BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10342_c0_seq1-m.131 5prime_partial 3-908(+) 302 (+)
         (301 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384501208|gb|EIE91699.1| hypothetical protein RO3G_16410 [Rhi...   338   1e-90   Rhizopus delemar RA 99-880
gi|384493059|gb|EIE83550.1| hypothetical protein RO3G_08255 [Rhi...   333   4e-89   Rhizopus delemar RA 99-880
gi|511008858|gb|EPB90114.1| hypothetical protein HMPREF1544_0309...   326   5e-87   Mucor circinelloides f. circinelloides 1006PhL
gi|511000234|gb|EPB81788.1| hypothetical protein HMPREF1544_1147...   307   2e-81   Mucor circinelloides f. circinelloides 1006PhL
gi|358060107|dbj|GAA94166.1| hypothetical protein E5Q_00814 [Mix...   234   2e-59   Mixia osmundae IAM 14324
gi|328769378|gb|EGF79422.1| hypothetical protein BATDEDRAFT_8950...   221   2e-55   Batrachochytrium dendrobatidis JAM81
gi|317037194|ref|XP_001398750.2| survival factor 1 [Aspergillus ...   213   6e-53   Aspergillus niger CBS 513.88
gi|134084334|emb|CAK48674.1| unnamed protein product [Aspergillu...   213   7e-53   Aspergillus niger
gi|302685385|ref|XP_003032373.1| hypothetical protein SCHCODRAFT...   213   7e-53   Schizophyllum commune H4-8
gi|350630582|gb|EHA18954.1| hypothetical protein ASPNIDRAFT_2119...   212   8e-53   Aspergillus niger ATCC 1015
gi|472586906|gb|EMS24405.1| survival factor 1 [Rhodosporidium to...   212   1e-52   Rhodotorula toruloides NP11
gi|358366693|dbj|GAA83313.1| survival factor 1 [Aspergillus kawa...   212   1e-52   Aspergillus kawachii IFO 4308
gi|331228524|ref|XP_003326929.1| hypothetical protein PGTG_08466...   211   2e-52   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|409048820|gb|EKM58298.1| hypothetical protein PHACADRAFT_2525...   210   3e-52   Phanerochaete carnosa HHB-10118-sp
gi|115387525|ref|XP_001211268.1| survival factor 1 [Aspergillus ...   209   6e-52   Aspergillus terreus NIH2624
gi|402224937|gb|EJU04999.1| oxidative stress survival Svf1-like ...   206   4e-51   Dacryopinax primogenitus
gi|409078518|gb|EKM78881.1| hypothetical protein AGABI1DRAFT_114...   206   7e-51   Agaricus bisporus var. burnettii JB137-S8
gi|426199527|gb|EKV49452.1| hypothetical protein AGABI2DRAFT_191...   206   8e-51   Agaricus bisporus var. bisporus H97
gi|501309555|dbj|GAC98379.1| hypothetical protein PHSY_005973 [P...   206   8e-51   Pseudozyma hubeiensis SY62
gi|299749729|ref|XP_001836295.2| survival factor 1 [Coprinopsis ...   205   1e-50   Coprinopsis cinerea okayama7#130
gi|121713728|ref|XP_001274475.1| conserved hypothetical protein ...   205   1e-50   Aspergillus clavatus NRRL 1
gi|119478972|ref|XP_001259515.1| hypothetical protein NFIA_07548...   205   1e-50   Aspergillus fischeri NRRL 181
gi|388857231|emb|CCF49244.1| uncharacterized protein [Ustilago h...   202   7e-50   Ustilago hordei
gi|336370884|gb|EGN99224.1| hypothetical protein SERLA73DRAFT_18...   202   1e-49   Serpula lacrymans var. lacrymans S7.3
gi|449542542|gb|EMD33521.1| hypothetical protein CERSUDRAFT_1180...   201   1e-49   Gelatoporia subvermispora B
gi|407917377|gb|EKG10686.1| Histone H4 [Macrophomina phaseolina ...   201   2e-49   Macrophomina phaseolina MS6
gi|242763931|ref|XP_002340672.1| oxidative stress protein Svf1, ...   201   2e-49   Talaromyces stipitatus ATCC 10500
gi|395332152|gb|EJF64531.1| oxidative stress survival Svf1-like ...   201   2e-49   Dichomitus squalens LYAD-421 SS1
gi|19075716|ref|NP_588216.1| Svf1 family protein Svf1 [Schizosac...   201   2e-49   Schizosaccharomyces pombe 972h-
gi|389749744|gb|EIM90915.1| survival factor 1 [Stereum hirsutum ...   200   4e-49   Stereum hirsutum FP-91666 SS1
gi|71021419|ref|XP_760940.1| hypothetical protein UM04793.1 [Ust...   199   6e-49   
gi|343426215|emb|CBQ69746.1| conserved hypothetical protein [Spo...   199   9e-49   Sporisorium reilianum SRZ2
gi|425772076|gb|EKV10501.1| Survival factor 1 [Penicillium digit...   197   3e-48   Penicillium digitatum Pd1
gi|169779139|ref|XP_001824034.1| survival factor 1 [Aspergillus ...   196   4e-48   Aspergillus oryzae RIB40
gi|357529053|sp|Q5BH63.2|SVF1_EMENI RecName: Full=Survival facto...   196   7e-48   Aspergillus nidulans FGSC A4
gi|212529268|ref|XP_002144791.1| oxidative stress protein Svf1, ...   196   8e-48   Talaromyces marneffei ATCC 18224
gi|255953961|ref|XP_002567733.1| Pc21g06910 [Penicillium chrysog...   195   1e-47   Penicillium rubens Wisconsin 54-1255
gi|443900114|dbj|GAC77441.1| hypothetical protein PANT_26d00050 ...   194   3e-47   Moesziomyces antarcticus T-34
gi|213408110|ref|XP_002174826.1| Svf1 family protein [Schizosacc...   193   4e-47   
gi|505757681|gb|EOR01802.1| Survival factor 1 [Wallemia ichthyop...   192   1e-46   Wallemia ichthyophaga EXF-994
gi|70997443|ref|XP_753469.1| oxidative stress protein Svf1 [Aspe...   191   1e-46   Aspergillus fumigatus Af293
gi|485927224|gb|EOD51306.1| putative survival factor 1 protein [...   191   2e-46   Neofusicoccum parvum UCRNP2
gi|400598031|gb|EJP65751.1| survival factor 1 [Beauveria bassian...   191   3e-46   Beauveria bassiana ARSEF 2860
gi|393231521|gb|EJD39113.1| oxidative stress survival, Svf1-like...   189   1e-45   Auricularia subglabra TFB-10046 SS5
gi|392564271|gb|EIW57449.1| oxidative stress survival Svf1-like ...   189   1e-45   Trametes versicolor FP-101664 SS1
gi|328859091|gb|EGG08201.1| hypothetical protein MELLADRAFT_1051...   188   2e-45   Melampsora larici-populina 98AG31
gi|398391969|ref|XP_003849444.1| hypothetical protein MYCGRDRAFT...   187   2e-45   Zymoseptoria tritici IPO323
gi|327297334|ref|XP_003233361.1| SVP1-like protein [Trichophyton...   187   3e-45   Trichophyton rubrum CBS 118892
gi|261198264|ref|XP_002625534.1| survival factor 1 [Ajellomyces ...   187   4e-45   Blastomyces gilchristii SLH14081
gi|302662066|ref|XP_003022692.1| hypothetical protein TRV_03153 ...   187   4e-45   Trichophyton verrucosum HKI 0517
gi|326472400|gb|EGD96409.1| SVP1-like protein [Trichophyton tons...   187   4e-45   Trichophyton tonsurans CBS 112818
gi|258567604|ref|XP_002584546.1| survival factor 1 [Uncinocarpus...   186   5e-45   Uncinocarpus reesii 1704
gi|390595496|gb|EIN04901.1| survival factor 1 [Punctularia strig...   186   6e-45   Punctularia strigosozonata HHB-11173 SS5
gi|393235544|gb|EJD43098.1| oxidative stress survival, Svf1-like...   186   8e-45   Auricularia subglabra TFB-10046 SS5
gi|302511059|ref|XP_003017481.1| hypothetical protein ARB_04362 ...   186   9e-45   Arthroderma benhamiae CBS 112371
gi|389628552|ref|XP_003711929.1| survival factor 1 [Magnaporthe ...   185   1e-44   Magnaporthe oryzae 70-15
gi|346323739|gb|EGX93337.1| survival factor 1 [Cordyceps militar...   184   2e-44   Cordyceps militaris CM01
gi|393221203|gb|EJD06688.1| survival factor 1 [Fomitiporia medit...   183   4e-44   Fomitiporia mediterranea MF3/22
gi|453081474|gb|EMF09523.1| survival factor 1 [Mycosphaerella po...   183   6e-44   Sphaerulina musiva SO2202
gi|494823555|gb|EON60920.1| survival factor 1 [Coniosporium apol...   182   7e-44   Coniosporium apollinis CBS 100218
gi|85079277|ref|XP_956318.1| survival factor 1 [Neurospora crass...   182   8e-44   Neurospora crassa OR74A
gi|336471307|gb|EGO59468.1| survival factor 1 [Neurospora tetras...   182   8e-44   Neurospora tetrasperma FGSC 2508
gi|440639683|gb|ELR09602.1| hypothetical protein GMDG_04096 [Geo...   182   1e-43   Pseudogymnoascus destructans 20631-21
gi|340960108|gb|EGS21289.1| hypothetical protein CTHT_0031420 [C...   182   1e-43   Chaetomium thermophilum var. thermophilum DSM 1495
gi|296417002|ref|XP_002838156.1| hypothetical protein [Tuber mel...   182   1e-43   Tuber melanosporum Mel28
gi|154297025|ref|XP_001548941.1| hypothetical protein BC1G_12601...   181   1e-43   Botrytis cinerea B05.10
gi|367023144|ref|XP_003660857.1| hypothetical protein MYCTH_2086...   181   2e-43   Myceliophthora thermophila ATCC 42464
gi|347838081|emb|CCD52653.1| similar to survival factor 1 [Botry...   181   2e-43   Botrytis cinerea T4
gi|154283373|ref|XP_001542482.1| survival factor 1 [Ajellomyces ...   181   3e-43   Histoplasma capsulatum NAm1
gi|512199538|gb|EPE28371.1| hypothetical protein GLAREA_09491 [G...   181   3e-43   Glarea lozoyensis ATCC 20868
gi|119174412|ref|XP_001239567.1| hypothetical protein CIMG_09188...   180   4e-43   Coccidioides immitis RS
gi|156063602|ref|XP_001597723.1| hypothetical protein SS1G_01919...   180   4e-43   Sclerotinia sclerotiorum 1980 UF-70
gi|302894219|ref|XP_003045990.1| hypothetical protein NECHADRAFT...   180   4e-43   Nectria haematococca mpVI 77-13-4
gi|465793169|emb|CCU98292.1| unnamed protein product [Malassezia...   180   5e-43   Malassezia sympodialis ATCC 42132
gi|303314283|ref|XP_003067150.1| hypothetical protein CPC735_016...   179   6e-43   Coccidioides posadasii C735 delta SOWgp
gi|340521725|gb|EGR51959.1| predicted protein [Trichoderma reese...   179   6e-43   Trichoderma reesei QM6a
gi|325091266|gb|EGC44576.1| Svf1 family protein [Ajellomyces cap...   179   9e-43   Histoplasma capsulatum H88
gi|402084031|gb|EJT79049.1| survival factor 1 [Gaeumannomyces gr...   178   1e-42   Gaeumannomyces graminis var. tritici R3-111a-1
gi|472238883|gb|EMR83723.1| putative survival factor 1 protein [...   177   2e-42   Botrytis cinerea BcDW1
gi|322695033|gb|EFY86848.1| survival factor 1 [Metarhizium acrid...   177   2e-42   Metarhizium acridum CQMa 102
gi|225561822|gb|EEH10102.1| Svf1 family protein [Ajellomyces cap...   177   2e-42   Histoplasma capsulatum G186AR
gi|347838471|emb|CCD53043.1| similar to survival factor 1 [Botry...   177   3e-42   Botrytis cinerea T4
gi|500258618|gb|EOO01530.1| putative survival factor 1 protein [...   177   3e-42   Phaeoacremonium minimum UCRPA7
gi|452978962|gb|EME78725.1| hypothetical protein MYCFIDRAFT_5695...   177   3e-42   Cercospora fijiensis CIRAD86
gi|116196860|ref|XP_001224242.1| hypothetical protein CHGG_05028...   177   3e-42   Chaetomium globosum CBS 148.51
gi|345570703|gb|EGX53524.1| hypothetical protein AOL_s00006g390 ...   176   5e-42   Arthrobotrys oligospora ATCC 24927
gi|322706731|gb|EFY98311.1| survival factor 1 [Metarhizium aniso...   176   8e-42   Metarhizium robertsii ARSEF 23
gi|156049579|ref|XP_001590756.1| hypothetical protein SS1G_08496...   176   9e-42   Sclerotinia sclerotiorum 1980 UF-70
gi|320592117|gb|EFX04556.1| survival factor 1 [Grosmannia clavig...   175   1e-41   Grosmannia clavigera kw1407
gi|169611288|ref|XP_001799062.1| hypothetical protein SNOG_08754...   174   2e-41   Parastagonospora nodorum SN15
gi|154303601|ref|XP_001552207.1| hypothetical protein BC1G_08685...   174   2e-41   Botrytis cinerea B05.10
gi|392594437|gb|EIW83761.1| survival factor 1 [Coniophora putean...   174   2e-41   Coniophora puteana RWD-64-598 SS2
gi|67515671|ref|XP_657721.1| hypothetical protein AN0117.2 [Aspe...   174   3e-41   Aspergillus nidulans FGSC A4
gi|310795297|gb|EFQ30758.1| hypothetical protein GLRG_05902 [Glo...   174   3e-41   Colletotrichum graminicola M1.001
gi|367046350|ref|XP_003653555.1| hypothetical protein THITE_2116...   173   5e-41   Thielavia terrestris NRRL 8126
gi|302422802|ref|XP_003009231.1| survival factor 1 [Verticillium...   173   6e-41   Verticillium alfalfae VaMs.102
gi|346970390|gb|EGY13842.1| survival factor 1 [Verticillium dahl...   172   7e-41   Verticillium dahliae VdLs.17
gi|358384654|gb|EHK22251.1| hypothetical protein TRIVIDRAFT_1863...   172   8e-41   Trichoderma virens Gv29-8
gi|388583334|gb|EIM23636.1| oxidative stress survival, Svf1-like...   172   9e-41   Wallemia mellicola CBS 633.66
gi|380493980|emb|CCF33486.1| survival factor 1 [Colletotrichum h...   172   1e-40   Colletotrichum higginsianum
gi|443919903|gb|ELU39948.1| survival factor 1 [Rhizoctonia solan...   172   1e-40   Rhizoctonia solani AG-1 IA
gi|471558913|gb|EMR61458.1| putative survival factor 1 protein [...   171   2e-40   Eutypa lata UCREL1
gi|477528877|gb|ENH80650.1| survival factor 1 [Colletotrichum or...   171   2e-40   Colletotrichum orbiculare MAFF 240422
gi|482810156|gb|EOA86962.1| hypothetical protein SETTUDRAFT_1630...   171   2e-40   Setosphaeria turcica Et28A
gi|396465408|ref|XP_003837312.1| similar to survival factor 1 [L...   171   2e-40   Leptosphaeria maculans JN3
gi|406867019|gb|EKD20058.1| survival factor 1 [Marssonina brunne...   171   3e-40   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|46121387|ref|XP_385248.1| hypothetical protein FG05072.1 [Fus...   171   3e-40   
gi|408395752|gb|EKJ74928.1| hypothetical protein FPSE_04964 [Fus...   170   4e-40   Fusarium pseudograminearum CS3096
gi|452838839|gb|EME40779.1| hypothetical protein DOTSEDRAFT_7435...   169   6e-40   Dothistroma septosporum NZE10
gi|477510061|gb|ENH63349.1| Survival factor 1 [Fusarium oxysporu...   169   1e-39   Fusarium oxysporum f. sp. cubense race 1
gi|475662934|gb|EMT60730.1| Survival factor 1 [Fusarium oxysporu...   168   2e-39   Fusarium oxysporum f. sp. cubense race 4
gi|342880281|gb|EGU81447.1| hypothetical protein FOXB_08029 [Fus...   167   2e-39   Fusarium oxysporum Fo5176
gi|452003049|gb|EMD95506.1| hypothetical protein COCHEDRAFT_1126...   167   3e-39   Bipolaris maydis C5
gi|226294073|gb|EEH49493.1| survival factor 1 [Paracoccidioides ...   166   6e-39   
gi|330933254|ref|XP_003304107.1| hypothetical protein PTT_16544 ...   166   7e-39   Pyrenophora teres f. teres 0-1
gi|451856461|gb|EMD69752.1| hypothetical protein COCSADRAFT_3242...   166   1e-38   Bipolaris sorokiniana ND90Pr
gi|512194205|gb|EPE09961.1| survival factor 1 [Ophiostoma piceae...   164   3e-38   Ophiostoma piceae UAMH 11346
gi|189206005|ref|XP_001939337.1| survival factor 1 [Pyrenophora ...   164   3e-38   Pyrenophora tritici-repentis Pt-1C-BFP
gi|378726680|gb|EHY53139.1| survival factor 1 [Exophiala dermati...   163   4e-38   Exophiala dermatitidis NIH/UT8656
gi|459367623|gb|EMG46593.1| Survival factor 1 [Candida maltosa X...   163   4e-38   Candida maltosa Xu316
gi|296809932|ref|XP_002845304.1| survival factor 1 [Arthroderma ...   163   5e-38   Arthroderma otae CBS 113480
gi|358393837|gb|EHK43238.1| hypothetical protein TRIATDRAFT_3011...   163   6e-38   Trichoderma atroviride IMI 206040
gi|361126735|gb|EHK98724.1| putative Survival factor 1 [Glarea l...   163   6e-38   Glarea lozoyensis 74030
gi|295670343|ref|XP_002795719.1| survival factor 1 [Paracoccidio...   162   7e-38   Paracoccidioides lutzii Pb01
gi|241947979|ref|XP_002416712.1| cell survival pathways (diauxic...   160   4e-37   Candida dubliniensis CD36
gi|429853262|gb|ELA28344.1| survival factor 1 [Colletotrichum gl...   159   6e-37   Colletotrichum gloeosporioides Nara gc5
gi|399170936|emb|CCE28030.1| uncharacterized protein CPUR_01504 ...   159   7e-37   Claviceps purpurea 20.1
gi|225684426|gb|EEH22710.1| survival factor 1 [Paracoccidioides ...   159   1e-36   
gi|68473854|ref|XP_719030.1| hypothetical protein CaO19.6068 [Ca...   159   1e-36   Candida albicans SC5314
gi|470395676|ref|XP_004335099.1| hypothetical protein ACA1_09772...   157   3e-36   Acanthamoeba castellanii str. Neff
gi|255730495|ref|XP_002550172.1| survival factor 1 [Candida trop...   157   3e-36   Candida tropicalis MYA-3404
gi|448114927|ref|XP_004202706.1| Piso0_001555 [Millerozyma farin...   156   8e-36   Millerozyma farinosa CBS 7064
gi|448112377|ref|XP_004202081.1| Piso0_001555 [Millerozyma farin...   155   9e-36   Millerozyma farinosa CBS 7064
gi|50548913|ref|XP_501927.1| YALI0C16973p [Yarrowia lipolytica] ...   155   1e-35   Yarrowia lipolytica CLIB122
gi|171688390|ref|XP_001909135.1| hypothetical protein [Podospora...   154   2e-35   Podospora anserina S mat+
gi|254572009|ref|XP_002493114.1| hypothetical protein [Komagatae...   154   4e-35   Komagataella phaffii GS115
gi|126273960|ref|XP_001387768.1| protein involved in the diauxic...   153   6e-35   Scheffersomyces stipitis CBS 6054
gi|240275428|gb|EER38942.1| Svf1 family protein [Ajellomyces cap...   152   1e-34   Histoplasma capsulatum H143
gi|353239545|emb|CCA71452.1| hypothetical protein PIIN_05391 [Pi...   152   1e-34   Serendipita indica DSM 11827
gi|164659528|ref|XP_001730888.1| hypothetical protein MGL_1887 [...   150   4e-34   Malassezia globosa CBS 7966
gi|294659594|ref|XP_461999.2| DEHA2G10428p [Debaryomyces hanseni...   149   8e-34   Debaryomyces hansenii CBS767
gi|513034286|gb|AGO14252.1| AaceriAFL203Cp [Saccharomycetaceae s...   148   1e-33   Saccharomycetaceae sp. 'Ashbya aceri'
gi|449295563|gb|EMC91584.1| hypothetical protein BAUCODRAFT_2986...   148   2e-33   Baudoinia panamericana UAMH 10762
gi|344228289|gb|EGV60175.1| hypothetical protein CANTEDRAFT_1271...   147   4e-33   Candida tenuis ATCC 10573
gi|45198318|ref|NP_985347.1| AFL203Cp [Ashbya gossypii ATCC 1089...   146   6e-33   Eremothecium gossypii ATCC 10895
gi|336268048|ref|XP_003348789.1| hypothetical protein SMAC_01812...   144   4e-32   Sordaria macrospora k-hell
gi|363748308|ref|XP_003644372.1| hypothetical protein Ecym_1320 ...   144   4e-32   Eremothecium cymbalariae DBVPG#7215
gi|50307357|ref|XP_453657.1| hypothetical protein [Kluyveromyces...   140   3e-31   Kluyveromyces lactis NRRL Y-1140
gi|320581407|gb|EFW95628.1| hypothetical protein HPODL_2962 [Oga...   139   8e-31   
gi|448519978|ref|XP_003868192.1| Svf1 survival factor [Candida o...   139   1e-30   Candida orthopsilosis Co 90-125
gi|344304430|gb|EGW34662.1| hypothetical protein SPAPADRAFT_5310...   138   1e-30   Spathaspora passalidarum NRRL Y-27907
gi|385303347|gb|EIF47427.1| survival factor 1 [Dekkera bruxellen...   137   3e-30   Brettanomyces bruxellensis AWRI1499
gi|405117716|gb|AFR92491.1| survival factor 1 [Cryptococcus neof...   137   5e-30   Cryptococcus neoformans var. grubii H99
gi|354544188|emb|CCE40911.1| hypothetical protein CPAR2_109490 [...   136   6e-30   Candida parapsilosis
gi|255714645|ref|XP_002553604.1| KLTH0E02728p [Lachancea thermot...   136   6e-30   Lachancea thermotolerans CBS 6340
gi|321251949|ref|XP_003192234.1| hypothetical protein CGB_B4070C...   135   1e-29   Cryptococcus gattii WM276
gi|260944134|ref|XP_002616365.1| hypothetical protein CLUG_03606...   135   1e-29   Clavispora lusitaniae ATCC 42720
gi|58259489|ref|XP_567157.1| hypothetical protein [Cryptococcus ...   135   2e-29   Cryptococcus neoformans var. neoformans JEC21
gi|367004130|ref|XP_003686798.1| hypothetical protein TPHA_0H015...   134   4e-29   Tetrapisispora phaffii CBS 4417
gi|406604735|emb|CCH43795.1| Survival factor 1 [Wickerhamomyces ...   133   6e-29   Wickerhamomyces ciferrii
gi|320037416|gb|EFW19353.1| survival factor 1 [Coccidioides posa...   130   3e-28   Coccidioides posadasii str. Silveira
gi|242213660|ref|XP_002472657.1| predicted protein [Postia place...   130   6e-28   Postia placenta Mad-698-R
gi|367001975|ref|XP_003685722.1| hypothetical protein TPHA_0E019...   128   2e-27   Tetrapisispora phaffii CBS 4417
gi|392577280|gb|EIW70409.1| hypothetical protein TREMEDRAFT_4313...   126   7e-27   Tremella mesenterica DSM 1558
gi|149244132|ref|XP_001526609.1| survival factor 1 [Lodderomyces...   125   1e-26   Lodderomyces elongisporus NRRL YB-4239
gi|367014363|ref|XP_003681681.1| hypothetical protein TDEL_0E022...   124   4e-26   Torulaspora delbrueckii
gi|315044585|ref|XP_003171668.1| hypothetical protein MGYG_06214...   119   9e-25   Microsporum gypseum CBS 118893
gi|50284879|ref|XP_444867.1| hypothetical protein [Candida glabr...   114   2e-23   Candida glabrata CBS 138
gi|254577343|ref|XP_002494658.1| ZYRO0A06666p [Zygosaccharomyces...   112   2e-22   Zygosaccharomyces rouxii CBS 732
gi|326481624|gb|EGE05634.1| survival factor 1 protein [Trichophy...   110   4e-22   Trichophyton equinum CBS 127.97
gi|410080233|ref|XP_003957697.1| hypothetical protein KAFR_0E041...   110   4e-22   Kazachstania africana CBS 2517
gi|444322674|ref|XP_004181978.1| hypothetical protein TBLA_0H017...   101   3e-19   Tetrapisispora blattae CBS 6284
gi|190348254|gb|EDK40677.2| hypothetical protein PGUG_04775 [Mey...   100   8e-19   Meyerozyma guilliermondii ATCC 6260
gi|146413699|ref|XP_001482820.1| hypothetical protein PGUG_04775...   100   9e-19   Meyerozyma guilliermondii ATCC 6260
gi|365985057|ref|XP_003669361.1| hypothetical protein NDAI_0C045...    99   2e-18   Naumovozyma dairenensis CBS 421
gi|471880880|emb|CCO34632.1| Survival factor 1 [Rhizoctonia sola...    94   6e-17   Rhizoctonia solani AG-1 IB
gi|156837582|ref|XP_001642813.1| hypothetical protein Kpol_365p1...    94   6e-17   Vanderwaltozyma polyspora DSM 70294
gi|403215118|emb|CCK69618.1| hypothetical protein KNAG_0C05170 [...    92   1e-16   Kazachstania naganishii CBS 8797
gi|401624247|gb|EJS42311.1| YDR222W [Saccharomyces arboricola H-6]     91   4e-16   Saccharomyces arboricola H-6
gi|367006334|ref|XP_003687898.1| hypothetical protein TPHA_0L010...    89   2e-15   Tetrapisispora phaffii CBS 4417
gi|366994772|ref|XP_003677150.1| hypothetical protein NCAS_0F031...    89   2e-15   Naumovozyma castellii CBS 4309
gi|349577280|dbj|GAA22449.1| K7_Ydr222wp [Saccharomyces cerevisi...    88   3e-15   Saccharomyces cerevisiae Kyokai no. 7
gi|151942200|gb|EDN60556.1| conserved protein [Saccharomyces cer...    87   4e-15   Saccharomyces cerevisiae YJM789
gi|6320428|ref|NP_010508.1| hypothetical protein YDR222W [Saccha...    87   4e-15   Saccharomyces cerevisiae S288c
gi|365985121|ref|XP_003669393.1| hypothetical protein NDAI_0C049...    87   8e-15   Naumovozyma dairenensis CBS 421
gi|323338172|gb|EGA79405.1| YDR222W-like protein [Saccharomyces ...    86   1e-14   Saccharomyces cerevisiae Vin13
gi|323309764|gb|EGA62970.1| YDR222W-like protein [Saccharomyces ...    86   1e-14   Saccharomyces cerevisiae FostersO
gi|444323581|ref|XP_004182431.1| hypothetical protein TBLA_0I025...    85   3e-14   Tetrapisispora blattae CBS 6284
gi|410079935|ref|XP_003957548.1| hypothetical protein KAFR_0E026...    83   8e-14   Kazachstania africana CBS 2517
gi|403414682|emb|CCM01382.1| predicted protein [Fibroporia radic...    83   9e-14   Fibroporia radiculosa
gi|255715265|ref|XP_002553914.1| KLTH0E10076p [Lachancea thermot...    83   1e-13   Lachancea thermotolerans CBS 6340
gi|254577593|ref|XP_002494783.1| ZYRO0A09570p [Zygosaccharomyces...    81   3e-13   Zygosaccharomyces rouxii CBS 732
gi|366989939|ref|XP_003674737.1| hypothetical protein NCAS_0B027...    80   5e-13   Naumovozyma castellii CBS 4309
gi|323355652|gb|EGA87471.1| YDR222W-like protein [Saccharomyces ...    78   3e-12   Saccharomyces cerevisiae VL3
gi|50286931|ref|XP_445895.1| hypothetical protein [Candida glabr...    78   3e-12   Candida glabrata CBS 138
gi|156846224|ref|XP_001646000.1| hypothetical protein Kpol_1031p...    74   4e-11   Vanderwaltozyma polyspora DSM 70294


>gi|384501208|gb|EIE91699.1| hypothetical protein RO3G_16410 [Rhizopus delemar RA 99-880]
          Length = 383

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 219/310 (70%), Gaps = 9/310 (2%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT--FKSVNMTNFTLSPDRRSASANNMSIKLNP 58
           FVQ+IHSNIGLWNPTI FT +F+    NT  FK++NM+ F LS D+RS   +  +I+L+ 
Sbjct: 72  FVQLIHSNIGLWNPTISFTCKFYDPETNTSIFKNINMSKFELSADKRSVKTDFFNIQLDA 131

Query: 59  ECNKYAVNLTHKELIVSFEFERIDRGFKIGGGKTYFGQDKSS--GFVEHKFWPKGNVKGN 116
               Y +N+TH EL+VS +F+RID+GFK+G G+TY G DK+S  GFV HKFWP+   KG 
Sbjct: 132 AQELYKINITHPELVVSMDFKRIDKGFKVGEGRTYLGGDKASAAGFVSHKFWPRAESKGT 191

Query: 117 MVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKI 176
            +++ + +++ G G+F+HAIQGM+P LIAS WNF+NFQS  AS+ M +F+TT  YGS  I
Sbjct: 192 FIINQQIYEIEGDGMFIHAIQGMQPQLIASNWNFINFQSKEASIGMMQFQTTKQYGSVNI 251

Query: 177 NQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDE-----DFS 231
           NQGSLV+N KLV VSV N  + ++   D ET+Y +P ++K TW+GKT++ +E     D +
Sbjct: 252 NQGSLVLNGKLVCVSVDNHVELMDLEKDSETEYDIPKRVKLTWKGKTIKEEEGDEIKDVT 311

Query: 232 AFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVAKPYVYQWFNEAEAHVKIGENEELTAKG 291
             + + +  L+DKIDVL E+PYF++K VQ FV KPY+YQW ++A A + IG+ E++  +G
Sbjct: 312 IVMVVDIKNLIDKIDVLAEIPYFIRKFVQTFVVKPYIYQWLDKATAEITIGDQEKVLTEG 371

Query: 292 KLFSECSFIS 301
             F E  F+S
Sbjct: 372 HCFQELVFVS 381



>gi|384493059|gb|EIE83550.1| hypothetical protein RO3G_08255 [Rhizopus delemar RA 99-880]
          Length = 383

 Score =  333 bits (854), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 217/310 (70%), Gaps = 9/310 (2%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT--FKSVNMTNFTLSPDRRSASANNMSIKLNP 58
           FVQ+IHSNI LWNPTI FT RF+    NT  FK++ M+ F LS D+RS   +  SI+L+ 
Sbjct: 72  FVQLIHSNISLWNPTISFTCRFYDPETNTSIFKNITMSKFELSADKRSVKTDFFSIQLDT 131

Query: 59  ECNKYAVNLTHKELIVSFEFERIDRGFKIGGGKTYFGQDKSS--GFVEHKFWPKGNVKGN 116
               Y VN+TH EL+VS EF+R+D+GFK+G GKTY G D +S  GFV HKFWP+   KG 
Sbjct: 132 AQKVYKVNITHPELVVSLEFKRVDKGFKVGEGKTYLGGDNASAAGFVSHKFWPRAESKGT 191

Query: 117 MVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKI 176
            +++ +  ++ G G+FVHAIQGM+P LIAS WNF++F S  AS+ M +F+TT  YGS  I
Sbjct: 192 FIINHQVHEIEGDGMFVHAIQGMQPQLIASNWNFIDFHSKEASIGMMQFQTTKQYGSVNI 251

Query: 177 NQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTL---ETDE--DFS 231
           NQGSLV+NNKL+ VSV N  + ++   D ET+Y +P ++K TW+GKT+   E+DE  D +
Sbjct: 252 NQGSLVLNNKLICVSVDNHVELMDLEKDTETEYDIPKRVKLTWKGKTIKEQESDETKDVT 311

Query: 232 AFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVAKPYVYQWFNEAEAHVKIGENEELTAKG 291
             + +++  L+DKIDVL E+P+ ++KIVQAFV KPY+YQW ++A A + IG+  +   +G
Sbjct: 312 IVMVVEIKNLIDKIDVLAEIPFVIRKIVQAFVVKPYIYQWLDKATAEITIGDQAKFLTEG 371

Query: 292 KLFSECSFIS 301
           + F E  F+S
Sbjct: 372 RCFQELVFVS 381



>gi|511008858|gb|EPB90114.1| hypothetical protein HMPREF1544_03090 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 381

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 216/309 (69%), Gaps = 9/309 (2%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLNP 58
           FVQ+IHSNIGLWNPTI  T RF    +  + FK++ M+ F LS D+RS   +  +I+L+ 
Sbjct: 72  FVQLIHSNIGLWNPTITMTCRFHDPESSTSVFKNITMSKFELSADKRSVKTDYFNIQLDA 131

Query: 59  ECNKYAVNLTHKELIVSFEFERIDRGFKIGGGKTYFGQDKSS--GFVEHKFWPKGNVKGN 116
               Y +N+TH EL+VS +FERIDRGFK+G GKTY G DKSS  GFV HKFWP+  VKG 
Sbjct: 132 AQKLYKLNITHPELVVSLDFERIDRGFKVGEGKTYLGGDKSSAAGFVSHKFWPRCTVKGT 191

Query: 117 MVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKI 176
            +V+ + F+  G G+F+HAIQGM+P LIAS WNFVNFQSD AS++M +F+TT  YGS  I
Sbjct: 192 FIVNQKIFETEGDGIFIHAIQGMQPQLIASNWNFVNFQSDKASIAMMQFQTTKQYGSVNI 251

Query: 177 NQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETD----EDFSA 232
           NQGSLV+++KLV VS+ N  + L+   D +T+Y +P  IK TW+GKT++ +    +D   
Sbjct: 252 NQGSLVLDDKLVCVSIDNSVELLDLKKDEDTQYDIPQTIKLTWKGKTIKQEGQEPKDVLI 311

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVAKPYVYQWFNEAEAHVKIGENEELTAKGK 292
            +  +   L++KIDVL E+PY ++K+VQ+ + KPY+YQW +++ A + IG+ E+ T +G 
Sbjct: 312 TMTTEPRGLIEKIDVLAEIPYVIRKLVQSLIVKPYIYQWIDKSTAEITIGD-EKTTVEGH 370

Query: 293 LFSECSFIS 301
            F E  F+S
Sbjct: 371 CFQELVFVS 379



>gi|511000234|gb|EPB81788.1| hypothetical protein HMPREF1544_11473 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 383

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 217/312 (69%), Gaps = 12/312 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNM-TNFTLSPDRRSASANNMSIKLN 57
           FVQ+I+S IGLW PT+ FT RF+   +  N FK+ N  + FTLS DRRS      +I L+
Sbjct: 71  FVQLIYSAIGLWKPTVSFTCRFYDPTSSTNKFKNFNQASEFTLSEDRRSVKTEFFNITLD 130

Query: 58  PECNKYAVNLTHKELIVSFEFERIDRGFKIGGGKTYFG---QDKSSGFVEHKFWPKGNVK 114
           P  +K+ +++TH +LIV  ++ RID+GFK+G GKTY G   Q  ++G V HKFWP+ + K
Sbjct: 131 PTLSKFKLSITHPDLIVDLDYVRIDKGFKVGEGKTYLGGNDQSSAAGIVSHKFWPRCSAK 190

Query: 115 GNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSK 174
           G  +++ + ++V   G+F+HAIQGM+P LIAS+WNFV+FQ+  A+LSM +F TT  YG  
Sbjct: 191 GTTIIEKQFYEVDAHGMFIHAIQGMQPQLIASKWNFVDFQAQDAALSMMQFTTTKQYGGV 250

Query: 175 KINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTL---ETDE--D 229
           ++NQGS+V+++KL+ V V+N  + ++   D ET+Y +P ++K TW+GKTL   ++DE  D
Sbjct: 251 EVNQGSIVLHDKLISVCVENNVEMMDLKKDDETEYDIPQRVKLTWKGKTLKENDSDEVKD 310

Query: 230 FSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVAKPYVYQWFNEAEAHVKIGENEELTA 289
            S  + + L  L+DKID+L+E+P+FLKK+VQ FV KPY+YQW ++A A + +G +E+   
Sbjct: 311 VSVVMIVNLKNLIDKIDILSEIPWFLKKLVQTFVVKPYIYQWIDDATAEITVG-DEKFEC 369

Query: 290 KGKLFSECSFIS 301
            G+ + E  F+S
Sbjct: 370 PGRCYQELVFVS 381



>gi|358060107|dbj|GAA94166.1| hypothetical protein E5Q_00814 [Mixia osmundae IAM 14324]
          Length = 446

 Score =  234 bits (598), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 142/373 (38%), Positives = 205/373 (54%), Gaps = 72/373 (19%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT----FKSVNMTNFT----------LSPDRRS 46
            +Q+IHS +G+W P IQFT R+F    N     +KSVN+TNF           + PDRRS
Sbjct: 74  MIQIIHSGVGMWYPQIQFTFRYFDPSANPPIKIWKSVNVTNFVVPAPAGTNKVIKPDRRS 133

Query: 47  ASANNMSIKLNP-ECNKYAVNLTH-KELIVSFEFERID--RGFKIG----GGKTYFGQDK 98
             ++  SI ++P + N Y +  T+ K++ VS E+ R     G+K+G    GG TYFG  K
Sbjct: 134 CKSDQFSITVDPDQPNTYKIEGTYDKDVQVSLEYTRAAGVPGWKLGAGPQGGMTYFGALK 193

Query: 99  SS---------------GFVEHKFWPKGNVKGNMVVDGRAFDVTG-VGLFVHAIQGMRPH 142
           S+               GF  H+FWP+ +VKG +       D++G  G+FVHAIQGMRP+
Sbjct: 194 SAKPTGSKLPDTTSGTDGFAVHRFWPRCHVKGIVRTGKEIADLSGSTGMFVHAIQGMRPN 253

Query: 143 LIASRWNFVNFQSDVA-------SLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNM 195
           L+A+RWNF NFQS  +       SL+M EF TT  YG++K+N GS+VV +KL+ V+  + 
Sbjct: 254 LVAARWNFANFQSPASSDPDQSVSLTMMEFTTTSYYGTQKVNIGSVVVGDKLIAVTAGSR 313

Query: 196 -------AQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFS-AFLEIKLDV------- 240
                  A  LE  +D ET Y VP  I++ W G  +++    + A + ++LD        
Sbjct: 314 DGKAGSSATHLEAVVDQETSYSVPQSIRFDWAGPLIDSPSSVAQAEILLELDPLAQSKGK 373

Query: 241 -----LMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKI------GENEELT 288
                L++K+DVL E+PY +KK++      KPY+YQW N   A + I      G   ELT
Sbjct: 374 YEGKGLIEKVDVLAEIPYLVKKVINVVAGTKPYIYQWLNPVTAKITIPSTTETGSTRELT 433

Query: 289 AKGKLFSECSFIS 301
             G LF+E ++IS
Sbjct: 434 VDGVLFNEATWIS 446



>gi|328769378|gb|EGF79422.1| hypothetical protein BATDEDRAFT_89507 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 359

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 185/309 (59%), Gaps = 12/309 (3%)

Query: 3   QMIHSNIGLWNPTIQFTSR-FFGNGVNTFKSVNM--TNFTLSPDRRSASANNMSIKLNPE 59
           Q+++S+I  W+P++Q T+R +  +GV   KSV++  +   LS D+ SA+ +NM+I    +
Sbjct: 48  QLVYSSINSWSPSVQITARVYMPDGVKKIKSVSLAGSALELSADKLSATCSNMTITYKAD 107

Query: 60  CN----KYAVNL-THKELIVSFEFERIDRGFKIGGGKTYFG-QDKSSGFVEHKFWPKGNV 113
            +     Y V L    EL+V F  + +   ++I  GK YF  +  ++G+V  +  PKG V
Sbjct: 108 ASTVGPSYIVKLDVSPELLVEFNMDAVVEAYQINEGKAYFDPETPATGYVASRIMPKGKV 167

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPN-YG 172
            G +VVDG   D  G G+F HAIQ   P    +RWNF+NFQ +  +L + +FE  P  Y 
Sbjct: 168 SGMIVVDGIMHDAAGHGVFSHAIQC--PPYNVARWNFINFQDETNALILYQFEMVPGAYP 225

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
              ++QG LV+NN++  V++ N ++F  T+LD  + Y++P  IK+ W GKT +T      
Sbjct: 226 KDIVSQGVLVLNNEITAVTIDNHSEFQGTTLDAFSNYQIPNAIKHVWHGKTRDTGVPIEI 285

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVAKPYVYQWFNEAEAHVKIGENEELTAKGK 292
            + +KLD L+DKIDVL+E+PY ++  +Q F++ P+VYQW  + E  V++   +E+   G+
Sbjct: 286 EMRLKLDRLVDKIDVLSELPYLIRMFIQTFISAPFVYQWIEDTEVVVRVEGGKEIRLNGR 345

Query: 293 LFSECSFIS 301
            F E +F++
Sbjct: 346 AFHENTFLA 354



>gi|317037194|ref|XP_001398750.2| survival factor 1 [Aspergillus niger CBS 513.88]
          Length = 378

 Score =  213 bits (541), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 114/310 (36%), Positives = 186/310 (60%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SNI   + T QFTS+ F   G+G + + S  ++NF       S  A+N++++LN
Sbjct: 70  MVQLIYSNIVGLHTTAQFTSKIFNLKGDGPHNWHSDPLSNFMFDESMLSFGADNLAVQLN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + + Y + +  + + +V+  F+R   GF IG  G +YFG D  +  G + H FWP+  V
Sbjct: 130 EDGDTYTIKSAVNDDSLVNLTFKRSSPGFMIGKDGTSYFGTDPENPWGSMSHAFWPRCAV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+TG G+F+HA+QGM+PH  A+RWNFVNFQ+   S  M E+ T P+YGS
Sbjct: 190 EGTITTKEKTYDLTGRGMFIHALQGMKPHHAAARWNFVNFQTPTYSAMMMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++   + N A   E+S D E+ +  P  IK+ W+GK+ E  E   A 
Sbjct: 250 TTVNVGGIVKDGEIIYAGINNSATHTESSQDAESDWPEPKSIKWVWDGKSKEGQE-VHAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG-ENEELTAKG 291
           L+  L   +D+IDV+ EVP F+K I  +    +PY++Q+  + +  +K+   + E+T +G
Sbjct: 309 LDGALGNRLDRIDVMAEVPGFIKTIAGSVAGTRPYIFQYCPQEKLSLKLKVGDSEVTEEG 368

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 369 TMFSEATFIS 378



>gi|134084334|emb|CAK48674.1| unnamed protein product [Aspergillus niger]
          Length = 372

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 114/310 (36%), Positives = 186/310 (60%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SNI   + T QFTS+ F   G+G + + S  ++NF       S  A+N++++LN
Sbjct: 64  MVQLIYSNIVGLHTTAQFTSKIFNLKGDGPHNWHSDPLSNFMFDESMLSFGADNLAVQLN 123

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + + Y + +  + + +V+  F+R   GF IG  G +YFG D  +  G + H FWP+  V
Sbjct: 124 EDGDTYTIKSAVNDDSLVNLTFKRSSPGFMIGKDGTSYFGTDPENPWGSMSHAFWPRCAV 183

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+TG G+F+HA+QGM+PH  A+RWNFVNFQ+   S  M E+ T P+YGS
Sbjct: 184 EGTITTKEKTYDLTGRGMFIHALQGMKPHHAAARWNFVNFQTPTYSAMMMEYTTPPSYGS 243

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++   + N A   E+S D E+ +  P  IK+ W+GK+ E  E   A 
Sbjct: 244 TTVNVGGIVKDGEIIYAGINNSATHTESSQDAESDWPEPKSIKWVWDGKSKEGQE-VHAE 302

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG-ENEELTAKG 291
           L+  L   +D+IDV+ EVP F+K I  +    +PY++Q+  + +  +K+   + E+T +G
Sbjct: 303 LDGALGNRLDRIDVMAEVPGFIKTIAGSVAGTRPYIFQYCPQEKLSLKLKVGDSEVTEEG 362

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 363 TMFSEATFIS 372



>gi|302685385|ref|XP_003032373.1| hypothetical protein SCHCODRAFT_85268 [Schizophyllum commune H4-8]
 gi|300106066|gb|EFI97470.1| hypothetical protein SCHCODRAFT_85268 [Schizophyllum commune H4-8]
          Length = 416

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 139/358 (38%), Positives = 204/358 (56%), Gaps = 61/358 (17%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSP---DRRSASANNMSIK 55
             Q+IHS++GLW P IQFT + F     +  +KSVN++NF   P   D+RS+ ++  S+ 
Sbjct: 63  MCQIIHSSVGLWYPQIQFTCKVFNPVRNIKIWKSVNISNFVTPPPGQDKRSSRSDQFSVT 122

Query: 56  LN------PECNKYAVNLT-HKELIVSFEFERIDR--GFKIG----GGKTYFGQDKSS-- 100
                   PE  KY +N     +L ++ E  R     GFK+G    GG +YFG D+++  
Sbjct: 123 HKAAEGEFPE--KYIINANLGTDLQIALEIRRPATVPGFKVGNGPKGGFSYFGADEANPE 180

Query: 101 GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD---- 156
           G+V H+FWP+ +V G+++++G A  + G G+FVHAIQGMRP+L+A+RWNF +FQSD    
Sbjct: 181 GYVVHRFWPRTSVTGHLIMNGAAEPMEGPGMFVHAIQGMRPNLVAARWNFAHFQSDEAGG 240

Query: 157 VASLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGVS---------------VKN 194
           V+ + M EF TT  YG K        +N GSLVV NKLV V+               V +
Sbjct: 241 VSGIQM-EFTTTDAYGKKGPGSGFVSVNVGSLVVGNKLVAVTAETKWPGEEVPAEAPVIS 299

Query: 195 MAQFLETSLDPETKYKVPTKIKYTWEGKTLETDE--DFSAFLEIKLDV------LMDKID 246
            A   +T  D +T YK PT+I + W+G ++  D   D++A +   L        L+DK+D
Sbjct: 300 RATHTKTEQDEDTGYKGPTEIAFEWKGPSIVPDAKGDYAAKVTCDLGPVATPHGLVDKVD 359

Query: 247 VLNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHV-KIGENEELTAKGKLFSECSFIS 301
           VL E+PY +K +V  +VA  KPY+YQW N A   + + G+ E     G L++E +FIS
Sbjct: 360 VLAEIPYAVKMVVN-YVAGTKPYIYQWMNPATMTLHEPGKEEPTEINGTLYNEATFIS 416



>gi|350630582|gb|EHA18954.1| hypothetical protein ASPNIDRAFT_211906 [Aspergillus niger ATCC
           1015]
          Length = 378

 Score =  212 bits (540), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 114/310 (36%), Positives = 186/310 (60%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SNI   + T QFTS+ F   G+G + + S  ++NF       S  A+N++++LN
Sbjct: 70  MVQLIYSNIVGLHTTAQFTSKIFNLKGDGPHNWHSDPLSNFMFDESMLSFGADNLAVQLN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + + Y + +  + + +V+  F+R   GF IG  G +YFG D  +  G + H FWP+  V
Sbjct: 130 EDGDTYTIKSAVNDDSLVNLTFKRSSPGFMIGKDGTSYFGTDPENPWGSMSHAFWPRCAV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+TG G+F+HA+QGM+PH  A+RWNFVNFQ+   S  M E+ T P+YGS
Sbjct: 190 EGTITTKEKTYDLTGRGMFIHALQGMKPHHAAARWNFVNFQTPTYSAMMMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++   + N A   E+S D E+ +  P  IK+ W+GK+ E  E   A 
Sbjct: 250 TTVNVGGIVKDGEIIYAGINNSATHTESSQDAESDWPEPKSIKWVWDGKSKEGKE-VHAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG-ENEELTAKG 291
           L+  L   +D+IDV+ EVP F+K I  +    +PY++Q+  + +  +K+   + E+T +G
Sbjct: 309 LDGALGNRLDRIDVMAEVPGFIKTIAGSVAGTRPYIFQYCPQEKLSLKLKVGDSEVTEEG 368

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 369 TMFSEATFIS 378



>gi|472586906|gb|EMS24405.1| survival factor 1 [Rhodosporidium toruloides NP11]
          Length = 424

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 131/362 (36%), Positives = 193/362 (53%), Gaps = 61/362 (16%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLNP 58
             Q+IHS+IGL  PTIQ T R      G NT+KSV ++NF +  D+RS  ++ +++ ++P
Sbjct: 63  MCQIIHSSIGLLWPTIQVTFRHANPKTGKNTWKSVTVSNFKVQADKRSMKSDQITVTMDP 122

Query: 59  -ECNKYAVNLTHK-ELIVSFEFERIDRGFKIG----GGKTYFGQ---------------D 97
              +KY +   +  E+ +S ++ER+  GFKIG    GG TYFGQ                
Sbjct: 123 TSSSKYTIEAKYDDEVQISLQYERLAEGFKIGAGPKGGFTYFGQLSGKASPTDGSPDYAG 182

Query: 98  KSSGFVEHKFWPKGNVKGNMVVDGRAFDVTGV-GLFVHAIQGMRPHLIASRWNFVNFQS- 155
            + G+  H+FWP+  V G M V     D+ G  G+F+HAIQG+RP+++A+ WNF NFQ+ 
Sbjct: 183 GADGYAIHRFWPRCAVSGIMRVGNDVTDLEGARGVFIHAIQGIRPNILAASWNFANFQTV 242

Query: 156 -----DVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSL------- 203
                +  SL M EF TTP YGSK IN GS+VV +KLV V+         +++       
Sbjct: 243 EKEGEEAVSLIMMEFTTTPAYGSKVINVGSVVVGDKLVAVTAGGSGVGGGSNVTHQDPVK 302

Query: 204 DPETKYKVPTKIKYTWEGKTLETD-EDFSAFLE-------------------IKLDVLMD 243
           D ET Y  P+ +K+ WEG  LE +  +  A  E                    K   L++
Sbjct: 303 DAETGYDAPSALKFCWEGAKLEGEGSNLKAVTEGNSKVHAVFTEDLLVDKEGYKTKGLVE 362

