BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10358_c0_seq1-m.138 5prime_partial 177-1322(-) 382 (-)
         (381 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384491435|gb|EIE82631.1| hypothetical protein RO3G_07336 [Rhi...    96   2e-17   Rhizopus delemar RA 99-880
gi|378729244|gb|EHY55703.1| hypothetical protein HMPREF1120_0382...    94   9e-17   Exophiala dermatitidis NIH/UT8656
gi|336464506|gb|EGO52746.1| hypothetical protein NEUTE1DRAFT_913...    91   5e-16   Neurospora tetrasperma FGSC 2508
gi|511004969|gb|EPB86323.1| hypothetical protein HMPREF1544_0686...    91   6e-16   Mucor circinelloides f. circinelloides 1006PhL
gi|367043674|ref|XP_003652217.1| hypothetical protein THITE_2143...    89   3e-15   Thielavia terrestris NRRL 8126
gi|482804860|gb|EOA81959.1| hypothetical protein SETTUDRAFT_1568...    88   5e-15   Setosphaeria turcica Et28A
gi|169607505|ref|XP_001797172.1| hypothetical protein SNOG_06810...    88   5e-15   Parastagonospora nodorum SN15
gi|407926277|gb|EKG19245.1| hypothetical protein MPH_03506 [Macr...    87   5e-15   Macrophomina phaseolina MS6
gi|212542655|ref|XP_002151482.1| HLH transcription factor, putat...    87   1e-14   Talaromyces marneffei ATCC 18224
gi|511010473|gb|EPB91694.1| hypothetical protein HMPREF1544_0140...    87   1e-14   Mucor circinelloides f. circinelloides 1006PhL
gi|322696901|gb|EFY88687.1| HLH transcription factor, putative [...    86   1e-14   Metarhizium acridum CQMa 102
gi|121701659|ref|XP_001269094.1| HLH transcription factor, putat...    86   1e-14   Aspergillus clavatus NRRL 1
gi|171687825|ref|XP_001908853.1| hypothetical protein [Podospora...    86   2e-14   Podospora anserina S mat+
gi|453089137|gb|EMF17177.1| hypothetical protein SEPMUDRAFT_1299...    86   2e-14   Sphaerulina musiva SO2202
gi|449304939|gb|EMD00946.1| hypothetical protein BAUCODRAFT_1901...    85   4e-14   Baudoinia panamericana UAMH 10762
gi|451848401|gb|EMD61707.1| hypothetical protein COCSADRAFT_1631...    84   5e-14   Bipolaris sorokiniana ND90Pr
gi|400601421|gb|EJP69064.1| helix-loop-helix DNA-binding domain-...    84   5e-14   Beauveria bassiana ARSEF 2860
gi|367020172|ref|XP_003659371.1| hypothetical protein MYCTH_2136...    84   5e-14   Myceliophthora thermophila ATCC 42464
gi|115491663|ref|XP_001210459.1| hypothetical protein ATEG_00373...    84   6e-14   Aspergillus terreus NIH2624
gi|70995582|ref|XP_752546.1| HLH transcription factor [Aspergill...    84   7e-14   Aspergillus fumigatus Af293
gi|159131301|gb|EDP56414.1| HLH transcription factor, putative [...    84   7e-14   Aspergillus fumigatus A1163
gi|451998960|gb|EMD91423.1| hypothetical protein COCHEDRAFT_1224...    84   8e-14   Bipolaris maydis C5
gi|336267086|ref|XP_003348309.1| hypothetical protein SMAC_02806...    84   8e-14   Sordaria macrospora k-hell
gi|119495602|ref|XP_001264582.1| HLH transcription factor, putat...    84   8e-14   Aspergillus fischeri NRRL 181
gi|477507442|gb|ENH60736.1| Sterol regulatory element-binding pr...    83   1e-13   Fusarium oxysporum f. sp. cubense race 1
gi|340513911|gb|EGR44186.1| predicted protein [Trichoderma reese...    83   1e-13   Trichoderma reesei QM6a
gi|342879590|gb|EGU80835.1| hypothetical protein FOXB_08702 [Fus...    83   1e-13   Fusarium oxysporum Fo5176
gi|475664442|gb|EMT62237.1| Sterol regulatory element-binding pr...    83   1e-13   Fusarium oxysporum f. sp. cubense race 4
gi|303320363|ref|XP_003070181.1| bHLH family transcription facto...    83   1e-13   Coccidioides posadasii C735 delta SOWgp
gi|119184389|ref|XP_001243114.1| hypothetical protein CIMG_07010...    83   1e-13   Coccidioides immitis RS
gi|402077970|gb|EJT73319.1| hypothetical protein GGTG_10163 [Gae...    83   2e-13   Gaeumannomyces graminis var. tritici R3-111a-1
gi|398410467|ref|XP_003856584.1| hypothetical protein MYCGRDRAFT...    82   2e-13   Zymoseptoria tritici IPO323
gi|330934414|ref|XP_003304538.1| hypothetical protein PTT_17167 ...    82   2e-13   Pyrenophora teres f. teres 0-1
gi|452847585|gb|EME49517.1| hypothetical protein DOTSEDRAFT_6832...    82   2e-13   Dothistroma septosporum NZE10
gi|145239741|ref|XP_001392517.1| possible bhlh transcription fac...    82   2e-13   Aspergillus niger CBS 513.88
gi|258568836|ref|XP_002585162.1| predicted protein [Uncinocarpus...    82   3e-13   Uncinocarpus reesii 1704
gi|494824028|gb|EON61347.1| hypothetical protein W97_00561 [Coni...    82   3e-13   Coniosporium apollinis CBS 100218
gi|358371788|dbj|GAA88394.1| HLH transcription factor [Aspergill...    82   3e-13   Aspergillus kawachii IFO 4308
gi|116180386|ref|XP_001220042.1| hypothetical protein CHGG_00821...    82   3e-13   Chaetomium globosum CBS 148.51
gi|226291293|gb|EEH46721.1| conserved hypothetical protein [Para...    82   4e-13   Paracoccidioides brasiliensis Pb18
