQPAQAAQRDRPSPDEPRTELPLKVAPSLAQALEELHLSRKAEREKQDAPAIL 142

Query: 71  SDTECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEE 127
             T CK P C   Y        +GPE E   C +H G PVFHEG K WSCCS +  +F  
Sbjct: 143 PGTRCKNPGCKTVY--------QGPETEGDSCRHHPGAPVFHEGFKSWSCCSIRTTDFSS 194

Query: 128 FLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTF 187
           FL+ +GC  G H +     + K      V CRHDW+QT + +++S++A+  D   S V  
Sbjct: 195 FLEQRGCSSGSHCWSSRKDQRK------VSCRHDWHQTSSSVVVSVYARTADPAQSRVEA 248

Query: 188 REKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLK 244
               L   ++  ++K F  T+ L+ L+D   S   +L +KVEI L+KA   SW  L+
Sbjct: 249 NSTLLSCQVRFEEDKVFQRTFHLWGLVDVSRSAVNLLPSKVEIVLRKAQPGSWGRLE 305



>gi|91077034|ref|XP_967567.1| PREDICTED: similar to CHORD CG6198-PA [Tribolium castaneum]
 gi|270001750|gb|EEZ98197.1| hypothetical protein TcasGA2_TC000627 [Tribolium castaneum]
          Length = 336

 Score =  119 bits (298), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 93/180 (51%), Gaps = 18/180 (10%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEF 125
           +A  T CK   CG+ Y        +GPE     C +H G P+FHEG K WSCC ++  +F
Sbjct: 140 IAIGTTCKNGGCGQTY--------QGPETNATPCTHHPGVPIFHEGMKFWSCCQKRTTDF 191

Query: 126 EEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSV 185
             FL   GCK G+H+++      +N +   VQCR D++QT TH+++SI+AK+   + S +
Sbjct: 192 NAFLNQVGCKSGQHVWIK-----ENADNTTVQCRWDYHQTATHVVVSIYAKQYCVKKSEI 246

Query: 186 TFREKELDVDLKMPDEKR--FITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
                 L   L  P +    F     L  ++D   S   +  TKVEIKLKKA   SW  L
Sbjct: 247 KLNPIRLYASLVFPQQNNAVFNLDLELRGIVDVGASQVSMYGTKVEIKLKKAEPGSWAKL 306



>gi|71895117|ref|NP_001026003.1| cysteine and histidine-rich domain-containing protein 1 [Gallus
           gallus]
 gi|82083024|sp|Q5ZML4.1|CHRD1_CHICK RecName: Full=Cysteine and histidine-rich domain-containing protein
           1; AltName: Full=CHORD domain-containing protein 1;
           AltName: Full=Protein morgana
 gi|53127292|emb|CAG31029.1| hypothetical protein RCJMB04_1l2 [Gallus gallus]
          Length = 331

 Score =  119 bits (298), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 91/175 (52%), Gaps = 16/175 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K Y        +GP   E  C YHSG P+FHEG K WSCC RK  +F  FL
Sbjct: 155 TPCKNAGCSKTY--------QGPHSTEEVCQYHSGVPIFHEGMKYWSCCKRKTSDFNTFL 206

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
             +GC  G H++       K+  K++V CRHDW+QT   + +SI+AK      S V    
Sbjct: 207 AQEGCTTGTHVWTK-----KDAGKKVVPCRHDWHQTGGEVTVSIYAKNSVPDLSYVEANS 261

Query: 190 KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLK 244
             L++ +    EK F     L+ +ID + S   +  TK+E+ ++KA  + W SL+
Sbjct: 262 TMLNIHIVFEGEKEFHRNVKLWGVIDVKRSYVNMTATKIEVSMRKAEPLLWASLE 316



>gi|410956946|ref|XP_003985097.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Felis catus]
          Length = 448

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 97/188 (51%), Gaps = 12/188 (6%)

Query: 57  EKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWS 116
           E + EED   I +   T CK   C K Y    +      +  C+YHSG P+FHEG K WS
Sbjct: 122 ENKKEEDSDEIKIG--TSCKNGGCSKTYQGLQSL-----DEVCVYHSGVPIFHEGMKYWS 174

Query: 117 CCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAK 176
           CC RK  +F+ FL  +GC  GKH++       K+  K++V CRHDW QT   + +S++AK
Sbjct: 175 CCRRKTSDFKTFLAQEGCTTGKHVWTK-----KDAGKKVVPCRHDWRQTGGEVTISVYAK 229

Query: 177 KVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKAN 236
               + S +      L+V +    EK F     L+ +ID   S   +   ++EI ++KA 
Sbjct: 230 NSLPELSQIVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVTRSYVTMTAQRIEITMRKAE 289