Query: 244 KIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEAEAHVKIG---ENEELTAKGKLFSECSF 299
           K+DVL ++PY +KK V  A   KP++Y W N  +A + +G   E + L   G +F+E + 
Sbjct: 363 KVDVLGQIPYLIKKFVNYAAGTKPFIYTWLNPVKASITLGTGSETKTLDVDGYVFTEATM 422

Query: 300 IS 301
           IS
Sbjct: 423 IS 424



>gi|358366693|dbj|GAA83313.1| survival factor 1 [Aspergillus kawachii IFO 4308]
          Length = 378

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 187/310 (60%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SNI   + T QFTS+ F   G+G + + S  ++NF       S  A+N++++LN
Sbjct: 70  MVQLIYSNIVGLHTTAQFTSKIFNLKGDGPHNWHSDPLSNFMFDESMLSFGADNLAVQLN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + + Y + +  +++ +V+  F+R   GF IG  G +YFG D  +  G + H FWP+  V
Sbjct: 130 EDGDTYTIKSAVNEDSLVNLTFKRSSPGFMIGKDGTSYFGTDPENPWGSMSHAFWPRCAV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+TG G+F+HA+QGM+PH  A+RWNFVNFQ+   S  M E+ T P+YGS
Sbjct: 190 EGTITTKEKTYDLTGRGMFIHALQGMKPHHAAARWNFVNFQTPTYSAMMMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++   + N A   ++S D E+ +  P  IK+ W+GK+ E  E   A 
Sbjct: 250 TTVNVGGIVKDGEIIYAGINNSATHTDSSQDAESDWPEPKSIKWVWDGKSKEGQE-VHAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG-ENEELTAKG 291
           L+  L   +D+IDV+ EVP F+K I  +    +PY++Q+  + +  +K+   + E+T +G
Sbjct: 309 LDGALGNRLDRIDVMAEVPGFIKTIAGSVAGTRPYIFQYCPQEKLSLKLKVGDSEVTEEG 368

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 369 TMFSEATFIS 378



>gi|331228524|ref|XP_003326929.1| hypothetical protein PGTG_08466 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309305919|gb|EFP82510.1| hypothetical protein PGTG_08466 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 475

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 141/405 (34%), Positives = 205/405 (50%), Gaps = 104/405 (25%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF--GNGVNTFKSVNMTNFTLSP----------DRRSAS 48
             Q+IHS IGLW P IQFT RF   G+G + +KS N+TNF   P          DRRS  
Sbjct: 69  MCQVIHSAIGLWYPQIQFTFRFVDQGSGAHHWKSTNVTNFKTPPASSGSSSVKYDRRSCK 128

Query: 49  ANNMSIKLNP-ECNKYAVNLTHKELI-VSFEFERID--RGFKIG----GGKTYFGQ---- 96
           A+  SI L+P + ++Y +   H + I + F   R+    G+K+G    GG TYFG+    
Sbjct: 129 ADQFSILLDPAQPDRYTITGKHDDSIHIQFSVTRMADVPGWKLGQDARGGLTYFGRWASK 188

Query: 97  ----------DKSSGFVEHKFWPKGNVKGNMVVDGRAFDVTGV-GLFVHAIQGMRPHLIA 145
                       S G++ H+FWP+ +V G +++DG+  ++ G   +FVHAIQGMRP+LIA
Sbjct: 189 EPSKSGPDYGAGSDGYLVHRFWPRCSVSGRLLIDGKTVELDGSRAIFVHAIQGMRPNLIA 248

Query: 146 SRWNFVNFQS---------------DVASLSMCEFETTP-NYGSKK-INQGSLVVNNKLV 188
           SRWNF NFQS                  SL++ EF T P +YG  + I  GS+VV +KLV
Sbjct: 249 SRWNFCNFQSVRPLEPLSEGAEDTDPGVSLTLMEFTTVPGSYGPPQTITVGSIVVGDKLV 308

Query: 189 GVSV-KNMAQFLETSL--------DPETKYKVPTKIKYTWEGKTL---------ETDED- 229
           G+    N ++ +++          D +T Y+VP+ IK+ W    L          TD   
Sbjct: 309 GICCSPNPSELVDSKTTHQAPLLHDVDTGYQVPSSIKFEWMAPVLANALGSSAPSTDSSP 368

Query: 230 FSAFLEIKLDV---------------LMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFN 273
            SA   + LD+               L++K+DV+ ++PY +KK++ A   A+PY+Y W N
Sbjct: 369 LSATAHLVLDLEAKRISEKESYVTKGLIEKVDVMAQIPYLVKKVISAVAGARPYIYTWLN 428

Query: 274 EAEAHVKI-----------------GENEELTAKGKLFSECSFIS 301
             EAH+ +                 GE  + T  G LF+E +FIS
Sbjct: 429 PVEAHITLPNSALPNGFNVKTEAVEGEASKFTIHGHLFNEATFIS 473



>gi|409048820|gb|EKM58298.1| hypothetical protein PHACADRAFT_252509 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 423

 Score =  210 bits (535), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 138/360 (38%), Positives = 197/360 (54%), Gaps = 61/360 (16%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSP---DRRSASANNMSI- 54
            +Q+IHS++G+W PTIQ TS+ +    G   +KSVN+ NF   P   D+RS+ A+  SI 
Sbjct: 66  LLQVIHSSVGVWYPTIQITSKIYNPNTGEKIWKSVNVANFVTPPPGLDKRSSKADQFSIT 125

Query: 55  -KLNPECN---KYAVNLT-HKELIVSFEFERIDR--GFKIG----GGKTYFGQD--KSSG 101
            K NP  N   KY VN     +L  SFE  R     GFK+G    GG +YFG D  K  G
Sbjct: 126 HKSNPGSNEPEKYVVNANLGDDLQCSFEVSRPASVPGFKVGKGPKGGFSYFGPDLEKPDG 185

Query: 102 FVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD----V 157
           +V H+FWP+  +KG ++  G+A +  G G+FVHAIQGMRP  +A+RWNF +FQSD    V
Sbjct: 186 YVVHRFWPRTALKGMIIHKGKAIEAKGPGMFVHAIQGMRPDTVAARWNFAHFQSDAHNGV 245

Query: 158 ASLSMCEFETTPNYGSKKINQ-------GSLVVNNKLVGVS---------------VKNM 195
           +++ M EF TT  YG K           GSLV+  KL  V+               V + 
Sbjct: 246 SAIQM-EFTTTDAYGKKGAGSGFVTTSVGSLVLGGKLAAVTSETRYPGEAQADDAEVISR 304

Query: 196 AQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV------LMDKIDVLN 249
           A  L T+ D +T Y  PT++ + W    L  +    A L++ +        L++K+DVL 
Sbjct: 305 AVHLRTAKDVDTGYDAPTELAFKWAAPALGGEGRVDASLQLDVGPPTAYKGLVEKVDVLA 364

Query: 250 EVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVK------IGENEELTAKGKLFSECSFIS 301
           E+PY +K +V  +VA  KP+VYQWFN    HV        G ++ +  +G++++E +FIS
Sbjct: 365 EIPYVIKTMVN-YVAGTKPFVYQWFNPGTLHVTGPDSLIPGLSQGVDIEGRIYNEATFIS 423



>gi|115387525|ref|XP_001211268.1| survival factor 1 [Aspergillus terreus NIH2624]
 gi|114195352|gb|EAU37052.1| survival factor 1 [Aspergillus terreus NIH2624]
          Length = 400

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 117/311 (37%), Positives = 185/311 (59%), Gaps = 12/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SNI   + T Q TS+ F   G+G + + S  ++NF       S  A+N+S+ LN
Sbjct: 92  MVQIIYSNIVGIHTTAQVTSKIFNLTGDGPHKWNSDPLSNFMFDESMLSFGADNLSLTLN 151

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y   +  +++ +V+  F+R   GF +G  G +YFG D  +  G + H FWP+  V
Sbjct: 152 EEGDTYTFKSAVNEDNLVNLSFKRTSPGFVVGKDGTSYFGTDPQNPWGSMSHAFWPRCAV 211

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+ G G+F+HA+QGM+PH  A+RWNFVNFQ+   +  M E+ T P+YGS
Sbjct: 212 EGTITTKEKTYDLGGRGMFIHALQGMKPHHAAARWNFVNFQTPTYTAVMMEYTTPPSYGS 271

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + ++V     N A   E++ DPE+ +  P  IK+ WEGKT +  +D  A 
Sbjct: 272 TVVNVGGIVKDGEIVYAGSTNTATHTESAQDPESDWPEPKSIKWAWEGKT-QDGKDVQAE 330

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAH--VKIGENEELTAK 290
           L   L   +D+IDV+ EVP F+K I  +    +PY++Q+  + +    VKIG+ EE++ +
Sbjct: 331 LHGPLGNRLDRIDVMAEVPGFIKTIAGSVAGTRPYIFQFAPQEKLSLKVKIGD-EEISEE 389

Query: 291 GKLFSECSFIS 301
           G +FSE +FIS
Sbjct: 390 GSMFSEATFIS 400



>gi|402224937|gb|EJU04999.1| oxidative stress survival Svf1-like protein [Dacryopinax sp.
           DJM-731 SS1]
          Length = 426

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 132/361 (36%), Positives = 194/361 (53%), Gaps = 63/361 (17%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVN--TFKSVNMTNFTLSP--------DRRSASAN 50
           F Q+IHS+IGLW+P +QFT +F+    N   +KS N+++F   P        DRRS+ A+
Sbjct: 61  FCQIIHSSIGLWSPQVQFTCKFYDPQTNEQIWKSANVSHFLTPPPPSQGRTYDRRSSQAD 120

Query: 51  NMSIKLNP----ECNKYAVNLT-----HKELIVSFEFERIDRGFKIG----GGKTYFGQ- 96
              +  +P    E   Y V+       H  L+V  E  R   GFK G    GG +YFG+ 
Sbjct: 121 KFRVIHSPATATELESYKVDAQPDEGFHVSLLV--ERPREIEGFKFGAGARGGFSYFGEM 178

Query: 97  DKSSGFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQS- 155
           DK  G V H+FWP+    G ++V+G+A   +G G+FVHAIQGMRP+L+A RWNF +F S 
Sbjct: 179 DKPDGCVVHRFWPRTKTSGVVLVNGKAVSASGQGMFVHAIQGMRPNLVAERWNFAHFISG 238

Query: 156 -----DVASLSMCEFETTPNYGSK-----------KINQGSLVVNNKLVGVS-------- 191
                 V+++ M EF T  +YG K           K+N G +V   KL  V+        
Sbjct: 239 NDVLGGVSAIQM-EFRTLESYGRKVEGREGVQGQVKVNVGCVVAGGKLAAVTGETQWVDE 297

Query: 192 -------VKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLD---VL 241
                  V + A+  +  +D ET Y VP+ I ++W   +L  +   SA +   L     L
Sbjct: 298 LEGEKTGVVSRAEHRDVMVDKETGYSVPSAIDWSWSAPSLGGEGTVSAKVHSDLGGFRGL 357

Query: 242 MDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFI 300
           ++K+DVL E+PY ++K++  A   KPY+YQ+FN A+  V++   E +  +G LF+E SFI
Sbjct: 358 LEKVDVLAEIPYMVRKVINYATGTKPYIYQYFNPAKMEVRMPGKEAVVVEGTLFNEASFI 417

Query: 301 S 301
           S
Sbjct: 418 S 418



>gi|409078518|gb|EKM78881.1| hypothetical protein AGABI1DRAFT_114442 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 426

 Score =  206 bits (524), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 141/364 (38%), Positives = 200/364 (54%), Gaps = 67/364 (18%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGN--GVNTFKSVNMTNFTLSP---DRRSASANNMSIK 55
             Q+IHS +GLW P IQFT + + +  G   +KSVN TNF   P   D+RS+ A+  S+ 
Sbjct: 66  MCQIIHSAVGLWYPQIQFTFKIYDSKTGEQFWKSVNATNFVTPPSGLDKRSSKADQFSVT 125

Query: 56  LN--------PECNKYAVNLTHKELIVSFEFERIDR--GFKIG----GGKTYFGQD--KS 99
                     PE   +  NL  +++ +S E +R     GFK+G    GG +YFG D  K 
Sbjct: 126 YKSHPDNPDFPESYTFNANLG-QDMQISMELKRYGTAPGFKVGKGPKGGYSYFGPDLEKP 184

Query: 100 SGFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVA- 158
            G+V H+FWP+   +G+ V +G+A    G  +FVHAIQGMRP+L+AS WNF +FQS +A 
Sbjct: 185 DGYVIHRFWPRMLAEGHYVQNGQAHMFKGGSMFVHAIQGMRPNLVASSWNFGHFQSSIAD 244

Query: 159 --SLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGVS--------------VKNM 195
             S    EF+TT  YG +        +N GS+VV+NKLV V+              VK+ 
Sbjct: 245 GVSAIQMEFKTTSQYGKRGAGSGGVSVNVGSIVVDNKLVAVTAQTVWPDEDSDESVVKSK 304

Query: 196 AQFLETSLDPETKYKVPTKIKYTWEGKTL--ETDEDFSAFLEIKLDV------LMDKIDV 247
           A  L   +DP+T YK P +I Y W+G +L      D +A   + +        L++K+DV
Sbjct: 305 ATHLRPEVDPDTGYKKPEEISYEWKGPSLVPGAPGDITAHQVVSVGSVANPQGLIEKVDV 364

Query: 248 LNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVKIGENEELTA---KGK-----LFSEC 297
           L E+PY +K  V  +VA  KP++YQWFN A   +K    EE++A   KGK     L++E 
Sbjct: 365 LAEIPYVVKMAVN-YVAGTKPFIYQWFNPAVLEIK--GPEEVSAGLSKGKKVEGWLYNEA 421

Query: 298 SFIS 301
           +FIS
Sbjct: 422 TFIS 425



>gi|426199527|gb|EKV49452.1| hypothetical protein AGABI2DRAFT_191479 [Agaricus bisporus var.
           bisporus H97]
          Length = 426

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 141/364 (38%), Positives = 200/364 (54%), Gaps = 67/364 (18%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGN--GVNTFKSVNMTNFTLSP---DRRSASANNMSIK 55
             Q+IHS +GLW P IQFT + + +  G   +KSVN TNF   P   D+RS+ A+  S+ 
Sbjct: 66  MCQIIHSAVGLWYPQIQFTFKIYDSKTGEQFWKSVNATNFVTPPPGLDKRSSKADQFSVT 125

Query: 56  LN--------PECNKYAVNLTHKELIVSFEFERIDR--GFKIG----GGKTYFGQD--KS 99
                     PE   +  NL  +++ +S E +R     GFK+G    GG +YFG D  K 
Sbjct: 126 YKSHPDNPDFPESYTFNANLG-QDMQISMELKRYGTAPGFKVGKGPKGGYSYFGPDLEKP 184

Query: 100 SGFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVA- 158
            G+V H+FWP+   +G+ V +G+A    G  +FVHAIQGMRP+L+AS WNF +FQS +A 
Sbjct: 185 DGYVIHRFWPRMLAEGHYVQNGQAHMFKGGSMFVHAIQGMRPNLVASSWNFGHFQSSIAD 244

Query: 159 --SLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGVS--------------VKNM 195
             S    EF+TT  YG +        +N GS+VV+NKLV V+              VK+ 
Sbjct: 245 GVSAIQMEFKTTSQYGKRGAGSGGVSVNVGSIVVDNKLVAVTAQTVWPDENSDESVVKSK 304

Query: 196 AQFLETSLDPETKYKVPTKIKYTWEGKTL--ETDEDFSAFLEIKLDV------LMDKIDV 247
           A  L   +DP+T YK P +I Y W+G +L      D +A   + +        L++K+DV
Sbjct: 305 ATHLRPEVDPDTGYKKPEEISYEWKGPSLVPGAPGDITAHQVVSVGSVANPQGLIEKVDV 364

Query: 248 LNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVKIGENEELTA---KGK-----LFSEC 297
           L E+PY +K  V  +VA  KP++YQWFN A   +K    EE++A   KGK     L++E 
Sbjct: 365 LAEIPYVVKMAVN-YVAGTKPFIYQWFNPAVLEIK--GPEEVSAGLSKGKKVEGWLYNEA 421

Query: 298 SFIS 301
           +FIS
Sbjct: 422 TFIS 425



>gi|501309555|dbj|GAC98379.1| hypothetical protein PHSY_005973 [Pseudozyma hubeiensis SY62]
          Length = 443

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 132/367 (35%), Positives = 191/367 (52%), Gaps = 69/367 (18%)

Query: 3   QMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSPDRRSASANNMSIKL---N 57
           Q+IHS +GLW P +Q T ++F    G   +KSVN+T F    D+RS+ A   S+     +
Sbjct: 77  QIIHSAVGLWYPQVQMTFKYFNPKTGKKIWKSVNVTKFAAQSDKRSSKAAEFSVNFSTTD 136

Query: 58  PECNKYAVNLT-HKELIVSFEFERID--RGFKIG----GGKTYFGQ--DKSSGFVEHKFW 108
              +KY +      +L +S+ F R    +G+K+G    GG +YFG   D   G+V H+FW
Sbjct: 137 AGDDKYTITANLDTDLQLSWSFTRPSAVKGWKLGSGPKGGFSYFGSNPDSPEGYVIHRFW 196

Query: 109 PKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLS-----MC 163
           P    +G+++  G A D  G G+FVHAIQGMRP+L+A++WNF NFQ+    L      M 
Sbjct: 197 PVAESEGHIISHGAAIDAKGTGMFVHAIQGMRPNLVAAKWNFANFQAQDDKLGRVSGVMM 256

Query: 164 EFETTPNYGSKK---------INQGSLVVNNKLVGVSVK----------------NMAQF 198
           EF TTP+YGS +         +N GS+V   KL+ V+                  +  + 
Sbjct: 257 EFTTTPDYGSVEKEQQRQSLTVNIGSIVAEGKLISVTAATRTAGAAESQPSRKSNSYVKH 316

Query: 199 LETSLDPETKYKVPTKIKYTWEGKTLETDE---DFSAFLEIKLDV-------------LM 242
           L+ +LD +T Y+ P  I+Y W+G  L+      D    +E  L V             L+
Sbjct: 317 LDKTLDQDTGYQAPQSIEYHWQGPLLDASSGKGDLQNTVEASLKVDLGKPYPSSETHGLV 376

Query: 243 DKIDVLNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVKIGE------NEELTAKGKLF 294
           DK+DVL E+PY ++K+V  +VA  KPY+YQ  NEA   +K+ E        E   KG LF
Sbjct: 377 DKVDVLAEIPYMVRKLVN-YVAGTKPYIYQTLNEATLKIKLPEAYGGDVKGETEVKGSLF 435

Query: 295 SECSFIS 301
            E +FIS
Sbjct: 436 EEHTFIS 442



>gi|299749729|ref|XP_001836295.2| survival factor 1 [Coprinopsis cinerea okayama7#130]
 gi|298408573|gb|EAU85479.2| survival factor 1 [Coprinopsis cinerea okayama7#130]
          Length = 424

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 137/362 (37%), Positives = 197/362 (54%), Gaps = 63/362 (17%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSP---DRRSASANNMSIK 55
             Q+IHS  G+W PT+QFT +      G   +KSVN++NFT SP   D+RS  A+  ++ 
Sbjct: 65  MCQVIHSATGVWYPTVQFTFKVHDPKTGKTIWKSVNVSNFTSSPPGLDKRSCKADEFTLT 124

Query: 56  LNPECNK-----YAVNLT-HKELIVSFEFERIDR--GFKIG----GGKTYFGQD--KSSG 101
             P  N      Y VN     +L  S EF+RI    G+K+G     G +YFG D  K  G
Sbjct: 125 YKPTNNPEYPETYVVNANLAADLQFSMEFQRIGTVPGWKLGKGPKAGYSYFGPDLEKPEG 184

Query: 102 FVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD----V 157
           +V H+FWP+    G+++ +G+A  V GVG+F+HAIQGMRP+L+AS WNF +F+S+    V
Sbjct: 185 YVIHRFWPRFKASGHIISEGKADTVQGVGMFIHAIQGMRPNLVASAWNFHHFESEELGGV 244

Query: 158 ASLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGV---------------SVKNM 195
           ++L M EF T   +G K        +N GSLV+ NKL  +               SV + 
Sbjct: 245 SALQM-EFTTCDTHGKKGSGSGRVSVNIGSLVIGNKLAVITAETAWPGEARPADPSVISR 303

Query: 196 AQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDKIDV 247
              L+T  D ET YK P++    W+G ++  D   +   ++++DV        L++KIDV
Sbjct: 304 TTHLDTQFDQETGYKKPSRQIVEWKGPSILADAPGTVTGKVEVDVGDVENPKGLIEKIDV 363

Query: 248 LNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVK------IGENEELTAKGKLFSECSF 299
           L E+PY LK  V  +VA  KPY+YQW N A+ H+        G +  +   G L+SE +F
Sbjct: 364 LAEIPYVLKVAVN-YVAGTKPYIYQWINPAKLHISGPDAIAPGLSSGIDVNGTLYSESTF 422

Query: 300 IS 301
           IS
Sbjct: 423 IS 424



>gi|121713728|ref|XP_001274475.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1]
 gi|119402628|gb|EAW13049.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1]
          Length = 378

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 185/310 (59%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SNI   + T QF ++ F   G+  + + S  ++N+       S  A+N+++ LN
Sbjct: 70  MVQVIYSNIAGIHTTAQFNTKIFNLNGDEPHVWHSDPLSNYMFDEQMLSFGADNLALTLN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E N Y + +  + + +V+  F R   GF +G  G +YFG D ++  G + H FWP+  V
Sbjct: 130 EEGNAYTIKSAVNDDSLVNLTFTRTAPGFVVGKDGTSYFGTDAANPWGSMMHAFWPRCRV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+ G G+F+HAIQGM+PH  A+RWNFVNFQ+   S  M EF T P+YGS
Sbjct: 190 EGTITTKEKTYDLAGRGMFIHAIQGMKPHHAAARWNFVNFQTPSYSAVMMEFTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V +N+++     N A    +S D ++ +  PT IK+ WEGK+ + +++  A 
Sbjct: 250 TVVNVGGIVKDNEIIYAGTTNSAVHTGSSHDSDSDWPQPTSIKWLWEGKSKD-EKEIRAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG-ENEELTAKG 291
           LE  L   +D+IDV+ EVP F+K I  +    +PY++Q+  + +  +K+   +EE+T +G
Sbjct: 309 LEGPLGNRLDRIDVMAEVPGFVKAIAGSVAGTRPYIFQFSPQEKLSLKLKVGDEEITEEG 368

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 369 FMFSEATFIS 378



>gi|119478972|ref|XP_001259515.1| hypothetical protein NFIA_075480 [Neosartorya fischeri NRRL 181]
 gi|119407669|gb|EAW17618.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181]
          Length = 378

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 185/311 (59%), Gaps = 12/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SNI   + T QF S+ F   G+  + + S  + N+    +  S  A+N+++ LN
Sbjct: 70  MVQVIYSNIAGIHTTAQFNSKIFNLKGDQPHIWHSDPLYNYMFDENMLSFGADNLALTLN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E   Y + +  +++ +V+  F R   GF +G  G +YFG D ++  G + H FWP+  V
Sbjct: 130 EEGTAYTIKSAVNEDSLVNLTFTRAAPGFVVGKDGTSYFGTDPANPWGSMMHAFWPRCRV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+TG G+F+HAIQGM+PH  A+RWNFVNFQ+   S  M E+ T P+YGS
Sbjct: 190 EGTITTKEKTYDLTGRGMFIHAIQGMKPHHAAARWNFVNFQTPSYSAVMMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V +++++     N A    ++ D ++ +  PT IK+ W+GK+ + ++D  A 
Sbjct: 250 TVVNVGGIVKDDEIIYAGATNSATHTASAHDADSDWPAPTSIKWVWDGKSKD-EKDVHAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQW--FNEAEAHVKIGENEELTAK 290
           LE  L   +D+IDV+ EVP F+K I  +    +PY++Q+    +    +KIG+ EE + +
Sbjct: 309 LEGPLGNRLDRIDVMAEVPGFVKTIAGSVAGTRPYIFQYSPHEKLSLKLKIGD-EEFSEE 367

Query: 291 GKLFSECSFIS 301
           G +FSE +FIS
Sbjct: 368 GSMFSEATFIS 378



>gi|388857231|emb|CCF49244.1| uncharacterized protein [Ustilago hordei]
          Length = 437

 Score =  202 bits (515), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 130/362 (35%), Positives = 192/362 (53%), Gaps = 64/362 (17%)

Query: 3   QMIHSNIGLWNPTIQFTSRFF--GNGVNTFKSVNMTNFTLSPDRRSASANNMSI---KLN 57
           Q+IHS +GLW P +Q T ++F    G   +KS+N+T F    D+RS+ A   S+     +
Sbjct: 76  QIIHSAVGLWYPQVQMTFKYFNPATGKKIWKSLNVTKFAAQTDKRSSKAAEFSVVYSTTD 135

Query: 58  PECNKYAVNLT-HKELIVSFEFERID--RGFKIG----GGKTYFGQDKSS--GFVEHKFW 108
              +KY++      +L +S+ F R    +G+K+G    GG +YFG +  S  G+V H+FW
Sbjct: 136 AGEDKYSITANLDADLQLSWSFTRPASVQGWKLGSGPKGGFSYFGSNLGSPEGYVIHRFW 195

Query: 109 PKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLS-----MC 163
           P    +G+++  G A D  G G+FVHAIQGMRP+L+A++WNF NFQ+    L      M 
Sbjct: 196 PVAESEGHIISQGGAIDAKGKGMFVHAIQGMRPNLVAAKWNFANFQAKDQKLGRVSGVMM 255

Query: 164 EFETTPNYGSKK----------INQGSLVVNNKL----------------VGVSVKNMAQ 197
           EF TTP+YGS +          +N GS+VV  KL                      +  +
Sbjct: 256 EFTTTPDYGSVERAEGHRQSLTVNIGSIVVEGKLVAVTAATRTANAAEGEASRKSNSYVK 315

Query: 198 FLETSLDPETKYKVPTKIKYTWEGKTLET-------DEDFSAFLEIKLDV---------L 241
            L+ +LD +T Y+ P  I+Y W+G  L+        +E   A L++ L           L
Sbjct: 316 HLDQTLDQDTGYQAPQAIEYHWQGPLLDASTGKGDLEEKVEASLKVDLGKPYPSSETHGL 375

Query: 242 MDKIDVLNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSF 299
           +DK+DVL E+PY ++K+V  +VA  KPY+YQ  N A   VK+   E+   KG LF E +F
Sbjct: 376 VDKVDVLAEIPYMVRKLVN-YVAGTKPYIYQTLNPATLKVKLPGGEQSEVKGSLFEEHTF 434

Query: 300 IS 301
           IS
Sbjct: 435 IS 436



>gi|336370884|gb|EGN99224.1| hypothetical protein SERLA73DRAFT_182110 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336383643|gb|EGO24792.1| hypothetical protein SERLADRAFT_449539 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 425

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 134/360 (37%), Positives = 199/360 (55%), Gaps = 63/360 (17%)

Query: 3   QMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSP---DRRSASANNMSI--K 55
           Q+IHS+IGLW PTIQFT +      G   ++S+N++NF   P   D+RS+ A+  SI  K
Sbjct: 68  QVIHSSIGLWYPTIQFTCKIHNPNTGETIWRSINVSNFVTPPPGLDKRSSKADQFSITHK 127

Query: 56  LNPE---CNKYAV--NLTHKELIVSFEFERIDR--GFKIG----GGKTYFGQD--KSSGF 102
           L+ +      Y V  NL+  +L +SF+F R     GFK+G    GG +Y+G D  K  G+
Sbjct: 128 LSSDPAYAELYTVRANLS-DDLQISFDFVRPTAVPGFKVGKGPKGGYSYYGPDLQKPEGY 186

Query: 103 VEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDV---AS 159
           V H+FWP+    G+++  G+A    G G+FVHAIQGMRP+L+ASRWNFVNFQS+     S
Sbjct: 187 VIHRFWPRTAANGHIIHKGQAISAKGPGMFVHAIQGMRPNLVASRWNFVNFQSNEHGGVS 246

Query: 160 LSMCEFETTPNYGSKK-------INQGSLVVNNKLVGVS---------------VKNMAQ 197
             + +  T   YG          ++ GSLV+  KL  V+               VK+ + 
Sbjct: 247 AILMDLTTPDAYGPHGAGSGGVVVSIGSLVLGGKLAVVTAETKLPNEQQSEQAPVKSRST 306

Query: 198 FLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDKIDVLN 249
            L  + DP+T Y+ PT +K+ W G ++      +    +++DV        L++KIDVL 
Sbjct: 307 HLNPAFDPDTGYEQPTGLKFRWAGPSIVAGAQGAVDATVQVDVGGPAAPKGLIEKIDVLA 366

Query: 250 EVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVK------IGENEELTAKGKLFSECSFIS 301
           E+PY +K +V  +VA  KPY+YQW N+A+  V+       G +  L  +G  ++E +FIS
Sbjct: 367 EIPYVIKTMVN-YVAGTKPYIYQWINKAKLVVRGPDSLIPGLSGGLEVEGVFYNEATFIS 425



>gi|449542542|gb|EMD33521.1| hypothetical protein CERSUDRAFT_118094 [Ceriporiopsis subvermispora
           B]
          Length = 425

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 129/362 (35%), Positives = 195/362 (53%), Gaps = 63/362 (17%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSP---DRRSASANNMSIK 55
             Q+IHS++G+W PTIQFT +      G   +KSVN+ NF   P   D+RS+ A+  SI 
Sbjct: 66  MCQVIHSSVGVWYPTIQFTCKIHNPNTGETAWKSVNVANFVTPPPGLDKRSSKADQFSIT 125

Query: 56  LNPECNK-----YAVNLT-HKELIVSFEFERID--RGFKIG----GGKTYFGQDKSS--G 101
             P  +      Y +      +L +S +  R     GFK+G    GG + FG D+++  G
Sbjct: 126 YKPSADASTPDGYTIRANLGDDLQISLDVTRTPDAPGFKVGKGPRGGFSDFGTDRANPEG 185

Query: 102 FVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD----V 157
           +V H+FWP+ + KG  +  G+A  V G G+FVHAIQGMRP+L+A+RWNF +FQSD    V
Sbjct: 186 YVVHRFWPRYHGKGMYIHKGKAITVNGPGMFVHAIQGMRPNLVAARWNFAHFQSDAHGGV 245

Query: 158 ASLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGV---------------SVKNM 195
           +++ M E  TT  YG K        +N GSLV+  KL  V               +V + 
Sbjct: 246 SAIQM-ELTTTEAYGPKGAGSGFVTVNVGSLVLGGKLAAVTAETRYPNEPLPENAAVVSR 304

Query: 196 AQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDKIDV 247
           A+  + ++DP+T YK P ++ + W   ++  D   +    + +DV        L++K+DV
Sbjct: 305 AEHSKAAIDPDTGYKAPAELVFRWAAPSVVADAPGAVDATLTVDVGELDAPKGLIEKVDV 364

Query: 248 LNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVK------IGENEELTAKGKLFSECSF 299
           L E+PY +K +V  +VA  KPY+YQW N A  +V        G +  L  +G +++E +F
Sbjct: 365 LAEIPYVIKTMVN-YVAGTKPYIYQWLNRATLNVTGPDALIPGLSGGLKVEGIVYNEATF 423

Query: 300 IS 301
           IS
Sbjct: 424 IS 425



>gi|407917377|gb|EKG10686.1| Histone H4 [Macrophomina phaseolina MS6]
          Length = 378

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 177/310 (57%), Gaps = 11/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF----GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
             Q+I+SN+     T QF ++ F    G   + + S  ++N+     + +  A+N S++L
Sbjct: 71  MAQVIYSNVAGIRTTCQFNTKIFYNDEGKTPHLWSSDPLSNYRFDEAKTNFYADNCSVEL 130

Query: 57  NPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           + + + Y + + T+K+ IVS +F +   GF +G  G +YFG D ++  G + H FWP+  
Sbjct: 131 SADGSSYTIKSSTNKQSIVSLKFTKSAPGFVVGKNGTSYFGTDPANPWGSMRHAFWPRCK 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G+++      D  G G FVHA+QGM+PH  A+RWNFVNFQS   S  M E+ T P+YG
Sbjct: 191 VEGSILTKDGELDFGGRGFFVHALQGMKPHHAAARWNFVNFQSPSYSAVMMEYTTPPSYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           S  ++ G +  ++K++     N A   E   D E ++  P    Y W+GKT +  +D  A
Sbjct: 251 STNVSVGGIATDDKIIFAGPNNSATHTEKKQDAENEWPEPLAASYVWDGKTAD-GKDVHA 309

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIV-QAFVAKPYVYQWFNEAEAHVKIGENEELTAKG 291
            L   L   +D++DV+ EVP F+K IV  A   KPY+YQW  +    VK+G+ EE + +G
Sbjct: 310 DLTGSLGPRVDRVDVMAEVPGFVKAIVASAAGTKPYIYQWHPKLTLKVKVGD-EEKSEEG 368

Query: 292 KLFSECSFIS 301
            LF+E +FIS
Sbjct: 369 TLFTEATFIS 378



>gi|242763931|ref|XP_002340672.1| oxidative stress protein Svf1, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218723868|gb|EED23285.1| oxidative stress protein Svf1, putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 378

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/310 (36%), Positives = 179/310 (57%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           +VQ+I++NI   + T QF ++ +   G+  + + S  + N    PD  S  A+N+++ LN
Sbjct: 70  WVQVIYNNIAGLHTTCQFNTKIYSLDGSSPHLWHSDTLYNHLFDPDMYSFGADNLALTLN 129

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y +     E  +V+  F R   G  IG  G +YFG D ++  G + H FWP+ +V
Sbjct: 130 EEGDAYTIKSAVNEGSLVNLAFTRKAPGVVIGENGTSYFGTDPANPWGSMSHAFWPRCSV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+ G+G +  A+QGM+PH  ASRWNFVNFQ    S  M EF T P+YGS
Sbjct: 190 EGTITTKEKTYDLKGLGFYSFALQGMKPHHAASRWNFVNFQGPSYSAWMMEFTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V ++K++     N A+ LET+ D E  +  P  I +TW+GK  E D +  A 
Sbjct: 250 TVVNVGGVVKDDKILYAGHTNSAKHLETNTDTENDWPEPKSINFTWDGKGKE-DNEIHAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENE-ELTAKG 291
           LE  L   +D+IDV+ E+P F+K  V +    +PY+YQ+  + +  +K+ E E E + +G
Sbjct: 309 LEGSLGKRLDRIDVMYELPGFVKSFVGSVAGTRPYIYQYSPQEKLTLKVKEGENEFSEQG 368

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 369 TMFSEATFIS 378



>gi|395332152|gb|EJF64531.1| oxidative stress survival Svf1-like protein [Dichomitus squalens
           LYAD-421 SS1]
          Length = 425

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 133/363 (36%), Positives = 193/363 (53%), Gaps = 65/363 (17%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVN--TFKSVNMTNFTLSP---DRRSASANNMSIK 55
             Q+IHS +G+W PTIQFT + F       T+KSVN++NF   P   D+RS+ A+  SI 
Sbjct: 66  MCQVIHSAVGVWYPTIQFTCKIFNPNTKEKTWKSVNVSNFVTPPPGLDKRSSKADQFSIT 125

Query: 56  L-------NPECNKYAVNLTHKELIVSFEFERIDR--GFKIG----GGKTYFGQDK--SS 100
                    PE      NL   +L ++ +  R     GFK G    GG +YFG D   + 
Sbjct: 126 HKSKPGSDTPESYTVTANL-DSDLQITLDIARPASVPGFKTGKGPNGGFSYFGPDPKNAE 184

Query: 101 GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD---- 156
           G+V H+FWP+    G +V  G A  V G G+FVHAIQGMRP+L+A+RWNF +FQSD    
Sbjct: 185 GYVIHRFWPRVQASGLLVHKGHAVQVKGPGMFVHAIQGMRPNLVAARWNFAHFQSDAHGG 244

Query: 157 VASLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGVS---------------VKN 194
           V+++ M +F TT +YG K        ++ GSLV+  KL  V+               V +
Sbjct: 245 VSAIQM-DFTTTNDYGRKGAGSGFVTVSVGSLVLGGKLAAVTAETRWPDEEPAATAGVIS 303

Query: 195 MAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDKID 246
            A   +T+ DP+T Y  PT+I + W   ++  +        I LD+        L++K+D
Sbjct: 304 RAVHSKTAHDPDTSYDAPTEITFRWAAPSIVPEAQGPIDGTIVLDLGSPDAYKGLIEKVD 363

Query: 247 VLNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVKI------GENEELTAKGKLFSECS 298
           VL E+PY +K +V  +VA  KPY+YQW N A+ +V +      G ++    +G L+ E +
Sbjct: 364 VLAEIPYVIKTMVN-YVAGTKPYIYQWLNPAKLNVSLPAGLIEGVSDTAEVEGNLYVEST 422

Query: 299 FIS 301
           FIS
Sbjct: 423 FIS 425



>gi|19075716|ref|NP_588216.1| Svf1 family protein Svf1 [Schizosaccharomyces pombe 972h-]
 gi|1351643|sp|Q09885.1|SVF1_SCHPO RecName: Full=Survival factor 1
 gi|4456834|emb|CAB37424.1| Svf1 family protein Svf1 [Schizosaccharomyces pombe]
          Length = 380

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 178/310 (57%), Gaps = 11/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+IHSN+G W  T Q T R F       + + S NM  F+   D+ S  A N S+ L 
Sbjct: 73  FVQLIHSNLGSWTTTAQSTCRIFDLKHPENDLWTSTNMDQFSFENDKTSFVAKNCSVVLE 132

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQDKSSGF--VEHKFWPKGNV 113
            +  +Y +  + + + I+     +    FKIG  G + +G D S  +  ++H FWP+  V
Sbjct: 133 -DQKRYRIRASINMDSIIDITVHQDAPPFKIGEDGNSTYGTDPSKPWASMKHTFWPRTRV 191

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G++V  GR  DVTG G+FVHA+Q  +PH +AS W F   Q    +  M +F+T P+YGS
Sbjct: 192 EGSIVARGRVVDVTGPGMFVHALQNGKPHHLASSWEFALLQHKKFTAIMMQFKTPPSYGS 251

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLET-DEDFSA 232
             +N G + + +K++  +V N  + +ET+LDP+T++  PT+I Y W+GK  ET  ED   
Sbjct: 252 TIVNIGGIAMKDKIISATVDNTIEHVETTLDPDTEWHEPTRISYEWDGKDAETYTEDIHL 311

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKG 291
            ++  L   + +IDVL E+P +LK  V      KP++YQ+F+  +  +K+G +E +  + 
Sbjct: 312 SVDAPLGRRLQRIDVLAEIPSWLKGFVHGVSGTKPFIYQYFSPVKFTLKMG-DEVIEDEA 370

Query: 292 KLFSECSFIS 301
            LF+E +FIS
Sbjct: 371 TLFNETTFIS 380



>gi|389749744|gb|EIM90915.1| survival factor 1 [Stereum hirsutum FP-91666 SS1]
          Length = 430

 Score =  200 bits (508), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 128/366 (34%), Positives = 201/366 (54%), Gaps = 66/366 (18%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV--NTFKSVNMTNFTLSP---DRRSASANNMSI- 54
            VQ+IHS+IG+W PT+Q T R +       T++S+N++NFT  P   D+RS+ ++  +I 
Sbjct: 66  MVQIIHSSIGVWYPTVQATCRIYNPNTKETTWRSINVSNFTTPPPGLDKRSSRSDQFTIT 125

Query: 55  -----KLNPECNKYAVNLT-----HKELIVSFEFERIDR--GFKIG----GGKTYFGQD- 97
                K +   ++YA + T       +L +S +  R     GFKIG    GG +YFG D 
Sbjct: 126 HKTLPKSSDSPSEYAESYTINVNFSSDLQISLDVRRPTSVPGFKIGKGPKGGYSYFGHDL 185

Query: 98  -KSSGFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD 156
            K  G+V H+FWP+    G+++ +G+A  V G G+FVHAIQGMRP+L+A+RWNF +FQS 
Sbjct: 186 EKPDGYVIHRFWPRAVATGHVIQNGKATSVEGPGMFVHAIQGMRPNLVAARWNFGHFQSQ 245

Query: 157 V---ASLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGVS--------------- 191
                S  + +F T  +YG K        ++ G LV+ NKLV V+               
Sbjct: 246 QHGGVSAILMDFTTINDYGGKGAGSGFVNVSVGGLVIANKLVAVTAETKWPGEEQDANAV 305

Query: 192 VKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMD 243
           VK+ A  L+ + DP+T Y  P+++ + W G +L  +   +    I +D+        L++
Sbjct: 306 VKSRATHLDAAHDPDTGYDEPSRLLFHWAGPSLLPEAPGNVTGTINVDLGGPGKEKGLIE 365

Query: 244 KIDVLNEVPYFLKKIVQAFVA--KPYVYQWFNEAEA------HVKIGENEELTAKGKLFS 295
           K+D L E+P  +K +V ++VA  KPY+YQW N  +        +  G +  L A+G +++
Sbjct: 366 KVDFLAEIPTVVKAVV-SYVAGTKPYIYQWHNPGKITLTGPDEILPGLSGGLEAEGYIYN 424

Query: 296 ECSFIS 301
           EC+FIS
Sbjct: 425 ECTFIS 430



>gi|71021419|ref|XP_760940.1| hypothetical protein UM04793.1 [Ustilago maydis 521]
 gi|46101015|gb|EAK86248.1| hypothetical protein UM04793.1 [Ustilago maydis 521]
          Length = 447

 Score =  199 bits (507), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 131/371 (35%), Positives = 193/371 (52%), Gaps = 73/371 (19%)

Query: 3   QMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSPDRRSASANNMSIKL---N 57
           Q+IHS +GLW P +Q T ++F    G   +KSVN+T F    D+RS+ A   S+     +
Sbjct: 77  QIIHSAVGLWYPQVQMTFKYFNPKTGKRIWKSVNVTKFAAQNDKRSSKAAEFSVDFTTTD 136

Query: 58  PECNKYAVNLT-HKELIVSFEFERID--RGFKIG----GGKTYFGQDKSS--GFVEHKFW 108
              ++Y++     K+L +S+ F R    +G+K+G    GG +YFG +  S  G+V H+FW
Sbjct: 137 AGDDRYSITANLGKDLQLSWSFTRPSAVKGWKLGSGPKGGFSYFGSNLGSPEGYVIHRFW 196

Query: 109 PKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLS-----MC 163
           P     G+++  G A D  G G+FVHAIQGMRP+L+A++WNF NFQ+    L      M 
Sbjct: 197 PVAESDGHIISQGSAIDAKGKGMFVHAIQGMRPNLVAAKWNFANFQAHHEKLGRVSGVMM 256

Query: 164 EFETTPNYGSKK------------INQGSLVVNNKLVGVSV----------------KNM 195
           EF TTP+YGS              +N GS+V   KLV V+                  + 
Sbjct: 257 EFTTTPDYGSVDQAAAQQQRQSLTVNIGSIVAEGKLVCVTAATRAAGAADSQPSHQSNSY 316

Query: 196 AQFLETSLDPETKYKVPTKIKYTWEGKTLETDE---DFSAFLEIKLDV------------ 240
            + L+  LD ET Y+ P  I+Y W+G  L+      D +  ++  L V            
Sbjct: 317 VKHLDKMLDQETDYQAPQSIEYHWQGPLLDASTGKGDIANHVDASLKVDLGKPYPSSETH 376

Query: 241 -LMDKIDVLNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVKI-------GENEELTAK 290
            L+DK+DVL E+PY ++K+V  +VA  KP++YQ  N+A   +K+       G+ E    K
Sbjct: 377 GLVDKVDVLAEIPYMVRKLVN-YVAGTKPFIYQTLNDATLTIKLPESYSGAGKGEATEVK 435

Query: 291 GKLFSECSFIS 301
           G LF E +FIS
Sbjct: 436 GTLFEEHTFIS 446



>gi|343426215|emb|CBQ69746.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 443

 Score =  199 bits (505), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 130/366 (35%), Positives = 187/366 (51%), Gaps = 67/366 (18%)

Query: 3   QMIHSNIGLWNPTIQFTSRFF--GNGVNTFKSVNMTNFTLSPDRRSASANNMSI--KLNP 58
           Q+IHS +GLW P +Q T ++F    G   +KSVN+T F    D+RS+ A   S+     P
Sbjct: 77  QIIHSAVGLWYPQVQMTFKYFNPATGKKIWKSVNVTKFAAQDDKRSSKAAEFSVVFSTTP 136

Query: 59  ECN-KYAVNLT-HKELIVSFEFERID--RGFKIG----GGKTYFGQDKSS--GFVEHKFW 108
             + KY +      EL +S+ F R    +G+K+G    GG +YFG +  S  G+V H+ W
Sbjct: 137 AGDDKYTITANLDAELQISWAFTRPAGVQGWKLGAGPKGGFSYFGSNLGSPEGYVIHRLW 196

Query: 109 PKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLS-----MC 163
           P    +G+++  G A D  G G+FVHAIQGMRP+L+A++WNF NFQ+    L      M 
Sbjct: 197 PVAESEGHIIAKGAAIDAKGRGMFVHAIQGMRPNLVAAKWNFANFQALDDKLGRVSGVMM 256

Query: 164 EFETTPNYG---------SKKINQGSLVVNNKLVGVSVKNMA----------------QF 198
           EF TTP+YG         S  +N GS+V N KLV V+                     + 
Sbjct: 257 EFTTTPDYGTASDAHHRQSLTVNIGSIVANGKLVSVTAATRTAGAPDAEPSRHSNSYIKH 316

Query: 199 LETSLDPETKYKVPTKIKYTWEGKTLETDE---DFSAFLEIKLDV-------------LM 242
           L+ +LD +T Y+ P  I+Y W G  L+      D +  ++  L+V             L+
Sbjct: 317 LDKTLDQDTGYQAPQAIEYHWHGPLLDLASGKGDVAHPVDAVLNVDLGKPYPSSETHGLV 376

Query: 243 DKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKI------GENEELTAKGKLFS 295
           DK+DVL E+PY ++K+V      KPY+YQ  N A   + +      G+ E    KG LF 
Sbjct: 377 DKVDVLAEIPYMVRKLVNVVAGTKPYIYQTLNAATLELTLPATGGEGKGETSKVKGTLFE 436

Query: 296 ECSFIS 301
           E +FIS
Sbjct: 437 EHTFIS 442



>gi|425772076|gb|EKV10501.1| Survival factor 1 [Penicillium digitatum Pd1]
 gi|425777253|gb|EKV15434.1| Survival factor 1 [Penicillium digitatum PHI26]
          Length = 378

 Score =  197 bits (501), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 177/310 (57%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+I+SNI   + T QF  + F   G G N + S  ++NF    +  S  A+N+S+ LN
Sbjct: 70  FVQVIYSNIVGIHTTAQFNVKVFDVSGKGDNKWFSDPLSNFMFDENMLSFGADNLSLTLN 129

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E   Y +  T +   +V  +F +   GF IG  G +YFG D  +  G + H FWP+  V
Sbjct: 130 EESTSYTIKSTVNSGALVDIKFSQTAPGFVIGKDGTSYFGTDPKNPWGSMRHAFWPRCAV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G++    + +D+ G GLF+ A+QGM+PH  A+RWN++NFQ+   S  M E+ T P+YGS
Sbjct: 190 EGSITTKDKTYDLGGRGLFIMALQGMKPHHAAARWNYINFQTPTYSAVMMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G++V + +++     N     E+  D  + +  P  IK+ W GKT +  E  +A 
Sbjct: 250 TTVNVGAIVKDGEIIYAGTTNTVAHTESGQDEGSDWPAPKSIKWEWSGKTTDGKE-LTAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG-ENEELTAKG 291
           +   L   +D+IDV+ EVP F+K I  +    +PY++Q+  + +  +K+   +EE+T +G
Sbjct: 309 VNGALGSRLDRIDVMAEVPGFIKSIAGSVAGTRPYIFQYSPQEKLSLKLKLGDEEITEEG 368

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 369 TMFSEATFIS 378



>gi|169779139|ref|XP_001824034.1| survival factor 1 [Aspergillus oryzae RIB40]
 gi|238499751|ref|XP_002381110.1| oxidative stress protein Svf1, putative [Aspergillus flavus
           NRRL3357]
 gi|83772773|dbj|BAE62901.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220692863|gb|EED49209.1| oxidative stress protein Svf1, putative [Aspergillus flavus
           NRRL3357]
 gi|391874228|gb|EIT83149.1| survival factor 1 [Aspergillus oryzae 3.042]
          Length = 378

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 181/310 (58%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+I+SNI   + T QF ++ F   G+  + + S  + NF       S  A+N+S+ LN
Sbjct: 70  FVQIIYSNIVGIHTTAQFNAKIFNLTGDAPHKWYSDPLYNFMFDESMLSFGADNLSLTLN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y + +  +++ +V+  F R   GF IG  G +YFG D  +  G + H FWP+  V
Sbjct: 130 EEGDAYTLKSAVNEDCLVNITFNRSSPGFVIGKDGTSYFGTDAQNPWGSMSHAFWPRCGV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+ G  +F+H +QGM+PH  A+RWNFVNFQ+   +  M EF T P+YGS
Sbjct: 190 EGTITTKEQTYDLKGRAMFIHGLQGMKPHHAAARWNFVNFQTPTYTAVMMEFTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++   V N A   E + D ++ +  P  IK+ W+GK+ + D+   A 
Sbjct: 250 TVVNVGGIVKDGEIIYAGVTNSATHTEAAQDKDSDWPEPKSIKWVWDGKSKD-DKTVHAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG-ENEELTAKG 291
           L+  L   +D+IDV+ EVP F+K I  +    +PY++Q+  + +  +K+   +EE++ +G
Sbjct: 309 LDGALGRRLDRIDVMAEVPGFIKTIAGSVAGTRPYIFQFAPQEKLTLKLKVGDEEVSEEG 368

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 369 VMFSESTFIS 378



>gi|357529053|sp|Q5BH63.2|SVF1_EMENI RecName: Full=Survival factor 1
 gi|259489688|tpe|CBF90165.1| TPA: Survival factor 1 [Source:UniProtKB/Swiss-Prot;Acc:Q5BH63]
           [Aspergillus nidulans FGSC A4]
          Length = 380

 Score =  196 bits (498), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 116/311 (37%), Positives = 173/311 (55%), Gaps = 11/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGV-NTFKSVNMTNFTLSPDRRSASANNMSIKL 56
            VQ+I+SNI   + T QF  + F   G+G  + + S  + N        S +A+N+S+ L
Sbjct: 71  MVQIIYSNIAGIHTTAQFNCKIFNTSGDGTPHIWFSDPLYNHMFDESMSSFAADNISLSL 130