gi|452989205|gb|EME88960.1| hypothetical protein MYCFIDRAFT_2099...    82   4e-13   Cercospora fijiensis CIRAD86
gi|317142251|ref|XP_001818912.2| hypothetical protein AOR_1_6721...    82   4e-13   Aspergillus oryzae RIB40
gi|346320879|gb|EGX90479.1| HLH transcription factor, putative [...    82   4e-13   Cordyceps militaris CM01
gi|440639440|gb|ELR09359.1| hypothetical protein GMDG_03925 [Geo...    81   4e-13   Pseudogymnoascus destructans 20631-21
gi|261203441|ref|XP_002628934.1| HLH transcription factor [Ajell...    81   4e-13   Blastomyces gilchristii SLH14081
gi|327349438|gb|EGE78295.1| HLH transcription factor [Ajellomyce...    81   4e-13   Blastomyces dermatitidis ATCC 18188
gi|512189823|gb|EPE05589.1| helix-loop-helix dna-binding domain-...    81   4e-13   Ophiostoma piceae UAMH 11346
gi|46108514|ref|XP_381315.1| hypothetical protein FG01139.1 [Fus...    81   5e-13   
gi|358388932|gb|EHK26525.1| hypothetical protein TRIVIDRAFT_1426...    81   5e-13   Trichoderma virens Gv29-8
gi|242769172|ref|XP_002341715.1| HLH transcription factor, putat...    81   5e-13   Talaromyces stipitatus ATCC 10500
gi|238498230|ref|XP_002380350.1| HLH transcription factor, putat...    81   5e-13   Aspergillus flavus NRRL3357
gi|156062882|ref|XP_001597363.1| hypothetical protein SS1G_01557...    81   5e-13   Sclerotinia sclerotiorum 1980 UF-70
gi|380480201|emb|CCF42572.1| helix-loop-helix DNA-binding domain...    81   6e-13   Colletotrichum higginsianum
gi|302922398|ref|XP_003053457.1| predicted protein [Nectria haem...    81   6e-13   Nectria haematococca mpVI 77-13-4
gi|408399693|gb|EKJ78787.1| hypothetical protein FPSE_01025 [Fus...    81   6e-13   Fusarium pseudograminearum CS3096
gi|358395957|gb|EHK45344.1| hypothetical protein TRIATDRAFT_1988...    81   7e-13   Trichoderma atroviride IMI 206040
gi|389642593|ref|XP_003718929.1| hypothetical protein MGG_00190 ...    80   7e-13   Magnaporthe oryzae 70-15
gi|295659717|ref|XP_002790416.1| conserved hypothetical protein ...    80   7e-13   Paracoccidioides lutzii Pb01
gi|384495856|gb|EIE86347.1| hypothetical protein RO3G_11058 [Rhi...    80   8e-13   Rhizopus delemar RA 99-880
gi|310793365|gb|EFQ28826.1| helix-loop-helix DNA-binding domain-...    80   8e-13   Colletotrichum graminicola M1.001
gi|328767300|gb|EGF77350.1| hypothetical protein BATDEDRAFT_9169...    80   1e-12   Batrachochytrium dendrobatidis JAM81
gi|328767408|gb|EGF77458.1| hypothetical protein BATDEDRAFT_2766...    80   1e-12   Batrachochytrium dendrobatidis JAM81
gi|320589151|gb|EFX01613.1| hlh transcription factor [Grosmannia...    80   1e-12   Grosmannia clavigera kw1407
gi|255937003|ref|XP_002559528.1| Pc13g11100 [Penicillium chrysog...    80   1e-12   Penicillium rubens Wisconsin 54-1255
gi|396462450|ref|XP_003835836.1| hypothetical protein LEMA_P0517...    79   2e-12   Leptosphaeria maculans JN3
gi|477525094|gb|ENH77009.1| helix-loop-helix dna-binding domain-...    79   2e-12   Colletotrichum orbiculare MAFF 240422
gi|406862693|gb|EKD15742.1| helix-loop-helix DNA-binding domain-...    79   2e-12   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|425767227|gb|EKV05801.1| putative bhlh transcription factor [...    79   2e-12   Penicillium digitatum PHI26
gi|512207852|gb|EPE36669.1| HLH, helix-loop-helix DNA-binding pr...    79   2e-12   Glarea lozoyensis ATCC 20868
gi|346978325|gb|EGY21777.1| hypothetical protein VDAG_03217 [Ver...    79   3e-12   Verticillium dahliae VdLs.17
gi|471559522|gb|EMR61872.1| putative helix-loop-helix dna-bindin...    77   6e-12   Eutypa lata UCREL1
gi|296422172|ref|XP_002840636.1| hypothetical protein [Tuber mel...    77   8e-12   Tuber melanosporum Mel28
gi|296816431|ref|XP_002848552.1| extensin [Arthroderma otae CBS ...    77   1e-11   Arthroderma otae CBS 113480
gi|154299982|ref|XP_001550408.1| hypothetical protein BC1G_11180...    77   1e-11   Botrytis cinerea B05.10
gi|328773465|gb|EGF83502.1| hypothetical protein BATDEDRAFT_2225...    76   2e-11   Batrachochytrium dendrobatidis JAM81
gi|302663223|ref|XP_003023256.1| HLH transcription factor, putat...    75   2e-11   Trichophyton verrucosum HKI 0517
gi|302496170|ref|XP_003010088.1| HLH transcription factor, putat...    75   2e-11   Arthroderma benhamiae CBS 112371
gi|315050073|ref|XP_003174411.1| hypothetical protein MGYG_04584...    75   3e-11   Microsporum gypseum CBS 118893
gi|67517875|ref|XP_658718.1| hypothetical protein AN1114.2 [Aspe...    75   3e-11   Aspergillus nidulans FGSC A4
gi|326484569|gb|EGE08579.1| HLH transcription factor [Trichophyt...    75   3e-11   Trichophyton equinum CBS 127.97
gi|328774270|gb|EGF84307.1| hypothetical protein BATDEDRAFT_2223...    75   3e-11   Batrachochytrium dendrobatidis JAM81
gi|327294010|ref|XP_003231701.1| hypothetical protein TERG_08000...    75   3e-11   Trichophyton rubrum CBS 118892