Query: 237 GISWPSLK 244
            + W SL+
Sbjct: 290 PMQWASLE 297



>gi|350417087|ref|XP_003491250.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Bombus impatiens]
          Length = 341

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 92/173 (53%), Gaps = 17/173 (9%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKI 131
           CK  SC   Y         GP ++   C +H G P+FHEG K WSCC +K  +F  FL+ 
Sbjct: 150 CKNNSCKATY--------NGPASDDEVCNHHPGVPIFHEGMKYWSCCQKKTTDFSTFLEQ 201

Query: 132 KGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKE 191
            GC +GKH ++      KN   +  +CR DW+QT T +++S++AKK     SS+      
Sbjct: 202 PGCAQGKHTWIS-----KNNNSKRAKCRMDWHQTGTFVVISVYAKKYQPDQSSIKLNPIR 256

Query: 192 LDVDLKMPDEK-RFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           L VDL   +E  R+     L  ++D   S+  +L TKVEIKLKKA   SW  L
Sbjct: 257 LTVDLFFIEENSRYNLDLELRGIVDITQSSVNMLPTKVEIKLKKAELGSWAKL 309



 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 41/65 (63%), Gaps = 5/65 (7%)

Query: 75  CKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGC 134
           C    CGKK+  D     EG   +CIYHSG PVFH+  KGWSCC++K  +F EFL IKGC
Sbjct: 10  CYNRGCGKKF--DPNDNKEG---DCIYHSGYPVFHDAYKGWSCCNKKCTDFTEFLNIKGC 64

Query: 135 KKGKH 139
            K  H
Sbjct: 65  VKSYH 69



>gi|327269263|ref|XP_003219414.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 1 [Anolis carolinensis]
          Length = 332

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 107/206 (51%), Gaps = 24/206 (11%)

Query: 45  KTITEEPKLAP---IEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAE 98
           K + E+ KL+    I++E + D++ I     T CK   C K +        EGP   E  
Sbjct: 127 KQVLEKLKLSTGNEIKEEEDSDEIKI----GTTCKNAGCAKTF--------EGPHSMEET 174

Query: 99  CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQC 158
           C YH G P+FHEG K WSCC RK  +F  FL  +GC  G H++      +K   K+++ C
Sbjct: 175 CTYHMGVPIFHEGMKYWSCCKRKTSDFNTFLSQEGCSTGTHVW------IKKDAKKVIPC 228

Query: 159 RHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKEN 218
           RHDW+QT   + +SI+AK    + S V     +L++ +    +K F     L+ +ID + 
Sbjct: 229 RHDWHQTGGEVTISIYAKNSVPEFSYVEANSTKLNIHIVFEGDKEFNQNLSLWGVIDVKR 288

Query: 219 STFEILTTKVEIKLKKANGISWPSLK 244
           S   +  TK+E+ ++KA  + W  L+
Sbjct: 289 SYVNMTATKIELTMRKAEPMLWAGLE 314



>gi|326914526|ref|XP_003203576.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Meleagris gallopavo]
          Length = 328

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 90/174 (51%), Gaps = 16/174 (9%)

Query: 73  TECKRPSCGKKYVDDATSRGEGP---EAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFL 129
           T CK   C K Y        +GP   E  C YHSG P+FHEG K WSCC RK  +F  FL
Sbjct: 152 TPCKNAGCSKTY--------QGPHSTEEVCQYHSGVPIFHEGMKYWSCCKRKTSDFNTFL 203

Query: 130 KIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFRE 189
             +GC  G H++       K+  K++V CRHDW+QT   + +SI+AK      S V    
Sbjct: 204 AQEGCTTGTHVWTK-----KDAGKKVVPCRHDWHQTGGEVTVSIYAKNSVPDLSYVEANS 258

Query: 190 KELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
             L++ +    EK F     L+ +ID + S   +  TK+E+ ++KA  + W SL
Sbjct: 259 TMLNIHIVFEGEKEFHHNVKLWGVIDVKRSYVNMTATKIEVTMRKAEPLLWASL 312



>gi|327269265|ref|XP_003219415.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like isoform 2 [Anolis carolinensis]
          Length = 313

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 107/206 (51%), Gaps = 24/206 (11%)

Query: 45  KTITEEPKLAP---IEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGP---EAE 98
           K + E+ KL+    I++E + D++ I     T CK   C K +        EGP   E  
Sbjct: 108 KQVLEKLKLSTGNEIKEEEDSDEIKI----GTTCKNAGCAKTF--------EGPHSMEET 155

Query: 99  CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQC 158
           C YH G P+FHEG K WSCC RK  +F  FL  +GC  G H++      +K   K+++ C
Sbjct: 156 CTYHMGVPIFHEGMKYWSCCKRKTSDFNTFLSQEGCSTGTHVW------IKKDAKKVIPC 209