Query: 57  NPECNKYAVNLTHKE-LIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           N E N Y +     E  +V   F R   GF IG  G TYFG D  +  G + H FWP+ N
Sbjct: 131 NEEGNAYTLKSAVNEGCLVDLTFNRAAPGFAIGKDGTTYFGTDPQNPWGSMRHMFWPRCN 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V G +    +  D+TG G+F  A+QGM+PH  ASRWNF+NFQ+   S  M EF T P+YG
Sbjct: 191 VTGTITTKEKVHDMTGRGMFSQALQGMKPHHAASRWNFINFQTPSFSAIMMEFTTPPSYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           S  +N G +  + +++     N A   E S D  + +  P  IK+ WEGKT +  +  +A
Sbjct: 251 STVVNVGGIAKDGEIIYAGTTNSATHTEASQDETSDWPEPKSIKWVWEGKTKD-GKTVTA 309

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIG-ENEELTAK 290
            ++  L   +D+IDV+ EVP F+K I  +   A+PY++Q+  + +  +K+   +EE T +
Sbjct: 310 EVDGPLGPKLDRIDVMAEVPGFIKTIAGSVAGARPYIFQYSPQQKLSLKLKVGDEEFTEE 369

Query: 291 GKLFSECSFIS 301
           G +FSE +FIS
Sbjct: 370 GSMFSEATFIS 380



>gi|212529268|ref|XP_002144791.1| oxidative stress protein Svf1, putative [Talaromyces marneffei ATCC
           18224]
 gi|210074189|gb|EEA28276.1| oxidative stress protein Svf1, putative [Talaromyces marneffei ATCC
           18224]
          Length = 375

 Score =  196 bits (497), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 177/310 (57%), Gaps = 13/310 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           +VQ+I++NI   + T QF ++ +   G+G + + S  + N    PD  S  A+N+++ LN
Sbjct: 70  WVQVIYNNIAGLHTTCQFNTKIYKLDGSGPHLWYSDTLHNHLFDPDMYSFGADNLALTLN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGG-GKTYFGQD--KSSGFVEHKFWPKGNV 113
              + Y + +  ++  +V+  F R   G  IG  G +YFG D  K  G + H FWP+  V
Sbjct: 130 EAGDSYTIKSAVNENSLVNLTFTRKAPGVVIGNNGTSYFGTDPAKPWGSMSHAFWPRCAV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+ G+G +  A+QGM+PH  A+RWNFVNFQ    S    EF T P+YGS
Sbjct: 190 EGTITTKEKTYDLKGLGFYAFALQGMKPHHAAARWNFVNFQGPSYSAWQMEFITPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +V ++K++     N A+ LET  D E  +  P  IK+TW+GK    D +  A 
Sbjct: 250 TLVSVGGVVKDDKILYAGSTNSAKHLETHNDSENDWPEPKSIKFTWDGK----DNELHAE 305

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENE-ELTAKG 291
           LE  L   +D+IDV+ E+P F+K  V +    KPY+YQ+  + +  +K+ E E E + +G
Sbjct: 306 LEGPLGKRLDRIDVMYELPGFVKSFVGSVAGTKPYIYQYSPQDKLTLKVKEGETEFSEQG 365

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 366 SMFSEATFIS 375



>gi|255953961|ref|XP_002567733.1| Pc21g06910 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211589444|emb|CAP95588.1| Pc21g06910 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 378

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 175/310 (56%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+I+SNI   + T QF  + F   G G N + S  ++NF    +  S  A+N+S+ LN
Sbjct: 70  FVQVIYSNIVGIHTTAQFNVKIFDLSGKGDNKWFSDPLSNFMFDENMLSFGADNLSLTLN 129

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
              + Y +  T +    V  +F R   GF +G  G +YFG D  +  G + H FWP+  V
Sbjct: 130 EVGDSYTIKSTVNSGAQVDIKFSRTAPGFVVGKDGTSYFGTDPKNPWGSMRHAFWPRCAV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+ G G+F+ A+QGM+PH  A+RWNF+NFQ+   S  M E+ T P+YGS
Sbjct: 190 EGTIATKDQTYDLGGRGVFIMALQGMKPHHAAARWNFINFQTPTYSAVMMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++     N     ET  D  + +  P  IK+ W GKT + D+  +A 
Sbjct: 250 TTVNVGGIVKDGEIIYAGTTNSVAHTETGQDEGSDWPAPKSIKWEWSGKTTD-DKALTAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG-ENEELTAKG 291
           +   L   +D+IDV+ EVP F+K I  +    +PY++Q+  + +  +K+   +EE+T +G
Sbjct: 309 VNGALGSRLDRIDVMAEVPGFIKSIAGSVAGTRPYIFQYSPQEKLSLKLKLGDEEITEEG 368

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 369 TMFSESTFIS 378



>gi|443900114|dbj|GAC77441.1| hypothetical protein PANT_26d00050 [Pseudozyma antarctica T-34]
          Length = 537

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 132/378 (34%), Positives = 195/378 (51%), Gaps = 80/378 (21%)

Query: 3   QMIHSNIGLWNPTIQFTSRFFG--NGVNTFKSVNMTNFTLSP---------DRRSASANN 51
           Q+IHS +GLW P +Q T ++F    G   +KSVN+T F   P         D+RS+ A  
Sbjct: 160 QIIHSAVGLWYPQVQMTFKYFNPKTGKKIWKSVNVTKFAAPPSAGAAGPQGDKRSSKAAE 219

Query: 52  MSI---KLNPECNKYAVNLT-HKELIVSFEFER--IDRGFKIG----GGKTYFGQDKSS- 100
            ++         +KY +      +L +S+ F R    +G+K+G    GG +YFG +  S 
Sbjct: 220 FTVLFTTTEAGEDKYTITANLDADLQLSWSFVRPAATQGWKLGAGPKGGFSYFGSNLGSP 279

Query: 101 -GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVAS 159
            G+V H+FWP    +G+++  G A D  G G+FVHAIQGMRP+L+A++WNF NFQ+    
Sbjct: 280 EGYVIHRFWPVAESEGHIISQGTAIDAKGKGMFVHAIQGMRPNLVAAKWNFANFQAQDDK 339

Query: 160 LS-----MCEFETTPNYGSKK----------INQGSLVVNNKLVGVSVK----------- 193
           L      M EF TTP+YGS            +N GS+V + KLV VS             
Sbjct: 340 LGRVSGIMMEFTTTPDYGSVAEGANARESLTVNIGSIVADGKLVAVSAATRSAGSPASEA 399

Query: 194 -----NMAQFLETSLDPETKYKVPTKIKYTWEGKTLET-----DEDFSAFLEIKLDV--- 240
                + A+ L+  LD +T Y+ P  I++ W+   L++     D D     ++K+D+   
Sbjct: 400 SRKSNSFARHLDPMLDQDTGYQAPQAIEFHWQAPLLDSASGKGDVDHKVEAQLKVDLGKP 459

Query: 241 --------LMDKIDVLNEVPYFLKKIVQAFVA--KPYVYQWFNEA-------EAHVKIGE 283
                   L+DK+DVL E+PY ++K+V  +VA  KPY+YQ  N A       E +   G+
Sbjct: 460 YPSSETHGLVDKVDVLAEIPYMVRKLVN-YVAGTKPYIYQTLNPATLTLTLPEQYAGAGK 518

Query: 284 NEELTAKGKLFSECSFIS 301
            E  + KG LF E +FIS
Sbjct: 519 GESTSIKGTLFEEHTFIS 536



>gi|213408110|ref|XP_002174826.1| Svf1 family protein [Schizosaccharomyces japonicus yFS275]
 gi|212002873|gb|EEB08533.1| Svf1 family protein [Schizosaccharomyces japonicus yFS275]
          Length = 381

 Score =  193 bits (491), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 174/310 (56%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF--GNGVNT-FKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+IHSN+G W  T Q   R F   N  N  + S N++ FT   +++S  A+ +S +L 
Sbjct: 73  FVQIIHSNLGSWTTTAQVVCRVFDLSNPENDLWTSTNLSEFTFEDNKQSFKADKVSFQLQ 132

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQDKSSGF--VEHKFWPKGNV 113
           P+   Y V  +   + I+ F FER+   FKIG    T +G D +  +  ++H FWP+ +V
Sbjct: 133 PDRRSYKVQCSVCMDSIIDFTFERLAPPFKIGEHATTSYGTDHTKPWATMKHSFWPRASV 192

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
            G++V  G+  DVTG G+FVHA+Q  +P  +   W F        +  M +F+T P+YGS
Sbjct: 193 TGSIVAHGKVIDVTGSGMFVHALQNGKPQHLGCAWEFALLLHSKYTAVMMQFKTPPSYGS 252

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLET-DEDFSA 232
             +N G +  +  +V  +VKN      T LDP+T+++ PT+I+Y W GK  ET  +D   
Sbjct: 253 AVVNVGGIATDEGVVAATVKNSVVHKATKLDPDTEWQEPTRIEYVWSGKDAETFTKDVKL 312

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKG 291
            ++ +L   +++IDVL+E+P +L+  V      KP++YQ+ +     + IG +E +    
Sbjct: 313 EVDAELARRLERIDVLSEIPSWLRGFVHGISGTKPFIYQYNSPVTFSLTIG-DEVIHEDA 371

Query: 292 KLFSECSFIS 301
            LF+E +FIS
Sbjct: 372 VLFNETTFIS 381



>gi|505757681|gb|EOR01802.1| Survival factor 1 [Wallemia ichthyophaga EXF-994]
          Length = 419

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 188/359 (52%), Gaps = 60/359 (16%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFF--GNGVNTFKSVNMTNFTLSP-------DRRSASANNM 52
           VQ++HS++G W P IQF    +    G   +KS++  NF+  P       DRRS SA+  
Sbjct: 61  VQVVHSHVGFWYPQIQFNFMLYTPSTGQKLWKSISANNFSSPPSFSTNKYDRRSCSADQF 120

Query: 53  SI-----KLNPECNKYAVNLTHK-ELIVSFEFERIDRGFKIG----GGKTYFGQDKSS-- 100
           SI         EC +    + ++ +++++F       GFK+G    GG T  G DKSS  
Sbjct: 121 SILHEQLPNQDECYRINAKIDNEVQIVINFIRPASCSGFKLGNGPNGGFTSLGNDKSSNK 180

Query: 101 --GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD-- 156
             G+V H+FWP+   +G ++V G+  D  G G F+HAIQGMR +LIA  WNF  FQS+  
Sbjct: 181 RDGYVVHRFWPRVRTEGQVIVRGKLVDAIGHGTFIHAIQGMRANLIARAWNFALFQSNQH 240

Query: 157 --VASLSMCEFETTPNYGSK---------KINQGSLVVNNKLVGVSVK-----------N 194
             VAS+ M EFE+T  YG+          K+  G+LV  +KL+ V+              
Sbjct: 241 GGVASILM-EFESTEGYGAATRTEGGGGVKVTIGALVAGDKLLSVTGSTTYPGQMPQGLT 299

Query: 195 MAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEI----KLDV---LMDKIDV 247
            A+   T  DPET Y VP++++Y W G  +E  +     + +    K DV   L++K+D 
Sbjct: 300 AAEHRNTLKDPETSYIVPSEVRYVWGGTAIENKKAIRGEMLVNYKEKNDVSRGLIEKVDF 359

Query: 248 LNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVK----IGENEELTAKGKLFSECSFIS 301
           L  +PY ++K V  F   KPY+YQ+ N  E  +     + E+ +LT +G  F+E SFIS
Sbjct: 360 LAHIPYVVRKAVHVFAKTKPYIYQYLNPTELQLDLPEGVAESTKLTVQGTAFTEQSFIS 418



>gi|70997443|ref|XP_753469.1| oxidative stress protein Svf1 [Aspergillus fumigatus Af293]
 gi|74673484|sp|Q4WVE5.1|SVF1_ASPFU RecName: Full=Survival factor 1
 gi|66851105|gb|EAL91431.1| oxidative stress protein Svf1, putative [Aspergillus fumigatus
           Af293]
 gi|159126801|gb|EDP51917.1| conserved hypothetical protein [Aspergillus fumigatus A1163]
          Length = 396

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 111/329 (33%), Positives = 183/329 (55%), Gaps = 30/329 (9%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SNI   + T QF S+ F   G+  + + S  + NF    +  S  A+N+++ LN
Sbjct: 70  MVQVIYSNIAGIHTTAQFNSKIFNLKGDQPHIWHSDPLYNFMFDENMLSFGADNLALTLN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E   Y + +  +++ +V+  F R   GF +G  G +YFG D ++  G + H FWP+  V
Sbjct: 130 EEGTAYTIKSAVNEDSLVNLTFTRTAPGFVVGKDGTSYFGTDPANPWGSMMHAFWPRCRV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +    + +D+TG G+F+HAIQGM+PH  A+RWNF+NFQ+   S  M E+ T P+YGS
Sbjct: 190 EGTITTKEKTYDLTGRGMFIHAIQGMKPHHAAARWNFINFQTPSYSAVMMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V +++++     N A    ++ D ++ +  PT IK  W+GK+ +  +D  A 
Sbjct: 250 TVVNVGGIVKDDEIIYAGATNSATHTASAHDADSDWPAPTSIKCVWDGKSKD-GKDVHAE 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQ-----------------WFNEA 275
           L+  L   +D++DV+ EVP F+K I  +    +PY++Q                  ++  
Sbjct: 309 LDGPLGNRLDRVDVMAEVPGFVKTIAGSVAGTRPYIFQVSLSLATGGSVVKLTIGQYSPQ 368

Query: 276 EA---HVKIGENEELTAKGKLFSECSFIS 301
           E     +KIG  EE + +G +FSE +FIS
Sbjct: 369 EKLSLKLKIGA-EEFSEEGSMFSEATFIS 396



>gi|485927224|gb|EOD51306.1| putative survival factor 1 protein [Neofusicoccum parvum UCRNP2]
          Length = 378

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/310 (35%), Positives = 170/310 (54%), Gaps = 11/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF----GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
             Q+I+SN+     T QF ++ F    G   N + S  ++N        +  A+N S++L
Sbjct: 71  MAQVIYSNVAGIRTTCQFNTKIFYNDGGKTPNLWSSDPLSNTRFDDAMHNFYADNCSVEL 130

Query: 57  NPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
             + + Y + + T+K+ IVS +  +   GF +G  G +YFG D ++  G + H FWP+  
Sbjct: 131 AADGSSYTIKSSTNKQSIVSLKIAKSAPGFVVGKNGTSYFGTDPANPWGSMRHAFWPRCK 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G+++      D  G G FVHA+QGM+PH  A+RWNFVNFQS   S  M E+ T P+YG
Sbjct: 191 VEGSILTQAGEIDFGGRGFFVHALQGMKPHHAAARWNFVNFQSPTYSAVMMEYTTPPSYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           S  ++ G +  + K++     N A   E   D +  +  P    Y W+GKT +  +   A
Sbjct: 251 STDVSVGGIATDGKIIFAGAHNTATHTEKKQDSDNDWPEPLSASYVWDGKTAD-GKAVHA 309

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIV-QAFVAKPYVYQWFNEAEAHVKIGENEELTAKG 291
            L   L  L+D++DV+ EVP F+K IV  A   KPY+YQ+  +    +K G+ EE T +G
Sbjct: 310 ELSGSLGQLVDRVDVMAEVPGFVKAIVASAAGTKPYIYQYHPKLTIKIKEGD-EEKTEEG 368

Query: 292 KLFSECSFIS 301
            LF+E +FIS
Sbjct: 369 VLFTEATFIS 378



>gi|400598031|gb|EJP65751.1| survival factor 1 [Beauveria bassiana ARSEF 2860]
          Length = 384

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 171/309 (55%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT---FKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+     T QF S+ F    +    + S  + NF +S D+ S  A++ +++L+
Sbjct: 71  MAQVIYSNVAGIRKTCQFNSKIFSTDPSMPHLWSSTPLNNFEISEDKGSFYADDCALELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N Y + +L  +  IV+ +  +   GF+ G  G + +G D     G++ H FWP+  V
Sbjct: 131 ADGNSYTIKSLNDERAIVNIKVTKTAPGFQAGTTGTSSYGTDPKEPWGWMRHAFWPRCAV 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G GL+++A+QGM+PH  A+RW+F+NFQ    S  M +F T P+YG 
Sbjct: 191 EGTITTADGPVDFAGRGLYIYALQGMKPHHAAARWSFLNFQGPSHSAVMMQFTTPPSYGC 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G + V+  +VG    +         DPE+ +  PTK  + W  K  + +    A 
Sbjct: 251 TVVNVGGVAVDGAIVGAGCGSTVNHTAIETDPESGWPAPTKATFAWHVKDKDGNP-VEAE 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
           ++  L   +D++DV+ EVP F+K+IV   V  KPY+YQ+  EA   +K+G ++E+T KG 
Sbjct: 310 IDAALGKRIDRVDVMAEVPAFVKRIVAGAVGTKPYIYQYSVEATLKLKVG-DKEITEKGH 368

Query: 293 LFSECSFIS 301
           +FSE +FIS
Sbjct: 369 IFSEATFIS 377



>gi|393231521|gb|EJD39113.1| oxidative stress survival, Svf1-like protein [Auricularia delicata
           TFB-10046 SS5]
          Length = 420

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/356 (34%), Positives = 191/356 (53%), Gaps = 57/356 (16%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV--NTFKSVNMTNFTLS---PDRRSASANNMSIK 55
            +Q+IH+++G+W PT+QF    +        + S N++NF+ +    D+RS  A   ++ 
Sbjct: 63  MLQVIHASVGVWYPTVQFVVHVYDPKTKERVWSSTNVSNFSATGGKEDKRSCKAKEFTVV 122

Query: 56  LNPECNKYAVNLTH---KELIVSFEFERID--RGFKIG----GGKTYFGQDKSS--GFVE 104
            +      +  +T    K+L VS    R     G+K+G    GG+++FG+D  S  G+V 
Sbjct: 123 HSDAGGSESYTITAQPAKDLQVSVVVTRAADAPGWKLGKGPKGGRSFFGRDPDSPDGYVV 182

Query: 105 HKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDV---ASLS 161
           H+FWP+ +  G++V  G+A  V G G+ VHAIQGMRP+L+A RWNF +FQS+     S  
Sbjct: 183 HRFWPRTHTSGHIVYKGKAISVDGSGMLVHAIQGMRPNLVACRWNFAHFQSEALGGTSAI 242

Query: 162 MCEFETTPNYGSK-------KINQGSLVVNNKLVGVS----------------VKNMAQF 198
           M E  TT  +G +       K+N GS+VV  KLV V+                V + A  
Sbjct: 243 MMELTTTRAHGPEGMGSGNVKVNIGSIVVGGKLVAVTGETHLPRVPEKTTERPVVSRATH 302

Query: 199 LETSLDPETKYKVPTKIKYTWEGKTL-ETDEDFSAFLEIKLDV------LMDKIDVLNEV 251
           LE   DPET+Y+VPTKI+++W G  + +  ++ SA L   +        L+ K+D L E+
Sbjct: 303 LEPQKDPETEYQVPTKIEFSWRGPAIVDGAQEVSASLTTDVGTPQAPIGLIQKVDFLGEI 362

Query: 252 PYFLKKIVQAFVA--KPYVYQWFNEAEAHVKI-----GENEELTAKGKLFSECSFI 300
           P  +K +V ++VA  KPY+YQW N A+  ++         EE+   G L +E +FI
Sbjct: 363 PSAIKGVV-SYVAGVKPYIYQWANPAKLTLRAKGLLPDGQEEVVVDGWLNNEATFI 417



>gi|392564271|gb|EIW57449.1| oxidative stress survival Svf1-like protein [Trametes versicolor
           FP-101664 SS1]
          Length = 425

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/363 (33%), Positives = 194/363 (53%), Gaps = 65/363 (17%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV--NTFKSVNMTNFTLSP---DRRSASANNMSIK 55
             Q+IHS++G+W PTIQFT + F       T+KSVN++NF   P   D+RS+ A+  SI 
Sbjct: 66  MCQVIHSSVGVWYPTIQFTCKIFNPNTKERTWKSVNVSNFVTPPPGLDKRSSKADEFSIT 125

Query: 56  L-------NPECNKYAVNLTHKELIVSFEFERIDR--GFKIG----GGKTYFGQDKSS-- 100
                    PE      NL   +L ++ +  R     GFK+G    GG +YFG D  S  
Sbjct: 126 YKPKPGSDTPESYVLTANLG-DDLQITLDIARAASAPGFKVGAGPNGGFSYFGPDPKSAE 184

Query: 101 GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD---- 156
           G+V H+FWP+    G +V  G+A  V G G+FVHAIQGMRP+L+A+RWNF  F S+    
Sbjct: 185 GYVVHRFWPRTQATGMIVHKGQAISVKGPGMFVHAIQGMRPNLVAARWNFALFHSEQHGG 244

Query: 157 VASLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGVSVKN-------------MA 196
           V+++ M +F TT  YG K        ++ G LV+  KL  V+ +              ++
Sbjct: 245 VSAVQM-DFTTTEAYGRKGNGSGFVTVSVGGLVLGGKLATVTAETKWPDEEYAPSGGIIS 303

Query: 197 QFLET--SLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDKID 246
           + + +  + D +T Y+ PT++ + W   ++ +D   +      +D+        L++K+D
Sbjct: 304 RIIHSKKAHDVDTGYEAPTEVTFRWAAPSILSDAQGTLDATATVDLGTPDAYSGLVEKVD 363

Query: 247 VLNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVKIGE------NEELTAKGKLFSECS 298
           VL E+PY +K +V  +VA  KPY+YQW N +  HV +        ++++   G +++E +
Sbjct: 364 VLAEIPYVIKTMVN-YVAGTKPYIYQWQNPSTLHVNLPAGIIPDVSDQVEVAGTMYNEAT 422

Query: 299 FIS 301
           FIS
Sbjct: 423 FIS 425



>gi|328859091|gb|EGG08201.1| hypothetical protein MELLADRAFT_105166 [Melampsora larici-populina
           98AG31]
          Length = 448

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 186/367 (50%), Gaps = 72/367 (19%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT--FKSVNMTNFTLSP----------DRRSAS 48
             Q+IHS +GLW P IQFT R++     T  +KS N+TNF +SP          DRRS  
Sbjct: 77  MCQVIHSAVGLWYPQIQFTFRYYDPETKTHVWKSTNVTNFKVSPPSNSKPKVNYDRRSCK 136

Query: 49  ANNMSIKLNP-ECNKYAVNLTHKELI-VSFEFERID--RGFKIG----GGKTYFGQDK-- 98
           ++  SI L+P + N Y VN  H   + + F   ++    G+K+G    GG TYFG     
Sbjct: 137 SDQFSILLDPSQPNTYHVNGQHDNNVSLDFSITQLSGVPGWKLGHDAQGGFTYFGNSNGK 196

Query: 99  -------------SSGFVEHKFWPKGNVKGNMVVDGRAFDV-TGVGLFVHAIQGMRPHLI 144
                        S G+V H+FWP+  + G + +DG+   + TG  +F+HA+QGMRP+LI
Sbjct: 197 KPQVGNKPDTTAGSDGYVVHRFWPRCTLTGEINIDGQRIQLDTGRAIFIHAVQGMRPNLI 256

Query: 145 ASRWNFVNFQS---------DVASLSMCEFETTPN--YG-SKKINQGSLVVNNKLVGVSV 192
           ASRWNF NFQS            SL   EF T P   YG ++ I      V + L+ V+ 
Sbjct: 257 ASRWNFCNFQSVPTGGEEEDQGVSLITMEFTTVPGSYYGPAQTITVDRATVPDTLLSVAG 316

Query: 193 KNMAQFLETS---LDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------- 240
              AQ        LD +T Y+ P  + + W+G  +E + +  A   +KLD+         
Sbjct: 317 SPRAQTTHEGPFMLDSDTGYQAPAGLSFAWKGPVIEGEGELKA--GVKLDLTSSSTTNYE 374

Query: 241 ---LMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEE------LTAK 290
              L++K+DV+ ++PY +KK V     A+PY+Y W N A+A +++  + E      +T  
Sbjct: 375 TKGLIEKVDVMAQIPYLIKKFVATVAGARPYIYTWHNPAQATIEMPSSTEASGSKTITVD 434

Query: 291 GKLFSEC 297
           G +F+ C
Sbjct: 435 GYMFNVC 441



>gi|398391969|ref|XP_003849444.1| hypothetical protein MYCGRDRAFT_75690 [Zymoseptoria tritici IPO323]
 gi|339469321|gb|EGP84420.1| hypothetical protein MYCGRDRAFT_75690 [Zymoseptoria tritici IPO323]
          Length = 376

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/312 (34%), Positives = 175/312 (56%), Gaps = 13/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF----GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
             Q+I+S++     T QF+S+ F        N + S N++N+  S D     A+  S++L
Sbjct: 67  MAQVIYSDVMGVRNTAQFSSKIFYPKESGKTNVWSSDNLSNYKFSKDNLDFKADGCSMEL 126

Query: 57  NPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           +P+ N Y + + T K+ IV  +F +   GF +G  G + FG D  +  G ++H FWP   
Sbjct: 127 SPDGNTYHIKSSTGKKAIVDLKFTKTAPGFAVGKNGVSTFGTDPKAPWGKMKHGFWPTCK 186

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G++V+     D  G G+ V A+QGM+PH  A++WNF NFQS   S  + +F T P+YG
Sbjct: 187 VEGSIVIKEGPVDFKGRGMAVFALQGMKPHFAAAKWNFCNFQSPTYSAVLMDFTTPPSYG 246

Query: 173 SKKINQGSLVVNNKLV--GVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDF 230
              +  G + V  +++  G S     +  E   DPE  +  P+ + Y+W+GKT +  +D 
Sbjct: 247 PSTVAVGGIAVEGEILFAGASPDVRVEHTEIKGDPENGWPEPSAVVYSWKGKTKD-GKDA 305

Query: 231 SAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTA 289
           SA +   L+   D++DV+ EVP F+K+IV      KPY+YQ+  +    +KIG +EE T 
Sbjct: 306 SAEIRTALEPRTDRLDVMGEVPKFVKQIVVGVAGTKPYIYQYDQKMTIKIKIG-DEEKTE 364

Query: 290 KGKLFSECSFIS 301
           +G+ F+E +FI+
Sbjct: 365 EGRTFAEATFIT 376



>gi|327297334|ref|XP_003233361.1| SVP1-like protein [Trichophyton rubrum CBS 118892]
 gi|326464667|gb|EGD90120.1| SVP1-like protein [Trichophyton rubrum CBS 118892]
          Length = 379

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 170/310 (54%), Gaps = 11/310 (3%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLNP 58
           +Q+I++N+   + T QF  + F       + + S  + N   + D  S   +N++I LN 
Sbjct: 71  LQLIYNNVVGLHTTCQFNCKVFSKDPAKPHLWASDPVQNHIFAEDMLSFGGDNVAISLND 130

Query: 59  ECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVK 114
           E   Y + +  +++ +V+    R   GF  G  G + FG D  +  G + H FWP+  V+
Sbjct: 131 EGTAYTIKSAINEDSLVNVTITRTAPGFVAGKDGISTFGTDPMNPWGSMRHAFWPRCKVE 190

Query: 115 GNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSK 174
           G+++   R  D  G G FVHA+QGM+PH +A+RWNFV+FQS   S SM E+ T P+YGS 
Sbjct: 191 GSIITREREIDFAGKGFFVHALQGMKPHHLAARWNFVDFQSPTFSASMMEYTTPPSYGST 250

Query: 175 KINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFL 234
            +N G +  + +++     N     E + D E  +  PT +K TW GKT    + F A +
Sbjct: 251 VVNVGGVAKDGEIIYAGAPNSITHTEATQDSENDWPEPTALKITWSGKT-ANGKLFEAII 309

Query: 235 EIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF--NEAEAHVKIGENEELTAKG 291
           E  L   MD+IDV+ EVP  +K +V +    +PYVYQ+   ++    +K+G+ EE+T +G
Sbjct: 310 EGSLGQRMDRIDVMAEVPGLIKSLVGSVAGTRPYVYQFIPPHKLPIKIKVGDGEEITEEG 369

Query: 292 KLFSECSFIS 301
            L  E +FIS
Sbjct: 370 TLLMEATFIS 379



>gi|261198264|ref|XP_002625534.1| survival factor 1 [Ajellomyces dermatitidis SLH14081]
 gi|239595497|gb|EEQ78078.1| survival factor 1 [Ajellomyces dermatitidis SLH14081]
 gi|239607877|gb|EEQ84864.1| survival factor 1 [Ajellomyces dermatitidis ER-3]
 gi|327355818|gb|EGE84675.1| survival factor 1 [Ajellomyces dermatitidis ATCC 18188]
          Length = 380

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 109/311 (35%), Positives = 177/311 (56%), Gaps = 12/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT---FKSVNMTNFTLSPDRRSASANNMSIKLN 57
            +Q+I+SN+   + T  F S+ +G    T   + + ++ N+    D  S   +N+++ LN
Sbjct: 72  MLQVIYSNVAGIHTTCHFNSKIYGTDGKTPHKWCTDSVQNYMFDEDMLSFGGDNIALTLN 131

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y+V +  ++E +V+   +R   GF +G  G + FG D  +  G + H FWP+  V
Sbjct: 132 AEGDTYSVKSAMNEESLVNVTLKRTAPGFAVGRNGTSNFGTDPENPWGSMRHVFWPRCQV 191

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +V   R  D  G GLF+HA+QGM+PH +A+RWNF  FQS   S    E+ T P+YGS
Sbjct: 192 EGTIVTPEREIDFKGRGLFIHALQGMKPHHLAARWNFGAFQSPTYSAVFMEYTTPPSYGS 251

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  + +LV     N A  L++  D    +  P  IK+TW+GK+ + D+D  A 
Sbjct: 252 TIVSVGGIAKDGELVVAGPVNPAIHLDSVEDTYNDWPEPKSIKFTWDGKSKD-DKDVEAV 310

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKI--GENEELTAK 290
           LE  L   +D++DV+ EVP  +K IV +    +PY+YQ+  + +  +KI  G+ E+ T +
Sbjct: 311 LEGSLGQRLDRVDVMAEVPGLIKSIVGSVAGTRPYIYQFSPQDKLSLKIRVGDTED-TER 369

Query: 291 GKLFSECSFIS 301
           G L+SE +FIS
Sbjct: 370 GTLYSEATFIS 380



>gi|302662066|ref|XP_003022692.1| hypothetical protein TRV_03153 [Trichophyton verrucosum HKI 0517]
 gi|291186652|gb|EFE42074.1| hypothetical protein TRV_03153 [Trichophyton verrucosum HKI 0517]
          Length = 379

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 171/310 (55%), Gaps = 11/310 (3%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLNP 58
           +Q+I++N+   + T QF  + F       + + S  + N   + D  S   +N++I LN 
Sbjct: 71  LQLIYNNVVGLHTTCQFNCKVFSKDPAKPHLWASDPVQNHIFAEDMLSFGGDNVAITLNE 130

Query: 59  ECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVK 114
           E   Y + +  +++ +V+    R   GF  G  G + FG D  +  G + H FWP+  V+
Sbjct: 131 EGTAYTIKSAINEDSLVNVTITRTAPGFVAGKDGISTFGTDPMNPWGSMRHAFWPRCKVE 190

Query: 115 GNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSK 174
           G+++   R  D  G G FVHA+QGM+PH +A+RWNFV+FQS   S  M E+ T P+YGS 
Sbjct: 191 GSIITREREIDFAGKGFFVHALQGMKPHHLAARWNFVDFQSPTFSAIMMEYTTPPSYGST 250

Query: 175 KINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFL 234
            +N G +  + +++     N     E + D E  +  PT +K TW GKT +  + F+A +
Sbjct: 251 IVNVGGVAKDGEIIYAGAPNSITHTEATQDSENDWPEPTALKITWSGKTAD-GKPFTAII 309

Query: 235 EIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF--NEAEAHVKIGENEELTAKG 291
           E  L   MD+IDV+ EVP  +K +V +    +PYVYQ+   ++    +K+G+ EE+T +G
Sbjct: 310 EGSLGQRMDRIDVMAEVPGLIKSLVGSVAGTRPYVYQFIPSHKLPIKIKVGDEEEITEEG 369

Query: 292 KLFSECSFIS 301
            L  E +FIS
Sbjct: 370 TLLMEATFIS 379



>gi|326472400|gb|EGD96409.1| SVP1-like protein [Trichophyton tonsurans CBS 112818]
          Length = 379

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 171/310 (55%), Gaps = 11/310 (3%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLNP 58
           +Q+I++N+   + T QF  + F       + + S  + N   + D  S   +N++I LN 
Sbjct: 71  LQLIYNNVVGLHTTCQFNCKVFSKDPAKPHLWASDPVQNHIFAEDMLSFGGDNVAITLNE 130

Query: 59  ECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVK 114
           E   Y + +  +++ +V+    R   GF  G  G + FG D  +  G ++H FWP+  V+
Sbjct: 131 EGTAYTIKSAINEDSLVNVTITRTAPGFVAGKDGISTFGTDPMNPWGSMKHAFWPRCKVE 190

Query: 115 GNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSK 174
           G+++   R  D  G G FVHA+QGM+PH +A+RWNFV+FQS   S  M E+ T P+YGS 
Sbjct: 191 GSIITREREIDFAGKGFFVHALQGMKPHHLAARWNFVDFQSPTFSAGMMEYTTPPSYGST 250

Query: 175 KINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFL 234
            +N G +  + +++     N     E + D E  +  PT +K TW GKT    + F A +
Sbjct: 251 VVNVGGVAKDGEVIYAGAPNSITHTEATQDSENDWPEPTALKITWSGKT-AGGKPFEAII 309

Query: 235 EIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF--NEAEAHVKIGENEELTAKG 291
           E  L   MD+IDV+ EVP  +K +V +    +PYVYQ+   ++    +K+G++EE+T +G
Sbjct: 310 EGSLGQRMDRIDVMAEVPGLIKSLVGSVAGTRPYVYQFIPSHKLPIKIKVGDDEEITEEG 369

Query: 292 KLFSECSFIS 301
            L  E +FIS
Sbjct: 370 TLLMEATFIS 379



>gi|258567604|ref|XP_002584546.1| survival factor 1 [Uncinocarpus reesii 1704]
 gi|237905992|gb|EEP80393.1| survival factor 1 [Uncinocarpus reesii 1704]
          Length = 378

 Score =  186 bits (473), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 176/310 (56%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SN+   + T QF ++ +       + + S  + N+    D  S   +N+++ LN
Sbjct: 70  MVQVIYSNVAGLHTTCQFNTKIYWADPQKPSNWFSDPIQNYLFDEDMLSFGGDNIALTLN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + +  ++  +V+  F R+  GF +G  G + FG D ++  G + H FWP+  V
Sbjct: 130 GDGTAYTIKSALNESCLVNLTFTRLTPGFVVGNDGTSNFGTDPANPWGSMRHAFWPQCKV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G+++      +  G G FVHA+QGM+PH +A+RWNF NFQS   S  + E+ T P+YGS
Sbjct: 190 EGSIITPDAELNCAGRGFFVHALQGMKPHHLAARWNFANFQSPTISAFVMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++     N A  +ET+ D + ++  PT +KYTW G+T +  E  +A 
Sbjct: 250 TVVNVGGIVKDGEIIHAGTSNTASHVETTQDSDNEWPEPTVVKYTWSGQTKDGKE-VNAT 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENE-ELTAKG 291
           LE  L   +D++DV+ EVP  +K IV +    KPY+YQ+  + +  +K+   + +   +G
Sbjct: 309 LEGSLGQRLDRVDVMAEVPAIIKSIVGSVAGTKPYIYQFSPKEKLSLKLRLGDTDFAEEG 368

Query: 292 KLFSECSFIS 301
            L+SE +FIS
Sbjct: 369 TLYSEATFIS 378



>gi|390595496|gb|EIN04901.1| survival factor 1 [Punctularia strigosozonata HHB-11173 SS5]
          Length = 425

 Score =  186 bits (472), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 132/361 (36%), Positives = 190/361 (52%), Gaps = 65/361 (18%)

Query: 3   QMIHSNIGLWNPTIQFTSRFFGNGVN--TFKSVNMTNFTLSP---DRRSASANNMSIKLN 57
           Q+IHS++GLW P IQFT + F       T+KSVN+++F   P   D+RS+ A+  SI   
Sbjct: 68  QLIHSSVGLWYPQIQFTCKTFNPRTKEKTWKSVNISHFVCPPPGLDKRSSKADQFSITHK 127

Query: 58  P-------ECNKYAVNLTHKELIVSFEFERIDR--GFKIG----GGKTYFGQD--KSSGF 102
           P       E      NL   +L +S +  R     GFK+G    GG +YFG D  K+ G+
Sbjct: 128 PSPSGDNAEGYTITANLA-DDLQLSLDVTRPASTPGFKVGKGPKGGYSYFGYDPEKADGY 186

Query: 103 VEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQS----DVA 158
           V H+FWP  +  G ++  G+A  V G G+FVHAIQGMRP+L+ASRWNF  F+S     V 
Sbjct: 187 VIHRFWPLTHAAGTLITKGQAIPVKGPGMFVHAIQGMRPNLVASRWNFAYFESAEQGGVT 246

Query: 159 SLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGV---------------SVKNMA 196
           ++ M +F T   +G K        ++ G +V+  KL  V               SV + A
Sbjct: 247 AVQM-DFTTLDTHGRKGPGSGGVTVSVGGVVLGGKLASVTTETRWPDEPLPESTSVISRA 305

Query: 197 QFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDKIDVL 248
             L+ + D ET Y +PT+I+Y W   ++  D        +++ V        L++K+DVL
Sbjct: 306 IHLQPTKDAETGYDLPTEIEYKWAAPSIVADAPGEVNASLRIAVGGPSEASGLVEKVDVL 365

Query: 249 NEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVK------IGENEELTAKGKLFSECSFI 300
            E+PY LK  V  +VA  KPY+YQW N A   VK       G +  L  +G+L++E +FI
Sbjct: 366 GEIPYALKMAVN-YVAGTKPYIYQWLNPATLVVKGPDSLIPGLSAGLEVQGRLYNEATFI 424

Query: 301 S 301
           S
Sbjct: 425 S 425



>gi|393235544|gb|EJD43098.1| oxidative stress survival, Svf1-like protein [Auricularia delicata
           TFB-10046 SS5]
          Length = 420

 Score =  186 bits (471), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 121/356 (33%), Positives = 189/356 (53%), Gaps = 57/356 (16%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV--NTFKSVNMTNFTLS---PDRRSASANNMSIK 55
            +Q+IH+++G+W PT+QF    +        + S N++NF+ +    D+RS  A   ++ 
Sbjct: 63  MLQVIHASVGVWYPTVQFVVHVYDPKTKERVWSSTNVSNFSATGGKEDKRSCKAKEFTVV 122

Query: 56  LNPECNKYAVNL---THKELIVSFEFERID--RGFKIG----GGKTYFGQDKSS--GFVE 104
            +      +  +     K+L VS    R     G+K+G    GG+++FG+D     G+V 
Sbjct: 123 HSDAGGSESYTIMAQPAKDLQVSVVLTRAADAPGWKLGKGPKGGRSFFGRDPDGPDGYVV 182

Query: 105 HKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDV---ASLS 161
           H+FWP+ +  G++V  G+A  V G G+ VHAIQGMRP+L+A RWNF +FQS+     S  
Sbjct: 183 HRFWPRTHTSGHIVYKGKAISVDGSGMLVHAIQGMRPNLVACRWNFAHFQSEAFGGTSAI 242

Query: 162 MCEFETTPNYGSK-------KINQGSLVVNNKLVGVS----------------VKNMAQF 198
           M E  TT  +G +       K+N GS+VV  KLV V+                V + A  
Sbjct: 243 MMELTTTRAHGPEGMGSGNVKVNIGSIVVGGKLVAVTGETHLPRVPEKTTERPVVSRATH 302

Query: 199 LETSLDPETKYKVPTKIKYTWEGKTL-ETDEDFSAFLEIKLDV------LMDKIDVLNEV 251
           LE   DPET+Y+VPTKI+++W G  + +  ++ SA L   +        L+ K+D L E+
Sbjct: 303 LEPQKDPETEYQVPTKIEFSWRGPAIVDGAQEVSASLTTDVGTPQAPIGLIQKVDFLGEI 362

Query: 252 PYFLKKIVQAFVA--KPYVYQWFNEAEAHVKI-----GENEELTAKGKLFSECSFI 300
           P  +K +V ++VA  KPY+YQW N A+  ++         EE+   G L +E +FI
Sbjct: 363 PSAIKGVV-SYVAGVKPYIYQWANPAKLTLRAKGLLPDGQEEVVVDGWLNNEATFI 417



>gi|302511059|ref|XP_003017481.1| hypothetical protein ARB_04362 [Arthroderma benhamiae CBS 112371]
 gi|291181052|gb|EFE36836.1| hypothetical protein ARB_04362 [Arthroderma benhamiae CBS 112371]
          Length = 379

 Score =  186 bits (471), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 170/310 (54%), Gaps = 11/310 (3%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLNP 58
           +Q+I++N+   + T QF  + F       + + S  + N   + D  S   +N++I LN 
Sbjct: 71  LQLIYNNVVGLHTTCQFNCKVFSKDPAKPHLWASDPVQNHIFAEDMLSFGGDNVAITLNE 130

Query: 59  ECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVK 114
           E   Y + +  +++ +V+    R   GF  G  G + FG D  +  G + H FWP+  V+
Sbjct: 131 EGTAYTIKSAINEDSLVNVTITRTAPGFVAGKDGISTFGTDPMNPWGSMRHAFWPRCKVE 190

Query: 115 GNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSK 174
           G+++   R  D  G G FVHA+QGM+PH +A+RWNFV+FQS   S  M E+ T P+YGS 
Sbjct: 191 GSIITREREIDFAGKGFFVHALQGMKPHHLAARWNFVDFQSPTFSAIMMEYTTPPSYGST 250

Query: 175 KINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFL 234
            +N G +  + +++     N     E + D E  +  PT +K TW GKT +  + F+A +
Sbjct: 251 IVNVGGVAKDGEIIYAGAPNSITHTEATQDSENDWPEPTALKITWSGKTAD-GKPFTAII 309

Query: 235 EIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHV--KIGENEELTAKG 291
           E  L   MD+IDV+ EVP  +K +V +    +PYVYQ+    +  +  K+G+ EE+T +G
Sbjct: 310 EGSLGQRMDRIDVMAEVPGLIKSLVGSVAGTRPYVYQFIPSHKLPIKFKVGDEEEITEEG 369

Query: 292 KLFSECSFIS 301
            L  E +FIS
Sbjct: 370 TLLMEATFIS 379



>gi|389628552|ref|XP_003711929.1| survival factor 1 [Magnaporthe oryzae 70-15]
 gi|351644261|gb|EHA52122.1| survival factor 1 [Magnaporthe oryzae 70-15]
 gi|440470965|gb|ELQ40004.1| survival factor 1 [Magnaporthe oryzae Y34]
 gi|440488266|gb|ELQ67997.1| survival factor 1 [Magnaporthe oryzae P131]
          Length = 389

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 169/313 (53%), Gaps = 13/313 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG----NGVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           FVQ+I+SN+     T QF ++ F        + + +  ++N + S D  +  A++ +++L
Sbjct: 71  FVQVIYSNVAGIRTTCQFNTKVFNLKDDGKPHLWCTTPLSNHSFSDDMTAFYADDCAVEL 130

Query: 57  NPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           + +   Y + ++T +  IV+ +  R   GF  G  G T FG D S   G + H FWP+  
Sbjct: 131 SEDGTSYTIKSMTDERAIVNIKVTRTTPGFHAGKTGTTLFGTDLSDPWGTMRHAFWPRCQ 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
            +G +       DV G  LFVHA+QGM+PH  A+ WNF+NFQ    S  + E+ T P+YG
Sbjct: 191 TEGTITTPDGPVDVKGRCLFVHALQGMKPHHAAASWNFINFQGPTHSAVLMEYITPPSYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           S  ++ G++  + ++V     N  + +E   D E  +K PTK+K TW G T +  +   A
Sbjct: 251 STTVSVGAIAKDGEIVVAGCSNHVEHVEIRKDSENDWKEPTKVKLTWSGATKD-GKKVDA 309

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA---HVKIGENEELT 288
            +  + +  +D+IDV+ EVP F+KK   A    KPY+YQ+     +    +KIG+  E+T
Sbjct: 310 GIVSEYETRLDRIDVMAEVPGFVKKFAAATAGTKPYIYQYMPRKASPTLKLKIGDEPEIT 369

Query: 289 AKGKLFSECSFIS 301
             G +F E +FI+
Sbjct: 370 ETGAMFCEATFIT 382



>gi|346323739|gb|EGX93337.1| survival factor 1 [Cordyceps militaris CM01]
          Length = 514

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 171/310 (55%), Gaps = 11/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+     T QF S+ F    +  + + S  + NF +S D+ S  A++ +++L+
Sbjct: 200 MAQVIYSNVAGIRKTCQFNSKIFSVDESKPHMWSSTPLNNFEISEDKASFYADDCALELS 259

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N Y + +L  +   V+ +  R   GF+ G  G + +G D     G++ H FWP+  V
Sbjct: 260 ADGNSYTIKSLNDEHATVNLKITRKAPGFQAGKTGTSSYGTDPKEPWGWMRHAFWPRCAV 319

Query: 114 KGNMVV-DGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           +G +   D  A D TG G + +A+QGM+PH  A+RW+F++FQ    S  M +F T P+YG
Sbjct: 320 EGTITTTDEGAVDFTGRGFYSYALQGMKPHHAAARWSFLHFQGPSHSAVMMQFVTPPSYG 379

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
              +N G +  ++ +VG    N A       DPE+ +  PT + + W  K  + +    A
Sbjct: 380 CTVVNVGGIATDSAIVGAGCDNTATDKAVEADPESGWPAPTNVAFVWHAKDKDGNP-VEA 438

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKG 291
            ++  L   +D++DV+ EVP F+K+IV   V  KPY+YQ+  +A   +K G  +E+T +G
Sbjct: 439 EIDAALGKRLDRVDVMAEVPAFVKRIVAGAVGTKPYIYQYATKATLKLKAG-GKEVTEEG 497

Query: 292 KLFSECSFIS 301
            +FSE +FIS
Sbjct: 498 HVFSEATFIS 507



>gi|393221203|gb|EJD06688.1| survival factor 1 [Fomitiporia mediterranea MF3/22]
          Length = 423

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 195/363 (53%), Gaps = 65/363 (17%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV--NTFKSVNMTNFTLSP----DRRSASANNMSI 54
             Q+IHS+IG+W PT+QFT + +      + ++S N++NF +SP    D+RS  ++  +I
Sbjct: 64  MCQVIHSSIGVWYPTVQFTFKLYNPTTKEHVWRSTNVSNF-VSPAPGHDKRSCKSDQFTI 122

Query: 55  --KLNPECN---KYAV-NLTHKELIVSFEFERIDR--GFKIG----GGKTYFGQD--KSS 100
             K NP  +    Y + +   +++ VS +  R     G+KIG     G +Y+G D  K  
Sbjct: 123 TYKSNPGSDTPESYTIFSHAAEDVQVSLDVMRPASAPGWKIGKGPKSGTSYYGPDIEKPD 182

Query: 101 GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD---- 156
           GFV H FWP+   KG+++  G+A + +G G++VHAI GMRP+L+ASRWNF +FQS+    
Sbjct: 183 GFVFHSFWPRTQCKGHIIYKGKAIEASGPGMYVHAIMGMRPNLVASRWNFADFQSNEHGG 242

Query: 157 VASLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGVSV---------------KN 194
           V+++ M E  T   YG K       K+N GSLV+  KLV V+                K+
Sbjct: 243 VSAIQM-ELTTLDAYGPKGSGSGGVKVNFGSLVIGGKLVCVTAETILPGQKPSDAAKFKS 301

Query: 195 MAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDKID 246
            A    T  DP+T Y  P ++++ W G +   D        +K+DV        L++K+D
Sbjct: 302 RAFHYNTIRDPDTSYAAPQELEFIWAGPSTLKDVPGQLSASVKVDVGSPSKPKGLVEKVD 361

Query: 247 VLNEVPYFLKKIVQAFVA--KPYVYQWFNE------AEAHVKIGENEELTAKGKLFSECS 298
            L E+P  +K ++ ++VA  KP++YQW+N       A   +  G +  +   G L++E S
Sbjct: 362 FLAEIPAVVKAVI-SYVAGTKPFIYQWYNPTTLKVIAPDSIIPGGSAGIEIPGTLYNEAS 420

Query: 299 FIS 301
           FIS
Sbjct: 421 FIS 423



>gi|453081474|gb|EMF09523.1| survival factor 1 [Mycosphaerella populorum SO2202]
          Length = 373

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 103/312 (33%), Positives = 182/312 (58%), Gaps = 15/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+S++     T QF+S+ F   G   + + S N++N++ S D+++  A+  ++ L+
Sbjct: 66  MAQVIYSDVLGVRTTAQFSSKVFAKNGGKDHIWASDNLSNYSFSKDKQNFKADGCTMDLS 125

Query: 58  PECNKYAVNL-THKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y V   T+K+ IV  ++ +   GF +G  G+T FG DK    G + H FWP+  V
Sbjct: 126 EDGKTYHVKSNTNKKSIVDMKWTQAAPGFVVGKDGRTLFGTDKKKPWGSMRHAFWPRCRV 185

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G+++      D+ GVG+F+HA+QGM+PH  A++WNF+N+QS   S  M EF T P+YG 
Sbjct: 186 EGSIMTKDGPIDMKGVGIFIHALQGMKPHFAAAKWNFINYQSAKYSAIMMEFTTPPSYGP 245

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSL--DPETKYKVPTKIKYTWEGKTLETDEDFS 231
             +N G + ++ +L+        +   T++  D +  +  P+ +  +W+G T +     +
Sbjct: 246 TSVNVGGIAIDGELIFAGSDPAVKVQHTAIKGDKDNDWPEPSAVAASWDGATKDGK---T 302

Query: 232 AFLEIKLDVL-MDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEAEAHVKIGENEELTA 289
              ++K D++  D+IDV+ EVP F+K+IV  A   KPY+YQ+  + +  +KIG+ E +  
Sbjct: 303 VHADLKGDIVRADRIDVMGEVPKFVKQIVAGAAGTKPYIYQYCPKMKLQLKIGD-EVIED 361

Query: 290 KGKLFSECSFIS 301
           +G+LF E +FI+
Sbjct: 362 EGQLFMEATFIT 373



>gi|494823555|gb|EON60920.1| survival factor 1 [Coniosporium apollinis CBS 100218]
          Length = 376