>gi|384491435|gb|EIE82631.1| hypothetical protein RO3G_07336 [Rhizopus delemar RA 99-880]
          Length = 162

 Score = 95.9 bits (237), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 58/64 (90%)

Query: 165 ADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYLQ 224
           AD++E ARK+SHSAIE+RRRER+NDKI Q+K LIPSCA+Q++LHK++ILQ+AI+YI YL+
Sbjct: 34  ADKKEKARKISHSAIEKRRRERMNDKISQIKRLIPSCAEQENLHKMTILQNAIDYISYLK 93

Query: 225 GCVA 228
             V+
Sbjct: 94  QIVS 97



>gi|378729244|gb|EHY55703.1| hypothetical protein HMPREF1120_03828 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 575

 Score = 93.6 bits (231), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 52/124 (41%), Positives = 75/124 (60%), Gaps = 15/124 (12%)

Query: 148 SLGGAATGANGDKQ--LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQD 205
           S G AA    G KQ   T+A  R++ARK +HS IERRRR ++N++   LK++IP+C +  
Sbjct: 177 SSGAAANSKKGGKQPSATSAAGRKIARKTAHSIIERRRRSKMNEEFGVLKDMIPAC-EGV 235

Query: 206 HLHKLSILQSAIEYIQYLQGCVAESRKREGNNNSEERFTKRSKFDRYEIPIPKHLKDDNT 265
            +HKL+ILQ+ IEY++YL+GCVA+  K E  N S           R E+  P+H +    
Sbjct: 236 EMHKLAILQAGIEYVRYLEGCVAQ-LKAENENKS-----------RLELAPPRHQQQQQI 283

Query: 266 DKSE 269
           D +E
Sbjct: 284 DMAE 287



>gi|336464506|gb|EGO52746.1| hypothetical protein NEUTE1DRAFT_91395 [Neurospora tetrasperma FGSC
           2508]
          Length = 420

 Score = 91.3 bits (225), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 66/95 (69%), Gaps = 2/95 (2%)

Query: 147 VSLGGAATGANGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDH 206
           VS    AT     K+ +TA  R++ARK +HS IERRRR ++N++   LK +IP+C  +  
Sbjct: 129 VSTTPPATTGGATKKQSTAAGRKIARKTAHSLIERRRRSKMNEEFALLKSMIPACTGE-- 186

Query: 207 LHKLSILQSAIEYIQYLQGCVAESRKREGNNNSEE 241
           +HKL+ILQ++IEYI+YL+ CVA+ + R  ++ SEE
Sbjct: 187 MHKLAILQASIEYIRYLEDCVAKLQARHQSSPSEE 221



>gi|511004969|gb|EPB86323.1| hypothetical protein HMPREF1544_06862 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 393

 Score = 90.9 bits (224), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 62/72 (86%)

Query: 166 DQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYLQG 225
           DQRE ARKVSHSAIERRRRERINDKILQLK+LIPSC +QD+LHK+SILQSAI+YI YL+ 
Sbjct: 191 DQREKARKVSHSAIERRRRERINDKILQLKQLIPSCVEQDNLHKMSILQSAIDYISYLKE 250

Query: 226 CVAESRKREGNN 237
            V +  ++ G +
Sbjct: 251 IVKKLDEKSGGD 262



>gi|367043674|ref|XP_003652217.1| hypothetical protein THITE_2143564 [Thielavia terrestris NRRL 8126]
 gi|346999479|gb|AEO65881.1| hypothetical protein THITE_2143564 [Thielavia terrestris NRRL 8126]
          Length = 369

 Score = 88.6 bits (218), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 73/115 (63%), Gaps = 6/115 (5%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK LIP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 133 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKSLIPACTGE--MHKLAILQASIEYVRY 190

Query: 223 LQGCVAESRKREGNNNSEERFTKRSKFDRYEIPIPKHLKDDNTDKSEYKRKNNSG 277
           L+ C+A+ + + G++   +  TKR+      +P P  L D       Y   N+SG
Sbjct: 191 LEDCIAKLKAQCGSDAKADAETKRAPSG---LPSPA-LGDGYNASRSYPSTNHSG 241



>gi|482804860|gb|EOA81959.1| hypothetical protein SETTUDRAFT_156846 [Setosphaeria turcica Et28A]
          Length = 423

 Score = 87.8 bits (216), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 93/171 (54%), Gaps = 15/171 (8%)

Query: 98  GRYEQRILPKQQGSST-SVFSVPMTPSNASSVMQHH-NSVIHPHPPYQQQRVSLGGAATG 155
           G   +R    QQG  T   +S+P  P+ +  ++Q        P  P  Q   +    AT 
Sbjct: 74  GHSRKRSATVQQGVVTKDDYSLPPPPTRSRKIIQMKPKDAQDPPKPSSQTHNAKATPATA 133

Query: 156 ANGDKQ---LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSI 212
             G K+    TTA  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+I
Sbjct: 134 VGGKKKQAGSTTAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACRGQE-MHKLAI 192

Query: 213 LQSAIEYIQYLQGCVAESRKREGNNNSEERFTKRSKFDRYEIPIP--KHLK 261
           LQ++IEY++YL+ CVA+ +      +S    T        E+P P  +H++
Sbjct: 193 LQASIEYMRYLEQCVADLKAANSRRDSPSSTTS-------ELPPPPTRHMR 236



>gi|169607505|ref|XP_001797172.1| hypothetical protein SNOG_06810 [Phaeosphaeria nodorum SN15]
 gi|160701427|gb|EAT85461.2| hypothetical protein SNOG_06810 [Phaeosphaeria nodorum SN15]
          Length = 335

 Score = 87.8 bits (216), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/128 (37%), Positives = 79/128 (61%), Gaps = 7/128 (5%)

Query: 108 QQGSSTSV--FSVPMTPSNASSVMQHHNSVIHPHPPYQQQRVSLGGAATGANGDKQL--- 162
           QQGS  +   +S+P  P+ +  ++Q       P  P Q Q       A+  +G K+    
Sbjct: 86  QQGSVVTKDDYSLPPPPTRSRKIIQMKPKDQEPAKPAQSQNTKSQAPASTTSGTKRKQAS 145

