BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10348_c0_seq1-m.136 5prime_partial 2-361(+) 120 (+)
         (119 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384500348|gb|EIE90839.1| hypothetical protein RO3G_15550 [Rhi...    82   3e-14   Rhizopus delemar RA 99-880
gi|511008467|gb|EPB89732.1| hypothetical protein HMPREF1544_0339...    77   2e-12   Mucor circinelloides f. circinelloides 1006PhL
gi|398412017|ref|XP_003857340.1| hypothetical protein MYCGRDRAFT...    76   3e-12   Zymoseptoria tritici IPO323
gi|452988259|gb|EME88014.1| hypothetical protein MYCFIDRAFT_1251...    75   7e-12   Cercospora fijiensis CIRAD86


>gi|384500348|gb|EIE90839.1| hypothetical protein RO3G_15550 [Rhizopus delemar RA 99-880]
          Length = 107

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (63%)

Query: 22  LLSYTSNYSTASNLKSQQQIQRTPSSVPAGTILKGLNFYKDGADPIALPDDEYPNWLWEI 81
           +L  TS   T   L +     R  SS P GT LKG+ F KDG DP+AL D EYP+WLW++
Sbjct: 10  VLICTSRLHTTRILFNTAVNARIASSAPKGTTLKGIQFLKDGKDPVALDDSEYPDWLWDL 69

Query: 82  LDKEKDEQLRSNEHSRYHHKEKRKQLIKNNNFDRNKR 118
           LD++K +Q  +   +R +H+++ ++ IK +NF ++K+
Sbjct: 70  LDEKKLKQKSTKPSNRQYHRKQNREAIKASNFMKDKK 106



>gi|511008467|gb|EPB89732.1| hypothetical protein HMPREF1544_03395 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 124

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 55/77 (71%)

Query: 42  QRTPSSVPAGTILKGLNFYKDGADPIALPDDEYPNWLWEILDKEKDEQLRSNEHSRYHHK 101
           QR PSS P GT+LKG+ + KD  DP+AL D EYP WLW++LD++K +Q  +   +R +H+
Sbjct: 47  QRKPSSAPKGTVLKGIQYLKDKQDPVALDDSEYPEWLWDLLDEKKQKQKTTKPVNRQYHR 106

Query: 102 EKRKQLIKNNNFDRNKR 118
           ++ ++ IK  NF ++K+
Sbjct: 107 KQSREAIKAMNFMKDKK 123



>gi|398412017|ref|XP_003857340.1| hypothetical protein MYCGRDRAFT_66222 [Zymoseptoria tritici IPO323]
 gi|339477225|gb|EGP92316.1| hypothetical protein MYCGRDRAFT_66222 [Zymoseptoria tritici IPO323]
          Length = 222

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 56/101 (55%), Gaps = 13/101 (12%)

Query: 20  PFLLSYTSNYSTASNLKSQQQIQRTPSSVPAGTILKGLNFYKDGADPIALPDDEYPNWLW 79
           PF    T N   A   +S + + R  SSVPAGT+LKGLNF K+  DP+A+ D EYP+WLW
Sbjct: 63  PFSTPLTPN-PRAGKSESAKPVTRIQSSVPAGTVLKGLNFMKNKQDPVAMEDHEYPSWLW 121

Query: 80  EILDKEKDEQ------------LRSNEHSRYHHKEKRKQLI 108
           E+L ++KD               +S +  R   K  RKQ++
Sbjct: 122 EVLAEQKDSSSSKGADAEGDLFSKSKKQRRIAAKALRKQMM 162



>gi|452988259|gb|EME88014.1| hypothetical protein MYCFIDRAFT_125120 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 220

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 41/57 (71%)

Query: 31  TASNLKSQQQIQRTPSSVPAGTILKGLNFYKDGADPIALPDDEYPNWLWEILDKEKD 87
           +A+  K  +Q  R  SSVPAGT+LKGLNF K+  DPIAL DDEYP WLW  L+K+ D
Sbjct: 70  SATKPKKSKQPARIASSVPAGTVLKGLNFMKNKQDPIALEDDEYPAWLWTALEKKAD 126