 Score =  182 bits (463), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 107/309 (34%), Positives = 168/309 (54%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+G    T QF S+     G   N + S  + N+     + S  A++ +++L+
Sbjct: 70  MAQVIYSNVGGIRTTCQFNSKIHYMDGKTPNLWASDPLKNYRFDDSKFSFYADSCALELS 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + + Y + + T++  +V  +  R+  GF +G  G +YFG D  +  G + H FWP+  V
Sbjct: 130 EDGSSYTIKSSTNRRSVVDLKVSRVAPGFVVGKNGTSYFGTDPKAPWGSMRHAFWPRCRV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G+M+      +  G   FVHA+QGM+PH  A+RWNFVNFQS   S  M E+ T P+YGS
Sbjct: 190 EGSMMTQTGEVNFNGKAFFVHALQGMKPHHAAARWNFVNFQSPTYSAVMMEYVTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  ++ ++     +  +  E   DP+  +  P    Y WEGKT +  E+  A 
Sbjct: 250 TVVSVGGVATDDGIIFAGSSSTVKHTEIKGDPDNDWPEPGAANYHWEGKTKD-GEEAQAD 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIV-QAFVAKPYVYQWFNEAEAHVKIGENEELTAKGK 292
           L   L   +D++DV+ EVP F+K IV  A   KPY+YQ+  +    VKIG+ E     G 
Sbjct: 309 LGGSLGTRLDRVDVMAEVPPFVKAIVASAAGTKPYIYQYAPKLTLKVKIGD-EVKEEDGL 367

Query: 293 LFSECSFIS 301
           LF+E +FIS
Sbjct: 368 LFTEATFIS 376



>gi|85079277|ref|XP_956318.1| survival factor 1 [Neurospora crassa OR74A]
 gi|74613747|sp|Q7RX39.1|SVF1_NEUCR RecName: Full=Survival factor 1
 gi|28917377|gb|EAA27082.1| survival factor 1 [Neurospora crassa OR74A]
          Length = 381

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 174/312 (55%), Gaps = 13/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+SN+     T QF  + F   G+  + + S  + N   S D+ S  A + +++L+
Sbjct: 71  FAQVIYSNVAGIRTTCQFNCKVFSLDGSKPHLWCSTPLNNHEFSEDKTSFYATDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N Y + +L  +  IV+   +R   GFKIG  G T FG D ++  G + H FWP+   
Sbjct: 131 EDGNSYTIKSLNDERSIVNVTIKRTAPGFKIGTSGTTLFGTDLANPWGSMRHVFWPRCVA 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G  +FVHA+QGM+PH  A++WNF NFQ    S  + ++ T P+YGS
Sbjct: 191 EGTIATPDGPVDCKGRAMFVHALQGMKPHHAAAKWNFCNFQGPNYSAVLMQYTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V +N+++    +     +    D E  +  PT IK+ W+G T +  +   A 
Sbjct: 251 TVVNVGGIVKDNEIIFAGAEGAVTHVAIKGDTENDWPEPTAIKFEWKGTTKDGKQA-DAV 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNE---AEAHVKIGENEELTA 289
           LE +L+  +D+IDV+ EVP F+K+IV   V  KPY+YQ+  +       +K+GE EE++ 
Sbjct: 310 LEGELEDKLDRIDVMAEVPGFVKQIVAGAVGTKPYIYQYAPQKKKLTLKLKLGE-EEISE 368

Query: 290 KGKLFSECSFIS 301
           +G LFSE +FIS
Sbjct: 369 EGYLFSEATFIS 380



>gi|336471307|gb|EGO59468.1| survival factor 1 [Neurospora tetrasperma FGSC 2508]
 gi|350292398|gb|EGZ73593.1| survival factor 1 [Neurospora tetrasperma FGSC 2509]
          Length = 385

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 174/312 (55%), Gaps = 13/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+SN+     T QF  + F   G+  + + S  + N   S D+ S  A + +++L+
Sbjct: 75  FAQVIYSNVAGIRTTCQFNCKVFSLDGSKPHLWCSTPLNNHEFSEDKTSFYATDCAVELS 134

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N Y + +L  +  IV+   +R   GFKIG  G T FG D ++  G + H FWP+   
Sbjct: 135 EDGNSYTIKSLNDERSIVNVTIKRTAPGFKIGTSGTTLFGTDLANPWGSMRHVFWPRCVA 194

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G  +FVHA+QGM+PH  A++WNF NFQ    S  + ++ T P+YGS
Sbjct: 195 EGTIATPDGPVDCKGRAMFVHALQGMKPHHAAAKWNFCNFQGPNYSAVLMQYTTPPSYGS 254

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V +N+++    +     +    D E  +  PT IK+ W+G T +  +   A 
Sbjct: 255 TVVNVGGIVKDNEIIFAGAEGAVTHVAIKGDTENDWPEPTAIKFEWKGTTKDGKQ-ADAV 313

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNE---AEAHVKIGENEELTA 289
           LE +L+  +D+IDV+ EVP F+K+IV   V  KPY+YQ+  +       +K+GE EE++ 
Sbjct: 314 LEGELEDKLDRIDVMAEVPGFVKQIVAGAVGTKPYIYQYAPQKKKLTLKLKLGE-EEISE 372

Query: 290 KGKLFSECSFIS 301
           +G LFSE +FIS
Sbjct: 373 EGYLFSEATFIS 384



>gi|440639683|gb|ELR09602.1| hypothetical protein GMDG_04096 [Geomyces destructans 20631-21]
          Length = 381

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 112/311 (36%), Positives = 174/311 (55%), Gaps = 11/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSR-FFGNGVNT--FKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+IHSN+     T QF ++ F+ +G     + S  +++   S D  +  A N++++L+
Sbjct: 71  FVQVIHSNVAGIRRTSQFNTKIFYPDGAKPILWASDPLSDVDFSDDGVNYYAENLAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + ++T+K  IV+    +   GF+ G  G T FG D  +  G + H FWP+  V
Sbjct: 131 EDGKTYTIKSMTNKTAIVNITMTQTAPGFQAGKDGTTLFGTDLENPWGKMRHVFWPRNKV 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +V      D  G G+FV+A+QGM+PH  A +WNFV+F  D  +  M E+ T  +YGS
Sbjct: 191 EGTIVTGDGPIDFKGKGMFVYALQGMKPHHAAGKWNFVDFHGDKFTAVMMEYTTPASYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G++V + +++  S  N A  + T  D +  +  P  +KY W GKT +  +   A 
Sbjct: 251 TIVNVGAIVKDGEVIMASSPNKATHVTTKSDSDNDWPEPATVKYEWSGKTKD-GKTVEAV 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAH--VKIGENEELTAK 290
           LE  L   +D+IDV+ EVP F+K IV      KPY+YQ+   A     +KIGE EE+   
Sbjct: 310 LETALGGRLDRIDVMAEVPGFVKTIVANTAGTKPYIYQYSPTAAPSLKLKIGEEEEVVET 369

Query: 291 GKLFSECSFIS 301
           GKLF+E +FI+
Sbjct: 370 GKLFAEATFIT 380



>gi|340960108|gb|EGS21289.1| hypothetical protein CTHT_0031420 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 381

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/312 (33%), Positives = 173/312 (55%), Gaps = 13/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+S++     T QF  + F   G+  + + S  + N   S D+ +  AN+++++L+
Sbjct: 71  FCQVIYSSLAGIRTTCQFNCKIFSLDGSKPHLWCSTPLINHEFSEDKTAFYANDLAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   + + ++     IV+    R   GFK G  GKT FG D S+  G + H FWP+   
Sbjct: 131 EDGTTFTIKSMNDPNAIVNLVVRRTAPGFKAGKTGKTLFGTDLSNPWGSMRHLFWPRCES 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G   F HA+QGM+PH  A++WNF NFQ    S  + +F T P+YGS
Sbjct: 191 EGTITTKDGPIDFKGRAFFAHALQGMKPHHAAAKWNFCNFQGPTYSAILMQFTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +  G +  + +++    ++    LET  D +  +  PT IKYTW GKT + ++  +A 
Sbjct: 251 TVVAVGGIAKDGEIIVAGCESDVAHLETKSDSQNDWPEPTIIKYTWAGKTKD-NKPVTAV 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA---HVKIGENEELTA 289
           +E  L+  +D+IDV+ EVP F+K IV A    KPY+YQ+  + +     +KIG ++E+T 
Sbjct: 310 IEGALEERLDRIDVMAEVPGFVKSIVAAAAGTKPYIYQYSPQKQKLSLKLKIG-DQEVTE 368

Query: 290 KGKLFSECSFIS 301
           +G +F+E +FIS
Sbjct: 369 EGVIFTEATFIS 380



>gi|296417002|ref|XP_002838156.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634066|emb|CAZ82347.1| unnamed protein product [Tuber melanosporum]
          Length = 383

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 169/310 (54%), Gaps = 13/310 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF-GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLNPE 59
            VQ+I+SN+   + T+Q +++ F  +G   + S  +TN+       S  A++M+I ++ +
Sbjct: 75  LVQVIYSNVANLHFTVQLSTKIFHPDGRIVWSSKPVTNYGFDEGNYSFYADDMAITMSED 134

Query: 60  CNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVKG 115
            N Y++ ++   EL +     R   GFKIG  GK+ +G D     G + H FWP+  + G
Sbjct: 135 GNSYSIKSMVDSELSIDLTCTRSGPGFKIGRDGKSLYGTDPVEPWGAIRHIFWPRNKLTG 194

Query: 116 NMVV----DGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNY 171
            MVV    +    D +G  + V A+Q M+PH  A++WNFVNFQ       M EF T P+Y
Sbjct: 195 FMVVAENGEPVKIDFSGSAMLVMALQAMKPHHAAAKWNFVNFQGPTMCAVMMEFTTPPSY 254

Query: 172 GSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFS 231
           GS K+N   +V + +++  S     + L+T LD E  +  PT  K+ W  K+ +  +D  
Sbjct: 255 GSSKVNVSGIVTDGEIIAASTCGTVEHLKTQLDEEAGWPEPTDAKFVW--KSSKHGKDVE 312

Query: 232 AFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAK 290
           A +E  L   +D++DV+ EVP F+KKI  +    KPY+YQ+  +    VKIG +  +  +
Sbjct: 313 AVIEGPLGDRIDRVDVMAEVPAFIKKIASSAAGTKPYIYQYSKQMTLKVKIG-DRVIEEE 371

Query: 291 GKLFSECSFI 300
           GK F E ++I
Sbjct: 372 GKFFGEATYI 381



>gi|154297025|ref|XP_001548941.1| hypothetical protein BC1G_12601 [Botryotinia fuckeliana B05.10]
          Length = 381

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/313 (33%), Positives = 165/313 (52%), Gaps = 17/313 (5%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFFGN-----GVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           VQMI++N+     T Q   + F +       + + S  + N+    +  S  A+ +SI L
Sbjct: 71  VQMIYNNVAGLRTTCQLNVKVFNHKGPKQSDHLWLSDALENYGFDEEMVSFYADGLSIAL 130

Query: 57  NPECNKYAVNLTHKEL-IVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           N   ++Y +     E  +V+  F+R   GF++G  G TY+G D ++  G + H+FWP+  
Sbjct: 131 NEAGDEYTIKAARNESGLVNLVFKRAAPGFQVGENGTTYYGTDPAAPWGEMRHRFWPRCT 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V G +    + +D  G G+F+HAIQGM+PH  A++WNFV FQ+   S  M EF T  +YG
Sbjct: 191 VTGTITTPEKNYDFKGRGIFIHAIQGMKPHHAAAKWNFVTFQTPTYSAIMMEFTTPASYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
              +N G +V + ++V     N  +  E+  DPET +  P   +Y WEGK+     +FSA
Sbjct: 251 HTSVNVGGIVKDGEIVYAGATNTVKHTESKEDPETMWPEPISAEYKWEGKS--KSGEFSA 308

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF----NEAEAHVKIGENEEL 287
            L   L    D++D+L+ +P F+K +V   V  +P+ YQW     N     +K GE   +
Sbjct: 309 ILSGPLGERTDRVDILSHIPSFIKSVVGGVVGTRPFCYQWAIPPTNSLVLKIKDGE-AAV 367

Query: 288 TAKGKLFSECSFI 300
             +G LF E +FI
Sbjct: 368 EEQGTLFGESTFI 380



>gi|367023144|ref|XP_003660857.1| hypothetical protein MYCTH_2086957 [Myceliophthora thermophila ATCC
           42464]
 gi|347008124|gb|AEO55612.1| hypothetical protein MYCTH_2086957 [Myceliophthora thermophila ATCC
           42464]
          Length = 381

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 109/312 (34%), Positives = 174/312 (55%), Gaps = 13/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+SN+     T QF  + F   G+  + + S  ++N   S D  +  A++ +++L+
Sbjct: 71  FAQVIYSNVAGIRTTCQFNCKVFSLDGSKPHLWSSTPLSNHGFSEDYTAFYADDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + +L  ++ IV+   +R   GFK G  G T FG D S+  G + H FWP+   
Sbjct: 131 EDGTTYTIKSLNDEQAIVNLTVKRTAPGFKAGKTGTTLFGTDLSNPWGSMRHVFWPRCTA 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G ++      D  G     HA+QGM+PH  A++WNF NFQ    S  + +F T P+YGS
Sbjct: 191 EGTIMTKDGPIDFKGRAFLSHALQGMKPHHAAAKWNFCNFQGPTYSAILMQFTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  + ++V    K+    ++T+ D E  +  PT IKYTW G T +  +   AF
Sbjct: 251 TVVSVGVIAKDGEIVVGGCKSDVTHIQTNSDSENDWPEPTTIKYTWAGTTKD-GKPVEAF 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEA---EAHVKIGENEELTA 289
           +E  L+  +D+IDV+ EVP F+KKIV  A   KPY+YQ+  +       +KIG +EE+T 
Sbjct: 310 IEGGLEDRLDRIDVMAEVPGFVKKIVAGAAGTKPYIYQYSPQKTKLSLKLKIG-DEEVTE 368

Query: 290 KGKLFSECSFIS 301
           +G +F+E +FIS
Sbjct: 369 EGFVFAEATFIS 380



>gi|347838081|emb|CCD52653.1| similar to survival factor 1 [Botryotinia fuckeliana T4]
 gi|472239439|gb|EMR84251.1| putative survival factor 1 protein [Botryotinia fuckeliana BcDW1]
          Length = 382

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 174/313 (55%), Gaps = 14/313 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRF-FGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKL 56
             Q+IHSN+     T QF  +  +  G    N + S  ++N   S D+    A++++I L
Sbjct: 71  MAQIIHSNVIGVRTTTQFNCKISYPKGSSKPNLWSSDQLSNVEFSDDKTCFYADDVAIDL 130

Query: 57  NPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           + +  +Y + ++T++  IV+    R+  GF +G  GK+Y+G D  +  G + H FWP+  
Sbjct: 131 SEDGTEYTIKSMTNEASIVNLTVTRVAPGFHVGKDGKSYYGTDPKAPWGSMRHAFWPRTI 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
            KG++     + D  G  LF+HA+QGM+PH  A++WNFVN+Q    S  M E+ T P YG
Sbjct: 191 TKGSITTKDGSIDFKGKALFIHALQGMKPHHAAAKWNFVNYQGPQFSAIMMEYTTPPAYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           S  ++ G +V + +++     N A       D +  +  P  +K+ W+GKT +  +  S 
Sbjct: 251 STVVSVGGIVKDGEIICAGAGNTAIHTRIKNDEDAGWPEPEAVKFDWQGKTKD-GKSVSG 309

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA---HVKIGENEELT 288
            +E  L+  +D++DV+ EVP F+KKIV      +PY+YQ+    +     +KIG +EE+T
Sbjct: 310 LIETDLEERLDRVDVMAEVPGFVKKIVGNVAGTRPYIYQYSPRNKPTTLTLKIG-DEEIT 368

Query: 289 AKGKLFSECSFIS 301
            +G L++E +FIS
Sbjct: 369 EEGVLYTEATFIS 381



>gi|154283373|ref|XP_001542482.1| survival factor 1 [Ajellomyces capsulatus NAm1]
 gi|150410662|gb|EDN06050.1| survival factor 1 [Ajellomyces capsulatus NAm1]
          Length = 380

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 106/312 (33%), Positives = 177/312 (56%), Gaps = 14/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGN---GVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            +Q+I+SN+   + T  F S+ +G      + + S ++ N+    D  S   +N+++ LN
Sbjct: 72  MLQVIYSNVAGLHTTCHFNSKIYGTDGKSPHIWCSDSVHNYMFDEDMLSFGGDNIALTLN 131

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y++ +  +++ +V+   +R   GF IG  G + FG D  +  G + H FWP+  V
Sbjct: 132 AEGDTYSIKSAINEDSLVNINLKRAAPGFAIGQNGTSNFGTDPENPWGSMRHVFWPRCTV 191

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +V   R  D  G GLF+HA+QGM+PH +A+RWNF  FQS   S    E+ T P+YGS
Sbjct: 192 EGTIVTPEREIDFKGHGLFIHALQGMKPHHLAARWNFGTFQSPTYSAVFMEYTTPPSYGS 251

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  + ++V       A  +E++ D    +  P  IK+TW+GK+ +  +   A 
Sbjct: 252 TIVSVGGIAKDGEIVVAGPVKPAIHVESAEDTYNDWPEPKSIKFTWDGKSKD-GKAVEAV 310

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA---HVKIGENEELTA 289
           LE  L   +D++DV+ EVP F+K IV +    KPY+YQ F+  E    ++++G+ E+ T 
Sbjct: 311 LEGSLGERLDRVDVMAEVPGFIKSIVGSVAGTKPYIYQ-FSPQEKLSLNIRVGDTED-TE 368

Query: 290 KGKLFSECSFIS 301
           +G L+SE +FIS
Sbjct: 369 QGTLYSEATFIS 380



>gi|512199538|gb|EPE28371.1| hypothetical protein GLAREA_09491 [Glarea lozoyensis ATCC 20868]
          Length = 381

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 176/309 (56%), Gaps = 12/309 (3%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFF----GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            Q+IHSN+     T QFT +       N    + S  ++N   + D+ +  A++++++L+
Sbjct: 72  AQIIHSNVAGIRQTSQFTLKVLYPRSENKPFLWSSDQLSNIDFNEDKTNFYADDVAVELS 131

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + ++ +++ IV+    R   GF++G  G +YFG D  +  G + H+FWP+  V
Sbjct: 132 EDGKTYTIKSMVNQKSIVNITVTRTAPGFQVGNDGTSYFGTDPKAPWGSMRHRFWPRNTV 191

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G+++      D  G  L  HA+QGM+PH   ++W FV+FQ    S  M EF T P+YGS
Sbjct: 192 EGSIMTKDGPIDFKGKALLSHALQGMKPHHAGAKWKFVDFQGPTYSAIMMEFTTPPSYGS 251

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++     ++A+  +   D E  +  P  +KY W GKT +  +  +A 
Sbjct: 252 TVVNVGGIVKDGEIITAGASHVAEHTKIKGDSENDWPEPEAVKYQWNGKTKD-GKSITAV 310

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEA-EAHVKIGENEELTAKG 291
           ++  LD  +D+IDV+ EVP F+K IV A    KPY+YQ+  ++ +  + +G++E+ + +G
Sbjct: 311 IDCPLDERLDRIDVMAEVPGFVKTIVAAAAGTKPYIYQYSPKSCQLKINVGDDEK-SEEG 369

Query: 292 KLFSECSFI 300
           +LF+E +FI
Sbjct: 370 QLFTEATFI 378



>gi|119174412|ref|XP_001239567.1| hypothetical protein CIMG_09188 [Coccidioides immitis RS]
 gi|392869765|gb|EAS28287.2| survival factor 1 [Coccidioides immitis RS]
          Length = 378

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 167/310 (53%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SN+   + T    ++ +       + + S  + N     D  S   +N++I L+
Sbjct: 70  MVQVIYSNVAGLHTTCHLNTKIYSTDPQIPHKWHSDTIHNHIFDEDMLSFGGDNVAITLS 129

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIG-GGKTYFGQD--KSSGFVEHKFWPKGNV 113
            +   Y +     E  +V+    R+  GF  G  G + FG D  +  G + H FWP+  V
Sbjct: 130 EDGTSYTIKSALNENSLVNLTMTRVAPGFVAGTNGTSNFGTDPERPWGSMRHSFWPRCKV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G ++   R  + +G G FVHA+QGM+PH +A+RWNF NFQS   S  + E+ T P+YGS
Sbjct: 190 EGTIITPEREINCSGRGFFVHALQGMKPHHLAARWNFANFQSPTYSAIIMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +  + +++     N A   E   D E  +  P  IK+TW G+  + D++ SA 
Sbjct: 250 TVVNVGGIAKDGEIIYAGTSNTASHGEIVKDSENDWPEPKTIKFTWSGQNKD-DKEVSAV 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENE-ELTAKG 291
           LE  L   +D++DV+ EVP F+K IV +    +PY+YQ+  + +  +K+   + E+T +G
Sbjct: 309 LEGPLGQRLDRVDVMAEVPGFIKSIVGSVAGTRPYIYQYSPQEKLSLKLRVGDTEITEEG 368

Query: 292 KLFSECSFIS 301
            L+SE +FIS
Sbjct: 369 TLYSEATFIS 378



>gi|156063602|ref|XP_001597723.1| hypothetical protein SS1G_01919 [Sclerotinia sclerotiorum 1980]
 gi|154697253|gb|EDN96991.1| hypothetical protein SS1G_01919 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 381

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 103/312 (33%), Positives = 165/312 (52%), Gaps = 15/312 (4%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFFGN-----GVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           VQMI++N+     T Q     F +       + + S  + N+    +  S  A+ +SI L
Sbjct: 71  VQMIYNNVAGLRTTCQLNVEVFNHKGPEQSDHLWLSDALENYGFDEEMVSFYADGLSIAL 130

Query: 57  NPECNKYAVNLTHKEL-IVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           N   ++Y +     E  +V+  F+R   GF++G  G TY+G D ++  G + H+FWP+  
Sbjct: 131 NEAGDEYTIKAARNESGLVNLVFKRAAPGFQVGENGTTYYGTDPAAPWGEMRHRFWPRCT 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V G +    + +D  G G+F+HAIQGM+PH  A++WNF+ FQ+   S  M EF T  +YG
Sbjct: 191 VSGTITTPEKNYDFKGRGIFIHAIQGMKPHHAAAKWNFLTFQTPTYSAIMMEFTTPASYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
              +N G +V + ++V     N  +  E+  DPET +  P  ++Y WEGK+     DF+A
Sbjct: 251 HTSVNVGGVVKDGEIVYAGATNTVKHTESKEDPETLWPEPVSVEYKWEGKS--KSGDFTA 308

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAH--VKIGENEELT- 288
            L   L    D++D+L+ +P F+K +V   V  +P+ YQW         +KI + E +  
Sbjct: 309 LLSGPLGERTDRVDILSHIPSFIKSVVGGVVGTRPFCYQWAIPPTDSLVLKIKDGETVVE 368

Query: 289 AKGKLFSECSFI 300
            +G LF E +FI
Sbjct: 369 EQGTLFGESTFI 380



>gi|302894219|ref|XP_003045990.1| hypothetical protein NECHADRAFT_32356 [Nectria haematococca mpVI
           77-13-4]
 gi|256726917|gb|EEU40277.1| hypothetical protein NECHADRAFT_32356 [Nectria haematococca mpVI
           77-13-4]
          Length = 377

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 108/312 (34%), Positives = 171/312 (54%), Gaps = 16/312 (5%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT---FKSVNMTNFTLSPDRRSASANNMSIKLN 57
            +Q+I+SN+     T QF  + F    +    + S  ++N   S D  S  A++++++L+
Sbjct: 71  LLQVIYSNVVGIRTTCQFNCKVFYPDRSKPILWCSTPLSNHDFSEDMASFYADDLAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + ++  +  IV+ +  R   GF+ G  GKT +G D  +  G + H FWP+   
Sbjct: 131 EDGTFYTIKSMNDERAIVNLKLTRTSPGFQAGATGKTLYGTDLENPWGSMRHVFWPRCVA 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +  D    D  G G +V+A+QGM+PH  ASRWNFVNFQ    S  M EF +TP+YGS
Sbjct: 191 EGTITTDEGPLDFKGRGFYVYALQGMKPHHAASRWNFVNFQGPTYSAVMMEFTSTPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDED---F 230
             +N G +  + +++    KN A   +   D E  +  P+  KYTW G    TD+D    
Sbjct: 251 TLVNVGGIAKDGEILIGGSKNTATHTQVKNDSENDWPEPSHAKYTWSG----TDKDGKTI 306

Query: 231 SAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTA 289
            A  E  L+  +D++DV+ EVP F+K IV A    KPY+YQ+  +    +KIG ++E+  
Sbjct: 307 EASSEGPLEERVDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYHPKLPLKLKIG-DQEIVE 365

Query: 290 KGKLFSECSFIS 301
           +G +F+E +FIS
Sbjct: 366 EGTIFTEATFIS 377



>gi|465793169|emb|CCU98292.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 454

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 127/367 (34%), Positives = 195/367 (53%), Gaps = 69/367 (18%)

Query: 3   QMIHSNIG---------LWNPTIQFTSRFF--GNGVNTFKSVNMTNFTLSP-DRRSASAN 50
           Q+I+S +G         L+ P +Q T R+F    G N +KS N+  F + P D+RS  ++
Sbjct: 88  QIIYSPVGCVPCATDFSLFQPQVQMTFRYFHPKTGENVWKSKNVDQFQVLPNDKRSCKSS 147

Query: 51  NMSI---KLNPECNKYAVNL---THKELIVSFEFERIDRGFKIG----GGKTYFGQDKSS 100
             ++    L     +Y ++    T  +L+ +   +   +G+K+G    GG +YFG++ +S
Sbjct: 148 AFTVTCKDLEDGSQQYDISGMLDTDLQLMYTLTRKPEAKGWKLGQGDKGGFSYFGENPAS 207

Query: 101 --GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQS--- 155
             G V H+FWP   V G +V++GRA +  G+G+FV AIQGMRP+L+AS+WNF NFQS   
Sbjct: 208 PVGHVVHRFWPMAEVSGMIVLNGRAIEAKGLGMFVQAIQGMRPNLVASKWNFANFQSREQ 267

Query: 156 DVASLSMCEFETTPNY------GSKKINQ----GSLVVNNKLVGVSVKNMAQFLE----- 200
             +S  + EF T P+Y      G++++ Q    GS+V   +LV V     A   E     
Sbjct: 268 GGSSAVLMEFTTIPDYGKASEDGTQRVPQTVTIGSIVCQGQLVAVVGATRAAGAELPSTH 327

Query: 201 -----TSLDPETKYKVPTKIKYTWEGKTLETD----EDFSAFLEIKLDV------LMDKI 245
                 +LDP+T Y VP  I+YT +G  L  D    +D +A L ++L        L++K+
Sbjct: 328 AEHQTLTLDPDTGYHVPQSIQYTLQGPALVGDGAPGQDVTAELRVELGAPGQTQGLIEKV 387

Query: 246 DVLNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVKIGEN---------EELTAKGKLF 294
           DVL E+PY +KK+V  +VA  KPY+YQ  N     +   E+           +T +G LF
Sbjct: 388 DVLAEIPYMVKKLVN-YVAGTKPYIYQTLNSVGMKLTCPESVAKALGLPETSVTLQGTLF 446

Query: 295 SECSFIS 301
            E +FIS
Sbjct: 447 EEHTFIS 453



>gi|303314283|ref|XP_003067150.1| hypothetical protein CPC735_016040 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240106818|gb|EER25005.1| hypothetical protein CPC735_016040 [Coccidioides posadasii C735
           delta SOWgp]
          Length = 378

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 167/310 (53%), Gaps = 10/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SN+   + T    ++ +       + + S  + N     D  S   +N++I L+
Sbjct: 70  MVQVIYSNVAGLHTTCHLNTKIYSTDPQIPHKWYSDTIHNHIFDEDMLSFGGDNVAITLS 129

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIG-GGKTYFGQD--KSSGFVEHKFWPKGNV 113
            +   Y +     E  +V+    R+  GF  G  G + FG D  +  G + H FWP+  V
Sbjct: 130 EDGTSYTIKSALNENSLVNLTMTRVAPGFVAGTNGTSNFGTDPERPWGSMRHSFWPRCKV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G ++   R  + +G G FVHA+QGM+PH +A+RWNF NFQS   S  + E+ T P+YGS
Sbjct: 190 EGTIITPEREINCSGRGFFVHALQGMKPHHLAARWNFANFQSPTYSAIIMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +  + +++     N A   E   D E  +  P  IK+TW G+  + D++ SA 
Sbjct: 250 TVVNVGGIAKDGEIIYAGTSNTASHGEIVKDSENDWPEPKTIKFTWSGQNKD-DKEVSAV 308

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG-ENEELTAKG 291
           LE  L   +D++DV+ EVP F+K IV +    +PY+YQ+  + +  +K+   + E+T +G
Sbjct: 309 LEGPLGQRLDRVDVMAEVPGFIKSIVGSVAGTRPYIYQYSPQEKLSLKLRVGDAEITEEG 368

Query: 292 KLFSECSFIS 301
            L+SE +FIS
Sbjct: 369 TLYSEATFIS 378



>gi|340521725|gb|EGR51959.1| predicted protein [Trichoderma reesei QM6a]
          Length = 386

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 175/310 (56%), Gaps = 11/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+SN+     T QF ++ F       + + S  ++N   S D+ S  A++ +++L+
Sbjct: 73  FCQVIYSNVAGLKVTCQFNTKIFSRDPAKPHLWCSNPLSNVAFSEDKTSFYADDCAVELS 132

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N Y + ++  +  +V+ +  +   GF+ G  G + +G D  +  G + H FWP+   
Sbjct: 133 EDGNSYTIKSMNDERALVNLKITKTAPGFQAGKTGTSLYGTDLKNPWGSMRHAFWPRCAA 192

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G  ++++A+QGM+PH  A+RWNF NFQ    +  M EF T P+YG+
Sbjct: 193 EGTITTKDGPVDFKGRAIYIYALQGMKPHHAAARWNFANFQGPNHTAIMMEFTTPPSYGN 252

Query: 174 KKINQGSLVVNNKLVGVSVK-NMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
             +N G+LV + +L+GVS + N      T  D  + +  PT++++ W   T +  +  +A
Sbjct: 253 TTVNVGALVKDGELIGVSTEGNKVTHKATKKDTTSDWPEPTQVQFDWSA-TSKDGKPVTA 311

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKG 291
            +++ L   +D++DV+ EVP F+K IV A    KPY+YQ+  +A   +K+G+ EE+T  G
Sbjct: 312 VIDVALGERVDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYAPKATLKLKVGD-EEITEDG 370

Query: 292 KLFSECSFIS 301
            LF+E +FIS
Sbjct: 371 PLFTEATFIS 380



>gi|325091266|gb|EGC44576.1| Svf1 family protein [Ajellomyces capsulatus H88]
          Length = 380

 Score =  179 bits (454), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 105/312 (33%), Positives = 177/312 (56%), Gaps = 14/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGN---GVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            +Q+I+SN+   + T  F S+ +G      + + S ++ N+    D  S   +N+++ LN
Sbjct: 72  MLQVIYSNVAGLHTTCHFNSKTYGTDGKSPHIWCSDSVHNYMFDEDMLSFGGDNIALTLN 131

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y++ +  +++ +V+   +R   GF +G  G + FG D  +  G + H FWP+  V
Sbjct: 132 AEGDTYSIKSAINEDSLVNINLKRAAPGFAVGQNGTSNFGTDPENPWGSMRHVFWPRCTV 191

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +V   R  D  G GLF+HA+QGM+PH +A+RWNF  FQS   S    E+ T P+YGS
Sbjct: 192 EGTIVTPEREIDFKGHGLFIHALQGMKPHHLAARWNFGTFQSPTYSAVFMEYTTPPSYGS 251

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  + ++V       A  +E++ D    +  P  IK+TW+GK+ +  +   A 
Sbjct: 252 TIVSVGGIAKDGEIVVAGPVKPAIHVESAEDTYNDWPEPKSIKFTWDGKSKD-GKAVEAV 310

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA---HVKIGENEELTA 289
           LE  L   +D++DV+ EVP F+K IV +    KPY+YQ F+  E    ++++G+ E+ T 
Sbjct: 311 LEGSLGERLDRVDVMAEVPGFIKSIVGSVAGTKPYIYQ-FSPQEKLSLNIRVGDTED-TE 368

Query: 290 KGKLFSECSFIS 301
           +G L+SE +FIS
Sbjct: 369 QGTLYSEATFIS 380



>gi|402084031|gb|EJT79049.1| survival factor 1 [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 389

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 105/312 (33%), Positives = 166/312 (53%), Gaps = 12/312 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+SN+     T QF ++ F   G   + + S  ++    S D     AN+ +++L+
Sbjct: 71  FCQVIYSNVAGIRTTCQFNTKVFNLDGTEPHLWCSTPLSEHFFSEDMTGFFANDCALELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y + ++T +  IV+ +  R   GF  G  G T FG D ++  G + H FWP+  V
Sbjct: 131 EEGDCYIIKSMTDERAIVNLKVTRSAPGFHAGKTGNTLFGTDLANPWGSMRHAFWPRCEV 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D+ G+GLF+HA+QGM+PH  A+ WNF +F     S  + E+ T P+YG 
Sbjct: 191 EGTITTADGPIDMKGLGLFIHALQGMKPHHAAAGWNFASFHGKSHSAVLMEYTTPPSYGC 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  N  +V     + A+ + T  D E  +K P K+K TW G   +  +   A 
Sbjct: 251 TTVSVGGIARNGDIVVAGCSSHAEHVTTKGDSENDWKEPAKVKLTWSG-VGKDQKPVEAV 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA---HVKIGENEELTA 289
           LE   +  +D+IDV+ EVP F+KK V A V  KPY+YQ+          +KIG+  E+T 
Sbjct: 310 LEGDYEDRLDRIDVMAEVPGFVKKFVGAAVGTKPYIYQYLPRKTPLSLKLKIGDEPEITE 369

Query: 290 KGKLFSECSFIS 301
            G +F E +FI+
Sbjct: 370 TGVVFCEATFIT 381



>gi|472238883|gb|EMR83723.1| putative survival factor 1 protein [Botryotinia fuckeliana BcDW1]
          Length = 381

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 163/313 (52%), Gaps = 17/313 (5%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFFGN-----GVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           VQMI++N+     T Q   + F +       + + S  + N+    +  S  A+ +SI L
Sbjct: 71  VQMIYNNVAGLRTTCQLNVKVFNHKGPKQSDHLWLSDALENYGFDEEMVSFYADGLSIAL 130

Query: 57  NPECNKYAVNLTHKEL-IVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           N   ++Y +     E  +V+  F+R   GF++G  G TY+G D ++  G + H+FWP+  
Sbjct: 131 NEAGDEYTIKAARNESGLVNLVFKRAAPGFQVGENGTTYYGTDPAAPWGEMRHRFWPRCT 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V G +    + +D  G G+F+HAIQGM+P   A++WNFV FQ+   S  M EF T  +YG
Sbjct: 191 VTGTITTPEKNYDFKGRGIFIHAIQGMKPQHAAAKWNFVTFQTPTYSAIMMEFTTPASYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
              +N G +V + ++V     N  +  E+  DPET +  P   +Y WEGK+     +FSA
Sbjct: 251 HTSVNVGGIVKDGEIVYAGATNTVKHTESKEDPETMWAEPISAEYKWEGKS--KSGEFSA 308

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF----NEAEAHVKIGENEEL 287
            L   L    D++D+L+ +P F+K IV      +P+ YQW     N     +K GE   +
Sbjct: 309 ILSGPLGERTDRVDILSHIPSFIKSIVGGIAGTRPFCYQWAIPPTNSFVLKIKDGE-AAV 367

Query: 288 TAKGKLFSECSFI 300
             +G LF E +FI
Sbjct: 368 EEQGTLFGESTFI 380



>gi|322695033|gb|EFY86848.1| survival factor 1 [Metarhizium acridum CQMa 102]
          Length = 404

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 168/309 (54%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SN+     T QF S+ F    +  + + S  + NF  + D+ S  A++ +++L+
Sbjct: 97  LVQVIYSNVAGMRTTCQFNSKIFSKDPSKPHLWCSTPLNNFEFNEDKTSCYADDCALELS 156

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N+Y + ++  +  IV+ +  R   GFK G  G T +G D  +  G + H FWP+   
Sbjct: 157 EDGNEYTIKSMNDQRSIVNLKITRTAPGFKAGKSGTTKYGTDLENPWGTMGHAFWPRCAA 216

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G  ++  A+QGM+PH  A +WNF NFQ    S  M EF T P+YGS
Sbjct: 217 EGTITTPDGPIDFKGRAMYSFALQGMKPHHAAGKWNFANFQGPNYSAIMMEFTTPPSYGS 276

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++     + A   +   D E ++  P+ +K+ W G   +  +  SA 
Sbjct: 277 TLVNVGGIVKDGQIITAGPGHEAIHTDVKNDSENEWPEPSSVKFEWTGNKTDA-KPVSAV 335

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
           LE  L    D++DV+ EVP F+K IV A    KPY+YQ+  +    +KIG +EE+T +G+
Sbjct: 336 LEGPLGERTDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYAPKMTLKLKIG-DEEITEEGQ 394

Query: 293 LFSECSFIS 301
           LF E +FI+
Sbjct: 395 LFMEATFIT 403



>gi|225561822|gb|EEH10102.1| Svf1 family protein [Ajellomyces capsulatus G186AR]
          Length = 380

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/312 (33%), Positives = 177/312 (56%), Gaps = 14/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGN---GVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            +Q+I+SN+   + T  F S+ +G      + + S ++ N+    D  S   +N+++ LN
Sbjct: 72  MLQVIYSNVAGLHTTCHFNSKIYGTDGKSPHIWCSDSVHNYMFDEDMLSFGGDNIALTLN 131

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y++ +  +++ +V+   +R   GF +G  G + FG D  +  G + H FWP+  V
Sbjct: 132 AEGDTYSIKSAINEDSLVNINLKRAAPGFAVGQNGTSNFGTDPENPWGSMRHVFWPRCTV 191

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +V   R  D  G GLF+HA+QGM+PH +A+RWNF  FQS   S    E+ T P+YGS
Sbjct: 192 EGTIVTPEREIDFKGHGLFIHALQGMKPHHLAARWNFGTFQSPTYSAVFMEYTTPPSYGS 251

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  + ++V       A  +E++ D    +  P  IK+TW+GK+ +  +   A 
Sbjct: 252 TIVSVGGIAKDGEIVVAGPVKPAIHVESAEDTYNDWPEPKSIKFTWDGKSKD-GKAVDAV 310

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA---HVKIGENEELTA 289
           LE  L   +D++DV+ EVP F+K IV +    KPY+YQ F+  E    ++++G+ ++ T 
Sbjct: 311 LEGSLGERLDRVDVMAEVPGFIKSIVGSVAGTKPYIYQ-FSPQEKLSLNIRVGDIQD-TE 368

Query: 290 KGKLFSECSFIS 301
           +G L+SE +FIS
Sbjct: 369 QGTLYSEATFIS 380



>gi|347838471|emb|CCD53043.1| similar to survival factor 1 [Botryotinia fuckeliana T4]
          Length = 381

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 163/313 (52%), Gaps = 17/313 (5%)

Query: 2   VQMIHSNIGLWNPTIQFTSRFFGN-----GVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           VQMI++N+     T Q   + F +       + + S  + N+    +  S  A+ +SI L
Sbjct: 71  VQMIYNNVAGLRTTCQLNVKVFNHKGPKQSDHLWLSDALENYGFDEEMVSFYADGLSIAL 130

Query: 57  NPECNKYAVNLTHKEL-IVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           N   ++Y +     E  +V+  F+R   GF++G  G TY+G D ++  G + H+FWP+  
Sbjct: 131 NEAGDEYTIKAARNESGLVNLVFKRAAPGFQVGENGTTYYGTDPAAPWGEMRHRFWPRCT 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V G +    + +D  G G+F+HAIQGM+P   A++WNFV FQ+   S  M EF T  +YG
Sbjct: 191 VTGTITTPEKNYDFKGRGIFIHAIQGMKPQHAAAKWNFVTFQTPTYSAIMMEFTTPASYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
              +N G +V + ++V     N  +  E+  DPET +  P   +Y WEGK+     +FSA
Sbjct: 251 HTSVNVGGIVKDGEIVYAGATNTVKHTESKEDPETMWPEPISAEYKWEGKS--KSGEFSA 308

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF----NEAEAHVKIGENEEL 287
            L   L    D++D+L+ +P F+K IV      +P+ YQW     N     +K GE   +
Sbjct: 309 ILSGPLGERTDRVDILSHIPSFIKSIVGGIAGTRPFCYQWAIPPTNSFVLKIKDGE-AAV 367

Query: 288 TAKGKLFSECSFI 300
             +G LF E +FI
Sbjct: 368 EEQGTLFGESTFI 380



>gi|500258618|gb|EOO01530.1| putative survival factor 1 protein [Togninia minima UCRPA7]
          Length = 381

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 170/311 (54%), Gaps = 11/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSR-FFGNGVNT--FKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+++SN+   + T+QF S+ F+ N      F S  + +   S D+ +    + +++L+
Sbjct: 71  FVQVLYSNVAGIHITVQFVSKVFYPNKEREPLFCSTQLRDHEFSEDKANFYGTDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + ++T +  IV+   ++   GF  G  GKT +G D S+  G++ H FWP+   
Sbjct: 131 EDGKTYTIKSMTDERSIVNLTLKQEAPGFVAGKDGKTLYGTDLSNPWGYMRHAFWPRCRA 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D TG     HA+QGM+PH  A+RWNF +FQ    S  M +F T P+YGS
Sbjct: 191 EGTITTPDGPIDFTGPAFLSHAMQGMKPHHAAARWNFCDFQGPTFSAIMMDFTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +  + +++     N A  L+   D    +  P  +++TW G T +  +   A 
Sbjct: 251 TVVNVGGIAKDGEILIAGSANKAVHLKAKTDNVNDWPEPETVQFTWSGTTKD-GKTVEAI 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF--NEAEAHVKIGENEELTAK 290
           LE  ++   D+IDV+ EVP F+K+IV   V  KPY+YQ+    +    +KIG++ E+  +
Sbjct: 310 LEGDVEDRADRIDVMAEVPGFVKQIVAGAVGTKPYIYQYMPSKKLSLKIKIGDDPEIVEE 369

Query: 291 GKLFSECSFIS 301
           G+LFSE +FIS
Sbjct: 370 GRLFSEATFIS 380



>gi|452978962|gb|EME78725.1| hypothetical protein MYCFIDRAFT_56951 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 374

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 172/311 (55%), Gaps = 13/311 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+S++     T QF+S+ F       + + S N+  F +S D+++  A N+S+ L 
Sbjct: 67  MAQVIYSDVRGVRTTAQFSSKVFAKEAGKPHIWASDNLDKFEISKDKQNFKAKNVSMDLT 126

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQD--KSSGFVEHKFWPKGNV 113
            +   Y +  + +K  IV  +F +   G  +G  G T FG D  +  G ++H FWP+  V
Sbjct: 127 EDGKSYIIKSSVNKNSIVDLKFTQSAPGVVVGKDGVTRFGTDIQQPWGKMKHAFWPRCRV 186

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G ++      D+ GVG+F+HA+QGM+PH  AS+WNF+N+QS   S  M EF T P+YGS
Sbjct: 187 EGTILTKDGPVDMKGVGIFIHALQGMKPHFAASKWNFINYQSPATSAIMMEFTTPPSYGS 246

Query: 174 KKINQGSLVVNNKLV--GVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFS 231
             +N G +  + +++  G S     Q  E   D E  +  P+ +  +W+GKT +  +D  
Sbjct: 247 TVVNVGVIAKDGEIIWAGASPDTKVQHTEIKGDKENDWPEPSGVSCSWDGKTKD-GKDLH 305

Query: 232 AFLEIKLDVLMDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEAEAHVKIGENEELTAK 290
           A + +      D++DV+ EVP F+K+IV  A   KPY+YQ+    +  + IG  EE   +
Sbjct: 306 AEI-VSPITRSDRVDVMGEVPKFVKQIVAGAAGTKPYIYQYEPTLKLKLNIG-GEEKIEE 363

Query: 291 GKLFSECSFIS 301
           G+LF E +FIS
Sbjct: 364 GRLFMEATFIS 374



>gi|116196860|ref|XP_001224242.1| hypothetical protein CHGG_05028 [Chaetomium globosum CBS 148.51]
 gi|88180941|gb|EAQ88409.1| hypothetical protein CHGG_05028 [Chaetomium globosum CBS 148.51]
          Length = 381

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 107/312 (34%), Positives = 170/312 (54%), Gaps = 13/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+SN+     T QF  + F   G+  + + +  ++N   S DR    A++ +++L+
Sbjct: 71  FAQVIYSNVAGIRTTCQFNCKVFSLDGSKPHLWSTTQLSNHDFSEDRTGFYADDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + ++   + IV+   +R   GFK G  G T FG D S+  G + H FWP+   
Sbjct: 131 EDGTTYTIKSMNDDKAIVNLTVKRTAPGFKAGKTGNTLFGTDLSNPWGSMRHIFWPRCTA 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G   F +A+QGM+PH  A++WNF NFQ    S  + +F T P+Y S
Sbjct: 191 EGTVTTKEGPIDFKGKAFFSYALQGMKPHHAAAKWNFCNFQGPKYSAILMQFTTPPSYAS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +  + +++    K+    ++T  D E  +  PT IKYTW G T +  +   AF
Sbjct: 251 TVVNVGVIAKDGEIIVGGCKSNVTHIQTKSDSENDWPEPTTIKYTWAGTTKD-GKPVEAF 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEA---EAHVKIGENEELTA 289
           +E  L+  +D+IDV+ EVP F+KKIV  A   KPY+YQ+  +       +KIG +EE + 
Sbjct: 310 IEGGLEEKLDRIDVMAEVPGFVKKIVAGAAGTKPYIYQYSPQKTKLSLKLKIG-DEEFSE 368

Query: 290 KGKLFSECSFIS 301
           +G +FSE +FIS
Sbjct: 369 EGFVFSEATFIS 380



>gi|345570703|gb|EGX53524.1| hypothetical protein AOL_s00006g390 [Arthrobotrys oligospora ATCC
           24927]
          Length = 400

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 153/260 (58%), Gaps = 9/260 (3%)

Query: 49  ANNMSIKLNPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVE 104
           A+N+++ L+ +   Y V +        +  F R+  GF  G  G++ +G D++   G + 
Sbjct: 143 ADNVAVTLSEDGGVYKVKSQADPNAFCNLVFTRLAPGFMAGKDGRSTYGTDQAKPWGEIR 202

Query: 105 HKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCE 164
           H FWP+  V+G  V+ G    V G GLF+HA+Q M+PH  A++WNF NFQ    S +  E
Sbjct: 203 HVFWPRCKVEGVYVIKGETVKVDGSGLFIHALQNMKPHHAAAKWNFANFQGPTVSANFME 262

Query: 165 FETTPNYGSKKINQGSLVVNNKLVGVS--VKNMAQFLETSLDPETKYKVPTKIKYTWEGK 222
           F T P+YG  ++  G + ++ +++  S   +N+A+ L ++ DPE ++  P  +K+TW+GK
Sbjct: 263 FTTPPSYGLTRVAVGGIAMDGEIISASGLPENLAEHLSSTEDPEARWPEPKDVKFTWKGK 322

Query: 223 TLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKI 281
             +  +D  A +E      MD++D+++EVP F+K IV A    +PY+YQ+F      VK+
Sbjct: 323 NKD-GKDVVAVIETTWPKRMDRVDIMSEVPGFVKSIVSAAAGTRPYIYQFFERVSLKVKV 381

Query: 282 GENEELTAKGKLFSECSFIS 301
           G++ E T +G +FSE +FIS
Sbjct: 382 GDH-ETTEEGWVFSEATFIS 400



>gi|322706731|gb|EFY98311.1| survival factor 1 [Metarhizium anisopliae ARSEF 23]
          Length = 378

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 166/309 (53%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+     T QF S+ F    +  + + S  + NF  + D+ S  A++ +++L+
Sbjct: 71  LAQVIYSNVAGMRTTCQFNSKIFSKDPSKPHLWCSTPLNNFEFNEDKTSCYADDCALELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N+Y + ++     IV+ +  R   GFK G  G T +G D  +  G + H FWP+   
Sbjct: 131 KDGNEYTIKSMNDPRSIVNLKITRTAPGFKAGKSGTTKYGTDLENPWGTMRHAFWPRCAA 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G  ++  A+QGM+PH  A +WNF NFQ    S  M EF T P+YGS
Sbjct: 191 EGTITTPDGPIDFKGQAMYSFALQGMKPHHAAGKWNFANFQGPNYSAIMMEFTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++     + A   +   D E ++  P+ +K+ W G   +  +  SA 
Sbjct: 251 TLVNVGGIVKDGQIITAGPGHEAIHTDVKNDSENEWPEPSSVKFEWTGNKTDA-KPVSAV 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
           LE  L    D++DV+ EVP F+K IV A    KPY+YQ+  +    +KIG +EE+T +G+
Sbjct: 310 LEGPLGERTDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYAPKMTLKLKIG-DEEVTEEGQ 368

Query: 293 LFSECSFIS 301
           LF E +FI+
Sbjct: 369 LFMEATFIT 377



>gi|156049579|ref|XP_001590756.1| hypothetical protein SS1G_08496 [Sclerotinia sclerotiorum 1980]
 gi|154692895|gb|EDN92633.1| hypothetical protein SS1G_08496 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 364

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 170/309 (55%), Gaps = 24/309 (7%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLNPEC 60
             Q+IHSN+ +  P             N + S  ++N   S D+    A++++I L+ + 
Sbjct: 71  MAQIIHSNV-ISKP-------------NLWSSNQLSNVEFSNDKTCYYADDVAIDLSEDG 116

Query: 61  NKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVKGN 116
            +Y + ++ ++  IV+    R+  GF +G  GK+Y+G D  +  G + H FWP+   KG+
Sbjct: 117 TEYTIKSMANEASIVNLTVTRVAPGFHVGKDGKSYYGTDPKAPWGSMRHAFWPRTITKGS 176

Query: 117 MVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKI 176
           ++    + D  G  LF+HA+QGM+PH  A++WNFVN+Q    S  M E+ T P YGS  +
Sbjct: 177 IITKDGSIDFKGKALFIHALQGMKPHHAAAKWNFVNYQGPQFSAIMMEYTTPPAYGSTVV 236

Query: 177 NQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEI 236
           + G +V + +++     N A+  +   D    +  P  +K+ W GKT +  +  S  +E 
Sbjct: 237 SVGGIVKDGEIICAGAGNTAKHTKVRNDQNAGWPEPEAVKFDWNGKTKD-GKSVSGLIET 295