Query: 163 -TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQ 221
            T A  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++IEY++
Sbjct: 146 NTNAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACRGQE-MHKLAILQASIEYMR 204

Query: 222 YLQGCVAE 229
           YL+ C+++
Sbjct: 205 YLEQCISD 212



>gi|407926277|gb|EKG19245.1| hypothetical protein MPH_03506 [Macrophomina phaseolina MS6]
          Length = 431

 Score = 87.4 bits (215), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 60/79 (75%), Gaps = 1/79 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           +TA  R++ARK +HS IERRRR ++N++   LK++IP+CA Q+ +HKL+ILQ++IEY++Y
Sbjct: 156 STAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACAGQE-MHKLAILQASIEYMRY 214

Query: 223 LQGCVAESRKREGNNNSEE 241
           L+ CVAE +      NS E
Sbjct: 215 LERCVAELKAANRAKNSPE 233



>gi|212542655|ref|XP_002151482.1| HLH transcription factor, putative [Talaromyces marneffei ATCC
           18224]
 gi|210066389|gb|EEA20482.1| HLH transcription factor, putative [Talaromyces marneffei ATCC
           18224]
          Length = 861

 Score = 86.7 bits (213), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 4/88 (4%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++I+Y+ Y
Sbjct: 554 TSAAGRKIARKTAHSLIERRRRSKMNEEFATLKDMIPACRGQE-MHKLAILQASIDYMNY 612

Query: 223 LQGCVAESRKREGNNNSEERFTKRSKFD 250
           L+ C+ E +   G  NS    +K+ K D
Sbjct: 613 LEECITELKNNAGRTNS---VSKKPKLD 637



>gi|511010473|gb|EPB91694.1| hypothetical protein HMPREF1544_01405 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 367

 Score = 86.7 bits (213), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 61/66 (92%)

Query: 165 ADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYLQ 224
           ADQRE ARKVSHSAIERRRRERINDKILQLK+LIPSC+++++LHK++ILQSAI+YI YL+
Sbjct: 133 ADQREQARKVSHSAIERRRRERINDKILQLKDLIPSCSERENLHKMTILQSAIDYITYLK 192

Query: 225 GCVAES 230
             + +S
Sbjct: 193 KVIEDS 198



>gi|322696901|gb|EFY88687.1| HLH transcription factor, putative [Metarhizium acridum CQMa 102]
          Length = 396

 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 65/92 (70%), Gaps = 5/92 (5%)

Query: 153 ATGANGDKQ---LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHK 209
           A GA G K+    T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HK
Sbjct: 157 AGGAQGKKRQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKSMIPACTGE--MHK 214

Query: 210 LSILQSAIEYIQYLQGCVAESRKREGNNNSEE 241
           L+ILQ++I+Y++YL+ CVA+ + + G  + E+
Sbjct: 215 LAILQASIDYVRYLEDCVAKLKAQHGEKSREQ 246



>gi|121701659|ref|XP_001269094.1| HLH transcription factor, putative [Aspergillus clavatus NRRL 1]
 gi|119397237|gb|EAW07668.1| HLH transcription factor, putative [Aspergillus clavatus NRRL 1]
          Length = 394

 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 59/79 (74%), Gaps = 4/79 (5%)

Query: 152 AATGANGDKQ---LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLH 208
           AAT AN  K+    T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  QD +H
Sbjct: 130 AATPANSKKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFATLKDMIPACQGQD-MH 188

Query: 209 KLSILQSAIEYIQYLQGCV 227
           KL+ILQ++IEY+ YL+ C+
Sbjct: 189 KLAILQASIEYVNYLERCI 207



>gi|171687825|ref|XP_001908853.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943874|emb|CAP69526.1| unnamed protein product [Podospora anserina S mat+]
          Length = 333

 Score = 85.9 bits (211), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 58/78 (74%), Gaps = 2/78 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK LIP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 152 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKSLIPACTGE--MHKLAILQASIEYVRY 209

Query: 223 LQGCVAESRKREGNNNSE 240
           L+ CV++ + +  N  SE
Sbjct: 210 LEDCVSQLKAQRSNTTSE 227



>gi|453089137|gb|EMF17177.1| hypothetical protein SEPMUDRAFT_129980 [Mycosphaerella populorum
           SO2202]
          Length = 416

 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/67 (56%), Positives = 55/67 (82%), Gaps = 1/67 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           TTA  R++ARK +HS IERRRR ++N++   LKE+IP+C  Q+ +HKL+ILQ++IEY++Y
Sbjct: 144 TTAAGRKIARKTAHSLIERRRRSKMNEEFGVLKEMIPACQGQE-MHKLAILQASIEYLRY 202

Query: 223 LQGCVAE 229
           L+ CVAE
Sbjct: 203 LEQCVAE 209



>gi|449304939|gb|EMD00946.1| hypothetical protein BAUCODRAFT_190174 [Baudoinia compniacensis
           UAMH 10762]
          Length = 423

 Score = 84.7 bits (208), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 60/80 (75%), Gaps = 7/80 (8%)

Query: 156 ANGDKQL------TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHK 209
           ANG K+       TTA  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HK
Sbjct: 132 ANGGKRKSSGNTGTTAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACKGQE-MHK 190

Query: 210 LSILQSAIEYIQYLQGCVAE 229
           L+ILQ++IEY++YL+ CVA+
Sbjct: 191 LAILQASIEYLRYLEQCVAD 210



>gi|451848401|gb|EMD61707.1| hypothetical protein COCSADRAFT_163131 [Bipolaris sorokiniana
           ND90Pr]
          Length = 424

 Score = 84.3 bits (207), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 74/118 (62%), Gaps = 5/118 (4%)

Query: 116 FSVPMTPSNASSVMQHHNSVIHPHPPYQQQRVSLGGAATGANGDKQL----TTADQRELA 171
           +S+P  P+ +  ++Q         P    Q  +    +  ANG K+     TTA  R++A
Sbjct: 94  YSLPPPPTRSRKIIQMKPKDTQESPKASVQSQNAKTTSATANGGKKKQASNTTAAGRKIA 153