Query: 159 RHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKEN 218
           RHDW+QT   + +SI+AK    + S V     +L++ +    +K F     L+ +ID + 
Sbjct: 210 RHDWHQTGGEVTISIYAKNSVPEFSYVEANSTKLNIHIVFEGDKEFNQNLSLWGVIDVKR 269

Query: 219 STFEILTTKVEIKLKKANGISWPSLK 244
           S   +  TK+E+ ++KA  + W  L+
Sbjct: 270 SYVNMTATKIELTMRKAEPMLWAGLE 295



>gi|391332709|ref|XP_003740773.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Metaseiulus occidentalis]
          Length = 354

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 102/192 (53%), Gaps = 13/192 (6%)

Query: 53  LAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGS 112
           +A I+K+ +E    +P    T CK  +C   Y  + T+     E  C YH G PVFHEG 
Sbjct: 127 VADIKKDDQEKTNGVPYG--TPCKNSACKATYCGEQTN-----EETCNYHEGFPVFHEGM 179

Query: 113 KGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMS 172
           K WSCC RK  +F  FL+ +GC  G H +V   KE K+     V CR+DW+QT + +I+S
Sbjct: 180 KYWSCCQRKTSDFNSFLEQEGCASGSHCWV--KKETKD---SAVACRYDWHQTGSQVIIS 234

Query: 173 IFAKKVDKQNSSVTFREKELDVDLKMPDEKR-FITTYPLYQLIDKENSTFEILTTKVEIK 231
           +FAK      S V     +  + +   + +  F T   L  +ID   S+ E L  KVEIK
Sbjct: 235 VFAKASLPDKSFVHANPVKCKIHIVFGENQSIFDTEIVLGGIIDVAASSVEHLGAKVEIK 294

Query: 232 LKKANGISWPSL 243
           LKKA  +SW +L
Sbjct: 295 LKKAEPVSWKNL 306



>gi|410931133|ref|XP_003978950.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Takifugu rubripes]
          Length = 380

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 99/195 (50%), Gaps = 17/195 (8%)

Query: 52  KLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVF 108
           KL   +K  EE+  +  V   T CK   C   Y        EGP+ +   C +H G PVF
Sbjct: 131 KLDLSKKAEEENQDSRTVLPGTRCKNTGCKTVY--------EGPDTDMEVCKHHPGGPVF 182

Query: 109 HEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTH 168
           HEG K WSCC  K  +F  FL  KGC  G+H +V         +K+ V CRHDW+QT   
Sbjct: 183 HEGYKFWSCCCIKTTDFNAFLDQKGCSSGRHCWVTKK------DKKKVACRHDWHQTGNS 236

Query: 169 IIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKV 228
           ++++I+AK  +     V      L   ++  D K F   + L+ +++   ST  ++ +KV
Sbjct: 237 VVLTIYAKNANADLCCVEANRTVLSCQIQFEDNKIFKRNFHLWGVVNVPESTVNMVPSKV 296

Query: 229 EIKLKKANGISWPSL 243
           EI L+KA+ ++W  L
Sbjct: 297 EIVLRKAHQVAWGKL 311



>gi|195108471|ref|XP_001998816.1| GI24177 [Drosophila mojavensis]
 gi|193915410|gb|EDW14277.1| GI24177 [Drosophila mojavensis]
          Length = 364

 Score =  117 bits (292), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 98/177 (55%), Gaps = 12/177 (6%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           +A  T CK   C   Y + ++  GE     C YH G P+FHEG K WSCC ++  +F +F
Sbjct: 142 IAVGTSCKNSGCTYSYTNTSSDFGE-----CTYHPGVPIFHEGMKFWSCCQKRTSDFAQF 196

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFR 188
           +  KGC  G+H          + +K+++QCR+DW+QT T+++++++AKK     S V   
Sbjct: 197 MAQKGCVYGQHK-----FVKDDDDKKVIQCRYDWHQTATNVVVAVYAKKYHYAESLVEVN 251

Query: 189 EKELDVDLKMPDEK--RFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
              L V L  P+++  +F     L  +++ + ++ ++L TKVEI L K    SWP L
Sbjct: 252 PIRLHVMLVFPEQENAKFDLDLELRGIVNVQTASAQMLGTKVEITLPKLEPGSWPKL 308



>gi|195036428|ref|XP_001989672.1| GH18665 [Drosophila grimshawi]
 gi|193893868|gb|EDV92734.1| GH18665 [Drosophila grimshawi]
          Length = 364

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 98/178 (55%), Gaps = 14/178 (7%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEF 128
           +A  T CK   C   Y + ++  GE     C +H G P+FHEG K WSCC ++  +F +F
Sbjct: 142 IAVGTNCKNIGCTYSYTNTSSDYGE-----CTHHPGVPIFHEGLKFWSCCQKRTSDFAQF 196