Query: 237 KLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAH---VKIGENEELTAKGK 292
            L+  +D++DV+ EVP F+KKIV      +PY+YQ+    +     +KIG+ EE+T +G 
Sbjct: 296 DLEERLDRVDVMAEVPGFVKKIVGNVAGTRPYIYQYCPRNKPTTLVLKIGD-EEITEEGT 354

Query: 293 LFSECSFIS 301
           L++E +FIS
Sbjct: 355 LYTEATFIS 363



>gi|320592117|gb|EFX04556.1| survival factor 1 [Grosmannia clavigera kw1407]
          Length = 384

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 111/316 (35%), Positives = 171/316 (54%), Gaps = 17/316 (5%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNTFK----SVNMTNFTLSPDRRSASANNMSIKL 56
           FVQ+I++NI     T QF ++ F  G    K    S  + +   S D  S  A + +++L
Sbjct: 71  FVQVIYNNISGIRTTCQFNTKIFYPGETNKKTLWSSTPLRDHEFSEDMTSFYATDCAVEL 130

Query: 57  NPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           + +   Y++ +L     IV+   +R   GF+ G  G++ FG D     G + H FWP+  
Sbjct: 131 SEDGESYSIKSLNDDRAIVNLTVKRTAPGFQAGKTGRSLFGTDLDDPWGSMRHVFWPRCV 190

Query: 113 VKGNMVV--DGR-AFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTP 169
             G++    DG  +FD    GLF+HA+QGM+PH +ASRWNF NFQS   S  + EF T P
Sbjct: 191 ASGSITTTEDGPLSFDGY-RGLFIHALQGMKPHHLASRWNFANFQSKEYSAVLMEFTTPP 249

Query: 170 NYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDED 229
           +YGS  I  G +  + +++          L    D E  +  PT+I++TW G T +    
Sbjct: 250 SYGSTVITVGGIARDGEIIIAGTDQTTTHLAVKEDSENDWPEPTQIRFTWSG-TAKDGSK 308

Query: 230 FSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF-NEAEAHVKI--GENE 285
             A +E  L+  +D+IDV+ EVP F+KKI  +    KPY+YQ++ ++A   +K+  G+  
Sbjct: 309 VDAVVEGALEERLDRIDVMAEVPGFVKKIAGSVAGTKPYIYQYYPHKAPIALKLKQGDQT 368

Query: 286 ELTAKGKLFSECSFIS 301
           E+T  G+LF E +FIS
Sbjct: 369 EITEPGRLFCEATFIS 384



>gi|169611288|ref|XP_001799062.1| hypothetical protein SNOG_08754 [Phaeosphaeria nodorum SN15]
 gi|111062802|gb|EAT83922.1| hypothetical protein SNOG_08754 [Phaeosphaeria nodorum SN15]
          Length = 377

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 169/310 (54%), Gaps = 12/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F+Q+I+SN+     T+QFT R F    +    + +  ++N+    ++ S  A+ +SI+L+
Sbjct: 71  FLQLIYSNVAGMRVTVQFTCRLFYPNNSKPGLWATDPLSNYGFDEEQHSFYADGVSIELS 130

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIGG--GKTYFGQDKSS--GFVEHKFWPKGN 112
            + + Y +     E  +V+ +F R   GF +GG  G + FG D  +  G + H FWP+  
Sbjct: 131 EDGSYYTIKAAVNENSMVNVKFSRTAPGF-MGGKNGTSNFGTDPKAPWGSMYHHFWPRAK 189

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G+++      +V G G+F HA+QGM+PH  A+RWNFVNFQS   S  + EF T  +Y 
Sbjct: 190 VEGSIITKDGEINVNGRGMFSHALQGMKPHHAAARWNFVNFQSPSYSAILMEFTTPASYA 249

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           S  +    +  ++KL+       A+   T  D +  +  PT   Y W GKT +  +D +A
Sbjct: 250 STVVRVSGIATDDKLLIAGTDGEAKHTATKQDSDNDWPEPTAASYHWVGKTAD-GQDVTA 308

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIV-QAFVAKPYVYQWFNEAEAHVKIGENEELTAKG 291
            L   L    D++DV+ EVP F+K IV  A   KPY+YQ+  +    VK+G+ E    +G
Sbjct: 309 ELSGSLGEKFDRVDVMAEVPGFVKAIVASAAGTKPYIYQYAPKMTIKVKVGD-EVKEEEG 367

Query: 292 KLFSECSFIS 301
            L++E +FIS
Sbjct: 368 TLYTEATFIS 377



>gi|154303601|ref|XP_001552207.1| hypothetical protein BC1G_08685 [Botryotinia fuckeliana B05.10]
          Length = 380

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 161/282 (57%), Gaps = 10/282 (3%)

Query: 28  NTFKSVNMTNFTLSPDRRSASANNMSIKLNPECNKYAV-NLTHKELIVSFEFERIDRGFK 86
           N + S  ++N   S D+    A++++I L+ +  +Y + ++T++  IV+    R+  GF 
Sbjct: 100 NLWSSDQLSNVEFSDDKTCFYADDVAIDLSEDGTEYTIKSMTNEASIVNLTVTRVAPGFH 159

Query: 87  IG-GGKTYFGQDKSS--GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHL 143
           +G  GK+Y+G D  +  G + H FWP+   KG++     + D  G  LF+HA+QGM+PH 
Sbjct: 160 VGKDGKSYYGTDPKAPWGSMRHAFWPRTITKGSITTKDGSIDFKGKALFIHALQGMKPHH 219

Query: 144 IASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSL 203
            A++WNFVN+Q    S  M E+ T P YGS  ++ G +V + +++     N A       
Sbjct: 220 AAAKWNFVNYQGPQFSAIMMEYTTPPAYGSTVVSVGGIVKDGEIICAGAGNTAIHTRIKN 279

Query: 204 DPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV 263
           D +  +  P  +K+ W+GKT +  +  S  +E  L+  +D++DV+ EVP F+KKIV    
Sbjct: 280 DEDAGWPEPEAVKFDWQGKTKD-GKSVSGLIETDLEERLDRVDVMAEVPGFVKKIVGNVA 338

Query: 264 A-KPYVYQWFNEAEA---HVKIGENEELTAKGKLFSECSFIS 301
             +PY+YQ+    +     +KIG +EE+T +G L++E +FIS
Sbjct: 339 GTRPYIYQYSPRNKPTTLTLKIG-DEEITEEGVLYTEATFIS 379



>gi|392594437|gb|EIW83761.1| survival factor 1 [Coniophora puteana RWD-64-598 SS2]
          Length = 428

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 126/368 (34%), Positives = 193/368 (52%), Gaps = 72/368 (19%)

Query: 3   QMIHSNIGLWNPTIQFTSRFFGNGV--NTFKSVNMTNFTLSP---DRRSAS------ANN 51
           Q+IHS++G+W PTIQFT++ +        ++S  +  FT  P   D+RS        + +
Sbjct: 64  QVIHSSVGVW-PTIQFTAKIYNPNTKERVWRSSTVRTFTTPPPGLDKRSCKGETADKSEH 122

Query: 52  MSIKLNP----ECNKYAVNLT-HKELIVSFEFERID--RGFKIG----------GGKTYF 94
            SI   P    + + Y +N +   E+ +S +  R      FKIG          GG +YF
Sbjct: 123 FSITFRPAYGDKPDTYTINASFGSEVQLSLDIVRPAGVPAFKIGSDKPGDPLARGGFSYF 182

Query: 95  GQDKSSGFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQ 154
           G DK  G+V H+FWP+    G+++ +G A +V G G+F HAIQGMRP+L+ASRWNF NFQ
Sbjct: 183 GHDKKEGYVVHRFWPRTYSTGHVIRNGVATEVKGQGIFNHAIQGMRPNLVASRWNFANFQ 242

Query: 155 SD----VASLSMCEFETTPNYGSK-------KINQGSLVVNNKLVGVSVKNMAQ------ 197
           S+    ++++ M EF T   +G K       K+N GS+V+ +KL  V+ +   +      
Sbjct: 243 SNEHGGISAVQM-EFTTCSTHGFKGANSGAVKVNIGSIVLGDKLALVTAETQVEGQEPAK 301

Query: 198 --------FLETSLDPETKYKVPTKIKYTWEGKTLETDED--FSAFLEIKLDV------L 241
                    L  + D +T Y +P+ +KY W G ++  D      A LE++         L
Sbjct: 302 GNVISRVHHLSPAHDVDTGYGMPSALKYEWAGSSILADASGQVEATLEVQTGAPADPSGL 361

Query: 242 MDKIDVLNEVPYFLKKIVQAFVA--KPYVYQWFNEAEAHVK------IGENEELTAKGKL 293
           ++K+DVL E P  +K +V  +VA  KPY+YQW N  +  VK       G ++ + A G L
Sbjct: 362 VEKLDVLAEFPSGVKMLVN-YVAGTKPYIYQWQNNTKLIVKGPDSIIPGLSQGIEANGIL 420

Query: 294 FSECSFIS 301
           F+E +FIS
Sbjct: 421 FNEATFIS 428



>gi|67515671|ref|XP_657721.1| hypothetical protein AN0117.2 [Aspergillus nidulans FGSC A4]
 gi|40746139|gb|EAA65295.1| hypothetical protein AN0117.2 [Aspergillus nidulans FGSC A4]
          Length = 546

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 105/281 (37%), Positives = 153/281 (54%), Gaps = 12/281 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGV-NTFKSVNMTNFTLSPDRRSASANNMSIKL 56
            VQ+I+SNI   + T QF  + F   G+G  + + S  + N        S +A+N+S+ L
Sbjct: 71  MVQIIYSNIAGIHTTAQFNCKIFNTSGDGTPHIWFSDPLYNHMFDESMSSFAADNISLSL 130

Query: 57  NPECNKYAVNLTHKE-LIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           N E N Y +     E  +V   F R   GF IG  G TYFG D  +  G + H FWP+ N
Sbjct: 131 NEEGNAYTLKSAVNEGCLVDLTFNRAAPGFAIGKDGTTYFGTDPQNPWGSMRHMFWPRCN 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHL--IASRWNFVNFQSDVASLSMCEFETTPN 170
           V G +    +  D+TG G+F  A+QGM+PH    ASRWNF+NFQ+   S  M EF T P+
Sbjct: 191 VTGTITTKEKVHDMTGRGMFSQALQGMKPHHAGTASRWNFINFQTPSFSAIMMEFTTPPS 250

Query: 171 YGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDF 230
           YGS  +N G +  + +++     N A   E S D  + +  P  IK+ WEGKT +  +  
Sbjct: 251 YGSTVVNVGGIAKDGEIIYAGTTNSATHTEASQDETSDWPEPKSIKWVWEGKTKD-GKTV 309

Query: 231 SAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQ 270
           +A ++  L   +D+IDV+ EVP F+K I  +   A+PY++Q
Sbjct: 310 TAEVDGPLGPKLDRIDVMAEVPGFIKTIAGSVAGARPYIFQ 350



>gi|310795297|gb|EFQ30758.1| hypothetical protein GLRG_05902 [Glomerella graminicola M1.001]
          Length = 381

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 106/312 (33%), Positives = 170/312 (54%), Gaps = 13/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+G    T QF ++ F    +    +++  + +  +S DR S  A++ +++L+
Sbjct: 71  LAQIIYSNVGGIRTTCQFNAKIFYPEKSKPTLWETTQLNHHEVSEDRMSFYADDCAVELS 130

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIG-GGKTYFGQD--KSSGFVEHKFWPKGNV 113
            +   Y +   + E  IV+ +  R   GF  G  GKT FG D  K  G + H FWP+  V
Sbjct: 131 EDGTYYTIKSMNSENAIVNLKVTRTSPGFHAGKTGKTLFGTDLSKPWGTMRHAFWPRCVV 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D TG   +V+A+QGM+PH  A++WNFV+FQ    S  M E+ T P+YGS
Sbjct: 191 EGTITTKEGPVDFTGRAFYVYALQGMKPHHAAAKWNFVDFQGPNYSAVMMEYTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  + +++   V   A   +   D   ++  P +IK+TW GK  E  +   A 
Sbjct: 251 TVVSVGGIAKDGEMIYGGVTQTATHTKAKNDSVNEWPEPEEIKFTWSGKDKE-GKAVEAI 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF---NEAEAHVKIGENEELTA 289
           +E  L   +D++DVL EVP F+KKIV      KPY+YQ+    N+    +KIG ++E++ 
Sbjct: 310 IEGPLGERLDRVDVLAEVPGFVKKIVAGTAGTKPYIYQYCPTKNKLTLKLKIG-DQEISE 368

Query: 290 KGKLFSECSFIS 301
           +G  FSE +FIS
Sbjct: 369 EGLCFSEATFIS 380



>gi|367046350|ref|XP_003653555.1| hypothetical protein THITE_2116076 [Thielavia terrestris NRRL 8126]
 gi|347000817|gb|AEO67219.1| hypothetical protein THITE_2116076 [Thielavia terrestris NRRL 8126]
          Length = 381

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 167/311 (53%), Gaps = 11/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+I+SN+     T QF  + F    +  + + S  + N   S D  S  A++ +++L+
Sbjct: 71  FVQVIYSNVAGIRTTCQFNCKIFSLDRSKPHLWSSTPLQNHEFSEDMTSFYADDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + ++  ++ IV+   +R   GFK G  G T FG D ++  G + H FWP+   
Sbjct: 131 EDGTTYTIKSMADEKAIVNLTVKRTAPGFKAGKTGTTLFGTDLANPWGSMRHVFWPRCVG 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G   F HA+QGM+PH  A++WNF +FQ    S  + EF T P+YGS
Sbjct: 191 EGTVSTQEGPIDFQGRAFFSHALQGMKPHHAAAKWNFCDFQGPTYSAILMEFTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +  G +  + ++V    ++    LET  D E  +  PT I+YTW G T +  +   A 
Sbjct: 251 TVVTVGVIAKDGEIVVGGCESAVTHLETKSDSENDWPEPTTIRYTWAG-TSKDGKAVEAV 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEAEAHVKIGE--NEELTAK 290
           +E  L+  +D+IDV+ EVP F+KKIV  A   KPY+YQ+  +        +  +EE+T +
Sbjct: 310 IEGALEERLDRIDVMAEVPGFVKKIVAGAAGTKPYIYQYSPQKTKLALKLKLGDEEVTEE 369

Query: 291 GKLFSECSFIS 301
           G +FSE +FIS
Sbjct: 370 GFVFSEATFIS 380



>gi|302422802|ref|XP_003009231.1| survival factor 1 [Verticillium albo-atrum VaMs.102]
 gi|261352377|gb|EEY14805.1| survival factor 1 [Verticillium albo-atrum VaMs.102]
          Length = 383

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 171/312 (54%), Gaps = 13/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+   + T+QF S+ F   G+  + + S  ++N   S D+ S  A++ ++ L+
Sbjct: 67  LAQVIYSNVAGIHTTVQFNSKIFYLDGSKPHLWCSTQLSNHGFSEDKASFYADDCALDLS 126

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + +L  +  IV+ +  R   GF  G  G T +G D  +  G + H FWP+   
Sbjct: 127 EDGTNYTIKSLNDQRSIVNLKITRKAPGFVAGKTGNTLYGTDLGNPWGSMRHAFWPRCAA 186

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D TG   +  A+QGM+PH  A+RW F +FQ+   S  + +F T P+YG+
Sbjct: 187 EGTITTPDGPIDFTGKAFYSFALQGMKPHHAAARWTFADFQTPTYSAVLMQFVTPPSYGT 246

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +  G +  + +++   V +      T  D E+++  P  IK+TW GKT +  +   A 
Sbjct: 247 TTVTIGGIAKDGEIIIGGVDSTVAHTRTKTDSESEWPEPEAIKFTWSGKTKD-GKAVEAV 305

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEAEA---HVKIGENEELTA 289
           +E  L   +D++DV+ EVP F+K+IV  A   KPY+YQ+  + +     +KIG +EE++ 
Sbjct: 306 IEGDLGKRLDRVDVMAEVPAFVKRIVAGAAGTKPYIYQYSPQEKKLTLKLKIG-DEEISE 364

Query: 290 KGKLFSECSFIS 301
           +G+LFSE +FIS
Sbjct: 365 EGQLFSEATFIS 376



>gi|346970390|gb|EGY13842.1| survival factor 1 [Verticillium dahliae VdLs.17]
          Length = 388

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 171/312 (54%), Gaps = 13/312 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+   + T+QF S+ F   G+  + + S  ++N   S D+ S  A++ ++ L+
Sbjct: 72  LAQVIYSNVAGIHTTVQFNSKIFYLDGSKPHLWCSTQLSNHGFSEDKASFYADDCALDLS 131

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + +L  +  IV+ +  R   GF  G  G T +G D  +  G + H FWP+   
Sbjct: 132 EDGTNYTIKSLNDQRSIVNLKITRKAPGFVAGKTGNTLYGTDLENPWGSMRHAFWPRCAA 191

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D TG   +  A+QGM+PH  A+RW F +FQ+   S  + +F T P+YG+
Sbjct: 192 EGTITTPDGPIDFTGKAFYSFALQGMKPHHAAARWTFADFQTPTYSAVLMQFVTPPSYGT 251

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +  G +  + +++   V +      T  D E+++  P  IK+TW GKT +  +   A 
Sbjct: 252 TTVTIGGIAKDGEIIIGGVDSTVAHTRTKTDSESEWPEPEAIKFTWSGKTKD-GKAVEAV 310

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEAEA---HVKIGENEELTA 289
           +E  L   +D++DV+ EVP F+K+IV  A   KPY+YQ+  + +     +KIG +EE++ 
Sbjct: 311 IEGDLGQRLDRVDVMAEVPAFVKRIVAGAAGTKPYIYQYSPQEKKLTLKLKIG-DEEISE 369

Query: 290 KGKLFSECSFIS 301
           +G+LFSE +FIS
Sbjct: 370 EGQLFSEATFIS 381



>gi|358384654|gb|EHK22251.1| hypothetical protein TRIVIDRAFT_186371 [Trichoderma virens Gv29-8]
          Length = 386

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 95/310 (30%), Positives = 175/310 (56%), Gaps = 11/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+     T QF ++ F       + + S  ++N   + D+ S  A++ +++L+
Sbjct: 73  MAQVIYSNVAGLKVTCQFNTKIFSRDPAKPHLWCSNPLSNVAFNEDKTSFYADDCAVELS 132

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N Y + ++  +  +V+ +  R   GF  G  G T +G D  +  G + H FWP+ + 
Sbjct: 133 EDGNSYTIKSMNDERALVNLKVTRTAPGFHAGKTGTTLYGTDLKNPWGSMRHAFWPRCSA 192

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D+ G  ++++A+QGM+PH  A+RWNF NFQ    +  M EF T P+YG+
Sbjct: 193 EGTITTKDGPVDLKGQAIYIYALQGMKPHHAAARWNFANFQGPNHTAVMMEFTTPPSYGN 252

Query: 174 KKINQGSLVVNNKLVGVSVK-NMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
             +N G+LV + +L+ +S + N A    +  D  + +  PT+++++W   + +  +  +A
Sbjct: 253 TTVNVGALVKDGELIAISTENNKATHKASKKDTTSDWPEPTQVEFSWSTSSKD-GKPVTA 311

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKG 291
            ++  L   +D++DV+ EVP F+K IV A    KPY+YQ+  +    +K+G+ EE++  G
Sbjct: 312 VIDANLGDRVDRVDVMAEVPGFVKTIVAAAAGTKPYIYQFAPKTTLKLKVGD-EEISEDG 370

Query: 292 KLFSECSFIS 301
           +LF+E +FIS
Sbjct: 371 QLFTEATFIS 380



>gi|388583334|gb|EIM23636.1| oxidative stress survival, Svf1-like protein [Wallemia sebi CBS
           633.66]
          Length = 401

 Score =  172 bits (436), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 176/352 (50%), Gaps = 62/352 (17%)

Query: 11  LWNPTIQFTSRFFG--NGVNTFKSVNMTNFTL-------SPDRRSASANNMSI---KLNP 58
            W P IQF    +        +KS+++ NF+        S DRRS SA+  +I    L  
Sbjct: 50  FWYPQIQFNFMLYNPTTANKLWKSISVNNFSTPAKVPGKSYDRRSCSADQFTILHESLPN 109

Query: 59  ECNKYAVNL---THKELIVSFEFERIDRGFKIG----GGKTYFGQDKSS----GFVEHKF 107
               Y +N       ++I++F       GFK+G    GG T +G DKSS    G+V H+F
Sbjct: 110 GDESYRINAKIDNEVQIIINFIRPASCAGFKLGDGPEGGYTSYGNDKSSNKRDGYVVHRF 169

Query: 108 WPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD----VASLSMC 163
           WP+   +G +++ G+  D  G G F+HAIQGMR +L+A  WNF  FQSD    V+SL M 
Sbjct: 170 WPRVRTEGQVIIKGKLVDAVGHGAFIHAIQGMRANLVARSWNFALFQSDQHGGVSSLLM- 228

Query: 164 EFETTPNY---------GSKKINQGSLVVNNKLVGVSVK-----------NMAQFLETSL 203
           EFETT  Y         G  K+  G+LV  +KL+ V+               A++  T  
Sbjct: 229 EFETTDGYGLATRTEGGGGVKVTIGALVAGDKLLSVTGSTTYPGQMPQGLTAAEYRNTIK 288

Query: 204 DPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLD---------VLMDKIDVLNEVPYF 254
           D ET Y VP++++Y W G  +E ++   A + +             L++K+D L  +PY 
Sbjct: 289 DQETAYIVPSEVRYVWGGAAIENNKAIRAEMLVNYKNEKEEGVNRGLVEKVDFLAHIPYV 348

Query: 255 LKKIVQAFV-AKPYVYQWFNEAEAHVK----IGENEELTAKGKLFSECSFIS 301
           ++K V  F   KPY+YQ+ N AE  +     + E  +LT +G  F+E SFIS
Sbjct: 349 VRKAVHVFAKTKPYIYQYLNPAELQLDLPEGVAEATKLTVQGTAFTEQSFIS 400



>gi|380493980|emb|CCF33486.1| survival factor 1 [Colletotrichum higginsianum]
          Length = 381

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 108/315 (34%), Positives = 172/315 (54%), Gaps = 19/315 (6%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVN---TFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+G    T QF ++ F  G +    +++  + ++ +S DR S  A++ +++L+
Sbjct: 71  LAQVIYSNVGGIRTTCQFNAKIFYPGKSKPTVWETTQLEHYEVSDDRMSFYADDCAVELS 130

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIG-GGKTYFGQD--KSSGFVEHKFWPKGNV 113
            +   Y +   + E  IV+ +  R   GF  G  GKT FG D  K  G + H FWP+  V
Sbjct: 131 EDGTYYTIKSMNSENAIVNLKVTRTAPGFHAGKTGKTLFGTDLAKPWGTMRHAFWPRCVV 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D TG   +V+A+QGM+PH  A++WNFV+FQ    S  M E+ T P+YGS
Sbjct: 191 EGTITTKEGPVDFTGRAFYVYALQGMKPHHAAAKWNFVDFQGPNFSAVMMEYTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDED---F 230
             ++ G +  + +++   V   A   +   D   ++  P +IK+TW GK    D+D    
Sbjct: 251 TVVSVGGIAKDGEMIYGGVTQTAAHTKVKNDAVNEWPEPEEIKFTWSGK----DKDGKAV 306

Query: 231 SAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQW---FNEAEAHVKIGENEE 286
            A +E  L   +D++DVL EVP F+KKIV      KPY+YQ+     +    +KIG +EE
Sbjct: 307 DAIIEGPLGERLDRVDVLAEVPGFVKKIVAGTAGTKPYIYQYCPTKTKLTLKLKIG-DEE 365

Query: 287 LTAKGKLFSECSFIS 301
           ++ +G  FSE +FIS
Sbjct: 366 ISEEGLCFSEATFIS 380



>gi|443919903|gb|ELU39948.1| survival factor 1 [Rhizoctonia solani AG-1 IA]
          Length = 406

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 180/353 (50%), Gaps = 65/353 (18%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV--NTFKSVNMTNFTLSP---DRRSASANNMSIK 55
           + Q+IHS          FT R F       T+KS+N+TNF   P   D+RS+ A+  ++ 
Sbjct: 64  WCQIIHS----------FTCRVFNPATKETTWKSINVTNFVTPPPGKDKRSSKADQFTVT 113

Query: 56  LNPECNKYAVNLT-----HKELIVSFEFERID--RGFKIGGGKTYFGQD--KSSGFVEHK 106
                 ++A   T       +L ++    R     GFK+G G+++FG D  K  G+V H+
Sbjct: 114 HGVGSGEFAEQYTINANLENDLQLALTISRPSSAEGFKVGRGESFFGPDVSKPEGYVVHR 173

Query: 107 FWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQS---DVASLSMC 163
           FWP+    G+++  G+A +  GVG+FVHAIQGMRP+L+A+RWNF NFQS    V+++ M 
Sbjct: 174 FWPRTKCAGHIIKSGQAIEANGVGMFVHAIQGMRPNLVAARWNFANFQSKDEQVSAIQM- 232

Query: 164 EFETTPNYGSK-------KINQGSLVVNNKLVGVS---------------VKNMAQFLET 201
           EF T   YG +        +N G +VV  KL+ V+               V++ A  L  
Sbjct: 233 EFTTIGAYGREGAGSGGVSVNVGGVVVGGKLIAVTGETAWTGETSAADAPVQSRAVHLGR 292

Query: 202 SLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDKIDVLNEVPY 253
             DPET YK P++I YTW+   +       A  EI  DV        L+ K+DVL E+P 
Sbjct: 293 VSDPETGYKQPSQIVYTWQAPGIGDVAPVKA--EITSDVGTPDAPKGLVQKVDVLGEIPA 350

Query: 254 FLKKIVQ-AFVAKPYVYQWFNEAEAHVKIGEN----EELTAKGKLFSECSFIS 301
            LK ++  A   KPY+YQW N +   V   E+       T  G L++E +FIS
Sbjct: 351 ALKMVISYAAGTKPYIYQWLNPSTLSVTGPESLVPGGSKTISGTLYNEATFIS 403



>gi|471558913|gb|EMR61458.1| putative survival factor 1 protein [Eutypa lata UCREL1]
          Length = 383

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 171/311 (54%), Gaps = 12/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT---FKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+I+SN+     T QF ++ F    +    + S  + +   S D+ S  A + +++L+
Sbjct: 71  FVQVIYSNVVGIRTTCQFNTKIFYPDRSKPILWSSTPLHDVDFSDDKTSFYAQDCAMELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + ++  ++ IV+ +  +   GF  G  G T +G D S+  G + H FWP+   
Sbjct: 131 EDGKSYTIKSMNDQKCIVNVKVAQAAPGFVAGKNGTTLYGTDLSNPWGTMRHAFWPRCVG 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +V +    D  G   F HA+QGM+PH  A+RWNF NFQS   S  + EF T P+YGS
Sbjct: 191 EGQIVTEEGPIDFKGPAFFSHALQGMKPHHAAARWNFANFQSPNYSAILMEFTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +  G +  + +++        +  +T  D    +  PT+IK+TW G T +  +   A 
Sbjct: 251 TVVGVGGIAKDGEIIAAGSITSVEHKKTKQDSTNDWPEPTEIKFTWTG-TAKDGKPVEAV 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA--HVKIGENEELTAK 290
           +E  L+  +D+IDV+ EVP F+K IV   V  KPY+YQ+  +A     +KIGE +E++ +
Sbjct: 310 IEGALEDKLDRIDVMAEVPGFVKTIVATAVGTKPYIYQFSPKAPTTLKLKIGE-QEVSEE 368

Query: 291 GKLFSECSFIS 301
           G+LFSE +FIS
Sbjct: 369 GRLFSEATFIS 379



>gi|477528877|gb|ENH80650.1| survival factor 1 [Colletotrichum orbiculare MAFF 240422]
          Length = 381

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 173/315 (54%), Gaps = 19/315 (6%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+++SN+G    T QF ++ F    +    +++  +++  +S DR S  A++ +++L+
Sbjct: 71  LAQVVYSNVGGIRTTCQFNAKIFYPEKSKPTLWEASQLSHQEISSDRYSFYADDCAVELS 130

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y +   + E  IV+ +  R   GF  G  GKT FG D S   G + H FWP+  V
Sbjct: 131 EDGTYYTIKSMNSENAIVNLKVTRTAPGFHAGKTGKTLFGTDMSKPWGTMRHAFWPRCAV 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       +  G G +V+A+QGM+PH  A++WNFV+FQ    S  M E+ T P+YGS
Sbjct: 191 EGTITTKEGPVNFAGRGFYVYALQGMKPHHAAAKWNFVDFQGPNYSAVMMEYTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDED---F 230
             ++ G +  + +++   V   A   ++  D   ++  P +IK+TW GK    D+D    
Sbjct: 251 TTVSVGGIAKDGEMIYGGVTQTAAHTKSKNDSVNEWPEPEEIKFTWTGK----DKDGKAV 306

Query: 231 SAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF---NEAEAHVKIGENEE 286
            A +E  L   +D++DVL EVP F+KKIV      KPY+YQ+    N+    +KIG ++E
Sbjct: 307 EALIEGPLGERLDRVDVLAEVPGFVKKIVAGTAGTKPYIYQFCPTKNKLTLKLKIG-DQE 365

Query: 287 LTAKGKLFSECSFIS 301
           ++ +G  FSE +FIS
Sbjct: 366 ISEEGLCFSEATFIS 380



>gi|482810156|gb|EOA86962.1| hypothetical protein SETTUDRAFT_163062 [Setosphaeria turcica Et28A]
          Length = 376

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 169/310 (54%), Gaps = 13/310 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT---FKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F+Q+I++NI     T+QF  + F  G      + S  + N+     + S  A+ +SI+L+
Sbjct: 71  FLQVIYNNIAGLRVTVQFNCKLFYPGNEKPFLWASDPVQNYGFDEKQHSFYADGVSIELS 130

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIGG--GKTYFGQDKSS--GFVEHKFWPKGN 112
            E + Y +    +++ +V+ +F R   GF +GG  G T +G +     G + H FWP+ +
Sbjct: 131 DEGDAYTIKAAVNEDSMVNVKFTRTAPGF-MGGKDGTTNYGTNPKEPWGSMHHHFWPRCS 189

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G ++      DV G G+  HA+QGM+PH  A+RWNFVNFQS   S  + EF T  +Y 
Sbjct: 190 VEGTIITKEAQIDVKGRGMLSHALQGMKPHHAAARWNFVNFQSPSYSAIIMEFTTPASYA 249

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           S  +    +  + KL+  + +   +  ET  D ET +  PT   Y W G+T E  E+ +A
Sbjct: 250 STVVRVAGIATDGKLLFANTQGDVKHTETKQD-ETGWSAPTSASYHWTGET-EDGEEVTA 307

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIV-QAFVAKPYVYQWFNEAEAHVKIGENEELTAKG 291
            L   L   +D++DV+ EVP F+K IV  A   KPY+YQ+  +    VK+G +E    +G
Sbjct: 308 DLAGALGETIDRVDVMAEVPGFIKTIVASAAGTKPYIYQYAPKMTIKVKVG-DEVKEEEG 366

Query: 292 KLFSECSFIS 301
            LF+E +FIS
Sbjct: 367 TLFTEATFIS 376



>gi|396465408|ref|XP_003837312.1| similar to survival factor 1 [Leptosphaeria maculans JN3]
 gi|312213870|emb|CBX93872.1| similar to survival factor 1 [Leptosphaeria maculans JN3]
          Length = 377

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 174/310 (56%), Gaps = 12/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSR-FFGNGVNTFKSVN--MTNFTLSPDRRSASANNMSIKLN 57
           F+Q+I++NI     T+QF  + F+ N    F  V+  ++N+    ++ S  A+ +SI+L+
Sbjct: 71  FLQVIYNNIAGLRVTVQFNVKLFYPNNEKPFLWVSDPVSNYGFDEEQHSFFADGVSIELS 130

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIGG--GKTYFGQDKSS--GFVEHKFWPKGN 112
           P+   Y +    + + +V+ +F R   G+ +GG  G T +G D  +  G + H FWP+ +
Sbjct: 131 PDGTAYTIKAAVNDKSLVNVKFTRTAPGY-MGGKDGTTNYGTDPKAPWGSMHHHFWPRCS 189

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G+++      ++ G G+  HA+QGM+PH  A+RWNFV FQS   S  + EF T P+Y 
Sbjct: 190 VEGSIITKEGEVNMKGRGMLSHALQGMKPHHAAARWNFVCFQSPSYSAIIMEFTTPPSYA 249

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           +  +    +  ++KL+  +     +   T  DP+T +  PT   Y W+GKT +  E  +A
Sbjct: 250 NTVVRVAGIASDDKLIVANTDCDVRHTATKEDPDTHWPEPTAAAYHWQGKTADGKE-VTA 308

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKI-VQAFVAKPYVYQWFNEAEAHVKIGENEELTAKG 291
            LE  L  + D++DV+ EVP F+K I   A   KPY+YQ+  +    +K+G +E    +G
Sbjct: 309 DLEGALGKIYDRVDVMAEVPGFIKAIAASAAGTKPYIYQYAPKLTIKIKVG-DEVKEEEG 367

Query: 292 KLFSECSFIS 301
            LF+E +F+S
Sbjct: 368 LLFTEATFVS 377



>gi|406867019|gb|EKD20058.1| survival factor 1 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 380

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 165/311 (53%), Gaps = 12/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF----GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           FVQ+IHSN+G    T QF  + +     N  + + S  + +   S D  S  A N++++L
Sbjct: 71  FVQVIHSNVGGLRTTSQFNCKIYYPKKDNKPSLWSSDQLNDVDFSDDMNSFYAQNLAVEL 130

Query: 57  NPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           + + N Y + +LT++  +V+    R   G  +G  G +YFG D  +  G + H FWP   
Sbjct: 131 SEDGNTYTIKSLTNEASVVNLTVTRKAPGIHVGKDGTSYFGTDPKAPWGKIRHAFWPSAI 190

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
             G +       D TG  +F+HA+QGM+PH   +RW F +FQS+  S  M EF T  +YG
Sbjct: 191 GSGTITTADGPIDFTGNAIFIHALQGMKPHHAGARWKFCHFQSENYSAIMMEFITPASYG 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           +  +  G +   +++V       A + +   D  + +  P   K  W GKT +  +D +A
Sbjct: 251 NTPVTVGVIAKGSEIVIAGSSGKATWTKVKADTVSGWSPPEAAKVEWSGKTKD-GKDVTA 309

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEAEA-HVKIGENEELTAK 290
            ++  L    D+ID++ EVP F+K IV  A   +PY+YQ+ N   +  +K+G N+E+  +
Sbjct: 310 VIDTPLSDHFDRIDIMAEVPGFVKTIVAGAAGTRPYIYQYPNTPTSLKIKVG-NDEINEQ 368

Query: 291 GKLFSECSFIS 301
           G L++E +FIS
Sbjct: 369 GTLYTEATFIS 379



>gi|46121387|ref|XP_385248.1| hypothetical protein FG05072.1 [Fusarium graminearum PH-1]
 gi|83305840|sp|Q4ICI6.1|SVF1_GIBZE RecName: Full=Survival factor 1
          Length = 377

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 166/309 (53%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+     T QF  + F       + + S  + N   + D+ S  A++ +++L+
Sbjct: 71  LAQVIYSNVAGIRTTCQFNCKVFDKDPTKPHLWASTPLNNQDFNEDKTSFYADDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGGGKTYF---GQDKSSGFVEHKFWPKGNV 113
            +   Y + ++  ++ IV+ +  R   GF+ G   T       +   G + H FWP+   
Sbjct: 131 EDGTYYTIKSMNSQDAIVNLKITRSTPGFQAGTTGTTLYGTDHNNPWGSIRHAFWPRCVS 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D+ G  LFV+A+QGM+PH  A RWNFVNFQ    S  M EF +TP+YGS
Sbjct: 191 EGTITTKEGPIDLKGKALFVYALQGMKPHHAAGRWNFVNFQGPTYSAIMMEFTSTPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++     + A   +   D E ++  P+++KYTW G T +  +   A 
Sbjct: 251 TLVNVGGIVKDGEIIHAGAMSTATHTQVKKDSENEWPEPSEVKYTWSGATKDA-KPVEAS 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
           +E  L   +D++DV+ EVP F+K IV A    KPY+YQ+  +    +KIG +EE+  +G 
Sbjct: 310 IEGPLGERVDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYHPKLSLKLKIG-DEEIVEEGV 368

Query: 293 LFSECSFIS 301
           +F+E +FIS
Sbjct: 369 MFTEATFIS 377



>gi|408395752|gb|EKJ74928.1| hypothetical protein FPSE_04964 [Fusarium pseudograminearum CS3096]
          Length = 377

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 165/309 (53%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+     T QF  + F       + + S  + N   + D+ S  A++ +++L+
Sbjct: 71  LAQVIYSNVAGIRTTCQFNCKVFDKDPTKPHLWASTPLNNQDFNEDKTSFYADDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGGGKTYF---GQDKSSGFVEHKFWPKGNV 113
            +   Y + ++  +  IV+ +  R   GF+ G   T       +   G + H FWP+   
Sbjct: 131 EDGTYYTIKSMNSQNAIVNLKITRSTPGFQAGTTGTTLYGTDHNNPWGSIRHAFWPRCVS 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D+ G  LFV+A+QGM+PH  A RWNFVNFQ    S  M EF +TP+YGS
Sbjct: 191 EGTITTKEGPIDLKGKALFVYALQGMKPHHAAGRWNFVNFQGPTYSAVMMEFTSTPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + +++     + A   +   D E ++  P+++KYTW G T +  +   A 
Sbjct: 251 TLVNVGGIVKDGEIIHAGAMSTATHTQVKKDSENEWPEPSEVKYTWSGATKD-GKPVEAL 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
           +E  L   +D++DV+ EVP F+K IV A    KPY+YQ+  +    +KIG +EE+  +G 
Sbjct: 310 IEGSLGDRVDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYHPKLSLKLKIG-DEEIVEEGV 368

Query: 293 LFSECSFIS 301
           +F+E +FIS
Sbjct: 369 IFTEATFIS 377



>gi|452838839|gb|EME40779.1| hypothetical protein DOTSEDRAFT_74353 [Dothistroma septosporum
           NZE10]
          Length = 375

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 176/311 (56%), Gaps = 12/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGN---GVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            + +I+S++     T QF+S+ + +     + + S N+ N + S D+++  A+  +I L+
Sbjct: 67  LLSLIYSDVMGVRTTAQFSSKIYASEPGKPHLWASDNLNNVSFSKDKQNLKADKCAIDLS 126

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + + T+K  +V  +F +   GF  G  G + FG D ++  G + HKFWP+ NV
Sbjct: 127 EDGKTYHIKSSTNKTQVVDMKFTQATPGFVAGKNGTSTFGTDPANPWGKMYHKFWPRCNV 186

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G ++      D  G G+F+HA+QGM+PH  A++WNF  FQ+   +  M EF T P+YG 
Sbjct: 187 EGTIMTKEGPVDFKGKGVFIHALQGMKPHFAAAKWNFAYFQTPTYTAIMMEFTTPPSYGE 246

Query: 174 KKINQGSLVVNNKLV--GVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFS 231
            K+N G +V + +++  G S +  A+  E   DP+  +  P  + +TW+GKT +   D  
Sbjct: 247 TKVNVGGVVKDGEIIFAGASPQLKAEHTEIKGDPDNDWPEPGAVAFTWDGKT-QDGRDAH 305

Query: 232 AFLEIKLDVLMDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQWFNEAEAHVKIGENEELTAK 290
           A L+  +    D++DV+ E+P F+K+IV  A   KPY+YQ+  + +  + I   EE   +
Sbjct: 306 AELKGAITPRTDRVDVMGELPKFVKQIVAGAAGTKPYIYQYTPKLKLKLNI-GGEEHEEE 364

Query: 291 GKLFSECSFIS 301
           G+LF E +FIS
Sbjct: 365 GQLFMEATFIS 375



>gi|477510061|gb|ENH63349.1| Survival factor 1 [Fusarium oxysporum f. sp. cubense race 1]
          Length = 377

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 163/309 (52%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT---FKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+     T QF ++ F +  +    + S  + N   + D+ S  A++ +I+L+
Sbjct: 71  LAQLIYSNVAGIRTTCQFNAKVFSSDPSKPHLWASTPLNNHDFNEDKTSFYADDCAIELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGGGKTYFGQ---DKSSGFVEHKFWPKGNV 113
            +   Y + ++     IV+ +  R   GF+ G   T       +   G + H FWP+   
Sbjct: 131 EDGTYYTIKSMNDPNAIVNLKITRSTPGFQAGTTGTTLYGTDLENPWGSMRHAFWPRCVS 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G   F +A+QGM+PH  ASRWNF+NFQ    S  + EF +TP+YGS
Sbjct: 191 EGTITTKDGPMDFKGKAFFAYALQGMKPHHAASRWNFLNFQGPTYSAVLMEFTSTPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + ++V   V N A   +   D E  +  P+  KYTW GKT +  +   A 
Sbjct: 251 TLVNVGGIVKDGEIVIGGVDNAATHTQVKKDSENDWPEPSDAKYTWAGKTKD-GKAVEAS 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
           +E  L   +D++DV+ EVP F+K IV A    KPY+YQ+  +    +KIG+ EE+  +G 
Sbjct: 310 VEGSLGERVDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYHPKLSLKIKIGD-EEIVEEGT 368

Query: 293 LFSECSFIS 301
           +F+E +FIS
Sbjct: 369 IFTEATFIS 377



>gi|475662934|gb|EMT60730.1| Survival factor 1 [Fusarium oxysporum f. sp. cubense race 4]
          Length = 377

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 163/309 (52%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT---FKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+     T QF ++ F +  +    + S  + N   + D+ S  A++ +I+L+
Sbjct: 71  LAQLIYSNVAGIRTTCQFNAKIFSSDPSKPHLWASTPLNNHDFNEDKTSFYADDCAIELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGGGKTYFGQ---DKSSGFVEHKFWPKGNV 113
            +   Y + ++   + IV+ +  R   GF+ G   T       +   G + H FWP+   
Sbjct: 131 EDGTFYTIKSMNDPDAIVNLKITRSTPGFQAGTTGTTLYGTDLENPWGSMRHAFWPRCVS 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G   F +A+QGM+PH  ASRWNF+NFQ    S  + EF +TP+YGS
Sbjct: 191 EGTITTKDGPMDFKGKAFFAYALQGMKPHHAASRWNFLNFQGPTYSAVLMEFTSTPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + ++V   V N A   +   D E  +  P+  KYTW GKT +  +   A 
Sbjct: 251 TLVNVGGIVKDGEIVIGGVDNTATHTQVKKDSENDWPEPSDAKYTWAGKTKD-GKAVEAS 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
           +E  L   +D++DV+ EVP F+K IV A    KPY+YQ+  +    +KIG+ EE   +G 
Sbjct: 310 VEGSLGERVDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYHPKLSLKLKIGD-EEFVEEGT 368

Query: 293 LFSECSFIS 301
           +F+E +FIS
Sbjct: 369 IFTEATFIS 377



>gi|342880281|gb|EGU81447.1| hypothetical protein FOXB_08029 [Fusarium oxysporum Fo5176]
          Length = 377

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 102/309 (33%), Positives = 163/309 (52%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT---FKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+     T QF ++ F +  +    + S  + N   + D+ S  A++ +I+L+
Sbjct: 71  LAQLIYSNVAGIRTTCQFNAKVFSSDPSKPHLWASTPLNNHDFNEDKTSFYADDCAIELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGGGKTYFGQ---DKSSGFVEHKFWPKGNV 113
            +   Y + ++     IV+ +  R   GF+ G   T       +   G + H FWP+   
Sbjct: 131 EDGTYYTIKSMNDPNAIVNLKITRSTPGFQAGTTGTTLYGTDLENPWGSMRHAFWPRCVS 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G   F +A+QGM+PH  ASRWNF+NFQ    S  + EF +TP+YGS
Sbjct: 191 EGTITTKDGPMDFKGKAFFAYALQGMKPHHAASRWNFLNFQGPTYSAVLMEFTSTPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V + ++V   V N A   +   D E  +  P+  KYTW GKT +  +   A 
Sbjct: 251 TLVNVGGIVKDGEIVIGGVDNAATHTQVKKDSENDWPEPSDAKYTWAGKTKD-GKAVEAS 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
           +E  L   +D++DV+ EVP F+K IV A    KPY+YQ+  +    +KIG+ EE+  +G 
Sbjct: 310 VEGSLGERVDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYHPKLSLKMKIGD-EEIVEEGT 368

Query: 293 LFSECSFIS 301
           +F+E +FIS
Sbjct: 369 VFTEATFIS 377



>gi|452003049|gb|EMD95506.1| hypothetical protein COCHEDRAFT_1126255 [Bipolaris maydis C5]
 gi|477593301|gb|ENI10370.1| hypothetical protein COCC4DRAFT_155941 [Bipolaris maydis ATCC
           48331]
          Length = 376

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 167/310 (53%), Gaps = 13/310 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSR-FFGNGVNTF--KSVNMTNFTLSPDRRSASANNMSIKLN 57
           F+Q+I++NI     T+QF  + FF N    F   S  + N+     + S  A+ +SI+L+
Sbjct: 71  FLQVIYNNIAGLRVTVQFNCKLFFPNNEKPFLWASDPVYNYGFDEKQHSFFADGVSIELS 130

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIGG--GKTYFGQDKSS--GFVEHKFWPKGN 112
            +  +Y +    +E  +V  +F R   GF +GG  G T +G +     G + H FWP+ +
Sbjct: 131 EDGTQYTIKAAVREDCMVDVKFTRTAPGF-MGGKDGTTNYGTNPKEPWGSMHHHFWPRCS 189

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G +       DV G G+  HA+QGM+PH  A+RWNFVNFQS   S  + EF T  +Y 
Sbjct: 190 VEGAIHTKEGPVDVKGRGMLSHALQGMKPHHAAARWNFVNFQSPSYSAILMEFTTPASYA 249

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           S  +    +  + KL+  +     +  ET  D ET +  PT   Y W GKT E  +D +A
Sbjct: 250 STIVRVAGIATDGKLLFANTDGDVKHTETKQD-ETGWPAPTAASYHWVGKT-EDGKDVTA 307

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIV-QAFVAKPYVYQWFNEAEAHVKIGENEELTAKG 291
            +   L  ++D++DV+ EVP F+K IV  A   KPY+YQ+  +    VK+G +E    +G
Sbjct: 308 DIAGSLGEIIDRVDVMAEVPGFIKTIVASAAGTKPYIYQYAPKMTIKVKVG-DEIKEEEG 366

Query: 292 KLFSECSFIS 301
            LF+E +FIS
Sbjct: 367 TLFTEATFIS 376



>gi|226294073|gb|EEH49493.1| survival factor 1 [Paracoccidioides brasiliensis Pb18]
          Length = 384

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 171/311 (54%), Gaps = 12/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            +Q+I+SN+   + T  F S+ +   G   + + S ++ ++    D  S    N+++ LN
Sbjct: 76  MLQVIYSNVAGIHTTCHFNSKIYATDGKSEHRWCSDSIRDYMFDEDMLSFGGENIALTLN 135

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y V +  + + +V+   +R   GF  G  G +YFG D  +  G + H FWP+  V
Sbjct: 136 AEGDTYTVKSAMNPDSLVNVTLKRTAPGFAAGRDGTSYFGTDPKNPWGSMRHVFWPRCQV 195

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G+++   R  D  G G+F+HA+QGM+PH +A+RWNF  FQS   S    E+ T P+YGS
Sbjct: 196 EGSIISPEREIDFKGRGVFIHALQGMKPHHLAARWNFGTFQSPAYSAVFMEYTTPPSYGS 255

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +V   ++V       A  LE+  D  T +  P  ++ TW+GKT +  E  SA 
Sbjct: 256 TVVSVGGVVKGGEIVCAGPVQPAVHLESEKDDYTSWPQPKSVRLTWDGKTKD-GEPVSAV 314

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF--NEAEAHVKIGENEELTAK 290
           LE  L   +D++DV+ EVP  +K I  +    KPY++Q+   ++    V+IG++EE +  
Sbjct: 315 LEGSLGRRLDRVDVMAEVPGIIKSIAGSVAGTKPYIFQYAPQDKLPLQVRIGDSEE-SEH 373

Query: 291 GKLFSECSFIS 301
           G L+ E +FIS
Sbjct: 374 GTLYLEATFIS 384



>gi|330933254|ref|XP_003304107.1| hypothetical protein PTT_16544 [Pyrenophora teres f. teres 0-1]
 gi|311319520|gb|EFQ87804.1| hypothetical protein PTT_16544 [Pyrenophora teres f. teres 0-1]
          Length = 377

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 170/315 (53%), Gaps = 22/315 (6%)

Query: 1   FVQMIHSNIGLWNPTIQFTSR-FFGNGVNTF--KSVNMTNFTLSPDRRSASANNMSIKLN 57
           F+Q+I++NI     T+QF  + F+ N    F   S  + N+    D+ S  A+ +SI+L+
Sbjct: 71  FLQVIYNNIAGLRVTVQFNCKLFYPNNEKPFLWASDPVHNYGFDEDQHSFYADGVSIELS 130

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIGG--GKTYFGQDKSS--GFVEHKFWPKGN 112
            + N Y +     E  +V+ +F R   GF +GG  G T +G D  +  G + H FWP+ +
Sbjct: 131 ADGNSYEIKAAVNENSMVNVKFTRTAPGF-MGGKDGMTNYGTDPKAPWGSMHHHFWPRCS 189

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G ++      DVTG G+  HA+QGM+PH  A+RWNFVNFQS   S  + EF T  +Y 
Sbjct: 190 VEGKIITKDGEVDVTGRGMLSHALQGMKPHHAAARWNFVNFQSPSYSAIIMEFTTPSSYA 249

Query: 173 SKKINQGSLVVNNKLV-----GVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETD 227
           S  +    +  + +L+     G  VK+     ET  D ET +  PT   Y W GKT +  
Sbjct: 250 STVVRVCGIATDGELLFANTDGAEVKHT----ETKQD-ETGWAEPTAASYHWVGKTKDGK 304

Query: 228 EDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIV-QAFVAKPYVYQWFNEAEAHVKIGENEE 286
           E  +A L   L   +D++DV+ EVP F+K IV  A   KPY+YQ+       VK+G+ E 
Sbjct: 305 E-VTADLAGALGKNLDRVDVMAEVPGFIKTIVASAAGTKPYIYQYAPTMTIKVKVGD-EV 362