Query: 172 RKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYLQGCVAE 229
           RK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++IEY++YL+ CV++
Sbjct: 154 RKTAHSLIERRRRSKMNEEFGVLKDMIPACRGQE-MHKLAILQASIEYMRYLEQCVSD 210



>gi|400601421|gb|EJP69064.1| helix-loop-helix DNA-binding domain-containing protein [Beauveria
           bassiana ARSEF 2860]
          Length = 438

 Score = 84.3 bits (207), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 65/87 (74%), Gaps = 6/87 (6%)

Query: 147 VSLGGAATG--ANGDKQ--LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCA 202
           V+  G+A+G  ++G KQ   T+A  R++ARK +HS IERRRR ++N++   LK++IP+C 
Sbjct: 169 VAAAGSASGKTSSGKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACT 228

Query: 203 DQDHLHKLSILQSAIEYIQYLQGCVAE 229
               +HKL+ILQ++IEYI+YL+ CV++
Sbjct: 229 GD--MHKLAILQASIEYIRYLEDCVSQ 253



>gi|367020172|ref|XP_003659371.1| hypothetical protein MYCTH_2136960 [Myceliophthora thermophila ATCC
           42464]
 gi|347006638|gb|AEO54126.1| hypothetical protein MYCTH_2136960 [Myceliophthora thermophila ATCC
           42464]
          Length = 403

 Score = 84.3 bits (207), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 57/76 (75%), Gaps = 2/76 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK LIP+C  +  +HKL+ILQ+AIEY++Y
Sbjct: 135 TSAAGRKMARKTAHSIIERRRRSKMNEEFAVLKSLIPACTGE--MHKLAILQAAIEYVRY 192

Query: 223 LQGCVAESRKREGNNN 238
           L+ CVA+ + + G+  
Sbjct: 193 LEDCVAKLKAQCGSGT 208



>gi|115491663|ref|XP_001210459.1| hypothetical protein ATEG_00373 [Aspergillus terreus NIH2624]
 gi|114197319|gb|EAU39019.1| hypothetical protein ATEG_00373 [Aspergillus terreus NIH2624]
          Length = 384

 Score = 84.3 bits (207), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 63/91 (69%), Gaps = 4/91 (4%)

Query: 148 SLGGAATGANGDKQ--LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQD 205
           S   A+  A+  KQ   T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  QD
Sbjct: 130 SANNASPAASKKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFATLKDMIPACRGQD 189

Query: 206 HLHKLSILQSAIEYIQYLQGCVAESRKREGN 236
            +HKL+ILQ++IEY+ YL+ C+ +  K  GN
Sbjct: 190 -MHKLAILQASIEYVNYLEKCI-QDLKTAGN 218



>gi|70995582|ref|XP_752546.1| HLH transcription factor [Aspergillus fumigatus Af293]
 gi|41581255|emb|CAE47904.1| possible bhlh transcription factor [Aspergillus fumigatus]
 gi|66850181|gb|EAL90508.1| HLH transcription factor, putative [Aspergillus fumigatus Af293]
          Length = 399

 Score = 84.0 bits (206), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 52/65 (80%), Gaps = 1/65 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  QD +HKLSILQ++IEY+ Y
Sbjct: 151 TSAAGRKIARKTAHSLIERRRRSKMNEEFATLKDMIPACRGQD-MHKLSILQASIEYVNY 209

Query: 223 LQGCV 227
           L+ C+
Sbjct: 210 LEKCI 214



>gi|159131301|gb|EDP56414.1| HLH transcription factor, putative [Aspergillus fumigatus A1163]
          Length = 399

 Score = 84.0 bits (206), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 52/65 (80%), Gaps = 1/65 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  QD +HKLSILQ++IEY+ Y
Sbjct: 151 TSAAGRKIARKTAHSLIERRRRSKMNEEFATLKDMIPACRGQD-MHKLSILQASIEYVNY 209

Query: 223 LQGCV 227
           L+ C+
Sbjct: 210 LEKCI 214



>gi|451998960|gb|EMD91423.1| hypothetical protein COCHEDRAFT_1224580 [Bipolaris maydis C5]
 gi|477591748|gb|ENI08820.1| hypothetical protein COCC4DRAFT_128615 [Bipolaris maydis ATCC
           48331]
          Length = 424

 Score = 84.0 bits (206), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 60/78 (76%), Gaps = 5/78 (6%)

Query: 156 ANGDKQL----TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLS 211
           ANG K+     TTA  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+
Sbjct: 134 ANGAKKKQASNTTAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACRGQE-MHKLA 192

Query: 212 ILQSAIEYIQYLQGCVAE 229
           ILQ++IEY++YL+ CV++
Sbjct: 193 ILQASIEYMRYLEQCVSD 210



>gi|336267086|ref|XP_003348309.1| hypothetical protein SMAC_02806 [Sordaria macrospora k-hell]
 gi|380091963|emb|CCC10229.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 408

 Score = 83.6 bits (205), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 59/83 (71%), Gaps = 2/83 (2%)

Query: 158 GDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAI 217
           G K+  +A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+ILQ++I
Sbjct: 139 GAKKKQSAAGRKVARKTAHSLIERRRRSKMNEEFALLKSMIPACTGE--MHKLAILQASI 196

Query: 218 EYIQYLQGCVAESRKREGNNNSE 240
           EYI+YL+ CVA  + R  +  SE
Sbjct: 197 EYIKYLEDCVARLQARHQSVPSE 219



>gi|119495602|ref|XP_001264582.1| HLH transcription factor, putative [Neosartorya fischeri NRRL 181]
 gi|119412744|gb|EAW22685.1| HLH transcription factor, putative [Neosartorya fischeri NRRL 181]
          Length = 399

 Score = 83.6 bits (205), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 52/65 (80%), Gaps = 1/65 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  QD +HKL+ILQ++IEY+ Y
Sbjct: 151 TSAAGRKIARKTAHSLIERRRRSKMNEEFATLKDMIPACRGQD-MHKLAILQASIEYVNY 209

Query: 223 LQGCV 227
           L+ CV
Sbjct: 210 LEKCV 214



>gi|477507442|gb|ENH60736.1| Sterol regulatory element-binding protein 2 [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 407