Query: 129 LKIKGCKKGKHLFVGSGKEVKNVE-KEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTF 187
           +  KGC  G+H F      VKN E K +V CR+DW+QT T+++++++AKK     S +  
Sbjct: 197 MAQKGCVYGQHKF------VKNEEDKNVVTCRYDWHQTATNVVVAVYAKKYHYAQSVLEV 250

Query: 188 REKELDVDLKMPDEK--RFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
               L + L  P+++  +F     L  +I+ + ++ ++  TKVEI L K    SW +L
Sbjct: 251 NPIRLHIMLVFPEQENAKFNLDLELRGIINVQKASAQMFATKVEITLPKLEPGSWSNL 308



>gi|383865839|ref|XP_003708380.1| PREDICTED: cysteine and histidine-rich domain-containing
           protein-like [Megachile rotundata]
          Length = 340

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 105/214 (49%), Gaps = 20/214 (9%)

Query: 34  GPKISYTQTISKTITEEPKLAPIEKEPEEDDLNIPVASDTECKRPSCGKKYVDDATSRGE 93
            P+++   T+S T+ E+  +  +     E      V     CK  +C   Y         
Sbjct: 111 APQVTLKPTVSPTLLEQ--IKGLTSSISEILPQTKVQIGQSCKNNACKATY--------N 160

Query: 94  GPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKGCKKGKHLFVGSGKEVKN 150
           GP ++   C +H G P+FHEG K WSCC +K  +F  FL+  GC +GKH ++      K 
Sbjct: 161 GPASDDEVCNHHPGIPIFHEGMKYWSCCQKKTTDFSTFLEQPGCLQGKHKWISENTGKK- 219

Query: 151 VEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELDVDLKMPDEK-RFITTYP 209
                V CR DW+QT T I++SI+AKK     S++      L VDL   +E  R+     
Sbjct: 220 -----VNCRMDWHQTGTLIVVSIYAKKYQPDQSTIKLNPIRLTVDLYFIEENSRYNLDLE 274

Query: 210 LYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           L  ++D   S+  +L TKVEIKLKKA   SW  L
Sbjct: 275 LRGVVDITQSSVNMLPTKVEIKLKKAESGSWAKL 308



>gi|225717222|gb|ACO14457.1| Cysteine and histidine-rich domain-containing protein 1 [Esox
           lucius]
          Length = 392

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 92/179 (51%), Gaps = 17/179 (9%)

Query: 69  VASDTECKRPSCGKKYVDDATSRGEGPEAE---CIYHSGTPVFHEGSKGWSCCSRKVLEF 125
           V   T CK   C  +Y        +GPE     C +H G PVFHEG K W+CC  K  +F
Sbjct: 147 VMQGTRCKNTGCKIQY--------QGPETNLETCRHHPGAPVFHEGYKYWNCCCVKTTDF 198

Query: 126 EEFLKIKGCKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSV 185
             FL  KGC +GKH +V      + +  + V CRHDWYQT + + ++I+AK    + S V
Sbjct: 199 NAFLDQKGCTEGKHRWV------QKLNNKKVACRHDWYQTASKVFVTIYAKNSIPELSYV 252

Query: 186 TFREKELDVDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSLK 244
                 L   ++  D K F   + L+ + D  NS   ++ TKVE+ L K++ ++W  L+
Sbjct: 253 EANRTVLTCHIQFEDNKIFHKDFHLWGVADVANSVVNMVPTKVEVSLHKSDAVAWGKLE 311



>gi|402890696|ref|XP_003908615.1| PREDICTED: cysteine and histidine-rich domain-containing protein
           1-like [Papio anubis]
          Length = 331

 Score =  116 bits (290), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 86/170 (50%), Gaps = 12/170 (7%)

Query: 75  CKRPSCGKKYVDDATSRG-EGPEAECIYHSGTPVFHEGSKGWSCCSRKVLEFEEFLKIKG 133
           CK   C K Y      RG E  E  C+YHSG P+FHEG K WSCC RK  +F  FL   G
Sbjct: 138 CKNGGCSKTY------RGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNAFLAQDG 191

Query: 134 CKKGKHLFVGSGKEVKNVEKEIVQCRHDWYQTPTHIIMSIFAKKVDKQNSSVTFREKELD 193
           C  GKH++       K+  + +V CRHDW+QT   + +S++AK    + S V      L+
Sbjct: 192 CTTGKHMWAK-----KDAGENVVPCRHDWHQTEGEVTISVYAKNSLPELSRVEVHSTLLN 246

Query: 194 VDLKMPDEKRFITTYPLYQLIDKENSTFEILTTKVEIKLKKANGISWPSL 243
           V +    EK F     L  + D +     +  TK+EI ++KA  + W S 
Sbjct: 247 VHIGFEGEKEFHQNVKLRDVTDVKRIYVTMTATKIEITIRKAEPMQWASF 296