Query: 287 LTAKGKLFSECSFIS 301
              +G LF+E +FIS
Sbjct: 363 KEEEGTLFTEATFIS 377



>gi|451856461|gb|EMD69752.1| hypothetical protein COCSADRAFT_32426 [Bipolaris sorokiniana
           ND90Pr]
          Length = 376

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 108/310 (34%), Positives = 167/310 (53%), Gaps = 13/310 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSR-FFGNGVNTF--KSVNMTNFTLSPDRRSASANNMSIKLN 57
           F+Q+I++NI     T+QF  + FF N    F   S  + N+     + S  A+ +S++L+
Sbjct: 71  FLQVIYNNIAGLRVTVQFNCKLFFPNNEKPFLWASDPVYNYGFDEKQHSFFADGVSVELS 130

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIGG--GKTYFGQDKSS--GFVEHKFWPKGN 112
            +  +Y +    +E  +V  +F R   GF +GG  G T +G +     G + H FWP+ +
Sbjct: 131 EDGTQYTIKAAVREDCMVDVKFTRTAPGF-MGGKDGTTNYGTNPKEPWGSMHHHFWPRCS 189

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G +       DV G G+  HA+QGM+PH  A+RWNFVNFQS   S  + EF T  +Y 
Sbjct: 190 VEGAIHTKEGPVDVKGRGMLSHALQGMKPHHAAARWNFVNFQSPSYSAILMEFTTPASYA 249

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           S  +    +  + KL+  + +   +  E+  D ET +  PT   Y W GKT E  +D +A
Sbjct: 250 STIVRVAGIATDGKLLFANTEGDVKHTESKQD-ETGWPAPTAASYHWVGKT-EDGKDVTA 307

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIV-QAFVAKPYVYQWFNEAEAHVKIGENEELTAKG 291
            +   L   +D++DV+ EVP F+K IV  A   KPY+YQ+  +    VK+G +E    +G
Sbjct: 308 DIAGSLGEAIDRVDVMAEVPGFIKTIVASAAGTKPYIYQYAPKMTIKVKVG-DEVKEEEG 366

Query: 292 KLFSECSFIS 301
            LF+E +FIS
Sbjct: 367 TLFTEATFIS 376



>gi|512194205|gb|EPE09961.1| survival factor 1 [Ophiostoma piceae UAMH 11346]
          Length = 384

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 108/316 (34%), Positives = 169/316 (53%), Gaps = 17/316 (5%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF----GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           FVQ+I++N+     T QF ++ F     N    + S  + +   S D +S  A + +++L
Sbjct: 71  FVQVIYNNVAGIRTTCQFNTKIFYVQDENKETLWSSTPLKDHEFSEDMQSFYATDCAVEL 130

Query: 57  NPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           + +   Y + + T    +V+    R   GF+IG  G+T FG D  +  G + H FWP+  
Sbjct: 131 SEDGTHYTIKSHTDDNAVVNLTVTRSCPGFQIGKDGRTLFGTDLENPWGSMRHVFWPRCV 190

Query: 113 VKGNMV--VDGRAFDVTGVGL-FVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTP 169
             G +    DG   D TG    F+HA+QGM+PH +ASRWNF NFQ    S  + +F T P
Sbjct: 191 ASGTITTKADG-PIDFTGSHTQFIHALQGMKPHHLASRWNFANFQGKDHSAVLMQFITPP 249

Query: 170 NYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDED 229
           +YGS  +  G +V + +++       A  +  + D E ++  PT+IKYTW G T +    
Sbjct: 250 SYGSTVVTVGGVVKDGEIIFAGTDATATHIAATEDGENEWPEPTQIKYTWAG-TAKDGSK 308

Query: 230 FSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF---NEAEAHVKIGENE 285
             A LE  L+  +D+IDV+ EVP F+KKI  +    KP++YQ+F    +    +K G+  
Sbjct: 309 VEAVLEGALEERLDRIDVMAEVPGFVKKIAGSVAGTKPFIYQYFPRHTKLSLKLKQGDAP 368

Query: 286 ELTAKGKLFSECSFIS 301
           E++  G LF+E +FIS
Sbjct: 369 EVSEPGLLFAEATFIS 384



>gi|189206005|ref|XP_001939337.1| survival factor 1 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187975430|gb|EDU42056.1| survival factor 1 [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 377

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 113/315 (35%), Positives = 171/315 (54%), Gaps = 22/315 (6%)

Query: 1   FVQMIHSNIGLWNPTIQFTSR-FFGNGVNTF--KSVNMTNFTLSPDRRSASANNMSIKLN 57
           F+Q+I++NI     T+QF  + F+ N    F   S  + N+    ++ S  A+ +SI+L+
Sbjct: 71  FLQVIYNNIAGLRVTVQFNCKLFYPNNEKPFLWASDPVHNYGFDENQHSFYADGVSIELS 130

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIGG--GKTYFGQDKSS--GFVEHKFWPKGN 112
            + N Y +     E  +V+ +F R   GF +GG  G T +G D  +  G + H FWP+ +
Sbjct: 131 ADGNSYDIKAAVNENSMVNVKFTRTAPGF-MGGKDGMTNYGTDPKAPWGSMHHHFWPRCS 189

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G ++      DVTG G+  HA+QGM+PH  A+RWNF NFQS   S  + EF T  +Y 
Sbjct: 190 VEGKIITKDGEVDVTGRGMLSHALQGMKPHHAAARWNFANFQSPSYSAIIMEFTTPSSYA 249

Query: 173 SKKINQGSLVVNNKLV-----GVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETD 227
           S  +    +  + +L+     G  VK+     ET  D ET +  PT   Y W GKT +  
Sbjct: 250 STVVRVCGIATDGELLFANTDGAEVKHT----ETKQD-ETGWAEPTAASYHWVGKTKD-G 303

Query: 228 EDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIV-QAFVAKPYVYQWFNEAEAHVKIGENEE 286
           +D +A L   L   +D++DV+ EVP F+K IV  A   KPY+YQ+  +    VK+G+ E 
Sbjct: 304 KDVTADLAGALGKNIDRVDVMAEVPGFIKTIVASAAGTKPYIYQYAPKMTIKVKVGD-EV 362

Query: 287 LTAKGKLFSECSFIS 301
              +G LF+E +FIS
Sbjct: 363 KEEEGTLFTEATFIS 377



>gi|378726680|gb|EHY53139.1| survival factor 1 [Exophiala dermatitidis NIH/UT8656]
          Length = 376

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 93/311 (29%), Positives = 174/311 (55%), Gaps = 14/311 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+G  + T QF ++ F   G G + + S  +T++     + S  A N++++LN
Sbjct: 70  MAQVIYSNVGGIHTTAQFNTKIFDHEGPGKHLWCSDPLTDYGFDEPQTSFYAENLALELN 129

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
              + Y + +  ++  IV+   +R   GF++G  G +YFG D  +  G + H FWP+  V
Sbjct: 130 EAGDTYTIRSAVNENCIVNLTVKRTAPGFQLGEDGTSYFGTDPENPWGSLRHAFWPRCTV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
            G M    + + + G GL+++ +QGM+PH +A+RWNFVNFQ+   S  + E+ T  +YG 
Sbjct: 190 TGTMQTPTKQYKIDGRGLYIYGLQGMKPHHLAARWNFVNFQTPTYSAVLMEYTTPASYGR 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  +N+L+  + +  A+ + ++ + E  +  P  + + W+G+  +  +  +  
Sbjct: 250 TVVSVGGIAKDNELI-CAGECTAKHVTSNQETENDWPEPRTVAFEWKGE--QGGKPVTGD 306

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF--NEAEAHVKIGENEELTAK 290
           +   L    D+IDVL+ +P F+K  +      KP+++Q+   ++    +KIG +EE+T  
Sbjct: 307 ITGDLPARSDRIDVLSHLPGFVKSFISGATGLKPHIFQYSSKDQLSLKLKIG-DEEITEP 365

Query: 291 GKLFSECSFIS 301
           G+LF E +FIS
Sbjct: 366 GQLFCEATFIS 376



>gi|459367623|gb|EMG46593.1| Survival factor 1 [Candida maltosa Xu316]
          Length = 371

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 112/314 (35%), Positives = 172/314 (54%), Gaps = 30/314 (9%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG----NGVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           F Q+IHSNI     T QFT R F       VN + S  + NF    D  +  A+N+S+++
Sbjct: 74  FAQIIHSNIMGLTVTAQFTFRLFNPENPKEVNLWTSTKLDNF--RTDGFNFYADNLSLEM 131

Query: 57  NPECNKYAVNLTH--KELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKG 111
           +   NK  +  +H   + IV FE ER+  G   G  G +Y+G+D     G + H FWP+ 
Sbjct: 132 SD--NKKYILKSHVTDDSIVEFEMERLTEGVIFGDDGMSYYGEDPEQPWGSMRHVFWPRC 189

Query: 112 NVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNY 171
            V+GN++   + + + G  +FV A+QGM+PH  A  WNF+NFQS+  S    EF T  +Y
Sbjct: 190 KVEGNVITPTKEYQINGFTMFVMALQGMKPHHAAKSWNFINFQSEHYSAIQMEFTTPKSY 249

Query: 172 GSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTW---EGKTLETDE 228
           GS K+N G +  N +++  ++ N    LE+ +D E  + VP KI++ +   EG ++    
Sbjct: 250 GSTKVNIGIVCNNEEILYGTIDNQVTHLESEVD-EIGWSVPKKIEFDYLNQEGASV---- 304

Query: 229 DFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEEL 287
              A +   L  L++++DV+ E+P F+K IV     AKPY+YQ+ NE    ++I   EE 
Sbjct: 305 ---AKVNGDLSELIERVDVMAEIPQFVKNIVSGVSGAKPYIYQYSNEFT--IEIDGKEE- 358

Query: 288 TAKGKLFSECSFIS 301
             KG   +E +FIS
Sbjct: 359 --KGLGLTEVTFIS 370



>gi|296809932|ref|XP_002845304.1| survival factor 1 [Arthroderma otae CBS 113480]
 gi|238842692|gb|EEQ32354.1| survival factor 1 [Arthroderma otae CBS 113480]
          Length = 345

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 131/224 (58%), Gaps = 7/224 (3%)

Query: 84  GFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMR 140
           GF +G  G + FG D  +  G + H FWP+  V+G+++   +  D  G G FVHA+QGM+
Sbjct: 123 GFVVGKDGTSTFGTDPMNPWGSMRHAFWPRCKVEGSIITREKEIDFAGRGFFVHALQGMK 182

Query: 141 PHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLE 200
           P  +A+RWNFV+FQS   S  + E+ T P+YGS  +N G +  +++++     N     +
Sbjct: 183 PQHLAARWNFVDFQSPTFSACIMEYTTPPSYGSTVVNVGGIAKDSEILYAGAPNSVTHTD 242

Query: 201 TSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQ 260
            + D E  +  PT +K  W GKT    + F A +E  L   +D+IDV+ EVP F+K +V 
Sbjct: 243 FTQDSENDWPEPTAVKIVWSGKT-AAGKPFEATVEGSLGPRLDRIDVMAEVPGFIKSLVG 301

Query: 261 AFVA-KPYVYQWF--NEAEAHVKIGENEELTAKGKLFSECSFIS 301
           +    +PYVYQ+   N+    +KIGE+EE+T +G L  E +FIS
Sbjct: 302 SVAGTRPYVYQFVPPNKLPIRIKIGEDEEITEEGTLLMEATFIS 345



>gi|358393837|gb|EHK43238.1| hypothetical protein TRIATDRAFT_301141 [Trichoderma atroviride IMI
           206040]
          Length = 384

 Score =  163 bits (412), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 168/310 (54%), Gaps = 11/310 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           FVQ+I+SN+     T QF ++ F       + + S  + N   + +R S  A++ +++L+
Sbjct: 73  FVQVIYSNVAGLRVTCQFNAKIFSRDPAKPHLWCSNPLKNVAFNEERTSFYADDCAVELS 132

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N Y + ++  +  +V+ +  R   GF+ G  G T FG D     G + H FWP+   
Sbjct: 133 EDGNSYTIKSMNDERALVNLKVTRAAPGFQAGKTGTTLFGTDLKDPWGQMRHAFWPRCTS 192

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +        + G  ++++A+QGM+PH  A+ WNF  FQ    S  M EF T P+YG+
Sbjct: 193 EGTITTKDGDVSLKGQAIYIYALQGMKPHHAAATWNFATFQGPNHSAIMMEFITPPSYGN 252

Query: 174 KKINQGSLVVNNKLVGVSVK-NMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
             +N G++V + +++ VS + N      +  D    +  PT+ +Y W   T +  +   A
Sbjct: 253 TVVNVGAIVKDGEVIAVSSENNKVTHKASKKDTANDWPEPTQAEYDWSA-TGKDGKPVKA 311

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKG 291
            ++  L   +D+ID++ EVP F+K IV+A    KPY+YQ+  +    +KIG+ EE++  G
Sbjct: 312 VIDATLGDRVDRIDIMAEVPGFVKTIVKAAAGTKPYIYQYSTKTTLKLKIGD-EEISEDG 370

Query: 292 KLFSECSFIS 301
           +LF+E +FIS
Sbjct: 371 QLFTEATFIS 380



>gi|361126735|gb|EHK98724.1| putative Survival factor 1 [Glarea lozoyensis 74030]
          Length = 240

 Score =  163 bits (412), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 141/239 (58%), Gaps = 7/239 (2%)

Query: 67  LTHKELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKGNVKGNMVVDGRA 123
           + +++ IV+    R   GF++G  G +YFG D  +  G + H+FWP+  V+G+++     
Sbjct: 1   MVNQKSIVNITVTRTAPGFQVGNDGTSYFGTDPKAPWGSMRHRFWPRNTVEGSIMTKDGP 60

Query: 124 FDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVV 183
            D  G  L  HA+QGM+PH   ++W FV+FQ    S  M EF T P+YGS  +N G +V 
Sbjct: 61  IDFKGKALLSHALQGMKPHHAGAKWKFVDFQGPTYSAIMMEFTTPPSYGSTVVNVGGIVK 120

Query: 184 NNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMD 243
           + +++     ++A+  +   D E  +  P  +KY W GKT +  +  +A ++  LD  +D
Sbjct: 121 DGEIITAGASHVAEHTKIKGDSENDWPEPEAVKYQWNGKTKD-GKSITAVIDCPLDERLD 179

Query: 244 KIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEA-EAHVKIGENEELTAKGKLFSECSFI 300
           +IDV+ EVP F+K IV A    KPY+YQ+  ++ +  + +G++E+ + +G+LF+E +FI
Sbjct: 180 RIDVMAEVPGFVKTIVAAAAGTKPYIYQYSPKSCQLKINVGDDEK-SEEGQLFTEATFI 237



>gi|295670343|ref|XP_002795719.1| survival factor 1 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226284804|gb|EEH40370.1| survival factor 1 [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 380

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 171/311 (54%), Gaps = 12/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            +Q+I+SN+   + T  F S+ +   G   + + S ++ ++    D  S    N+++ LN
Sbjct: 72  MLQVIYSNVAGIHTTCHFNSKIYATDGKSEHRWCSDSIHDYMFDEDMLSFGGENIALTLN 131

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y + +  + + +V+   +R   GF  G  G +YFG D  +  G + H FWP+  V
Sbjct: 132 AEGDTYTIKSAMNPDSLVNVTLKRTAPGFAAGRDGTSYFGTDPKNPWGSMRHVFWPQCQV 191

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G ++   R  D  G G+F+HA+QGM+PH +A+RWNF  FQS   S    EF T P+YGS
Sbjct: 192 EGIIISPEREIDFRGRGVFIHALQGMKPHHLAARWNFGTFQSPTYSAVFMEFTTPPSYGS 251

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +V + ++V       A  LE+  D  T +  P  ++ TW+GKT +  +  SA 
Sbjct: 252 TVVSVGGVVKDGEIVCAGPVQPAVHLESEEDDYTSWPQPKSVRLTWDGKTKD-GKPISAV 310

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF--NEAEAHVKIGENEELTAK 290
           LE  L   +D++DV+ EVP  +K I  +    KPY++Q+   ++    V+IG++EE +  
Sbjct: 311 LEGSLGRRLDRVDVMAEVPGIIKSIAGSVAGTKPYIFQYAPQDKLPLKVRIGDSEE-SEH 369

Query: 291 GKLFSECSFIS 301
           G L+ E +FIS
Sbjct: 370 GTLYLEATFIS 380



>gi|241947979|ref|XP_002416712.1| cell survival pathways (diauxic growth shift; apoptosis) effector,
           SVF-family, putative; survival factor [1], putative
           [Candida dubliniensis CD36]
 gi|223640050|emb|CAX44295.1| cell survival pathways (diauxic growth shift; apoptosis) effector,
           SVF-family, putative [Candida dubliniensis CD36]
          Length = 382

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 164/311 (52%), Gaps = 15/311 (4%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSN+     T QFT R +      +N + S  + +F +     +  A N+S++L 
Sbjct: 76  FAQIIHSNVMGLTTTAQFTFRLYNVKDKNINLWTSTKLEDFEIK--ESNFYAKNLSLELT 133

Query: 58  PECNKYAVNLTHKELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKGNVK 114
                   +  +KE IV FE ER+  G   G  G +++G+D     G + H FWP+  + 
Sbjct: 134 DNKVYKLKSSVNKESIVEFEMERLTDGVIFGDDGMSFYGEDPEQPWGSMRHAFWPRCKIN 193

Query: 115 GNMV-VDGRAFDVT-GVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           G +   D +  ++  G+ +FV A+QGM+PH  A  WNF+NFQS   S    EF T  +YG
Sbjct: 194 GTITTADNKVIEINNGLTMFVMALQGMKPHHAAKSWNFMNFQSSNHSAVQMEFTTPKSYG 253

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTW-EGKTLETDEDFS 231
           + K+N G +  N K++  S+ N     +T  D    + VP KI++ + +GK  E      
Sbjct: 254 TTKVNIGIVTDNEKVLIASIDNQVVHSDTKFDDVGGWDVPQKIEFNFIDGKDKEKQ---V 310

Query: 232 AFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEELTAK 290
           A +   L  L++++DV+ E+P F+K IV     A+PY+YQ+ NE    +  G +E++   
Sbjct: 311 ASVSGNLSQLVERVDVMAEIPQFVKNIVSGVAGARPYIYQYANEFTIDINNGNDEKVKED 370

Query: 291 GKLFSECSFIS 301
           G  F+E +FIS
Sbjct: 371 GVGFTEVTFIS 381



>gi|429853262|gb|ELA28344.1| survival factor 1 [Colletotrichum gloeosporioides Nara gc5]
          Length = 376

 Score =  159 bits (403), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 101/314 (32%), Positives = 171/314 (54%), Gaps = 22/314 (7%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
             Q+I+SN+G    T QF  + +    +    +++  + ++ +S DR S  A++ +++L+
Sbjct: 71  MAQVIYSNVGGIRTTCQFNVKIWYPNNSKPMLWEATPLNHYEISEDRYSFFADDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQD--KSSGFVEHKFWPKGNV 113
            +   Y + ++     +V+ +  R   GF  G  GKT FG D  K  G + H FWP+  V
Sbjct: 131 ADGTFYTIKSMNSDNALVNLKVTRTSPGFHAGKTGKTLFGTDLSKPWGTMRHAFWPRCAV 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       + TG G +V+A+QGM+PH  A++WNFV+FQ    S  M E+ T P+YGS
Sbjct: 191 EGTITTKAGPVNFTGRGFYVYALQGMKPHHAAAKWNFVDFQGPNYSAVMMEYTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +  + +L+   V   A   ++  D   ++  P +IK+TW GK    D+D  A 
Sbjct: 251 TVVSVGGIAKDGELIYGGVTQTATHTKSKSDSVNEWPEPEEIKFTWSGK----DKDGKAV 306

Query: 234 ---LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVAKPYVYQWF---NEAEAHVKIGENEEL 287
              +   L+  +D++DVL EVP F+KKI    VA  Y+YQ+    N+    +KIG ++E+
Sbjct: 307 DGSIVGALEERLDRVDVLAEVPGFVKKI----VAGTYIYQFCPTKNKLSLKLKIG-DQEI 361

Query: 288 TAKGKLFSECSFIS 301
           + +G  + E +FIS
Sbjct: 362 SEEGLCYCESTFIS 375



>gi|399170936|emb|CCE28030.1| uncharacterized protein CPUR_01504 [Claviceps purpurea 20.1]
          Length = 378

 Score =  159 bits (403), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 162/309 (52%), Gaps = 10/309 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNT---FKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SN+     T QF S+ F    +    + S  + NF  + D+    A++  ++L+
Sbjct: 71  LVQVIYSNVAGMRTTCQFNSKIFSKDASKPHLWCSTPLNNFGFNEDQTGCFADDCVLELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQ--DKSSGFVEHKFWPKGNV 113
            + N+Y + ++  +  IV+ +  R   GF  G  G T +G   +K  G + H FWP+   
Sbjct: 131 KDGNEYTIKSMNDERSIVNIKITRTAPGFVAGKTGTTKYGTNLEKPWGCIRHVFWPRCAA 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G  ++  A+QGM+PH  A++WNFV FQS   S  M EF T  +YG+
Sbjct: 191 EGTITTPDGPVDFKGRAMYSFALQGMKPHHAAAKWNFVCFQSPSYSAIMMEFTTPASYGT 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +  + +++     +     E   D E ++  P+ +K  W+G T +  +  SA 
Sbjct: 251 TLVNVGGIAKDGEILTAGAGHEIIHAEIKNDTENEWPEPSAVKMAWKG-TEKDAKPVSAT 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
           +E  L    D++DV+ EVP F+K IV A    KPY+YQ+  +    +KIG ++E+  +G+
Sbjct: 310 IEGSLGPRSDRVDVMAEVPGFVKTIVAAAAGTKPYIYQYTPKMTLKLKIG-DQEIAEEGQ 368

Query: 293 LFSECSFIS 301
           L  E +FIS
Sbjct: 369 LLMEATFIS 377



>gi|225684426|gb|EEH22710.1| survival factor 1 [Paracoccidioides brasiliensis Pb03]
          Length = 484

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 161/296 (54%), Gaps = 11/296 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            +Q+I+SN+   + T  F S+ +   G   + + S ++ ++    D  S    N+++ LN
Sbjct: 103 MLQVIYSNVAGIHTTCHFNSKIYATDGKSEHRWCSDSIRDYMFDEDMLSFGGENIALTLN 162

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E + Y V +  + + +V+   +R   GF  G  G +YFG D  +  G + H FWP+  V
Sbjct: 163 AEGDTYTVKSAMNPDSLVNVTLKRTAPGFAAGRDGTSYFGTDPKNPWGSMRHVFWPRCQV 222

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G ++   R  D  G G+F+HA+QGM+PH +A+RWNF  FQS   S    E+ T P+YGS
Sbjct: 223 EGTIISPEREIDFKGRGVFIHALQGMKPHHLAARWNFGTFQSPAYSAVFMEYTTPPSYGS 282

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             ++ G +V   ++V       A  LE+  D  T +  P  ++ TW+GKT +  E  SA 
Sbjct: 283 TVVSVGGVVKGGEIVCAGPVQPAVHLESEKDDYTSWPQPKSVRLTWDGKT-KDGEPVSAV 341

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF--NEAEAHVKIGENEE 286
           LE  L   +D++DV+ EVP  +K I  +    KPY++Q+   ++    V+IG++EE
Sbjct: 342 LEGSLGRRLDRVDVMAEVPGIIKSIAGSVAGTKPYIFQYAPQDKLPLQVRIGDSEE 397



>gi|68473854|ref|XP_719030.1| hypothetical protein CaO19.6068 [Candida albicans SC5314]
 gi|68474063|ref|XP_718928.1| hypothetical protein CaO19.13489 [Candida albicans SC5314]
 gi|74586606|sp|Q5ABA2.1|SVF1_CANAL RecName: Full=Survival factor 1
 gi|46440721|gb|EAL00024.1| hypothetical protein CaO19.13489 [Candida albicans SC5314]
 gi|46440827|gb|EAL00129.1| hypothetical protein CaO19.6068 [Candida albicans SC5314]
 gi|238879458|gb|EEQ43096.1| survival factor 1 [Candida albicans WO-1]
          Length = 382

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 166/313 (53%), Gaps = 19/313 (6%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSN+     T QFT R +      +N + S  + +F +      A   ++ +K N
Sbjct: 76  FAQIIHSNVMGLTTTAQFTFRLYNVKDKSINLWTSTKLEDFEIKDSNFYAKDLSLELKDN 135

Query: 58  PECN-KYAVNLTHKELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKGNV 113
                K +VN   KE IV FE ER+  G   G  G +++G+D     G + H FWP+  V
Sbjct: 136 KVYKLKSSVN---KESIVEFEMERLTDGVIFGDDGMSFYGEDPEQPWGSMRHVFWPRCKV 192

Query: 114 KGNMV-VDGRAFDVT-GVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNY 171
            G +   D +  ++  G+ +FV A+QGM+PH  A  WNF+NFQS   S    EF T  +Y
Sbjct: 193 NGTITTADNKVIEINNGLTMFVMALQGMKPHHAAKSWNFMNFQSANHSAVQMEFTTPKSY 252

Query: 172 GSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTW-EGKTLETDEDF 230
           G+ K+N G +  N K++  S+ N     +T  D    + VP KI++ + +GK    D+D 
Sbjct: 253 GTTKVNIGIVTDNEKILIASIDNQVVHSDTKFDDVGGWDVPQKIEFNYIDGK----DKDK 308

Query: 231 S-AFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEELT 288
             A +   L  L++++DV+ E+P F+K IV     A+PY+YQ+ NE    +  G+ E++ 
Sbjct: 309 QVASVSGNLSQLVERVDVMAEIPQFVKNIVSGVAGARPYIYQYANEFTIDINNGDGEKVK 368

Query: 289 AKGKLFSECSFIS 301
             G  F+E +FIS
Sbjct: 369 EDGVGFTEVTFIS 381



>gi|470395676|ref|XP_004335099.1| hypothetical protein ACA1_097720 [Acanthamoeba castellanii str.
           Neff]
 gi|440791848|gb|ELR13086.1| hypothetical protein ACA1_097720 [Acanthamoeba castellanii str.
           Neff]
          Length = 362

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 143/281 (50%), Gaps = 9/281 (3%)

Query: 26  GVNTFKSVNMTNFTLSPDRRSASANNMSIKLNPECNKYAVNLTHKELIVSFEFERIDRGF 85
           G  TF S    +   S D  + +     I  NPE N Y + +   E     + E I +  
Sbjct: 82  GKATFFSHKYGDKQWSFDDTTITIGGFKIVRNPEANAYHITVDDPEC-KHIKGELIVQSS 140

Query: 86  KIGG------GKTYFGQDKSSGFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGM 139
           + GG      GKT F +D+S+        P+  + G + V G   +V   G   H +Q M
Sbjct: 141 EGGGVKFGDDGKTAFAEDRSAYSSMFYAIPRATITGALSVKGEKVEVDAYGFVSHFVQNM 200

Query: 140 RPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFL 199
           +PH    +W+ + F ++  SL      T   YG ++I+ G  V  NKL  V+V N   + 
Sbjct: 201 KPHKAGLKWSMMKFHAEELSLVSDLLLTPKQYGKEEISHGLFVYKNKLTAVTVDNSITYP 260

Query: 200 ETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIV 259
            T  D +T Y++PT  +Y W GKTLE  +DF A + +    L+DK+D+L  +P+ L+ ++
Sbjct: 261 TTQYDKDTGYEMPTSAEYVWRGKTLE-GQDFQAVIRLTPTNLIDKVDILGHLPWALRMVI 319

Query: 260 QAFVAKPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFI 300
           +AFVA+P+ YQW + A A V IGE E +T +GK   E +FI
Sbjct: 320 KAFVARPFHYQWLDTATATVTIGE-ETITVEGKALHEVTFI 359



>gi|255730495|ref|XP_002550172.1| survival factor 1 [Candida tropicalis MYA-3404]
 gi|240132129|gb|EER31687.1| survival factor 1 [Candida tropicalis MYA-3404]
          Length = 371

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 171/311 (54%), Gaps = 25/311 (8%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSNI     T QFT R F    + +N + S  + NF    D  +  A+N+S+++ 
Sbjct: 75  FAQIIHSNIMGLTTTAQFTFRLFNPEDDKLNLWTSTKLENF--RTDGYNFHADNLSLEMT 132

Query: 58  PECNKYAVNLTH--KELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKGN 112
              NK     +H   + IV FE ERI  G   G  G TY+G+D     G + H FWP+  
Sbjct: 133 D--NKIYTLKSHVCDDSIVEFEMERISDGVIFGDDGMTYYGEDPEQPWGSMRHVFWPRCK 190

Query: 113 VKGNMVVDGRAFDV-TGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNY 171
           + G ++   + + +  G+ +FV A+QGM+PH  A  WNF+NFQS+  S    EF T  +Y
Sbjct: 191 INGKIITKEKEYIIDNGLTMFVFALQGMKPHHAAKSWNFINFQSEHYSAIQMEFTTPISY 250

Query: 172 GSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFS 231
           G+ K+N G +V +++++  ++ N     ++ +D E  + VP KI++ +    +E D+   
Sbjct: 251 GTTKVNIGMVVKDDEVIIGTINNQVTHSDSEVD-EVGWPVPKKIEFDF----IEDDKSV- 304

Query: 232 AFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEELTAK 290
           A +   L  L++++DV+ E+P F+K IV     AKPY+YQ+ NE E  V      ++  +
Sbjct: 305 AKVTGDLKKLIERVDVMAEIPQFVKNIVSGVAGAKPYIYQFSNEFEIEVN-----DVKEE 359

Query: 291 GKLFSECSFIS 301
           G  F+E +FIS
Sbjct: 360 GLGFTEVTFIS 370



>gi|448114927|ref|XP_004202706.1| Piso0_001555 [Millerozyma farinosa CBS 7064]
 gi|359383574|emb|CCE79490.1| Piso0_001555 [Millerozyma farinosa CBS 7064]
          Length = 373

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 170/310 (54%), Gaps = 20/310 (6%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV----NTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           F Q+IHSN+   + T QFT RF+ +      N + S  + +F    D  +  A N+SI++
Sbjct: 74  FAQVIHSNLMGVHTTAQFTFRFYNSKGPEENNIWTSTKLEDFRT--DGSNFYAKNLSIEI 131

Query: 57  NPECNKYAVNL-THKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           + +  +Y +    +++ +V  +F+R+  G   G  G T +G D  +  G + H FWP+  
Sbjct: 132 SNDNTEYVLKSGVNEDSVVEMKFKRLVPGVIFGKDGTTLYGDDMQNPWGSMRHVFWPRCA 191

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G +    + +D+ G  +FV A+QGM+PH  A  WNF+NFQS+  S    EF T  +Y 
Sbjct: 192 VEGTVKSQDKTYDIEGYTMFVMAMQGMKPHHAAKAWNFLNFQSEHFSAVQMEFTTPKSYA 251

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
             K+N   L  N+K++  S+ N     ++++D E  + VP  I + ++G     + +  A
Sbjct: 252 ETKVNIAILTSNDKILVASINNSVVHRDSTVD-EVGWPVPKSIVFNYDG----VNSNLKA 306

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEELTAKG 291
            +  +L  L++++DV+ E+P F+K IV     A+PY+YQ+ +E EA V+  E E    KG
Sbjct: 307 SVSGELKHLVERVDVMAEIPQFVKTIVSGVAGARPYIYQYCDEMEADVEGHEKE----KG 362

Query: 292 KLFSECSFIS 301
             + E +FIS
Sbjct: 363 VGYIEVTFIS 372



>gi|448112377|ref|XP_004202081.1| Piso0_001555 [Millerozyma farinosa CBS 7064]
 gi|359465070|emb|CCE88775.1| Piso0_001555 [Millerozyma farinosa CBS 7064]
          Length = 373

 Score =  155 bits (393), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 171/310 (55%), Gaps = 20/310 (6%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV----NTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           F Q+IHSN+   + T QFT RF+ +      N + S  + +F    D  +  A N+SI++
Sbjct: 74  FAQVIHSNVMGVHTTAQFTFRFYNSKGPEENNIWTSTKLEDFRT--DGSNFYAKNLSIEI 131

Query: 57  NPECNKYAVNL-THKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           + +  +Y +    +++ +V  +F+R+  G   G  G T +G D  +  G + H FWP+  
Sbjct: 132 SDDNTEYVLKSGVNEDSVVEMKFKRLVPGVIFGKDGTTLYGDDIQNPWGSMRHVFWPRCA 191

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V+G +    + +D+ G  +FV A+QGM+PH  A  WNF+NFQS+  S    EF T  +Y 
Sbjct: 192 VEGTVKSQDKTYDIEGYTMFVMAMQGMKPHHAAKAWNFLNFQSENFSAVQMEFTTPKSYA 251

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           + K+N   L  N+K++  S+ N     ++++D E  + VP  I + ++G     + +  A
Sbjct: 252 NTKVNIAILTSNDKILVASINNSVVHKDSTVD-EVGWPVPKSIVFNYDG----VNSNLKA 306

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEELTAKG 291
            +  +L  L++++DV+ E+P F+K IV     A+PY+YQ+ +E EA V+  E E    KG
Sbjct: 307 SVSGELKHLVERVDVMAEIPQFVKTIVSGVAGARPYIYQYCDEMEADVEGHEKE----KG 362

Query: 292 KLFSECSFIS 301
             + E +FIS
Sbjct: 363 VGYIEVTFIS 372



>gi|50548913|ref|XP_501927.1| YALI0C16973p [Yarrowia lipolytica]
 gi|74604350|sp|Q6CBN5.1|SVF1_YARLI RecName: Full=Survival factor 1
 gi|49647794|emb|CAG82247.1| YALI0C16973p [Yarrowia lipolytica CLIB122]
          Length = 398

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 114/329 (34%), Positives = 174/329 (52%), Gaps = 33/329 (10%)

Query: 2   VQMIHSN-IGLWNPTIQFTSRFFGNG---VNTFKSVNMTNF-TLSPD-RRSASANNMSIK 55
           VQ+IHSN +G+ N T QFT R         N + S N+  F  + P+       + ++IK
Sbjct: 74  VQIIHSNPLGIQN-TAQFTFRLSNADKPEENVWSSTNVEEFEPVGPNFTAKGPMDGVNIK 132

Query: 56  LNPECNK--YAVNLTHKELIVSFE------FERIDRGFKIGG-GKTYFGQDKSS--GFVE 104
           L P  +         H ++ VS E      F R   GFKIG  G++ +G+D ++  G + 
Sbjct: 133 LVPSVDDDGKTTEAFHVKIHVSDEVKLDLTFTRSVEGFKIGPTGQSKYGEDLNNPWGAMR 192

Query: 105 HKFWPKGNVKGNMVV---DGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLS 161
           H FWP+ +V G + V   D    D    G FVHA QGM+PH  AS+WNF+ +QS   S  
Sbjct: 193 HSFWPRASVSGTIEVANKDKMELD-NDFGFFVHATQGMKPHHAASKWNFITYQSPKYSAV 251

Query: 162 MCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEG 221
           + ++ T P+YGS ++  G +    KL+  S     + +ET  D E  ++VPT IK+  EG
Sbjct: 252 VMDYTTPPSYGSSRVTIGGVASAEKLLFTSANATVEHVETKEDEEVGWQVPTLIKFECEG 311

Query: 222 KTLE-TDEDFS-------AFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWF 272
             ++  DED         A L+  L   ++++DV+ E+P FLK +       KPY+YQ+ 
Sbjct: 312 PKVDVADEDVDKPENRGKAVLQGNL-THLERMDVMAEIPAFLKSLASTVSGTKPYIYQFR 370

Query: 273 NEAEAHVKIGENEELTAKGKLFSECSFIS 301
           NE E  ++I + E++  KG++F E +FIS
Sbjct: 371 NEMELELEI-DGEKIQDKGQIFCEATFIS 398



>gi|171688390|ref|XP_001909135.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944157|emb|CAP70267.1| unnamed protein product [Podospora anserina S mat+]
          Length = 381

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/311 (29%), Positives = 163/311 (52%), Gaps = 11/311 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+SN+   + T QF  + F    +  + + S  +TN   S D+ S  A++ +++L+
Sbjct: 71  FAQVIYSNVAGIHTTCQFNCKLFSLDSSKPHLWCSTQLTNPDFSEDKSSFFADDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   Y + ++     IV+   +R   GF++G  GKT FG D  +  G + H FWP+   
Sbjct: 131 EDGTTYTIKSMNDDRAIVNLTIKRAGPGFQVGRTGKTLFGTDLKNPWGTMRHAFWPRCTA 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G   ++ A+QGM+PH  A++WNFV+FQ    +  +  F T P+YG 
Sbjct: 191 EGTISTKEGPVDFRGKATYIMALQGMKPHHAAAKWNFVDFQGPTYTAVVMNFTTPPSYGL 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
            ++  G +V + ++V  + K+     ++  D E  +  P  IKYTW G T +  +   A 
Sbjct: 251 TEVTIGGIVKDGEIVMANCKSTVTHTKSKSDGENGWPEPETIKYTWTGTTKD-GKPVEAS 309

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVAKPYVYQWFNEAEAHVKIG---ENEELTAK 290
           LE  L+  +D+IDV+ EVP F+K+IV +          +   +  + +    + +E++ +
Sbjct: 310 LEGALEKRLDRIDVMAEVPGFVKQIVSSAAGTKPYIYQYYPQQQKLTLKIKVDGQEVSEQ 369

Query: 291 GKLFSECSFIS 301
           G +F+E +FIS
Sbjct: 370 GTVFAESTFIS 380



>gi|254572009|ref|XP_002493114.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238032912|emb|CAY70935.1| hypothetical protein PAS_chr3_1234 [Komagataella pastoris GS115]
 gi|328352870|emb|CCA39268.1| Survival factor 1 [Komagataella pastoris CBS 7435]
          Length = 390

 Score =  154 bits (388), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 96/320 (30%), Positives = 171/320 (53%), Gaps = 23/320 (7%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVN---TFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSN+   +   QFT + F         + S  + NF +  +  +  A+++SIKL 
Sbjct: 73  FAQVIHSNVVGLHTNAQFTFKIFHKDTPEDFVWTSTGLENFRV--EGPNFFADHLSIKLI 130

Query: 58  PECNKYAVNLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVK 114
            +   +  +L + E IV     R+  G K G  G TY+G+D  +  G + H FWP+ +VK
Sbjct: 131 DDKTYHLKSLVNPESIVDLTITRLTDGVKFGKDGTTYYGEDPENPWGSMRHIFWPRCHVK 190

Query: 115 GNMVVDGRAFD------------VTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSM 162
           G ++++ ++ D            + G+ ++V A+QGM+PH  A+ WNF+N+ S   S+ +
Sbjct: 191 GKILLENKSEDKSSESDEFIERPIEGISMYVMALQGMKPHHAAATWNFLNYVSPDYSVVI 250

Query: 163 CEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGK 222
            EF T P+Y + K+  G +  N K+V  S+ N  ++++  +D  T + +PT I++   G 
Sbjct: 251 MEFTTPPSYATTKVTVGIVSNNEKVVLSSINNETKYIDRVVDDVTGWSIPTSIEFDLSG- 309

Query: 223 TLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKI 281
             E D      ++ KL+ L +++DV+ E+P F+K IV      KP++YQ+ N     +  
Sbjct: 310 -YEGDSQLRVVVKGKLEKLSERVDVMAEIPQFVKNIVSGIAGTKPFIYQFNNPFTFTLAK 368

Query: 282 GENEELTAKGKLFSECSFIS 301
              E ++ +G  ++E +FI+
Sbjct: 369 DGEEIVSEEGNGYNEATFIT 388



>gi|126273960|ref|XP_001387768.1| protein involved in the diauxic switch [Scheffersomyces stipitis
           CBS 6054]
 gi|126213638|gb|EAZ63745.1| protein involved in the diauxic switch [Scheffersomyces stipitis
           CBS 6054]
          Length = 385

 Score =  153 bits (386), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 166/315 (52%), Gaps = 21/315 (6%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV-----NTFKSVNMTNFTLSPDRRSASANNMSIK 55
           F Q+IHSN+   + T QFT R F +       N + S  + NF    D  +  A+ +S +
Sbjct: 77  FAQIIHSNLMGVHTTAQFTFRLFHHDEDKAEDNIWTSTKLENF--RTDGSNFYADKVSFE 134

Query: 56  LNPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKG 111
           LN +   Y + +   +E +V     R+  G   G  G TY+G D ++  G + H FWP+ 
Sbjct: 135 LNDDNTTYTLKSHVTEEALVELTVTRLTPGVIFGKDGTTYYGDDVANPWGSMRHLFWPRC 194

Query: 112 NVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNY 171
            V G +    + F+++G  +FV A+QGM+PH  A  WNF+NF S   S    EF T  +Y
Sbjct: 195 TVNGTVKTPTQTFEISGYTMFVMALQGMKPHHAAKAWNFMNFHSKTYSAVQMEFTTPISY 254

Query: 172 GSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTW----EGKTLETD 227
            + K+N G +  + ++V  ++ N+    +   DP   + VPT I + +    + +  + D
Sbjct: 255 ANTKVNVGIISKDGEIVLATINNVVLHQDPKEDPGVGWHVPTAITFKYIKDKKEEVAKDD 314

Query: 228 EDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEE 286
           +     +   L  L++++DV+ E+P  +K IV   V  KPY+YQ+ NE +  +++G+++E
Sbjct: 315 DVVVGSVSGPLTTLVERVDVMAEIPQLVKNIVSGVVGTKPYIYQYCNEFD--IEVGQDKE 372

Query: 287 LTAKGKLFSECSFIS 301
              KG  F+E +FIS
Sbjct: 373 ---KGLGFTEVTFIS 384



>gi|240275428|gb|EER38942.1| Svf1 family protein [Ajellomyces capsulatus H143]
          Length = 254

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/267 (34%), Positives = 152/267 (56%), Gaps = 25/267 (9%)

Query: 43  DRRSASANNMSIKLNPECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS 100
           D  S   +N+++ LN + + Y++ +  +++ +V+   +R   GF +G  G + FG D  +
Sbjct: 5   DMLSFGGDNIALTLNADGDTYSIKSAINEDSLVNINLKRAAPGFAVGQNGTSNFGTDPEN 64

Query: 101 --GFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVA 158
             G + H FWP+  V+G +V   R  D  G GLF+HA+QGM+PH +A+RWNF  FQS   
Sbjct: 65  PWGSMRHVFWPRCTVEGTIVTPEREIDFKGHGLFIHALQGMKPHHLAARWNFGTFQSPTY 124

Query: 159 SLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYT 218
           S    E+ T P+YGS  ++  S          S+++M+   +T  D    +  P  IK+ 
Sbjct: 125 SAVFMEYTTPPSYGSTIVSGQS----------SLRSMSIRRDTYND----WPEPKSIKFP 170

Query: 219 WEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA 277
           W+GK+ +  +   A LE  L   +D++DV+ EVP F+K IV +    KPY+YQ F+  E 
Sbjct: 171 WDGKSKD-GKAVEAVLEGSLGERLDRVDVMAEVPGFIKSIVGSVAGTKPYIYQ-FSPQEK 228

Query: 278 ---HVKIGENEELTAKGKLFSECSFIS 301
              ++++G+ E+ T +G L+SE +FIS
Sbjct: 229 LSLNIRVGDTED-TEQGTLYSEATFIS 254



>gi|353239545|emb|CCA71452.1| hypothetical protein PIIN_05391 [Piriformospora indica DSM 11827]
          Length = 370

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 120/363 (33%), Positives = 176/363 (48%), Gaps = 71/363 (19%)

Query: 9   IGLWNPTIQFTSRFFGNGVN--TFKSVNMTNFTLSP---DRRSASANNMSIKLNPECNK- 62
           I LW PT+QFT + +       T++S +++NF   P   D+RS  ++  SI   P  +  
Sbjct: 9   IRLWYPTVQFTFKLYNPATKEVTWRSSSVSNFVTPPPGQDKRSCKSDTFSIVYRPSSSDP 68

Query: 63  -YAVNLT-----HKELIVSFEFERIDRG--FKIG----GGKTYFG--QDKSSGFVEHKFW 108
            ++ N T       ++ VS    R +     KIG    GG TYFG   D + G+V H+FW
Sbjct: 69  DHSENYTVTAKVSDDISVSLIVTRPNHAPSVKIGSLPKGGYTYFGTNMDNADGYVVHRFW 128

Query: 109 PKGNVKGNMV---------VDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVA- 158
           P+  V G++            GR    TG G+ VHAIQGMRP+LIA RWNF  F   +  
Sbjct: 129 PQTKVSGHITFGSAGGAAGSAGRIEQFTGFGMLVHAIQGMRPNLIARRWNFCWFTGHIPD 188

Query: 159 -----SLSMCEFETTPNYGSKKINQGSLVVNN---------------------KLVGVSV 192
                S  M EF TT ++G KK  +G +VVN                      ++    V
Sbjct: 189 SDKRVSAIMMEFTTTESHGRKKGGEGGVVVNVGCVSVGERVAATAETKWPDAPRIQNAPV 248

Query: 193 KNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDK 244
            + A  LET LD +T Y  P KI+++W+   +  D++     ++ LDV        L++K
Sbjct: 249 ISRATHLETVLDKDTGYMQPQKIEFSWQN-VIAQDKEHKFKADLLLDVGFGEHSKGLIEK 307

Query: 245 IDVLNEVPYFLKKIVQAFVAKPYVYQWFNE-AEAHVKIGE-----NEELTAKGKLFSECS 298
           +DVL E+P  LK IV A   KPY+YQW    A  H+   E     ++E+  +G  + E S
Sbjct: 308 VDVLAEIPKVLKTIVHATGTKPYIYQWMQPNAVLHLHGPEGFFHRDKEIDVEGTAYVEAS 367

Query: 299 FIS 301
           ++S
Sbjct: 368 YVS 370



>gi|164659528|ref|XP_001730888.1| hypothetical protein MGL_1887 [Malassezia globosa CBS 7966]
 gi|159104786|gb|EDP43674.1| hypothetical protein MGL_1887 [Malassezia globosa CBS 7966]
          Length = 355

 Score =  150 bits (379), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 173/345 (50%), Gaps = 70/345 (20%)

Query: 26  GVNTFKSVNMTNFTLSPDRRSASANN---MSIKLNPECNK-YAVNLT---HKELIVSFEF 78
           G N +KS N+  F + P+ +S+  +N   ++ K  P+ ++ Y V+       ++I S   
Sbjct: 11  GENVWKSKNVDGFQVLPNNKSSCKSNSFNVNFKGQPDGSQVYDVSAKLDDQVQVIYSMTR 70

Query: 79  ERIDRGFKIG----GGKTYFGQDKS--SGFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLF 132
               +G+K+G     G +YFG+++S   G+V H+FWP     G ++++GRA + TG G+F
Sbjct: 71  PSQAKGWKLGQDERAGFSYFGENESVPEGYVVHRFWPFATTSGLIIINGRAIEATGQGMF 130

Query: 133 VHAIQGMRPHLIASRWNFVNFQSDV---ASLSMCEFETTPNYG-----------SKKINQ 178
           V AIQGMRP+L+ASRWNF NFQS      S  M EF TT +YG            + +  
Sbjct: 131 VQAIQGMRPNLVASRWNFGNFQSKEMGGTSAIMMEFTTTSDYGKAGTEAGATRKPQTVTI 190

Query: 179 GSLVVNNKLVGV------SVKNMAQFLETSLDPETK-------------YKVPTKIKYTW 219
           GS+V   +LV V      +V+   Q   +S  P T              Y VP K+ +  
Sbjct: 191 GSIVCGGQLVAVVGATRLAVRGSEQEPSSSHTPATHIQHEACAKDELTGYSVPQKMTFVL 250

Query: 220 EGKTL------ETDEDFSAFLEIKLDV------LMDKIDVLNEVPYFLKKIVQAFVA--K 265
           +G  L        D    A +++ L        L++K+DVL E+P+ ++KIV  +VA  K
Sbjct: 251 DGPALVGVDRPSADVRVHATMDVNLGAPTAMQGLIEKVDVLAEIPFMVRKIVN-YVAGTK 309

Query: 266 PYVYQWFNEAEAHVKIGE---------NEELTAKGKLFSECSFIS 301
           PY+YQ  N  +  ++I E         +  L  +G LF E +FIS
Sbjct: 310 PYIYQTLNATQLKLEIPEAVKNAIGASSTSLELQGSLFEEHTFIS 354



>gi|294659594|ref|XP_461999.2| DEHA2G10428p [Debaryomyces hansenii CBS767]
 gi|218511862|sp|Q6BIH2.2|SVF1_DEBHA RecName: Full=Survival factor 1
 gi|199434086|emb|CAG90475.2| DEHA2G10428p [Debaryomyces hansenii CBS767]
          Length = 376

 Score =  149 bits (376), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 162/310 (52%), Gaps = 17/310 (5%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG----NGVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           F Q+IHSN+   + T QFT RFF        N + S  + +F    +  +  AN +SI+L
Sbjct: 74  FAQVIHSNVMGVHTTAQFTFRFFNFKGKQEDNLWTSTKLEDFRC--EGSNFYANGLSIEL 131

Query: 57  NPECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGN 112
           + +   Y V  + +K+ +V     ++  G   G  G TY+G D  +  G + H FWP+ +
Sbjct: 132 DKDNKSYTVKSSVNKDSVVDLTMVKLVPGVIFGDNGTTYYGDDLENPWGSMRHLFWPRCS 191

Query: 113 VKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           V G +    + F++ G  +FV A+QGM+PH  A  WNF+NFQS+  S    EF T  +Y 
Sbjct: 192 VSGTVKSGDKVFEIEGYTMFVMALQGMKPHHAAKAWNFLNFQSESHSAVQMEFTTPMSYA 251

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
           + K+N   L  N+K++  S+ N        +D ET + VP  I + ++G + + ++    
Sbjct: 252 NTKVNIAILTSNDKILSCSINNEVVHENPEVD-ETGWPVPKAITFNFDGLS-DDNKKVVG 309

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKG 291
            +   L  L++++DV+ E+P F+K I       KPY+YQ+ N+ E  +  G  E     G
Sbjct: 310 KVHGDLITLVERVDVMAEIPQFIKNIATGVSGTKPYIYQFCNDMEIEIDDGVKE----SG 365

Query: 292 KLFSECSFIS 301
             F+E +FIS
Sbjct: 366 MGFNEATFIS 375



>gi|513034286|gb|AGO14252.1| AaceriAFL203Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 385

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 98/317 (30%), Positives = 167/317 (52%), Gaps = 24/317 (7%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNG---VNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+S IG    T QFT R        + T+ S  + NF +  +  +  A+N+S++L+
Sbjct: 73  FAQIIYSKIGGLPRTAQFTFRLHYASRPELGTWTSTKLENFRV--EGANFYADNLSLELD 130