 Score = 83.2 bits (204), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 64/93 (68%), Gaps = 2/93 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C     +HKLSILQ++IEYI+Y
Sbjct: 171 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGMIPACTGD--MHKLSILQASIEYIRY 228

Query: 223 LQGCVAESRKREGNNNSEERFTKRSKFDRYEIP 255
           L+ CV++ + ++  +N +    +++   R  +P
Sbjct: 229 LEDCVSKLKAQQEEDNGQTESGRQTPTGRDRLP 261



>gi|340513911|gb|EGR44186.1| predicted protein [Trichoderma reesei QM6a]
          Length = 456

 Score = 83.2 bits (204), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 82/139 (58%), Gaps = 26/139 (18%)

Query: 112 STSVFSVPMTPSNASSVMQHHNSVIHPHPPYQQQRVSLGG---AATGANGD--------- 159
           S+S F++P  P+ +  ++Q          P  QQ  + G    A+T  +G+         
Sbjct: 122 SSSTFALPPPPTRSRKIIQMK--------PRTQQSTAAGAHSAASTTRDGEPSSSSSSST 173

Query: 160 --KQ--LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQS 215
             KQ   T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+ILQ+
Sbjct: 174 RKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFALLKSMIPACTGE--MHKLAILQA 231

Query: 216 AIEYIQYLQGCVAESRKRE 234
           +IEY++YL+ CVA+ + ++
Sbjct: 232 SIEYVRYLEDCVAKLKAQQ 250



>gi|342879590|gb|EGU80835.1| hypothetical protein FOXB_08702 [Fusarium oxysporum Fo5176]
          Length = 407

 Score = 83.2 bits (204), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 64/93 (68%), Gaps = 2/93 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C     +HKLSILQ++IEYI+Y
Sbjct: 171 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGMIPACTGD--MHKLSILQASIEYIRY 228

Query: 223 LQGCVAESRKREGNNNSEERFTKRSKFDRYEIP 255
           L+ CV++ + ++  +N +    +++   R  +P
Sbjct: 229 LEDCVSKLKAQQEEDNGQTESGRQTPTGRDRLP 261



>gi|475664442|gb|EMT62237.1| Sterol regulatory element-binding protein 2 [Fusarium oxysporum f.
           sp. cubense race 4]
          Length = 407

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 64/93 (68%), Gaps = 2/93 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C     +HKLSILQ++IEYI+Y
Sbjct: 171 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGMIPACTGD--MHKLSILQASIEYIRY 228

Query: 223 LQGCVAESRKREGNNNSEERFTKRSKFDRYEIP 255
           L+ CV++ + ++  +N +    +++   R  +P
Sbjct: 229 LEDCVSKLKAQQEEDNGQTESGRQTPTGRDRLP 261



>gi|303320363|ref|XP_003070181.1| bHLH family transcription factor [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240109867|gb|EER28036.1| bHLH family transcription factor [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 435

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 71/127 (55%), Gaps = 19/127 (14%)

Query: 116 FSVPMTPSNASSVMQHHNSVIHPHPPYQQQRVSLGGAATGANGDKQ-------------L 162
           F++P  P+    ++Q     + P    Q +    G  A G +G                 
Sbjct: 104 FTLPPPPTRTRKIIQ-----VKPKGQEQPKASGAGAQAKGKDGQSASADGSGSKRKQPGA 158

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           TTA  R++AR+ +HS IERRRR ++N++   LK +IP+C  Q+ +HKL+ILQ++IEY+ Y
Sbjct: 159 TTAAGRKIARRTAHSLIERRRRSKMNEEFATLKNMIPACKGQE-MHKLAILQASIEYVNY 217

Query: 223 LQGCVAE 229
           L+ C+A+
Sbjct: 218 LEQCIAD 224



>gi|119184389|ref|XP_001243114.1| hypothetical protein CIMG_07010 [Coccidioides immitis RS]
 gi|392866000|gb|EAS31860.2| hypothetical protein CIMG_07010 [Coccidioides immitis RS]
          Length = 432

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 71/127 (55%), Gaps = 19/127 (14%)

Query: 116 FSVPMTPSNASSVMQHHNSVIHPHPPYQQQRVSLGGAATGANGDKQ-------------L 162
           F++P  P+    ++Q     + P    Q +    G  A G +G                 
Sbjct: 103 FTLPPPPTRTRKIIQ-----VKPKGQEQPKASGAGAQAKGKDGQSASADGSGSKRKQPGA 157

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           TTA  R++AR+ +HS IERRRR ++N++   LK +IP+C  Q+ +HKL+ILQ++IEY+ Y
Sbjct: 158 TTAAGRKIARRTAHSLIERRRRSKMNEEFATLKNMIPACKGQE-MHKLAILQASIEYVNY 216

Query: 223 LQGCVAE 229
           L+ C+A+
Sbjct: 217 LEQCIAD 223



>gi|402077970|gb|EJT73319.1| hypothetical protein GGTG_10163 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 441

 Score = 82.8 bits (203), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 56/80 (70%), Gaps = 2/80 (2%)

Query: 150 GGAATGANGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHK 209
           G +A G       T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HK
Sbjct: 155 GASAAGKKKQSSATSAAGRKMARKTAHSLIERRRRSKMNEEFATLKNMIPACTGE--MHK 212

Query: 210 LSILQSAIEYIQYLQGCVAE 229
           L+ILQ++IEY+ YL+ CV++
Sbjct: 213 LAILQASIEYVGYLEDCVSK 232



>gi|398410467|ref|XP_003856584.1| hypothetical protein MYCGRDRAFT_107535 [Zymoseptoria tritici
           IPO323]
 gi|339476469|gb|EGP91560.1| hypothetical protein MYCGRDRAFT_107535 [Zymoseptoria tritici
           IPO323]
          Length = 451

 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 65/91 (71%), Gaps = 5/91 (5%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           +TA  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++IEY++Y
Sbjct: 169 STAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACKGQE-MHKLAILQASIEYLRY 227