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
                Y +  +   E +V   F+R+  G K+G    TY+G +     G + H FWP+ +V
Sbjct: 131 STATSYTLKSSVTAESVVDITFQRLTPGVKVGEDPTTYYGDNTEQPWGTMRHVFWPRNSV 190

Query: 114 KGNMVVDGRAFDV-TGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
            G +VV G    +     + + A+QGM+PH  A  WNF+NFQS+  S+ + EF T  +Y 
Sbjct: 191 NGTVVVHGELITLKNDFSVMILALQGMKPHHAAKAWNFLNFQSETHSVVLMEFTTPKSYA 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEG-------KTLE 225
           + K++ G +   + ++ V++ N A+ ++   D E  + VP  +   + G       K + 
Sbjct: 251 NTKVSIGIICDKDSVLSVTIDNEAEHVKPETD-EVGWPVPKALSLEFNGIPSSVSDKEVA 309

Query: 226 TDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGEN 284
           + +  SA ++++L  L++++DV+ E+P F+K IV   V  KPY+YQ+ +EA       E 
Sbjct: 310 SAQKLSARVDVQLKNLVERVDVMAEIPAFVKNIVSGVVGTKPYIYQYADEASLTYAGSE- 368

Query: 285 EELTAKGKLFSECSFIS 301
                KG  +SE +FIS
Sbjct: 369 ----YKGFAWSEVTFIS 381



>gi|449295563|gb|EMC91584.1| hypothetical protein BAUCODRAFT_298603 [Baudoinia compniacensis
           UAMH 10762]
          Length = 374

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 151/280 (53%), Gaps = 10/280 (3%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF-GNGVNTFKSVNMTNFTLSPDRRS-ASANNMSIKLNP 58
            VQ+I+SN+     T QF+++ F  +G + + S ++ +F  S D++S  S    S+ ++ 
Sbjct: 67  LVQVIYSNVLGVRKTAQFSAKIFRPDGKHLWASDSLNDFAFSSDKQSFKSKEGCSMDISE 126

Query: 59  ECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQD--KSSGFVEHKFWPKGNVK 114
           +   Y V  T +K  +V  +F +   GF  G  G + FG D  K  G ++H FWP+  V+
Sbjct: 127 DGKSYVVKSTVNKSSVVDLKFTQSLPGFVAGENGTSTFGTDPKKPWGRMKHIFWPRCQVE 186

Query: 115 GNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSK 174
           G+++      D  G G+FVHA+QGM+PH  A+RWNF NFQS   S  + E+ T  +YG  
Sbjct: 187 GSIITAEGPVDFRGRGMFVHALQGMKPHFAAARWNFANFQSPSYSAIVMEYTTPKSYGET 246

Query: 175 KINQGSLVVNNKLV--GVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSA 232
            +  G +     ++  G S    A+  +   DP+  +  P  + + W G + E  +  SA
Sbjct: 247 VVAVGGIATELGILIAGASPDIKAEHTQVKGDPDNAWPEPGSVSFKWSGTSAE-GKVVSA 305

Query: 233 FLEIKLDVLMDKIDVLNEVPYFLKKIVQ-AFVAKPYVYQW 271
            L+  +    D++DV+ E+P F+K+IV  A   KPY+YQ+
Sbjct: 306 SLDGDIHPRTDRVDVMGELPKFVKQIVAGASGTKPYIYQY 345



>gi|344228289|gb|EGV60175.1| hypothetical protein CANTEDRAFT_127148 [Candida tenuis ATCC 10573]
 gi|344228290|gb|EGV60176.1| hypothetical protein CANTEDRAFT_127148 [Candida tenuis ATCC 10573]
          Length = 375

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 104/315 (33%), Positives = 165/315 (52%), Gaps = 30/315 (9%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV--NTFKSVNMTNFTLSPDRRSAS---ANNMSIK 55
           F Q+IHSNI   + T QFT R + +    N + S ++ NF     R   S   A+NMSI+
Sbjct: 74  FAQVIHSNIMGVHTTAQFTFRIYDDKGKNNLWTSTHLENF-----RTEGSNFYADNMSIE 128

Query: 56  LNPECNKYAV-NLTHKELIVSFEFERIDRGFKIGG-GKTYFGQDKSS--GFVEHKFWPKG 111
            N +  +  + +  + + +V F  +R+  G   GG G T +G+D     G + H FWP+ 
Sbjct: 129 FNEDGTEVILKSDVNPDSVVEFTMKRLVPGVIFGGDGTTLYGEDVEEPWGSMRHCFWPRC 188

Query: 112 NVKGNMVVDGRAFDVT----GVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFET 167
            V G +V   +A D T    G+ +FV A+QGM+PH  A  WNF+NFQS+  S    EF T
Sbjct: 189 EVSGTIV--SKALDTTLEINGLTMFVMALQGMKPHHAAKSWNFLNFQSENYSAVQMEFTT 246

Query: 168 TPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETD 227
             +Y + K+N G +   +K++  S+ N        +D E  + VP  I +  +      D
Sbjct: 247 PRSYANTKVNIGVVCGKDKILLASINNDVVHENAEID-EVGWPVPKAITFNHDA----AD 301

Query: 228 EDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEE 286
           + +   ++ +L  L++++DV+ E+P F+K IV      KPY+YQ+ N+    + I +N  
Sbjct: 302 KSYHVDVKGELKSLVERVDVMAEIPQFIKNIVSGVAGTKPYIYQYCNK----MTINDNNV 357

Query: 287 LTAKGKLFSECSFIS 301
            +  G  FSE +FIS
Sbjct: 358 ASETGVAFSEATFIS 372



>gi|45198318|ref|NP_985347.1| AFL203Cp [Ashbya gossypii ATCC 10895]
 gi|74693187|sp|Q755L7.1|SVF1_ASHGO RecName: Full=Survival factor 1
 gi|44984205|gb|AAS53171.1| AFL203Cp [Ashbya gossypii ATCC 10895]
 gi|374108575|gb|AEY97481.1| FAFL203Cp [Ashbya gossypii FDAG1]
          Length = 385

 Score =  146 bits (369), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 165/317 (52%), Gaps = 24/317 (7%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNG---VNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+S IG    T QFT R        + T+ S  + NF +  +  +  A+N+S++L+
Sbjct: 73  FAQIIYSKIGGLPRTAQFTFRLHHASRPELGTWTSTKLENFRV--EGANFYADNLSLELD 130

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
                Y +  +   + +V   F+R+  G K+G    TY+G +     G + H FWP+ +V
Sbjct: 131 STATSYTLQSSVTADSVVDITFKRLTPGVKVGEDPTTYYGDNTKEPWGTMRHVFWPRNSV 190

Query: 114 KGNMVVDGRAFDV-TGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
            G +VV G    +     + + A+QGM+PH  A  WNF+NF S+  S+ + EF T  +Y 
Sbjct: 191 NGTVVVHGEMITLKNDYSVMILALQGMKPHHAAKAWNFLNFHSETHSVLLMEFTTPKSYA 250

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEG-------KTLE 225
           + K++ G L   + ++ V++ N  + ++   D E  + VP  +   + G       K + 
Sbjct: 251 NTKVSIGILCDKDSVLSVTIDNEVEHVKPKTD-EVGWPVPKALSMKFTGIPSSVPDKEVA 309

Query: 226 TDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGEN 284
           + E  SA ++I+L  L++++DV+ E+P F+K IV   V  KPY+YQ+ NEA       E 
Sbjct: 310 SAEKLSARVDIELKNLVERVDVMAEIPAFVKNIVSGVVGTKPYIYQYANEALLTYAGSE- 368

Query: 285 EELTAKGKLFSECSFIS 301
                KG  +SE +FIS
Sbjct: 369 ----YKGFAWSEVTFIS 381



>gi|336268048|ref|XP_003348789.1| hypothetical protein SMAC_01812 [Sordaria macrospora k-hell]
 gi|380094047|emb|CCC08264.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 354

 Score =  144 bits (362), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 93/311 (29%), Positives = 152/311 (48%), Gaps = 38/311 (12%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+I+SN+     T QF S+ F   G+  + + S  + N   S D+ S  A + +++L+
Sbjct: 71  FAQVIYSNVAGIRTTCQFNSKVFTLDGSKPHLWCSTPLNNPEFSEDKTSFYATDCAVELS 130

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            + N Y + +L  +  IV+   +R   GFK+G  G T FG D ++  G + H FWP+   
Sbjct: 131 ADGNSYTIKSLNDERSIVNVTVKRTAPGFKVGTSGTTLFGTDPANPWGSMRHIFWPRCVA 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G +       D  G  +FVHA+QGM+PH  A++WNF +FQ    S  + ++ T P+YGS
Sbjct: 191 EGTIATPDGPVDCKGRAMFVHALQGMKPHHAAAKWNFCDFQGPNYSAVLMQYTTPPSYGS 250

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAF 233
             +N G +V +N+++    +     +    D E  +  P+ +                  
Sbjct: 251 TVVNVGGIVKDNEIIFAGAEGAVTHVAIKGDTENDWPAPSAV------------------ 292

Query: 234 LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGK 292
                     KIDV+ EVP F+K+IV   V  KPY+YQ+  + +      +  E     +
Sbjct: 293 ----------KIDVMAEVPGFVKQIVAGAVGTKPYIYQYAPQKKKLTLKLKIGEEEISEE 342

Query: 293 --LFSECSFIS 301
             LF+E +FIS
Sbjct: 343 GYLFAEATFIS 353



>gi|363748308|ref|XP_003644372.1| hypothetical protein Ecym_1320 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356888004|gb|AET37555.1| hypothetical protein Ecym_1320 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 390

 Score =  144 bits (362), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 103/324 (31%), Positives = 167/324 (51%), Gaps = 37/324 (11%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGN---GVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHS IG  + T QFT R        +N + S  + NF +  D  +  ANN+S++L+
Sbjct: 73  FAQIIHSTIGSLHTTGQFTFRCHHKTRPDLNVWTSTKLENFRI--DGTNFYANNLSLELS 130

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            +   + +  +   + IV     R+  G K+G    TY+G+D+ S  G + H FWP+ +V
Sbjct: 131 SDGTSFHLKSSVCTDSIVDLVATRLTSGVKVGEDPTTYYGEDEKSPWGTMRHVFWPRNSV 190

Query: 114 KGNMVVDGRAFDVTGVG--------LFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEF 165
            G + + G      GV         +   A+QGM+PH  A  WNF+NF S+  S+ + EF
Sbjct: 191 NGTITLKG------GVAVSFKENYSMLAMAMQGMKPHHAARSWNFLNFHSEEYSVILMEF 244

Query: 166 ETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKT-- 223
            T  +Y + +++ G L   N ++ V+V N  + L+ S+D    + VP  I   ++G +  
Sbjct: 245 TTPKSYENTEVSIGILCDKNSVLAVTVDNKVEHLDASVD-SVGWPVPKAISIDFQGVSAS 303

Query: 224 -----LETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEA 277
                ++T    SA +E +L  L++++DV+ E+P F+K IV     AKPY+YQ+ NE   
Sbjct: 304 ITDNEIDTAPKISANMEGQLSCLVERVDVMAEIPNFVKNIVSGVAGAKPYIYQFVNELNF 363

Query: 278 HVKIGENEELTAKGKLFSECSFIS 301
                  E +  KG  + E +FIS
Sbjct: 364 TF-----EGVKHKGLGWCEVTFIS 382



>gi|50307357|ref|XP_453657.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|74606334|sp|Q6CQY2.1|SVF1_KLULA RecName: Full=Survival factor 1
 gi|49642791|emb|CAH00753.1| KLLA0D13332p [Kluyveromyces lactis]
          Length = 403

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 99/325 (30%), Positives = 165/325 (50%), Gaps = 33/325 (10%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF---GNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSNI   + T QFT R +         + SV + NF +  +  +  A+N+SI +N
Sbjct: 73  FAQVIHSNIIGLHTTAQFTFRIYHKENTDDQIWTSVKLENFRI--EGTNFYADNLSIVMN 130

Query: 58  PECNKYAVNLTHKELI-VSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
            E  +     T  E + V F   R   G K+G    TY+G D +   G + H FWP+ ++
Sbjct: 131 EEGTEVQFKSTVDENVEVDFTIRRAVDGVKVGEDPSTYYGDDVTQPWGSMRHVFWPRNHI 190

Query: 114 KGNMVVDGRAFDVT----------GVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMC 163
            G +       +V              +FV A+QGM+PH  A  W F+NFQS+  +  + 
Sbjct: 191 SGKIAAKNEETNVKIDLQFSEEKKHYSMFVFAMQGMKPHHAAKSWTFLNFQSEDYTAVLM 250

Query: 164 EFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEG-- 221
           EF T  +Y +  +N G +     ++ V+V N A++++  +D    + VP +I  ++ G  
Sbjct: 251 EFTTPKSYANTTVNIGIVCDTKNILSVTVDNDAEYIDPEVD-SVGWPVPKEISVSFNGIN 309

Query: 222 -----KTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEA 275
                  +E+ + F+  ++ KLD L++++DV+ E+P F+K IV      KPY+YQ+F++ 
Sbjct: 310 ADIKDDDVESADPFNTIVKGKLDNLVERVDVMAEIPTFVKNIVSGVAGTKPYIYQFFDDF 369

Query: 276 EAHVKIGENEELTAKGKLFSECSFI 300
           E  +K  E     +KG  + E +FI
Sbjct: 370 ELTIKDQE-----SKGFGWCEITFI 389



>gi|320581407|gb|EFW95628.1| hypothetical protein HPODL_2962 [Ogataea parapolymorpha DL-1]
          Length = 386

 Score =  139 bits (350), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 98/316 (31%), Positives = 165/316 (52%), Gaps = 23/316 (7%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNG---VNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSN+   + T QFT + F         + S  + NFT++    +  A+N+S++++
Sbjct: 72  FAQVIHSNLVGLHTTAQFTFKIFKKSKPDAYVWTSTKLENFTVA--GANFYADNLSVEVD 129

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
                Y +  + +   IV    E I    K G  G TY+G D ++  G + H FWP+   
Sbjct: 130 DALRVYRIKSSVNPASIVDLTLELIGESVKFGKDGTTYYGTDLANPWGSMRHIFWPRCKA 189

Query: 114 KGNMVVDGRAF---DVT---GVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFET 167
            G + + G      D+T   G+G++V A+QGM+PH  A+ WNF+N+QS+  S+ + EF T
Sbjct: 190 SGTIQLGGNEQFEQDITLNSGLGMYVMALQGMKPHHAAAAWNFLNYQSENYSVVVMEFTT 249

Query: 168 TPNYGSKKINQGSLV-VNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLET 226
             +Y +  ++ G +   N K++  SV N  + L+T  D  + + VP + ++T  GK LE 
Sbjct: 250 PKSYNTTTVSVGIVTDKNGKILLGSVDNTTKHLKTYTDSVSGWNVPGEAEFTLRGKDLEV 309

Query: 227 DEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENE 285
                  +   L  L +++DV+NE+P F+K I       KPY++Q+ NE +  +      
Sbjct: 310 Q------VSGALTNLSERVDVMNELPQFVKNIASGVAGTKPYIFQFSNELDFKLVKDGKV 363

Query: 286 ELTAKGKLFSECSFIS 301
           E +  G  ++E +FIS
Sbjct: 364 EHSETGYGYTETTFIS 379



>gi|448519978|ref|XP_003868192.1| Svf1 survival factor [Candida orthopsilosis Co 90-125]
 gi|380352531|emb|CCG22757.1| Svf1 survival factor [Candida orthopsilosis]
          Length = 387

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 159/321 (49%), Gaps = 29/321 (9%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSN+   + T QFT R +       N + S  + NF +  D  +  A+N+  ++ 
Sbjct: 75  FAQIIHSNVMGVHTTAQFTFRLYNINDPSKNIWTSTRLENFKIV-DGFNFEADNLKFEMV 133

Query: 58  PECNKYAVNLTHKELIVSFEFERIDRGFKIGG-GKTYFGQD--KSSGFVEHKFWPKGNVK 114
              N    +    E IV  E ER+  G   G  G T++G D  +  G + H FWPK  V 
Sbjct: 134 DGRNYKLKSFVCDESIVELEVERLTDGVIFGDDGMTFYGDDINQPWGSMRHVFWPKCTVN 193

Query: 115 GNMVVD--GRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           G ++    G      G  +FV A+QGM+PH  A  WNF+NFQS   +    EF T  +Y 
Sbjct: 194 GRILTKKLGEVKITNGYTMFVMALQGMKPHHAAKSWNFMNFQSSNYAAVQMEFTTPKSYA 253

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTW----EGKTLETDE 228
           + KI+ G +  N K++  ++ N    L++ +D    + VP  I++ +     G T+    
Sbjct: 254 NTKIDIGIVTDNEKILFATIDNEVVHLDSEID-SVGWPVPKAIEFNYVDPLNGNTI---- 308

Query: 229 DFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHV-------K 280
              A +   L  L++++DV+ E+P F+K IV     AKPY+YQ+ NE E  +       K
Sbjct: 309 ---AKVTGPLKNLVERVDVMAEIPQFVKNIVSGVAGAKPYIYQYSNEFEIEILDKEKDSK 365

Query: 281 IGENEELTAKGKLFSECSFIS 301
            G+  E   KG  F+E +FIS
Sbjct: 366 SGKAVEGKEKGIGFTEVTFIS 386



>gi|344304430|gb|EGW34662.1| hypothetical protein SPAPADRAFT_53101 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 387

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 101/327 (30%), Positives = 157/327 (48%), Gaps = 39/327 (11%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNG---VNTFKSVNMTNFTLSPDRRSASA------NN 51
           F Q+IHSN+   + T QFT R F +    +  + S  + NF L      A        +N
Sbjct: 73  FAQVIHSNVMGVHTTAQFTFRLFNSKTPELGIWTSTKLENFRLEGANFYADGISLELIDN 132

Query: 52  MSIKLNPECNKYAVNLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFW 108
            + KLN   N         E +V  E  R+  G   G  G T++G+D  +  G + H FW
Sbjct: 133 KTFKLNFSANP--------ESLVELEMTRLTDGVIFGEDGFTFYGEDVENPWGSMRHAFW 184

Query: 109 PKGNVKGNMVVDGRAFD-----------VTGVGLFVHAIQGMRPHLIASRWNFVNFQSDV 157
           P+ +V G +     A +           + G  +FV A+QGM+PH  A  WNF+NFQS+ 
Sbjct: 185 PRCSVAGKITTTKTATEANAEPVTKEIPIEGYTMFVFALQGMKPHHAAKSWNFLNFQSEN 244

Query: 158 ASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKY 217
            S    EF T  +Y   ++N G +  N K++  +V N    L+   D E  + VP  I++
Sbjct: 245 YSAVQMEFTTPRSYAETRVNVGMICNNEKVLYATVNNKVVHLDPHDDVEIGWPVPKSIEF 304

Query: 218 TWEGKTLETDEDFSAFLEIKLDV--LMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNE 274
            +       D++      +K D+  L++++DV+ E+P  +K IV     AKPY+YQ+ +E
Sbjct: 305 HYLKDAANPDDEGVEVGVVKGDLKTLVERVDVMAEIPQLVKTIVSNVAGAKPYIYQYCDE 364

Query: 275 AEAHVKIGENEELTAKGKLFSECSFIS 301
            E  V     + +T  G  +SE +FIS
Sbjct: 365 LELTV-----DGITESGVAYSEVTFIS 386



>gi|385303347|gb|EIF47427.1| survival factor 1 [Dekkera bruxellensis AWRI1499]
          Length = 413

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 99/342 (28%), Positives = 170/342 (49%), Gaps = 43/342 (12%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVN---TFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSN+   +   QFT + F         + S  + N  +  D     A+N+SI L+
Sbjct: 72  FAQIIHSNLMGIHTNAQFTFKVFKKDEPEKYVWTSTKLENAKIV-DGTDFYADNLSIVLD 130

Query: 58  PE-CNKYAVN--LTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKG 111
            E  + Y +N  +T K  +++ +   +  G   G  G TY+G D  +  G + H FWP+ 
Sbjct: 131 KEKGDTYTINSSVTPKSEVINLKLVHVGEGVIFGKDGTTYYGTDPENPWGSMRHLFWPRC 190

Query: 112 NVKGNMVV-----------DGRA----FDVT---------------GVGLFVHAIQGMRP 141
              G ++            DG      +D T               G+G++V A+QGM+P
Sbjct: 191 RATGEIICRKYRQPKEDETDGNGEFLDWDSTNEKLKISEEKFEIKNGLGMYVMAMQGMKP 250

Query: 142 HLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLV-VNNKLVGVSVKNMAQFLE 200
           H  A+ W+F+N+QS+  S+ + E+ T P+Y +  ++   +V  + K V  ++ N  + L+
Sbjct: 251 HHAAAAWDFLNYQSNSHSVVIMEYTTPPSYNTTTVSTAMVVDKDGKPVLCTLNNKTEHLD 310

Query: 201 TSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQ 260
           T  D +  + VP K+KYT EG   E  +  +A +   L  + +++DV++E+P  +K IV 
Sbjct: 311 TYKDEDCGWMVPRKMKYTMEGVNSE-GKKTTAVVTADLQRMSERVDVMSEIPQLVKNIVS 369

Query: 261 AFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
                +PY+YQ+ N  E  V +  +E +  KG  ++E +FIS
Sbjct: 370 GIAGTRPYIYQYSNSMELKVXVEGDEIINEKGYGYNETTFIS 411



>gi|405117716|gb|AFR92491.1| survival factor 1 [Cryptococcus neoformans var. grubii H99]
          Length = 424

 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 114/362 (31%), Positives = 175/362 (48%), Gaps = 65/362 (17%)

Query: 1   FVQMIHSNIGLW--NPTIQFTSRFFGNGVN--TFKSVNMTNFTLSPDRRSASANNMSIKL 56
            VQ+I S +G++    T Q T + +        +KSV+ +N     D++S  ++   I+ 
Sbjct: 66  MVQIIWSYLGIFLIPATTQMTFKHYNPTTKKAVWKSVHASNAKF--DKQSCKSDLFEIRH 123

Query: 57  N---PECNKYAVNLT-HKELIVSFEFERIDR--GFKIG----GGKTYFGQDKS--SGFVE 104
           +    E   Y +  +  K++ ++ E+ +     GFK+G    GG + FG+DK+   G+V 
Sbjct: 124 SGSPTEGETYNITASLEKDVQITVEYTKPADAPGFKLGSGPDGGISTFGKDKAKREGYVV 183

Query: 105 HKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQS--------- 155
           H+F P  +  G ++++G+A D  G G+F+HAIQGMRP+LIASRWNF  F +         
Sbjct: 184 HRFHPFIHSSGTVIINGQAVDAKGEGIFIHAIQGMRPNLIASRWNFCFFSTAPGQDEEKL 243

Query: 156 -DVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSL----------- 203
             V +  M EFETT ++G K    G   VN   +  S      FL T             
Sbjct: 244 GSVRAFQM-EFETTDDFGPKGAKSGRTKVNIGGIYCSKTAPVPFLITGQTHAPSSDSTYP 302

Query: 204 ----------------DPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKL-------DV 240
                           D ET Y VP+ I++ W+G   +      A L I+          
Sbjct: 303 VPSQDISSASHLNPVHDSETGYSVPSGIEFKWQGDRRDGQGKAGATLVIEKAGKVPGEGG 362

Query: 241 LMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSF 299
           L++K+DVL E+PY +KK + A      Y+YQ+ N A   VK+ E E +  KG +F+E SF
Sbjct: 363 LIEKVDVLAEIPYVIKKGLTAMTGTNAYIYQYHNPATLEVKLDE-EVIPVKGFVFNEASF 421

Query: 300 IS 301
           IS
Sbjct: 422 IS 423



>gi|354544188|emb|CCE40911.1| hypothetical protein CPAR2_109490 [Candida parapsilosis]
          Length = 381

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 103/317 (32%), Positives = 160/317 (50%), Gaps = 26/317 (8%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSN+   + T QFT R +    +  N + S  + NF +  D  +  A+N+  ++ 
Sbjct: 74  FAQIIHSNVMGVHTTAQFTFRLYNINDSSKNIWTSTKLENFKIV-DGFNFEADNLKFEM- 131

Query: 58  PECNKYAV-NLTHKELIVSFEFERIDRGFKIGG-GKTYFGQD--KSSGFVEHKFWPKGNV 113
            +  KY + +    E IV  E ER+  G   G  G T++G+D  +  G + H FWP+  V
Sbjct: 132 IDGKKYKLRSFVCNESIVELEVERLTDGVIFGDDGMTFYGEDIKQPWGSMRHVFWPRCTV 191

Query: 114 KGNMVVD--GRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNY 171
            G ++    G      G  +FV A+QGM+PH  A  WNF+NFQS   +    EF T  +Y
Sbjct: 192 NGRILTKKLGEVTITNGYTMFVMALQGMKPHHAAKSWNFMNFQSSNYAAVQMEFTTPKSY 251

Query: 172 GSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTW----EGKTLETD 227
            + K+N G +  N K++  ++ N    L   +D    + VP  I++ +     G T+   
Sbjct: 252 ANTKVNIGLVTDNEKILFATIDNEVIHLSPEVD-SVGWPVPKSIEFNYVDPLNGNTI--- 307

Query: 228 EDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEE 286
               A +   L  L+++IDV+ E+P F+K IV     AKPY+YQ+ NE E  +   E + 
Sbjct: 308 ----AKVTGPLKNLIERIDVMAEIPQFVKNIVSGVAGAKPYIYQYSNEFEIEILDKEKDP 363

Query: 287 LTA--KGKLFSECSFIS 301
                KG  F+E +FIS
Sbjct: 364 KGGKEKGIGFTEVTFIS 380



>gi|255714645|ref|XP_002553604.1| KLTH0E02728p [Lachancea thermotolerans]
 gi|238934986|emb|CAR23167.1| KLTH0E02728p [Lachancea thermotolerans CBS 6340]
          Length = 414

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 102/336 (30%), Positives = 167/336 (49%), Gaps = 42/336 (12%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG---NGVNTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
           F Q+IHSN+   + T QFT R +      +N + S  + NF +  D  +  A+++SI++N
Sbjct: 73  FAQVIHSNVVGIHTTAQFTFRLYNVKEPKLNVWTSTKLANFRI--DGPNFYADDLSIEMN 130

Query: 58  PECNKYAVNLT-HKELIVSFEFERIDRGFKIGG-GKTYFGQ--DKSSGFVEHKFWPKGNV 113
              ++     + +   +V   FER   G K+G  G TY+G   ++  G + H FWP+   
Sbjct: 131 EAGSQVRFQSSVNPASVVDLTFERAVPGVKVGANGTTYYGDNLEQPWGSMRHVFWPRNFC 190

Query: 114 KGNMVV--------DGRAFDVTGV------------GLFVHAIQGMRPHLIASRWNFVNF 153
            G + V        D  A     V             +FV A+QGM+PH  A  WNF+NF
Sbjct: 191 HGTLKVKPELDSESDTEAEKEVPVQEIVFEKGAPVFSMFVMALQGMKPHHAAKAWNFLNF 250

Query: 154 QSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPT 213
           QS+  S  + EF T  +Y + KI  G L     ++ V++ N  + L+T +D    + VP 
Sbjct: 251 QSETHSAVLMEFTTPKSYANTKICVGILCDKKDIIAVTIDNNFEHLDTKID-SVGWPVPH 309

Query: 214 KIKYTWEG-KTLETDED------FSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-K 265
           KI  +++G K+  +DE+       +A     L+ L++++DV++E+P F+K IV      K
Sbjct: 310 KIDVSFKGVKSDVSDEEVATASPVTALASGPLEQLVERVDVMSEIPSFVKNIVSGVAGTK 369

Query: 266 PYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
           PY+YQ+ N+    V    ++     G  + E +FIS
Sbjct: 370 PYIYQYANDFSLRV----DDAAPVSGTGWCEITFIS 401



>gi|321251949|ref|XP_003192234.1| hypothetical protein CGB_B4070C [Cryptococcus gattii WM276]
 gi|317458702|gb|ADV20447.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 424

 Score =  135 bits (341), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 104/312 (33%), Positives = 151/312 (48%), Gaps = 64/312 (20%)

Query: 44  RRSASANNMSIKLNPECNKYAVNLT-HKELIVSFEFERIDR--GFKIG----GGKTYFGQ 96
           R S S N        E   Y +  +  K++ ++ E+ +     GFK+G    GG + FG+
Sbjct: 122 RHSGSPN--------EAETYNITASLEKDVQITVEYTKPTDAPGFKLGSGPDGGISTFGK 173

Query: 97  DKS--SGFVEHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQ 154
           D++   G+V H+F P  +  G +V++G+A D  G G+F+HAIQGMRP+LIASRWNF  F 
Sbjct: 174 DRAKREGYVVHRFHPFIHGSGTVVINGQAIDAKGEGVFIHAIQGMRPNLIASRWNFCFFS 233

Query: 155 S----------DVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFL----- 199
           +           V ++ M EFETT ++G K    G   VN   +  S      FL     
Sbjct: 234 TAPGQDEEKLGSVRAIQM-EFETTDDFGPKGAKSGRTKVNIGAIYCSKTAPIPFLITGQT 292

Query: 200 ------------------ETSLDP----ETKYKVPTKIKYTWEGKTLETDEDFSAFLEIK 237
                              T L+P    ET Y VP  I++ W+G   +      A L I+
Sbjct: 293 HAPPSDSTYPVPSQDISSATHLNPVHDSETGYSVPGSIEFKWQGDRRDGQGKAGATLVIE 352

Query: 238 LD-------VLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTA 289
                     L++K+DVL E+PY +KK + A      Y+YQ+ N A   V +GE E +  
Sbjct: 353 KQGKVLGEGGLIEKVDVLAEIPYVIKKGLTAMTGTNAYIYQYHNPATLEVSLGE-EVIPV 411

Query: 290 KGKLFSECSFIS 301
           KG +F+E SFIS
Sbjct: 412 KGFVFNEASFIS 423



>gi|260944134|ref|XP_002616365.1| hypothetical protein CLUG_03606 [Clavispora lusitaniae ATCC 42720]
 gi|238850014|gb|EEQ39478.1| hypothetical protein CLUG_03606 [Clavispora lusitaniae ATCC 42720]
          Length = 376

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 98/319 (30%), Positives = 155/319 (48%), Gaps = 35/319 (10%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNTFKSVNMTNFTLSPDRRSASAN----NMSIKL 56
           F Q+IHSNI     T QFT R + N +     + +   T   D R+  +N    ++SI+L
Sbjct: 74  FAQVIHSNIMGIKNTAQFTFRLYNNNLGAEDPLCIWTSTALEDFRTEGSNFYAKDLSIEL 133

Query: 57  NPE-----------CNKYAVNLTHKELIVSFEFERIDRGFKIGGGKTYFGQDKSS--GFV 103
           + E           C K  V+L   +L+    F           G T +G D  +  G +
Sbjct: 134 SGENSNVYTIKSKVCPKSEVDLVVTKLVPGVIFG--------ADGTTLYGDDIENPWGAM 185

Query: 104 EHKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMC 163
            H FWP+ + KG + +   + ++ G  +FV A+QGM+PH  A  WNF+NFQS+  S    
Sbjct: 186 RHAFWPRCSAKGTIKLGDTSLEIDGYTMFVMALQGMKPHHAAKSWNFLNFQSENFSAVQM 245

Query: 164 EFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKT 223
           EF T  +Y + K+N   L   +K++  S+ N         D    +KVP  I + +   T
Sbjct: 246 EFTTPSSYANTKVNVAILTSKDKIIATSIDNEIIHENAEAD-NVGWKVPKAITFNF---T 301

Query: 224 LETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIG 282
             T+ +  A +   L  L++++DV+ E+P F+K IV      KPY+YQ+ N      + G
Sbjct: 302 EGTNSEVIATVRGNLTRLIERVDVMAEIPQFVKNIVSGVAGTKPYIYQFCNTLTIEYE-G 360

Query: 283 ENEELTAKGKLFSECSFIS 301
           ++E+    G  F+E +FIS
Sbjct: 361 KSED----GIAFNEATFIS 375



>gi|58259489|ref|XP_567157.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134106647|ref|XP_778334.1| hypothetical protein CNBA3340 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50261037|gb|EAL23687.1| hypothetical protein CNBA3340 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57223294|gb|AAW41338.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 424

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 112/362 (30%), Positives = 176/362 (48%), Gaps = 65/362 (17%)

Query: 1   FVQMIHSNIGLW--NPTIQFTSRFFGNGVN--TFKSVNMTNFTLSPDRRSASANNMSIKL 56
            VQ+I S +G++    T Q T + +        +KSV+ +N     D++S  ++   I+ 
Sbjct: 66  MVQVIWSYLGIFLIPATTQMTFKHYNPTTKKAVWKSVHASNAKF--DKQSCKSDLFEIRH 123

Query: 57  N---PECNKYAVNLT-HKELIVSFEFERI--DRGFKIG----GGKTYFGQDKS--SGFVE 104
           +    E   Y +  +  K++ ++ E+ R     GFK+G    GG + FG+D++   G+V 
Sbjct: 124 SGSPTEGETYNITASLEKDVQITVEYTRPADTPGFKLGSGPDGGISAFGKDRAKREGYVV 183

Query: 105 HKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQS--------- 155
           H+F P  +  G +V++G+A D  G G+F+HAIQGMRP+L+ASRWNF  F +         
Sbjct: 184 HRFHPFIHSSGTLVINGQAVDAKGEGIFIHAIQGMRPNLVASRWNFCFFSTAPGQDEEKL 243

Query: 156 -DVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFL--------------- 199
             V +  M EFETT ++G K    G   VN   +  S      FL               
Sbjct: 244 GSVRAFQM-EFETTDDFGPKGAKSGRTKVNIGAIYCSKTAPVPFLITGQTHAPPSDSTYP 302

Query: 200 --------ETSLDP----ETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKL-------DV 240
                    T L+P    ET Y VP+ +++ W+G   +      A L I+          
Sbjct: 303 APSQDISSATHLNPVHDSETGYSVPSGLEFKWQGDRRDGQGKAGATLVIEKAGKVPGEGG 362

Query: 241 LMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSF 299
           L++K+DVL E+PY +KK + A      Y+YQ+ N A   V + E E +  KG +F+E +F
Sbjct: 363 LIEKVDVLAEIPYVIKKGLTAVTGTNAYIYQYHNPATLEVNLDE-EVIPVKGFVFNEATF 421

Query: 300 IS 301
           IS
Sbjct: 422 IS 423



>gi|367004130|ref|XP_003686798.1| hypothetical protein TPHA_0H01580 [Tetrapisispora phaffii CBS 4417]
 gi|357525100|emb|CCE64364.1| hypothetical protein TPHA_0H01580 [Tetrapisispora phaffii CBS 4417]
          Length = 446

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 105/366 (28%), Positives = 174/366 (47%), Gaps = 72/366 (19%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGN----GVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           F Q+IHSNI  +    QFT R + +     +N + S  + NF +  +  +  A+N+S++L
Sbjct: 75  FAQIIHSNIIGYITQAQFTFRIYDSRNPGNLNLWTSTKLENFKI--EGPNFYADNLSLEL 132

Query: 57  NPECNKYA-VNLTHKELIVSFEFERIDRGFKIG-GGKTYFGQ--DKSSGFVEHKFWPKGN 112
           N E  +Y  V+  + +  +   F R+  G K+G    TY+G   ++  G + H FWP+ +
Sbjct: 133 NEENTEYHFVSSVNDDSKIDLTFTRLVPGVKVGDNSTTYYGDNIEEPWGTMRHVFWPRNS 192

Query: 113 VKGNMVVDGRAFDVTGV------------------------------------------- 129
           V G + +  +  +V                                              
Sbjct: 193 VVGTIDLK-KPIEVKSATNGESETQDNEEGQEENDQDESESNEEIQKEDINIKFTKEYPV 251

Query: 130 -GLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLV 188
             LF+ A+QGM+PH  A  WNF+NF S+  S  + EF T  +Y + K++ G +     ++
Sbjct: 252 YSLFIMAVQGMKPHHAAKTWNFLNFHSEEGSTVLIEFTTPKSYANTKVSIGIVTSKEDIL 311

Query: 189 GVSVKNMAQFLETSLDPETKYKVPTKIKYTWEG-KTLETDED-----------FSAFLEI 236
            V+V N  + L + +D E  +KVP  I+ T  G K+  +DE            F+A  E 
Sbjct: 312 AVTVDNNYEHLNSEVD-EIGWKVPKNIQVTLNGIKSNISDEQVAGGELTDADKFTAVYEA 370

Query: 237 KLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFS 295
           KL+ L++++DV++E+P F+K IV      KPY+YQ+ N  +  +KI E    + KG  + 
Sbjct: 371 KLEQLVERVDVMSEIPQFVKNIVSGIAGTKPYIYQYANIEDCTLKINEK---SIKGLGWM 427

Query: 296 ECSFIS 301
           E +FIS
Sbjct: 428 EVTFIS 433



>gi|406604735|emb|CCH43795.1| Survival factor 1 [Wickerhamomyces ciferrii]
          Length = 388

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 100/323 (30%), Positives = 166/323 (51%), Gaps = 31/323 (9%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV--NTFKSVNMTNFTLSPDRRSASANNMSIKLNP 58
           F Q+IHSN+   + T QFT + F        + S  + +F +  +   AS  N+ I++N 
Sbjct: 73  FAQVIHSNVVGIHTTAQFTFKLFNTNTKEQIWTSTKLEDFIIKGENFYAS--NLKIEIND 130

Query: 59  ECNKY-AVNLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVK 114
           E N+Y  V+  + E IV  +F +I    KIG  G T +G D  +  G + H FWP+  V+
Sbjct: 131 EGNEYHLVSKVNPESIVDLKFSKIAPSVKIGKDGVTIYGDDVENPWGTMRHVFWPRNKVE 190

Query: 115 GNM------VVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETT 168
           G++        + + +++ G  +FV A+QGM+PH  A+ WNF+NF S   S  + EF T 
Sbjct: 191 GSIQSTKEGSTETKNYEINGFSMFVMALQGMKPHHAAATWNFLNFHSKSLSTVVMEFTTP 250

Query: 169 PNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEG-KTLETD 227
            +YGS K++   L  +  ++G S+ N    L   +D E  +  PT +++   G  +   D
Sbjct: 251 KSYGSTKVSLAFLSNDEGIIGSSINNEVLHLNPEID-EVGWPKPTSLEFKGHGIDSKAND 309

Query: 228 EDFSAFLEIKLD-------VLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQ-WFNEAEAH 278
           E   +     ++        L++++DV++E+P F+K +V      KPY+YQ W N    +
Sbjct: 310 EQVQSGSAKPVEWTLKGGLQLVERVDVMHEIPNFVKNLVSGVAGTKPYIYQFWDNMTIEY 369

Query: 279 VKIGENEELTAKGKLFSECSFIS 301
            +I E    T+ G L  E +FI+
Sbjct: 370 NEIKE----TSIGYL--EATFIT 386



>gi|320037416|gb|EFW19353.1| survival factor 1 [Coccidioides posadasii str. Silveira]
          Length = 305

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 118/235 (50%), Gaps = 7/235 (2%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKLN 57
            VQ+I+SN+   + T    ++ +       + + S  + N     D  S   +N++I L+
Sbjct: 70  MVQVIYSNVAGLHTTCHLNTKIYSTDPQIPHKWYSDTIHNHIFDEDMLSFGGDNVAITLS 129

Query: 58  PECNKYAVNLTHKE-LIVSFEFERIDRGFKIG-GGKTYFGQD--KSSGFVEHKFWPKGNV 113
            +   Y +     E  +V+    R+  GF  G  G + FG D  +  G + H FWP+  V
Sbjct: 130 EDGTSYTIKSALNENSLVNLTMTRVAPGFVAGTNGTSNFGTDPERPWGSMRHSFWPRCKV 189

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGS 173
           +G ++   R  + +G G FVHA+QGM+PH +A+RWNF NFQS   S  + E+ T P+YGS
Sbjct: 190 EGTIITPEREINCSGRGFFVHALQGMKPHHLAARWNFANFQSPTYSAIIMEYTTPPSYGS 249

Query: 174 KKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDE 228
             +N G +  + +++     N A   E   D E  +  P  IK+TW G+  +  E
Sbjct: 250 TVVNVGGIAKDGEIIYAGTSNTASHGEIVKDSENDWPEPKTIKFTWSGQNKDDKE 304



>gi|242213660|ref|XP_002472657.1| predicted protein [Postia placenta Mad-698-R]
 gi|220728255|gb|EED82153.1| predicted protein [Postia placenta Mad-698-R]
          Length = 258

 Score =  130 bits (326), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 119/221 (53%), Gaps = 35/221 (15%)

Query: 5   IHSNIGLWNPTIQFTSRFFGNGVN--TFKSVNMTNFTLSP---DRRSASANNMSIKL--- 56
           + + I +W PTIQFT + +    N  T+KS+N++NF   P   D+RS+ A+  SI     
Sbjct: 40  VETQICVWYPTIQFTCKIYNPATNERTWKSINVSNFVTPPPGLDKRSSKADQFSITHRSN 99

Query: 57  ----NPECNKYAVNLTHKELIVSFEFERIDR--GFKIG----GGKTYFGQDK--SSGFVE 104
                PE     VNL + +L +S E  R     G+K+G    GG +YFG D   + G+V 
Sbjct: 100 PGSDTPESYSIRVNLDN-DLQISLEVTRPASAPGWKVGKGPKGGFSYFGHDPEHAEGYVV 158

Query: 105 HKFWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMC- 163
           H+FWP     G ++  G A  V+G G+FVHAIQGMRP+L+A+RWNF +F S  A L  C 
Sbjct: 159 HRFWPMDLATGTIIHKGHAKQVSGPGMFVHAIQGMRPNLVAARWNFAHFVS--AELGGCS 216

Query: 164 ----EFETTPNYGSK-------KINQGSLVVNNKLVGVSVK 193
               EF T   YG +         N GSLV+  KL  V+ +
Sbjct: 217 AIQMEFTTIDAYGRQGAGSGFVTANVGSLVLGGKLAAVTAE 257



>gi|367001975|ref|XP_003685722.1| hypothetical protein TPHA_0E01960 [Tetrapisispora phaffii CBS 4417]
 gi|357524021|emb|CCE63288.1| hypothetical protein TPHA_0E01960 [Tetrapisispora phaffii CBS 4417]
          Length = 441

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 174/354 (49%), Gaps = 59/354 (16%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFF-GNGV---NTFKSVNMTNFTLSPDRRSASANNMSIKL 56
             Q+IHSNI   + T QF  R    N V   N + S  + NF +  D  +  A+N+ I+L
Sbjct: 75  LAQVIHSNIVGLHQTAQFNCRIVDSNDVKNFNVWTSTKLENFRI--DGTNFYADNLKIEL 132

Query: 57  NPECNKYAVNLTHKELI-VSFEFERIDRGFKIGGG-KTYFGQDKSS--GFVEHKFWPKGN 112
           N + N++ V     E++ +   F R+  G K+G    TYFG +     G + H FWP+  
Sbjct: 133 NEDGNQFHVVANVNEIVSLDLFFTRVTDGCKLGNDPNTYFGDNVEEPWGKIRHIFWPRNK 192

Query: 113 VKGNMVV-------------DG------RAF---------DVTGVGLFVHAIQGMRPHLI 144
           + G + +             +G      ++F         +   + +FV A QGM+PH  
Sbjct: 193 LVGTINIKYEEPREEQGNQKEGEEEQQLKSFIEKTIKFTEEKPALSMFVLAFQGMKPHHA 252

Query: 145 ASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLD 204
           A  WNF+NFQSD  S+ + EF T  +Y + K++ G +  + K++ V+  N  + +++++D
Sbjct: 253 AKAWNFINFQSDEYSVILIEFITPKSYANTKVSIGIVTDSEKILSVATNNNFEHIDSTVD 312

Query: 205 PETKYKVPTKIKYTWEGKTLETDEDFS----------------AFLEIKLDVLMDKIDVL 248
               + VP  IK T+ G + +  +D                  A + + L  L+++IDV+
Sbjct: 313 -SIGWPVPKAIKCTFNGISADLSDDQVKKMYGENNGTLKEQEIAVVNVNLTNLIERIDVM 371

Query: 249 NEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
           NE+P F+K IV      KPY+YQ+  + + +++I  N+++   G L  E  FIS
Sbjct: 372 NEIPQFVKNIVSGVAGTKPYIYQYAGDEDFNIEIN-NKKVKGLGML--EVIFIS 422



>gi|392577280|gb|EIW70409.1| hypothetical protein TREMEDRAFT_43130 [Tremella mesenterica DSM
           1558]
          Length = 417

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 107/358 (29%), Positives = 158/358 (44%), Gaps = 61/358 (17%)

Query: 1   FVQMIHSNIGLW--NPTIQFTSRFFGNGVN--TFKSVNMTNFTLSPDRRSASANNMSIK- 55
            VQ+I S +GL+    T Q T + +        +KS++ + F   P+ RS  +++  IK 
Sbjct: 63  MVQIIWSYLGLFLVPATCQMTFKIYNPHAKKAVWKSISASGF--KPNGRSCKSDHFDIKH 120

Query: 56  ---LNPECNKYAVNLTHKELIVSFEFERIDR--GFKIG----GGKTYFGQDKSSGFVEHK 106
               + E + + V    K +     F R     G K G    GG + FG+DK  G   H+
Sbjct: 121 TGAASGEESYHIVAHLDKHVQFDLVFRRPAEAPGVKFGAGEMGGISTFGKDKEDGIALHR 180

Query: 107 FWPKGNVKGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSD---------- 156
           F P     G   +DG+  D  G G+FV AIQGMRP  +A+RWNF  F +           
Sbjct: 181 FLPLMYSSGTFTLDGKVVDAKGDGMFVRAIQGMRPDSLATRWNFAFFTTGGGIEEGPLGG 240

Query: 157 VASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVK----------------------- 193
           V ++ M EFETT  YG K    G   VN  +V ++                         
Sbjct: 241 VRAIQM-EFETTDAYGPKGHKSGRTKVNVGVVTITSLPSPLIVVGQTHHASSDAFPRLSK 299

Query: 194 --NMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFL-------EIKLDVLMDK 244
             + A  L    D +T Y  PT I + WEG  ++      A +        +    L++K
Sbjct: 300 DISAATHLGVVKDKDTGYYAPTGISFVWEGDRVDGKGRAGAKVVQEKAGATVGEGGLIEK 359

Query: 245 IDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
           +DVL E+P  ++K + A    KPY++Q+ N A   V + + E    KG LF E +FIS
Sbjct: 360 VDVLGEIPLLIRKGLAAVTGTKPYIFQYQNPATLEVTL-DGETTPVKGWLFDEATFIS 416



>gi|149244132|ref|XP_001526609.1| survival factor 1 [Lodderomyces elongisporus NRRL YB-4239]
 gi|146449003|gb|EDK43259.1| survival factor 1 [Lodderomyces elongisporus NRRL YB-4239]
          Length = 362

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 159/312 (50%), Gaps = 35/312 (11%)

Query: 1   FVQMIHSNI-GLWNPTIQFTSRFFGNGVNTFKSVNMTNFTLSPDRRSASANNMSIKLNPE 59
           FVQ+I+S I G+ N T  F  R  G     + S+ + ++ +  +  + +A N S+KL  +
Sbjct: 74  FVQIIYSLIMGVVN-TAHFNLRCNGK----WYSLPLQDYKI--EGNNVTAKNFSLKLGED 126

Query: 60  CNKYAVNLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNVKGN 116
              Y +       +V   F+++  G   G  G T +G D  +  G + H FWP+  V+G 
Sbjct: 127 GVLYQLKSAMGSTMVDLTFKQVSPGVIFGEDGTTLYGTDAENPWGKMRHCFWPRCTVEGA 186

Query: 117 MVV-DGRAFDVT---GVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYG 172
           +V  D    D++   G+G+ V A+QGM+PH  AS WNF+N+Q D  S  + EF T  +Y 
Sbjct: 187 IVNNDLGKVDISLQNGLGMVVMALQGMKPHHAASSWNFLNYQGDEYSAVVMEFTTPKSYA 246

Query: 173 SKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPETK--YKVPTKIKYTWEGKTLETDEDF 230
             ++N G LV  +K++  S+ N         +P+T   + VP KI +         D   
Sbjct: 247 KTRVNIGILVKGDKIISTSIDNDV----VHENPKTNDIWPVPQKITF--------QDPKN 294

Query: 231 SAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEELTA 289
              L   LD L++++DV+ E+P F+K +V     AKPY+YQ+  + E   + GE E    
Sbjct: 295 GWKLTGNLDHLVERVDVMAEIPQFVKNLVSNISGAKPYIYQYMEDFELEYE-GEKE---- 349

Query: 290 KGKLFSECSFIS 301
           KG  + E +FIS
Sbjct: 350 KGPGYCEVTFIS 361



>gi|367014363|ref|XP_003681681.1| hypothetical protein TDEL_0E02270 [Torulaspora delbrueckii]
 gi|359749342|emb|CCE92470.1| hypothetical protein TDEL_0E02270 [Torulaspora delbrueckii]
          Length = 425

 Score =  124 bits (311), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 97/346 (28%), Positives = 168/346 (48%), Gaps = 51/346 (14%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG----NGVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           F Q+IHSNI   +   QFT R F     + +N + S  + +F +  +  +  A ++S++L
Sbjct: 73  FAQIIHSNIVGIHTQAQFTFRIFNSKKPDELNLWTSTKLEDFRV--EGPNFYAKDLSLEL 130

Query: 57  NPECNKYA-VNLTHKELIVSFEFERIDRGFKIG-GGKTYFGQ--DKSSGFVEHKFWPKGN 112
           N E N+Y  V+  +++  V   F R+  G K+G    TY+G   ++  G + H FWP+ +
Sbjct: 131 NEEDNEYHFVSQVNEKSTVDLTFTRLTPGCKVGEDPNTYYGDNLEEPWGKMRHVFWPRNS 190

Query: 113 VKGNM-----------------VVDGRAF----------DVTGVGLFVHAIQGMRPHLIA 145
           ++G +                    G++           +     +FV A QGM+PH  A
Sbjct: 191 IRGTINLKKPEPTENEEQEEEPQETGKSVYEEQTITFGPNDKAYSMFVMAFQGMKPHHAA 250

Query: 146 SRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDP 205
             WNF+ F S+  +  + EF T  +Y + K+  G L  +  ++ V+  N    L+  +D 
Sbjct: 251 KAWNFMYFHSEKHTAVLMEFVTPKSYANTKVTIGILTSDKDILAVTTNNEFSHLDPQID- 309

Query: 206 ETKYKVPTKIKYTWEGKTLE-TDED--------FSAFLEIKLDVLMDKIDVLNEVPYFLK 256
              + VP  +   ++G + E TDE          +A +E  L  L+++IDV+NE+P F+K
Sbjct: 310 SVGWNVPQSVSIAYDGFSPEVTDEQVASGDYKKVTAKVEGPLQNLIERIDVMNEIPNFIK 369

Query: 257 KIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
            IV      KPY+YQ+   AE +  +  +++    G  ++E +FIS
Sbjct: 370 TIVSGVAGTKPYIYQY---AEDNFTLQVDDQPYEHGVAWTEVTFIS 412



>gi|315044585|ref|XP_003171668.1| hypothetical protein MGYG_06214 [Arthroderma gypseum CBS 118893]
 gi|311344011|gb|EFR03214.1| hypothetical protein MGYG_06214 [Arthroderma gypseum CBS 118893]
          Length = 325

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 95/165 (57%), Gaps = 4/165 (2%)

Query: 140 RPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFL 199
           R  L  SRWNFV+FQS   S  M E+ T P+YGS  +N G +V + +++     N     
Sbjct: 162 RTELRPSRWNFVDFQSPTFSAGMMEYTTPPSYGSTVVNVGGVVKDGEIIYAGAPNSVTHT 221

Query: 200 ETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIV 259
           E++ D E  +  P+ +K TW GKT E  + F A ++  L   MD+IDV+ EVP  +K +V
Sbjct: 222 ESTQDSENDWPEPSAMKITWSGKTAE-GKSFEATIDGSLGPRMDRIDVMAEVPGLIKSLV 280

Query: 260 QAFVA-KPYVYQWF--NEAEAHVKIGENEELTAKGKLFSECSFIS 301
            +    +PYVYQ+    +    +KIG++EE+T +G L  E +FIS
Sbjct: 281 GSVAGTRPYVYQFIPSQKLPIKIKIGDDEEITEEGTLLVEATFIS 325



>gi|50284879|ref|XP_444867.1| hypothetical protein [Candida glabrata CBS 138]
 gi|74610991|sp|Q6FY35.1|SVF1_CANGA RecName: Full=Survival factor 1
 gi|49524169|emb|CAG57760.1| unnamed protein product [Candida glabrata]
          Length = 443

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 166/363 (45%), Gaps = 67/363 (18%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNG----VNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           F Q+IHSNI   +   QFT R F +     +N + S  + NF +  +  +  A+++S++L
Sbjct: 73  FAQIIHSNIIGLHTAAQFTFRIFDSKNPEKLNLWTSTKLENFRI--EDANFYADDLSVEL 130

Query: 57  NPECNKYA-VNLTHKELIVSFEFERIDRGFKIGGG-KTYFGQ--DKSSGFVEHKFWPKGN 112
           N +  +Y  ++  +++ IV     R+  G K+G    TY+G   ++  G + H FWP+  
Sbjct: 131 NADNTQYRLISKVNEQSIVDLTVTRLTPGAKLGDDPSTYYGDNVEQPWGSMRHVFWPRNT 190

Query: 113 VKGNMVV---------------------------------------DGRAF----DVTGV 129
             G + V                                       + R      D    
Sbjct: 191 CVGEIKVKIPKETAEKTAEEQAQEKEQQEEQEQEGEDEAVEETIEYEERTLKFGEDDPSY 250

Query: 130 GLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVG 189
            +FV A QGM+PH  A  WNF+ F S   ++ + EF T  +Y + K++ G +  + +++ 
Sbjct: 251 CMFVMAFQGMKPHHAAKAWNFMFFHSKENTMVLMEFTTPKSYSNTKVSIGIITNDKEILA 310

Query: 190 VSVKNMAQFLETSLDPETKYKVPTKIKYTWEG-KTLETDED---------FSAFLEIKLD 239
           V+  N A  L   +D    + VP +I+   +G K+   DED           A +E  L+
Sbjct: 311 VTHDNSALHLNQEID-SVGWNVPKQIRVELKGHKSSAKDEDVEADNDEHKIKAVVEGPLE 369

Query: 240 VLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECS 298
            ++++IDV+ EVP F+K IV      KPY+YQ+ +    H ++ + E+    G  + E +
Sbjct: 370 NMVERIDVMGEVPNFVKNIVSGVAGTKPYIYQFGDAENFHFQLDDGEK--KNGLAWVEVT 427

Query: 299 FIS 301
           FIS
Sbjct: 428 FIS 430



>gi|254577343|ref|XP_002494658.1| ZYRO0A06666p [Zygosaccharomyces rouxii]
 gi|238937547|emb|CAR25725.1| ZYRO0A06666p [Zygosaccharomyces rouxii]
          Length = 463

 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 105/388 (27%), Positives = 165/388 (42%), Gaps = 97/388 (25%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFG-----NGVNTFKSVNMTNFTLSPDRRSASANNMSIK 55
           F Q+IHSNI   +   QFT R +        +N + S  + NF +  D  +  A+N+S++
Sbjct: 73  FAQIIHSNIIGLHTQAQFTFRVYNAKEGKEALNLWTSTKLENFRI--DGPNFYADNLSVE 130

Query: 56  LNPECNKYA----VNLTHKELIVSFEFERIDRGFKIGGG-KTYFGQ--DKSSGFVEHKFW 108
           L+ +   Y     VN   K   V   F ++  G K+G    TY+G   ++  G + H FW
Sbjct: 131 LDQDSKTYHFKSDVNEKSK---VDLTFTKLTPGCKVGDDPSTYYGDNIEEPWGRMRHVFW 187

Query: 109 PKG---------------------NVKGNMVV-DGRAFD--------------------- 125
           P+                      ++KG     D R  D                     
Sbjct: 188 PRNKVTGKIDIKVPVKQQASEEHKDIKGEQTSQDTRQKDRESAEEKGTSEENEEEEEEEE 247

Query: 126 -----------VTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSK 174
                         + +FV A QGM+PH  A  WNF+ F S+  +  + EF T  +Y + 
Sbjct: 248 LEDLHIKFTDESPALSMFVMAFQGMKPHHAAKAWNFLYFHSEDHTAVLMEFITPKSYANT 307

Query: 175 KINQGSLVVNNKLVGVSVKNMAQFLETSLDPETKYKVPTKIKYTWEG-KTLETDEDFSAF 233
           K++ G +   N+++ VSV N  + L +S+D    + VP  +   + G K+   DE  +A 
Sbjct: 308 KVSVGIITSKNEVLSVSVNNDFRHLNSSVD-SVGWNVPKNLSVKFNGFKSTAPDEKIAAI 366

Query: 234 -------------------LEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFN 273
                              +E KLD L+++IDV+NE+P F+K IV      KPY+YQ+ +
Sbjct: 367 TNSPTKQEKYDNDTQLHATVEGKLDQLVERIDVMNEIPNFVKSIVSGVAGTKPYIYQYAD 426

Query: 274 EAEAHVKIGENEELTAKGKLFSECSFIS 301
           E     +    E    KG  + E +FIS
Sbjct: 427 EFTLQFQDASKE----KGLAWVEVTFIS 450



>gi|326481624|gb|EGE05634.1| survival factor 1 protein [Trichophyton equinum CBS 127.97]
          Length = 235

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 89/157 (56%), Gaps = 4/157 (2%)

Query: 148 WNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMAQFLETSLDPET 207
           WNFV+FQS   S  M E+ T P+YGS  +N G +  + +++     N     E + D E 
Sbjct: 80  WNFVDFQSPTFSAGMMEYTTPPSYGSTVVNVGGVAKDGEVIYAGAPNSITHTEATQDSEN 139

Query: 208 KYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KP 266
            +  PT +K TW GKT    + F A +E  L   MD+IDV+ EVP  +K +V +    +P
Sbjct: 140 DWPEPTALKITWSGKT-AGGKPFEAIIEGSLGQRMDRIDVMAEVPGLIKSLVGSVAGTRP 198

Query: 267 YVYQWF--NEAEAHVKIGENEELTAKGKLFSECSFIS 301
           YVYQ+   ++    +K+G++EE+T +G L  E +FIS
Sbjct: 199 YVYQFIPSHKLPIKIKVGDDEEITEEGTLLMEATFIS 235



>gi|410080233|ref|XP_003957697.1| hypothetical protein KAFR_0E04110 [Kazachstania africana CBS 2517]
 gi|372464283|emb|CCF58562.1| hypothetical protein KAFR_0E04110 [Kazachstania africana CBS 2517]
          Length = 433

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 166/358 (46%), Gaps = 64/358 (17%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGN----GVNTFKSVNMTNFTLSPDRRSASANNMSIKL 56
           F Q+IHS+I  ++   QFT R F +     +N + S  + NF   P+  +  A+N+SI+L
Sbjct: 73  FAQIIHSSIIGFHTAAQFTFRIFDSKNPESLNLWTSTKLDNF--RPEGPNFYADNLSIEL 130

Query: 57  NPECNKY-AVNLTHKELIVSFEFERIDRGFKIG-GGKTYFGQ--DKSSGFVEHKFWPKGN 112
           + +   Y  V+  +++  V  E  R+  G K G    TYFG   D+  G + H FWP+  
Sbjct: 131 SEDNTTYHIVSNVNEQSTVDIEVTRLTPGAKAGEDPTTYFGDNIDEPWGSMRHTFWPRNK 190

Query: 113 VKGNM---------------------------VVDGRAFDVTGV---------GLFVHAI 136
             G +                                A++   +          +FV A 
Sbjct: 191 CVGKINLKKPIKSEETEQEITTEESTEESTEETEPSVAYEDQEIVFTESKPAFSMFVLAF 250

Query: 137 QGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVKNMA 196
           QGM+PH  A  WNFV   +   S  + E+ T  +Y + K++ G +  ++ ++ +S  N  
Sbjct: 251 QGMKPHHAAKAWNFVYMHTKTHSAVLMEYITPKSYANTKVSVGIITSDDDVLTLSTTNNY 310

Query: 197 QFLETSLDPETKYKVPTKIKYTWEGKTLE-TDEDFS----------AFLEIKLDVLMDKI 245
           + L T +D E  + VP  IK +  G + + +DE+ +          A +E  L  L++++
Sbjct: 311 EHLNTEVD-EIGWNVPKDIKVSISGVSSKLSDEEIAEKGSEGEKVVAVIEAPLKNLVERV 369

Query: 246 DVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEA-HVKIGENEELTAKGKLFSECSFIS 301
           DV+ E+P F+K IV      KP++YQ+ ++     V  GE E+    G  ++E +FIS
Sbjct: 370 DVMGELPGFVKNIVSGVAGTKPFIYQYASDDFCMQVNNGEKEQ----GLGWAEVTFIS 423



>gi|444322674|ref|XP_004181978.1| hypothetical protein TBLA_0H01720 [Tetrapisispora blattae CBS 6284]
 gi|387515024|emb|CCH62459.1| hypothetical protein TBLA_0H01720 [Tetrapisispora blattae CBS 6284]
          Length = 488

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 104/185 (56%), Gaps = 15/185 (8%)

Query: 130 GLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVG 189
           GLFV A+QGM+P+  A  WNFVNF S   S+ + EF T  +YG  K++ G +  N K++ 
Sbjct: 293 GLFVMAMQGMKPNHAAKAWNFVNFHSKEHSVMVMEFITPKSYGCTKVSVGVISNNEKVLA 352

Query: 190 VSVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLE------------TDEDFSAFLEIK 237
           +++ N  Q L+  +D E  + VP K+K    G + E            + +  S+ +++ 
Sbjct: 353 MTIDNDFQHLDQKVD-EIGWNVPHKLKIKLSGISSELPDKQIAADDILSKDRVSSTVDVD 411

Query: 238 LDVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSE 296
           L  L++++DV+ E+P F+K IV      KPY+YQ+ +     +++ + E+   KG  ++E
Sbjct: 412 LKTLVERVDVMAEIPQFVKNIVSGIAGTKPYIYQYADRDNFTLQVND-EKTFEKGIGWTE 470

Query: 297 CSFIS 301
            +FIS
Sbjct: 471 VTFIS 475



>gi|190348254|gb|EDK40677.2| hypothetical protein PGUG_04775 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 258

 Score = 99.8 bits (247), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 98/176 (55%), Gaps = 10/176 (5%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNTFKSVNMTNFTLSPDRRSASAN----NMSIKL 56
           F Q+IHSN+   + T QFT R   +  +  K +N+   T   + ++  AN    N+SI+L
Sbjct: 74  FAQVIHSNLMGVHTTAQFTFRLVHH--DNLKEMNLWTSTKLENFKTQGANFYADNLSIEL 131

Query: 57  NPECNKYAVNLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
           + +      ++T K  +V+   +R+  G   G  G T +G D ++  G + H FWP+ +V
Sbjct: 132 HGDEYVLKSSVTPKS-VVNLTMKRLVPGVIFGKDGTTLYGDDVANPWGSMRHLFWPRCSV 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTP 169
            G +V DG+  D+ G+ +FV A+QGM+PH  A  WNF+NFQS+  S    EF T P
Sbjct: 191 TGTIVTDGKTIDIDGLTMFVMAMQGMKPHHAAKSWNFLNFQSEEFSAVQMEFTTPP 246



>gi|146413699|ref|XP_001482820.1| hypothetical protein PGUG_04775 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 258

 Score = 99.8 bits (247), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 98/176 (55%), Gaps = 10/176 (5%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVNTFKSVNMTNFTLSPDRRSASAN----NMSIKL 56
           F Q+IHSN+   + T QFT R   +  +  K +N+   T   + ++  AN    N+SI+L
Sbjct: 74  FAQVIHSNLMGVHTTAQFTFRLVHH--DNLKEMNLWTSTKLENFKTQGANFYADNLSIEL 131

Query: 57  NPECNKYAVNLTHKELIVSFEFERIDRGFKIG-GGKTYFGQDKSS--GFVEHKFWPKGNV 113
           + +      ++T K  +V+   +R+  G   G  G T +G D ++  G + H FWP+ +V
Sbjct: 132 HGDEYVLKSSVTPKS-VVNLTMKRLVPGVIFGKDGTTLYGDDVANPWGSMRHLFWPRCSV 190

Query: 114 KGNMVVDGRAFDVTGVGLFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTP 169
            G +V DG+  D+ G+ +FV A+QGM+PH  A  WNF+NFQS+  S    EF T P
Sbjct: 191 TGTIVTDGKTIDIDGLTMFVMAMQGMKPHHAAKSWNFLNFQSEEFSAVQMEFTTPP 246



>gi|365985057|ref|XP_003669361.1| hypothetical protein NDAI_0C04580 [Naumovozyma dairenensis CBS 421]
 gi|343768129|emb|CCD24118.1| hypothetical protein NDAI_0C04580 [Naumovozyma dairenensis CBS 421]
          Length = 454

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 98/184 (53%), Gaps = 17/184 (9%)

Query: 131 LFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV 190
           +FV A QGM+PH  A  WNF+ F S+  +  + EF T  +YG+ K++ G L  +  ++ V
Sbjct: 262 MFVMAFQGMKPHHAAKAWNFIYFHSEKHTAVLMEFTTPKSYGNTKVSVGILTSDKDILAV 321

Query: 191 SVKNMAQFLETSLDPETKYKVPTKIKYTWEG------------KTLETDEDFSAFLEIKL 238
           +  N    L+  +D    + +P   +  + G              ++ D+  +A +E  L
Sbjct: 322 TTDNQVTHLDAEID-SVGWNIPKNFRVDFNGVKSTVTDDEVKNNEVKDDDRIAATVEGPL 380

Query: 239 DVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSEC 297
           + L+++IDV+ EVP F+K IV      KPY+YQ+ ++ E  +K+ + E    KG  ++E 
Sbjct: 381 NNLVERIDVMGEVPGFVKNIVSGVAGTKPYIYQYASDDEFTLKVNDEE---VKGLAWAEV 437

Query: 298 SFIS 301
           +FIS
Sbjct: 438 TFIS 441



>gi|471880880|emb|CCO34632.1| Survival factor 1 [Rhizoctonia solani AG-1 IB]
          Length = 211

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 80/146 (54%), Gaps = 16/146 (10%)

Query: 1   FVQMIHSNIGLWNPTIQFTSRFFGNGVN---TFKSVNMTNFTLSP---DRRSASANNMSI 54
           + Q+IHS +G+W P IQFT R F N V    T+KSVN+TNF   P   D+RSA ++  ++
Sbjct: 62  WCQVIHSAVGMWYPQIQFTCRIF-NPVTRETTWKSVNITNFVTPPPGKDKRSAKSDQFTV 120

Query: 55  KLNPECNKYAVNLT-------HKELIVSFEFERIDRGFKIGGGKTYFGQD--KSSGFVEH 105
                   YA   T         +L ++        GFK+G G+++FG D  K  G+V H
Sbjct: 121 THGAGTGDYAEQYTINANLGDDLQLALTISRPASAEGFKVGRGESFFGPDANKPEGYVVH 180

Query: 106 KFWPKGNVKGNMVVDGRAFDVTGVGL 131
           +FWP+    G+++  G+A +  GVG+
Sbjct: 181 RFWPRTKCTGHIIKSGQAIEANGVGI 206



>gi|156837582|ref|XP_001642813.1| hypothetical protein Kpol_365p11 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156113384|gb|EDO14955.1| hypothetical protein Kpol_365p11 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 470

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 100/184 (54%), Gaps = 16/184 (8%)

Query: 131 LFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV 190
           LF+ A QGM+PH  A  WNF+NF S+  S  + EF T  +Y + K++ G +   + ++ V
Sbjct: 277 LFIMAFQGMKPHHAAKAWNFLNFHSEENSAVLIEFITPKSYANTKVSIGIVTSKDDILSV 336

Query: 191 SVKNMAQFLETSLDPETKYKVPTKIKYTWEG-KTLETDEDF-----------SAFLEIKL 238
           +V N  + L   +D    +KVP  +   + G  +  TDE+            +  +E  L
Sbjct: 337 TVNNDFKHLNAEVD-SIGWKVPKNLCIEFNGVASTVTDEEIENEEVKDEHKVNVVVETPL 395

Query: 239 DVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEAEAHVKIGENEELTAKGKLFSEC 297
             L++++DV+NE+P F+K IV      KPY+YQ+ ++ E  +++   E+   +G  ++E 
Sbjct: 396 KKLVERVDVMNEIPQFVKNIVSGIAGTKPYIYQFADDEEFTIQLNGGEK--QRGLGWTEV 453

Query: 298 SFIS 301
           +FIS
Sbjct: 454 TFIS 457



>gi|403215118|emb|CCK69618.1| hypothetical protein KNAG_0C05170 [Kazachstania naganishii CBS
           8797]
          Length = 463

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 89/157 (56%), Gaps = 14/157 (8%)

Query: 131 LFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV 190
           +FV A QGM+P+  A  WNFV   +   S  + E+ T  +YG+ K++ G L  + +++ +
Sbjct: 271 MFVLAFQGMKPNHAAKAWNFVYVHTRENSAVLMEYITPKSYGNTKVSVGILTSDTEILSL 330

Query: 191 SVKNMAQFLETSLDPETKYKVPTKIKYTWEGKT------------LETDEDFSAFLEIKL 238
           S+ N  + LET +D E  + VP KIK  + G +            L+ D++ SA +E  +
Sbjct: 331 SINNNYEHLETEVD-EVGWSVPKKIKVEFAGVSPEVTDEQIAGGELKKDDEVSAVIEGPM 389

Query: 239 DVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNE 274
             L+++IDV+ E+P F+K IV      KPY+YQ+ ++
Sbjct: 390 TNLIERIDVMGEIPGFVKNIVSGIAGTKPYIYQYADD 426



>gi|401624247|gb|EJS42311.1| YDR222W [Saccharomyces arboricola H-6]
          Length = 421

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 88/322 (27%), Positives = 142/322 (44%), Gaps = 71/322 (22%)

Query: 1   FVQMIHSNI--GLWNPTIQFTSRFFGNGVN--------TFKSVNMTNFTL---------- 40
           FVQ+++S +  G++    Q   + FG+  N        +FK  N+T F            
Sbjct: 99  FVQLLYSTVMGGIYK-GFQLNFKIFGSENNNSDYDVWESFKLDNITEFQPLKLVSRSVIF 157

Query: 41  ----SPDRRSASANNMSIKLN-PECNKYAVNLTHKELIVSFEFERIDRGFKIG--GGKTY 93
               + D +  S   +SIK + P CN    NL    ++  F+      GFK+   G   Y
Sbjct: 158 EFLNNKDEKLGSIGQLSIKCDLPTCNNTIQNLKIDLMVDLFQ------GFKMNPNGCNYY 211

Query: 94  FGQD--------KSSGFVEHKFWPKGNVKGNMVVDGR---------AFDVTGVGL-FVHA 135
           F +          S   + H F P+G   G++  D R           D+  V + ++ A
Sbjct: 212 FDKPITSTEESVSSDKMIRHVFVPRGKCNGHISYDKRLNNGNFQNKTLDLADVPVVYLDA 271

Query: 136 IQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV----- 190
           +QG+ P+  AS+WNF+ FQS+  S    EF T   Y +  +   S+   NKL+ +     
Sbjct: 272 VQGLLPNKAASKWNFLCFQSENYSTLAIEFTTPQEYDNFTVTVWSITEKNKLIAIGSSVS 331

Query: 191 SVKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNE 250
           S K   +F  TS D E+ +  PT IK+   G+  E D             L+++ DVL E
Sbjct: 332 SPKRHVRFRATSTDKESGWIYPTSIKF--PGRFSERDLR-----------LVNRYDVLGE 378

Query: 251 VPYFLKKIVQAFVA-KPYVYQW 271
           +P  ++ + Q  V+ KP++YQ+
Sbjct: 379 LPSMVRSLAQKIVSIKPFIYQY 400



>gi|367006334|ref|XP_003687898.1| hypothetical protein TPHA_0L01070 [Tetrapisispora phaffii CBS 4417]
 gi|357526204|emb|CCE65464.1| hypothetical protein TPHA_0L01070 [Tetrapisispora phaffii CBS 4417]
          Length = 424

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 115/234 (49%), Gaps = 37/234 (15%)

Query: 81  IDRGFKIGGGKTYFGQDKSSGFVEHKFWPKG---------NVKGNMVVDGRAFDVTGVGL 131
           ++RG      +    Q  S+  + H F P+          ++KGN  ++    DV     
Sbjct: 215 LERGISKEESEDKSAQFSSNKMMRHLFVPRARCTGKLYYKDIKGNNEIELELDDVPTS-- 272

Query: 132 FVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVS 191
           ++ A+QG+ P+  A  WNF+ + S   S+   EF TT  Y +  +   ++  N+KLV V 
Sbjct: 273 YIDAVQGLLPNKAARAWNFLCYHSKSWSILCMEFTTTAEYNNHTVTTWAVTKNDKLVKVC 332

Query: 192 V---KNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVL 248
               K+  ++L+TS+D E  +K P+KI++  +            F E  L+ L+++ D++
Sbjct: 333 SAVDKHSVKYLKTSVDKENNWKPPSKIEFPMK------------FTECDLN-LVNRYDIM 379

Query: 249 NEVPYFLKKIVQAFV-AKPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
           NE+P  ++KI Q     KPY+YQ+  +++      ENE    KG    E +FIS
Sbjct: 380 NELPLVVRKIAQNIAHVKPYIYQYCQQSKY-----ENE----KGISIIESTFIS 424



>gi|366994772|ref|XP_003677150.1| hypothetical protein NCAS_0F03120 [Naumovozyma castellii CBS 4309]
 gi|342303018|emb|CCC70796.1| hypothetical protein NCAS_0F03120 [Naumovozyma castellii CBS 4309]
          Length = 471

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 96/185 (51%), Gaps = 19/185 (10%)

Query: 131 LFVHAIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV 190
           +FV A QGM+PH  A  WNF+ F S   S  + E+ T  +Y + K++ G L  + +++ +
Sbjct: 279 MFVMAFQGMKPHHAAKAWNFLYFHSKDYSAVLMEYTTPKSYANTKVSVGILTSDKEVLAL 338

Query: 191 SVKNMAQFLETSLDPETKYKVPTKIKYTWEG-KTLETDED-----------FSAFLEIKL 238
           +  N    L   +D    + +P  +K  ++G K+  TDE+            +A +E  L
Sbjct: 339 TTDNTVSHLNPEID-SVGWNIPKNLKVEFKGVKSTLTDEEVENNNLPDSDKVTATVEGPL 397

Query: 239 DVLMDKIDVLNEVPYFLKKIVQAFVA-KPYVYQWFNEA-EAHVKIGENEELTAKGKLFSE 296
             L+ +IDV+ EVP F+K IV      KPY+YQ+ +E    HV  G+      KG  ++E
Sbjct: 398 RNLVQRIDVMGEVPGFVKNIVSGVAGTKPYIYQYADEDFSLHVNNGKE----VKGLGWAE 453

Query: 297 CSFIS 301
            +FIS
Sbjct: 454 VTFIS 458



>gi|349577280|dbj|GAA22449.1| K7_Ydr222wp [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 415

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 121/261 (46%), Gaps = 46/261 (17%)

Query: 38  FTLSPDRRSASANNMSIKLN-PECNKYAVNLTHKELIVSFEFERIDRGFKIG--GGKTYF 94
           F  + + +  S   +SIK + P CN    NL    L+  F+      GFK+   G   YF
Sbjct: 153 FLSNKNEKLGSIGQLSIKCDLPTCNNTIQNLKIDLLVDLFQ------GFKMNPNGCNYYF 206

Query: 95  GQDKSSG--------FVEHKFWPKGNVKGNMVVD---------GRAFDVTGVGL-FVHAI 136
            +  S+          + H F P+G   GN+  D          +   +T V + ++ A+
Sbjct: 207 DKQISTSDEFVSSDKMIRHVFVPRGKCNGNISYDKKLNSGDFQNKNISLTDVPVVYLDAV 266

Query: 137 QGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV-----S 191
           QG+ P+  AS+WNF+ FQS+  S+   EF T  ++ +  +   S+   NKL+ +     S
Sbjct: 267 QGLLPNKAASKWNFLCFQSENYSVLAIEFTTPRDHDNVTVTVWSITEKNKLISIGSSVQS 326

Query: 192 VKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEV 251
            K   +F  TS D E+ +  PT IK+               F E  L  L+++ DVL E+
Sbjct: 327 PKRHVRFRATSTDKESGWVYPTSIKFP------------GGFSEHDLR-LVNRYDVLGEL 373

Query: 252 PYFLKKIVQAFVA-KPYVYQW 271
           P  ++ + Q  V+ KP++YQ+
Sbjct: 374 PSMVRSLAQKIVSIKPFIYQY 394



>gi|151942200|gb|EDN60556.1| conserved protein [Saccharomyces cerevisiae YJM789]
 gi|190404827|gb|EDV08094.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gi|207346578|gb|EDZ73036.1| YDR222Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256269997|gb|EEU05246.1| YDR222W-like protein [Saccharomyces cerevisiae JAY291]
 gi|259145458|emb|CAY78722.1| EC1118_1D0_4940p [Saccharomyces cerevisiae EC1118]
 gi|323305550|gb|EGA59292.1| YDR222W-like protein [Saccharomyces cerevisiae FostersB]
          Length = 415

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 121/261 (46%), Gaps = 46/261 (17%)

Query: 38  FTLSPDRRSASANNMSIKLN-PECNKYAVNLTHKELIVSFEFERIDRGFKIG--GGKTYF 94
           F  + + +  S   +SIK + P CN    NL    L+  F+      GFK+   G   YF
Sbjct: 153 FLSNKNEKLGSIGQLSIKCDLPTCNNTIQNLKIDLLVDLFQ------GFKMNPNGCNYYF 206

Query: 95  GQDKSSG--------FVEHKFWPKGNVKGNMVVD---------GRAFDVTGVGL-FVHAI 136
            +  S+          + H F P+G   GN+  D          +   +T V + ++ A+
Sbjct: 207 DKQISTSDEFVSSDKMIRHVFVPRGKCNGNISYDKKLNSGDFQNKNISLTDVPVVYLDAV 266

Query: 137 QGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV-----S 191
           QG+ P+  AS+WNF+ FQS+  S+   EF T  ++ +  +   S+   NKL+ +     S
Sbjct: 267 QGLLPNKAASKWNFLCFQSENYSVLAIEFTTPRDHDNVTVTVWSITEKNKLISIGSSVQS 326

Query: 192 VKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEV 251
            K   +F  TS D E+ +  PT IK+               F E  L  L+++ DVL E+
Sbjct: 327 PKRHVRFRATSTDKESGWVYPTSIKFP------------GGFSEHDLR-LVNRYDVLGEL 373

Query: 252 PYFLKKIVQAFVA-KPYVYQW 271
           P  ++ + Q  V+ KP++YQ+
Sbjct: 374 PSMVRSLAQKIVSIKPFIYQY 394



>gi|6320428|ref|NP_010508.1| hypothetical protein YDR222W [Saccharomyces cerevisiae S288c]
 gi|74676360|sp|Q04925.1|YDR22_YEAST RecName: Full=SVF1-like protein YDR222W
 gi|728678|emb|CAA88502.1| unknown [Saccharomyces cerevisiae]
 gi|45269481|gb|AAS56121.1| YDR222W [Saccharomyces cerevisiae]
 gi|285811240|tpg|DAA12064.1| TPA: hypothetical protein YDR222W [Saccharomyces cerevisiae S288c]
 gi|392300336|gb|EIW11427.1| hypothetical protein CENPK1137D_4045 [Saccharomyces cerevisiae
           CEN.PK113-7D]
          Length = 415

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 120/261 (45%), Gaps = 46/261 (17%)

Query: 38  FTLSPDRRSASANNMSIKLN-PECNKYAVNLTHKELIVSFEFERIDRGFKIG--GGKTYF 94
           F  + + +  S   +SIK + P CN    NL    L+  F+      GFK+   G   YF
Sbjct: 153 FLSNKNEKLGSIGQLSIKCDLPTCNNTIQNLKIDLLVDLFQ------GFKMNPNGCNYYF 206

Query: 95  GQD--------KSSGFVEHKFWPKGNVKGNMVVD---------GRAFDVTGVGL-FVHAI 136
            +          S   + H F P+G   GN+  D          +   +T V + ++ A+
Sbjct: 207 DKQISMSDEFVSSDKMIRHVFVPRGKCNGNISYDKKLNSGDFQNKNISLTDVPVVYLDAV 266

Query: 137 QGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV-----S 191
           QG+ P+  AS+WNF+ FQS+  S+   EF T  ++ +  +   S+   NKL+ +     S
Sbjct: 267 QGLLPNKAASKWNFLCFQSENYSVLAIEFTTPRDHDNVTVTVWSITEKNKLISIGSSVQS 326

Query: 192 VKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEV 251
            K   +F  TS D E+ +  PT IK+               F E  L  L+++ DVL E+
Sbjct: 327 PKRHVRFRATSTDKESGWVYPTSIKFP------------GGFSEHDLR-LVNRYDVLGEL 373

Query: 252 PYFLKKIVQAFVA-KPYVYQW 271
           P  ++ + Q  V+ KP++YQ+
Sbjct: 374 PSMVRSLAQKIVSIKPFIYQY 394



>gi|365985121|ref|XP_003669393.1| hypothetical protein NDAI_0C04910 [Naumovozyma dairenensis CBS 421]
 gi|343768161|emb|CCD24150.1| hypothetical protein NDAI_0C04910 [Naumovozyma dairenensis CBS 421]
          Length = 441

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 127/265 (47%), Gaps = 40/265 (15%)

Query: 65  VNLTHKELIVSFEFE-RID--RGFKIG-GGKTYFGQD------------KSSGFVEHKFW 108
           VNL H E     +   ++D  +GFK+   G +YF               KSS ++ H F 
Sbjct: 188 VNLPHGENTSDLQINLKVDLYQGFKMNPDGTSYFLDKSIHRNDQSRENVKSSRYLRHVFV 247

Query: 109 PKGNVKGNMVVDGRA------FDVTGVGL-FVHAIQGMRPHLIASRWNFVNFQSDVASLS 161
           P+G  +G +    +A      FD   V + ++ A+QGM P+  AS+WNF+ FQS   S+ 
Sbjct: 248 PRGICEGTISYKDKATNKSFDFDFEKVPVCYLDAVQGMVPNKAASKWNFMTFQSLTYSIL 307

Query: 162 MCEFETTPNYGSKKINQGSLVVNNKLVGVSVK----NMAQFLETSLDPETKYKVPTKIKY 217
           + E+ TT ++    +   ++  + +++ +  +    N+ +F  T LD ET ++ P+ IK+
Sbjct: 308 LLEYTTTRDFKYGTVTTWAISRDEEIISIGSQVNNTNIVKFKSTILDKETGWEYPSAIKF 367

Query: 218 TWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPYVYQWFNEAE 276
                 L  D D +   E     L+++ D+ +E+P  +K I   FV   PY+YQ+   ++
Sbjct: 368 NL---FLHDDADANDKFEEDNLNLVNRYDIFHELPSIVKNIASEFVHINPYLYQYCQRSK 424

Query: 277 AHVKIGENEELTAKGKLFSECSFIS 301
                  NEE    G    E +FIS
Sbjct: 425 FR-----NEE----GISIVESTFIS 440



>gi|323338172|gb|EGA79405.1| YDR222W-like protein [Saccharomyces cerevisiae Vin13]
          Length = 415

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 120/261 (45%), Gaps = 46/261 (17%)

Query: 38  FTLSPDRRSASANNMSIKLN-PECNKYAVNLTHKELIVSFEFERIDRGFKIG--GGKTYF 94
           F  + + +  S   +SIK + P CN    NL    L+  F+      GFK+   G   YF
Sbjct: 153 FLSNKNEKLGSIGQLSIKCDLPTCNNTIQNLKIDLLVDLFQ------GFKMNPNGCNYYF 206

Query: 95  GQDKSSG--------FVEHKFWPKGNVKGNMVVD---------GRAFDVTGVGL-FVHAI 136
            +  S+            H F P+G   GN+  D          +   +T V + ++ A+
Sbjct: 207 DKQISTSDEFVSSDKMXRHVFVPRGKCNGNISYDKKLNSGDFQNKNISLTDVPVVYLDAV 266

Query: 137 QGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV-----S 191
           QG+ P+  AS+WNF+ FQS+  S+   EF T  ++ +  +   S+   NKL+ +     S
Sbjct: 267 QGLLPNKAASKWNFLCFQSENYSVLAIEFTTPRDHDNVTVTVWSITEKNKLISIGSSVQS 326

Query: 192 VKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEV 251
            K   +F  TS D E+ +  PT IK+               F E  L  L+++ DVL E+
Sbjct: 327 PKRHVRFRATSTDKESGWVYPTSIKFP------------GGFSEHDLR-LVNRYDVLGEL 373

Query: 252 PYFLKKIVQAFVA-KPYVYQW 271
           P  ++ + Q  V+ KP++YQ+
Sbjct: 374 PSMVRSLAQKIVSIKPFIYQY 394



>gi|323309764|gb|EGA62970.1| YDR222W-like protein [Saccharomyces cerevisiae FostersO]
          Length = 415

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 120/261 (45%), Gaps = 46/261 (17%)

Query: 38  FTLSPDRRSASANNMSIKLN-PECNKYAVNLTHKELIVSFEFERIDRGFKIG--GGKTYF 94
           F  + + +  S   +SIK + P CN    NL    L+  F+      GFK+   G   YF
Sbjct: 153 FLSNKNEKLGSIGQLSIKCDLPTCNNTIQNLKIDLLVDLFQ------GFKMNPNGCNYYF 206

Query: 95  GQDKSSG--------FVEHKFWPKGNVKGNMVVD---------GRAFDVTGVGL-FVHAI 136
            +  S+          + H F P+G   GN+  D          +   +T V + ++ A+
Sbjct: 207 DKQISTSDEFVSSDKMIRHVFVPRGKCNGNISYDKKLNSGDFQNKNISLTDVPVVYLDAV 266

Query: 137 QGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV-----S 191
           QG+ P+   S+WNF+ FQS+  S+   EF T  ++ +  +   S+   NKL+ +     S
Sbjct: 267 QGLLPNKAVSKWNFLCFQSENYSVLAIEFTTPRDHDNVTVTVWSITEKNKLISIGSSVQS 326

Query: 192 VKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEV 251
            K   +F  TS D E+ +  PT IK+               F E  L  L+++ DVL E+
Sbjct: 327 PKRHVRFRATSTDKESGWVYPTSIKFP------------GGFSEHDLR-LVNRYDVLGEL 373

Query: 252 PYFLKKIVQAFVA-KPYVYQW 271
           P  ++ + Q  V+ KP++YQ+
Sbjct: 374 PSMVRSLAQKIVSIKPFIYQY 394



>gi|444323581|ref|XP_004182431.1| hypothetical protein TBLA_0I02550 [Tetrapisispora blattae CBS 6284]
 gi|387515478|emb|CCH62912.1| hypothetical protein TBLA_0I02550 [Tetrapisispora blattae CBS 6284]
          Length = 435

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 126/279 (45%), Gaps = 51/279 (18%)

Query: 51  NMSIKLNPECN---KYAVNLTHKELIVSFEFERIDRGFKIG-GGKTYF---------GQD 97
           ++ IKLN   N     + N   ++L ++  F  + +GF I   G TYF          +D
Sbjct: 180 HLHIKLNINSNGKNDTSTNKNARDLKINI-FVDLFKGFMINPDGCTYFIDKPTLKSSLED 238

Query: 98  K---SSGFVEHKFWPKGNVKGNMVVDGRAFDVTGVGL------FVHAIQGMRPHLIASRW 148
           K   S+ F+ H F PK   KG +    +   +  + L      ++ A+QG+ P+  ASRW
Sbjct: 239 KDTISNKFIRHMFVPKCTGKGTISYHNKDDKLVTIKLSSVPMAYIDAVQGLLPNKAASRW 298

Query: 149 NFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVK-----NMAQFLETSL 203
           NF+ FQ    SL   E+ T   YG+  I   S+   +KLV +  K     +  ++ ET  
Sbjct: 299 NFMTFQGKNHSLLCMEYVTIKEYGNDSITIWSISQKDKLVTIGAKVSNNRHRVKYTETVR 358

Query: 204 DPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV 263
           D E+ +  PT I++               F E  L  L+++ DV+ E+P F+K + + + 
Sbjct: 359 DEESGWDFPTAIRFP------------PGFKENNLH-LVNRYDVMCELPSFIKSLAEKYA 405

Query: 264 -AKPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
             KP++YQ+   +  H           KG    E SFIS
Sbjct: 406 HIKPFIYQYCQNSTYH---------RDKGISIIETSFIS 435



>gi|410079935|ref|XP_003957548.1| hypothetical protein KAFR_0E02600 [Kazachstania africana CBS 2517]
 gi|372464134|emb|CCF58413.1| hypothetical protein KAFR_0E02600 [Kazachstania africana CBS 2517]
          Length = 409

 Score = 83.2 bits (204), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 111/217 (51%), Gaps = 26/217 (11%)

Query: 97  DKS--SGFVEHKFWPKGNVKGNMVVDG----RAFDVTGVGL-FVHAIQGMRPHLIASRWN 149
           DKS   G++ H F PKG + G +  +     +  ++  + + ++ A+QG+ P   A RWN
Sbjct: 207 DKSVVKGYMRHLFVPKGKINGTIEYEKDKIKKTIELNEIPIAYLDAVQGLLPSKAAKRWN 266

Query: 150 FVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKL--VGVSVKN--MAQFLETSLDP 205
           F+ F+S   ++ + E++TTP Y ++KI   S++  +++  +G  V N  + +F +T LD 
Sbjct: 267 FMFFKSANYTILVIEYQTTPEYDNQKITMWSILHKDEIISIGSQVDNDEVVKFKQTQLDS 326

Query: 206 ETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-A 264
              ++ PT + + +     ET +     L++    L+++ D+L E+P  ++K+       
Sbjct: 327 TNGWRYPTAMSFNFRKSDTETYK-----LKLSKMNLVNRYDILGELPSIIRKLASGIANI 381

Query: 265 KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
           KP++YQ+   A           +   G   +E +FIS
Sbjct: 382 KPFLYQYCQAARF---------MEEDGICIAESTFIS 409



>gi|403414682|emb|CCM01382.1| predicted protein [Fibroporia radiculosa]
          Length = 176

 Score = 83.2 bits (204), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 58/176 (32%), Positives = 86/176 (48%), Gaps = 39/176 (22%)

Query: 164 EFETTPNYGSK-------KINQGSLVVNNKLVGVS---------------VKNMAQFLET 201
           EF TT  YG          +N GSLV+  KLV V+               V + A   +T
Sbjct: 2   EFTTTDAYGRHGAGSGFVAVNVGSLVIGGKLVAVTAETKWPDEALPETAGVISRAVHTKT 61

Query: 202 SLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDV--------LMDKIDVLNEVPY 253
           + D +T Y  PT++ + W   +L  D   +    + LDV        L++K+DVL E+PY
Sbjct: 62  TPDVDTSYNAPTELVFKWAAPSLLPDAPGTIDATLTLDVGQPNAYKGLIEKVDVLAEIPY 121

Query: 254 FLKKIVQAFVA--KPYVYQWFNEAEAHVKI------GENEELTAKGKLFSECSFIS 301
            +K +V  +VA  KPY+YQWFN    HV +       ++ E+   G L++E +FIS
Sbjct: 122 VIKTMVN-YVAGTKPYIYQWFNPVTLHVNLPSGLIPDKSGEVEIAGTLYNEATFIS 176



>gi|255715265|ref|XP_002553914.1| KLTH0E10076p [Lachancea thermotolerans]
 gi|238935296|emb|CAR23477.1| KLTH0E10076p [Lachancea thermotolerans CBS 6340]
          Length = 398

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 94/208 (45%), Gaps = 25/208 (12%)

Query: 84  GFKIG--GGKTYFGQDKSS-GFVEHKFWPKGNVKGNMVVDGR------AFDVTGVGLFVH 134
           GFK+   G   Y  + K S   + H F PK    G+   +         FD     LF+ 
Sbjct: 180 GFKVDPDGSSVYLDKHKKSRKIMRHVFVPKSTFSGSFKTEQGNSPAQCVFDAVP-SLFIE 238

Query: 135 AIQGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSV-- 192
           A+QG+ P+  ASRWNF  F S        EF TT NYG   +    L  +  +  V    
Sbjct: 239 AVQGLSPNKAASRWNFACFLSRELGFVCMEFTTTANYGKTTVTVSGLGSHEGVTAVYASS 298

Query: 193 ----KNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVL 248
               ++    L +  D ++ ++ P+ IK   EG         S  LEI    L+++ D+L
Sbjct: 299 DPDPESHVVHLTSIRDNDSNWEYPSAIKVPVEGS--------SQCLEIDSLRLVNRYDIL 350

Query: 249 NEVPYFLKKIVQAFVA-KPYVYQWFNEA 275
           +E+P  ++KIVQ+    KPY+YQ+   A
Sbjct: 351 SELPGVVRKIVQSIAGIKPYLYQYCQRA 378



>gi|254577593|ref|XP_002494783.1| ZYRO0A09570p [Zygosaccharomyces rouxii]
 gi|238937672|emb|CAR25850.1| ZYRO0A09570p [Zygosaccharomyces rouxii]
          Length = 403

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 103/214 (48%), Gaps = 34/214 (15%)

Query: 99  SSGFVEHKFWPKGNVKGNM-VVDGRAFDV-----TGVGLFVHAIQGMRPHLIASRWNFVN 152
           S   V H F P+    GN+  +D +   V        GL++ A+QG+ P+  A+RWNF+ 
Sbjct: 212 SKKMVRHLFVPRAQCCGNISYLDSKGEKVDLQLDKVPGLYIDAVQGLVPYKAANRWNFLC 271

Query: 153 FQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKL--VGVSV--KNMAQFLETSLDPETK 208
           FQS   SL   EF TT  Y    +       NN++  VG S+  KN+ QF  T+ D +T 
Sbjct: 272 FQSLTTSLLCMEFTTTEEYNRTTVTIWCSTRNNQIETVGSSINGKNI-QFEATTKDDKTG 330

Query: 209 YKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-AKPY 267
           Y+ PT+I +               F+E  L  L+++ D++ E+P  +K + +     KPY
Sbjct: 331 YEYPTQIAFPM------------GFVEQHLR-LVNRYDIMGELPSLVKSLAENIAHIKPY 377

Query: 268 VYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
           +YQ+    ++    G+      KG    E +FIS
Sbjct: 378 IYQY---CQSSTHAGQ------KGISIIESTFIS 402



>gi|366989939|ref|XP_003674737.1| hypothetical protein NCAS_0B02790 [Naumovozyma castellii CBS 4309]
 gi|342300601|emb|CCC68363.1| hypothetical protein NCAS_0B02790 [Naumovozyma castellii CBS 4309]
          Length = 416

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 105/215 (48%), Gaps = 28/215 (13%)

Query: 99  SSGFVEHKFWPKGNVKGNM-VVDGRA-----FDVTGVGL-FVHAIQGMRPHLIASRWNFV 151
           S   + H F P+G   G +  +D +      FD  GV + ++ A+QG+ P+  ASRWNF+
Sbjct: 217 SKRLLRHVFVPRGQGFGTISYIDKKTKKSYDFDFAGVPVCYLDALQGLVPNKAASRWNFM 276

Query: 152 NFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGVSVK----NMAQFLETSLDPET 207
            FQ    S+   E+ TT +Y  +K+   S+  + K+V +  +    ++ +F  T  DPE 
Sbjct: 277 TFQGPSYSVLCLEYTTTASYNHQKVTMWSISKDKKIVSIGSQLNNDSIIKFNSTIKDPEN 336

Query: 208 KYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFVA-KP 266
            +  P  I++ +      +D     + E KL  L+++ D+L E+P  +K I       +P
Sbjct: 337 GWSFPQSIEFNF------SDMPLYRWSEDKLH-LVNRYDILGELPQIVKNIASEIEGVRP 389

Query: 267 YVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
           Y+YQ+   +      GE      +G    EC+FIS
Sbjct: 390 YLYQYCQRSSFQ---GE------EGVSIVECTFIS 415



>gi|323355652|gb|EGA87471.1| YDR222W-like protein [Saccharomyces cerevisiae VL3]
          Length = 297

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 112/249 (44%), Gaps = 45/249 (18%)

Query: 38  FTLSPDRRSASANNMSIKLN-PECNKYAVNLTHKELIVSFEFERIDRGFKIG--GGKTYF 94
           F  + + +  S   +SIK + P CN    NL    L+  F+      GFK+   G   YF
Sbjct: 52  FLSNKNEKLGSIGQLSIKCDLPTCNNTIQNLKIDLLVDLFQ------GFKMNPNGCNYYF 105

Query: 95  GQDKSSG--------FVEHKFWPKGNVKGNMVVD---------GRAFDVTGVGL-FVHAI 136
            +  S+          + H F P+G   GN+  D          +   +T V + ++ A+
Sbjct: 106 DKQISTSDEFVSSDKMIRHVFVPRGKCNGNISYDKKLNSGDFQNKNISLTDVPVVYLDAV 165

Query: 137 QGMRPHLIASRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKLVGV-----S 191
           QG+ P+  AS+WNF+ FQS+  S+   EF T  ++ +  +   S+   NKL+ +     S
Sbjct: 166 QGLLPNKAASKWNFLCFQSENYSVLAIEFTTPRDHDNVTVTVWSITEKNKLISIGSSVQS 225

Query: 192 VKNMAQFLETSLDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEV 251
            K   +F  TS D E+ +  PT IK+               F E  L  L+++ DVL E+
Sbjct: 226 PKRHVRFRATSTDKESGWVYPTSIKFP------------GGFSEHDLR-LVNRYDVLGEL 272

Query: 252 PYFLKKIVQ 260
           P  ++ + Q
Sbjct: 273 PSMVRSLAQ 281



>gi|50286931|ref|XP_445895.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525201|emb|CAG58814.1| unnamed protein product [Candida glabrata]
          Length = 421

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 99/194 (51%), Gaps = 28/194 (14%)

Query: 97  DKSSGFVEHKFWPKGNVKGNMVV------DGRAFDVTGVG-----LFVHAIQGMRPHLIA 145
           ++S+  + H F PKG   G +         G+  D + +      +++ A+QG++P+  A
Sbjct: 224 EESNKMIRHVFIPKGVADGKITYKKLNSKSGKYDDFSILLTNSPIVYIDAVQGLQPNKAA 283

Query: 146 SRWNFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVNNKL--VGVSV-KNMAQFLETS 202
           SRWNF+ FQS+  S+   EF TT  +G+K +   S   + KL  +G S+ K+  +F +T 
Sbjct: 284 SRWNFLCFQSEHHSVLCMEFTTTSEHGNKTMTIWSTSEDGKLKTIGSSLDKHKVKFNKTH 343

Query: 203 LDPETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAF 262
            D E  +  PT I++             + F E  L  L+++ DVL E+P  +K + Q  
Sbjct: 344 KDKENGWDYPTSIQFP------------ADFHEDHLR-LINRYDVLGELPGVVKSVAQNI 390

Query: 263 V-AKPYVYQWFNEA 275
              KPY+YQ+  E+
Sbjct: 391 AHIKPYIYQYCQES 404



>gi|156846224|ref|XP_001646000.1| hypothetical protein Kpol_1031p48 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116671|gb|EDO18142.1| hypothetical protein Kpol_1031p48 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 417

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 101/217 (46%), Gaps = 33/217 (15%)

Query: 96  QDKSSGFVEHKFWPKGNVKGNM-VVDGRAFDVTGVGL------FVHAIQGMRPHLIASRW 148
           QD SS  + H F P+G   G +   D +  +   + L      ++ A+QG+ P+  A  W
Sbjct: 223 QDISSKMLRHLFIPRGRCSGTISYTDSKGENDIKLTLSDVPISYIDAVQGLLPNKAAKSW 282

Query: 149 NFVNFQSDVASLSMCEFETTPNYGSKKINQGSLVVN---NKLVGVSVKNMAQFLETSLDP 205
           NF+ +QS+  S+   E+ TT  YG+  +   S+       KL+    K    + +T  D 
Sbjct: 283 NFLCYQSENYSILCMEYTTTEEYGNDTVTIYSITNKEKITKLISCVNKCKVVYDKTIEDK 342

Query: 206 ETKYKVPTKIKYTWEGKTLETDEDFSAFLEIKLDVLMDKIDVLNEVPYFLKKIVQAFV-A 264
           +  +  PT I +  +            F E +L+ L+++ D++ E+P  +KKI Q     
Sbjct: 343 DNGWSYPTSIAFPMD------------FSEPELN-LVNRYDIMEELPLIVKKIAQNIANV 389

Query: 265 KPYVYQWFNEAEAHVKIGENEELTAKGKLFSECSFIS 301
           KPY+YQ+  ++       ENEE    G    E +FIS
Sbjct: 390 KPYIYQYCQKSSF-----ENEE----GISIIESTFIS 417