Query: 223 LQGCVAESRKREGNNNSEERFTKRSKFDRYE 253
           L+ CVA+ + +     S     +RS+F R E
Sbjct: 228 LEQCVADLQAQ----TSPRMQPQRSEFRRTE 254



>gi|330934414|ref|XP_003304538.1| hypothetical protein PTT_17167 [Pyrenophora teres f. teres 0-1]
 gi|311318779|gb|EFQ87361.1| hypothetical protein PTT_17167 [Pyrenophora teres f. teres 0-1]
          Length = 428

 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 60/82 (73%), Gaps = 1/82 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++IEY++Y
Sbjct: 145 TSAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACKGQE-MHKLAILQASIEYMRY 203

Query: 223 LQGCVAESRKREGNNNSEERFT 244
           L+ C+++ R    + +S    T
Sbjct: 204 LEQCISDLRTAHSHRDSPSSTT 225



>gi|452847585|gb|EME49517.1| hypothetical protein DOTSEDRAFT_68329 [Dothistroma septosporum
           NZE10]
          Length = 413

 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 55/67 (82%), Gaps = 1/67 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           TTA  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++IEY++Y
Sbjct: 143 TTAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACKGQE-MHKLAILQASIEYLRY 201

Query: 223 LQGCVAE 229
           L+ CV++
Sbjct: 202 LEQCVSD 208



>gi|145239741|ref|XP_001392517.1| possible bhlh transcription factor [Aspergillus niger CBS 513.88]
 gi|134077029|emb|CAK39903.1| unnamed protein product [Aspergillus niger]
 gi|350629644|gb|EHA18017.1| hypothetical protein ASPNIDRAFT_208174 [Aspergillus niger ATCC
           1015]
          Length = 387

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 61/90 (67%), Gaps = 2/90 (2%)

Query: 150 GGAATGANGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHK 209
           G +A         T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  QD +HK
Sbjct: 133 GASANSKKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFGTLKDMIPACKGQD-MHK 191

Query: 210 LSILQSAIEYIQYLQGCVAESRKREGNNNS 239
           L+ILQ++I+Y+ YL+ C+ +  K  GN ++
Sbjct: 192 LAILQASIDYVNYLEQCILD-LKTAGNRHA 220



>gi|258568836|ref|XP_002585162.1| predicted protein [Uncinocarpus reesii 1704]
 gi|237906608|gb|EEP81009.1| predicted protein [Uncinocarpus reesii 1704]
          Length = 399

 Score = 82.0 bits (201), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 66/108 (61%), Gaps = 14/108 (12%)

Query: 135 VIHPHPPYQQQRVSLGGAATGANGD-----------KQ--LTTADQRELARKVSHSAIER 181
           +I   P  Q+Q  + G  A G +G            KQ   TTA  R++AR+ +HS IER
Sbjct: 92  IIQVKPKGQEQPRTAGTQAKGKDGQNASTDGPGSKKKQSNATTAAGRKIARRTAHSLIER 151

Query: 182 RRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYLQGCVAE 229
           RRR ++N++   LK +IP+C  Q+ +HKL+ILQ++IEY+ YL+ C+ +
Sbjct: 152 RRRSKMNEEFATLKNMIPACQGQE-MHKLAILQASIEYVNYLEQCIVD 198



>gi|494824028|gb|EON61347.1| hypothetical protein W97_00561 [Coniosporium apollinis CBS 100218]
          Length = 409

 Score = 82.0 bits (201), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 54/67 (80%), Gaps = 1/67 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           TT   R++ARK +HS IERRRR ++N++   LK++IP+C  QD +HKLSILQ++I+Y++Y
Sbjct: 152 TTTAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACRGQD-MHKLSILQASIDYMRY 210

Query: 223 LQGCVAE 229
           L+ CV++
Sbjct: 211 LEKCVSD 217



>gi|358371788|dbj|GAA88394.1| HLH transcription factor [Aspergillus kawachii IFO 4308]
          Length = 386

 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 56/74 (75%), Gaps = 2/74 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  QD +HKL+ILQ++I+Y+ Y
Sbjct: 146 TSAAGRKIARKTAHSLIERRRRSKMNEEFGTLKDMIPACKGQD-MHKLAILQASIDYVNY 204

Query: 223 LQGCVAESRKREGN 236
           L+ C+ +  K  GN
Sbjct: 205 LEQCILD-LKTAGN 217



>gi|116180386|ref|XP_001220042.1| hypothetical protein CHGG_00821 [Chaetomium globosum CBS 148.51]
 gi|88185118|gb|EAQ92586.1| hypothetical protein CHGG_00821 [Chaetomium globosum CBS 148.51]
          Length = 385

 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 62/95 (65%), Gaps = 5/95 (5%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK LIP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 135 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGLIPACTGE--MHKLAILQASIEYVRY 192

Query: 223 LQGCVAESRKREGNNNSEERFTKRSKFDRYEIPIP 257
           L+ CV + + + G   SE       +  +  +P P
Sbjct: 193 LEDCVTKLKAQCG---SEAMLDPEPRLSQSGLPSP 224



>gi|226291293|gb|EEH46721.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18]
          Length = 519

 Score = 81.6 bits (200), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 56/75 (74%), Gaps = 1/75 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           TTA  R++ARK +HS IERRRR ++N++   LK +IP+C  Q+ +HKL+ILQ++I+Y+ Y
Sbjct: 157 TTAAGRKIARKTAHSLIERRRRSKMNEEFTTLKNMIPACGGQE-MHKLAILQASIDYMNY 215

Query: 223 LQGCVAESRKREGNN 237
           L+ C+++ +    N+
Sbjct: 216 LEQCISDLKAANSND 230



>gi|452989205|gb|EME88960.1| hypothetical protein MYCFIDRAFT_209944 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 332

 Score = 81.6 bits (200), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 61/83 (73%), Gaps = 7/83 (8%)

Query: 151 GAATGA----NGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDH 206
           GA TG+     G  Q  TA  R++ARK +HS IERRRR ++N++   LK+++P+C  Q+ 
Sbjct: 26  GAQTGSKRKQTGSGQ--TAAGRKIARKTAHSLIERRRRSKMNEEFAVLKDMVPACRGQE- 82

Query: 207 LHKLSILQSAIEYIQYLQGCVAE 229
           +HKL+ILQ++IEY++YL+ CVA+
Sbjct: 83  MHKLAILQASIEYLRYLEQCVAD 105



>gi|317142251|ref|XP_001818912.2| hypothetical protein AOR_1_672164 [Aspergillus oryzae RIB40]
          Length = 317

 Score = 81.6 bits (200), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 54/75 (72%), Gaps = 1/75 (1%)

Query: 153 ATGANGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSI 212
           AT        T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  QD +HKL+I
Sbjct: 139 ATSKKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFATLKDMIPACRGQD-MHKLAI 197

Query: 213 LQSAIEYIQYLQGCV 227
           LQ++I+Y+ YL+ C+
Sbjct: 198 LQASIDYVNYLEQCI 212



>gi|346320879|gb|EGX90479.1| HLH transcription factor, putative [Cordyceps militaris CM01]
          Length = 436

 Score = 81.6 bits (200), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 57/76 (75%), Gaps = 2/76 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C     +HKL+ILQ++IEYI+Y
Sbjct: 189 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKNMIPACTGD--MHKLAILQASIEYIRY 246

Query: 223 LQGCVAESRKREGNNN 238
           L+ CV++ + + G+ +
Sbjct: 247 LEDCVSQLKAQHGSEH 262



>gi|440639440|gb|ELR09359.1| hypothetical protein GMDG_03925 [Geomyces destructans 20631-21]
          Length = 404

 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 54/67 (80%), Gaps = 2/67 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 142 TSAAGRKMARKTAHSLIERRRRSKMNEEFGVLKDMIPAC--KGEMHKLAILQASIEYVRY 199

Query: 223 LQGCVAE 229
           L+ C+A+
Sbjct: 200 LEDCIAQ 206



>gi|261203441|ref|XP_002628934.1| HLH transcription factor [Ajellomyces dermatitidis SLH14081]
 gi|239586719|gb|EEQ69362.1| HLH transcription factor [Ajellomyces dermatitidis SLH14081]
          Length = 414

 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 53/67 (79%), Gaps = 1/67 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           TTA  R++ARK +HS IERRRR ++N++ + LK +IP+C  Q+ +HKL+ILQ++I+Y+ Y
Sbjct: 186 TTAAGRKIARKTAHSLIERRRRSKMNEEFMTLKNMIPACRGQE-MHKLAILQASIDYMNY 244

Query: 223 LQGCVAE 229
           L+ C+ E
Sbjct: 245 LEQCLKE 251



>gi|327349438|gb|EGE78295.1| HLH transcription factor [Ajellomyces dermatitidis ATCC 18188]
          Length = 540

 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 53/67 (79%), Gaps = 1/67 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           TTA  R++ARK +HS IERRRR ++N++ + LK +IP+C  Q+ +HKL+ILQ++I+Y+ Y
Sbjct: 182 TTAAGRKIARKTAHSLIERRRRSKMNEEFMTLKNMIPACRGQE-MHKLAILQASIDYMNY 240

Query: 223 LQGCVAE 229
           L+ C+ E
Sbjct: 241 LEQCLKE 247



>gi|512189823|gb|EPE05589.1| helix-loop-helix dna-binding domain-containing protein [Ophiostoma
           piceae UAMH 11346]
          Length = 611

 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 52/66 (78%), Gaps = 2/66 (3%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 228 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGMIPACTGE--MHKLAILQASIEYVRY 285

Query: 223 LQGCVA 228
           L+ CVA
Sbjct: 286 LEDCVA 291



>gi|46108514|ref|XP_381315.1| hypothetical protein FG01139.1 [Fusarium graminearum PH-1]
          Length = 403

 Score = 81.3 bits (199), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 64/95 (67%), Gaps = 5/95 (5%)

Query: 150 GGAATGANGDKQ---LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDH 206
           G AAT     K+    T+A  R++ARK +HS IERRRR ++N++   LK +IP+C     
Sbjct: 152 GDAATDDKTKKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGMIPACTGD-- 209

Query: 207 LHKLSILQSAIEYIQYLQGCVAESRKREGNNNSEE 241
           +HKLSILQ++IEYI+YL+ CV++ + ++ ++   E
Sbjct: 210 MHKLSILQASIEYIRYLEDCVSKLKAQQEDDGQTE 244



>gi|358388932|gb|EHK26525.1| hypothetical protein TRIVIDRAFT_142610 [Trichoderma virens Gv29-8]
          Length = 374

 Score = 81.3 bits (199), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 58/77 (75%), Gaps = 2/77 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 150 TSAAGRKIARKTAHSLIERRRRSKMNEEFALLKSMIPACTGE--MHKLAILQASIEYVRY 207

Query: 223 LQGCVAESRKREGNNNS 239
           L+ CVA+ + ++  + S
Sbjct: 208 LEDCVAKLKAQQEQSQS 224



>gi|242769172|ref|XP_002341715.1| HLH transcription factor, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218724911|gb|EED24328.1| HLH transcription factor, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 497

 Score = 81.3 bits (199), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 53/67 (79%), Gaps = 1/67 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++I+Y+ Y
Sbjct: 193 TSAAGRKIARKTAHSLIERRRRSKMNEEFATLKDMIPACRGQE-MHKLAILQASIDYMNY 251

Query: 223 LQGCVAE 229
           L+ C+ E
Sbjct: 252 LEECITE 258



>gi|238498230|ref|XP_002380350.1| HLH transcription factor, putative [Aspergillus flavus NRRL3357]
 gi|220693624|gb|EED49969.1| HLH transcription factor, putative [Aspergillus flavus NRRL3357]
          Length = 380

 Score = 81.3 bits (199), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 54/75 (72%), Gaps = 1/75 (1%)

Query: 153 ATGANGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSI 212
           AT        T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  QD +HKL+I
Sbjct: 128 ATSKKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFATLKDMIPACRGQD-MHKLAI 186

Query: 213 LQSAIEYIQYLQGCV 227
           LQ++I+Y+ YL+ C+
Sbjct: 187 LQASIDYVNYLEQCI 201



>gi|156062882|ref|XP_001597363.1| hypothetical protein SS1G_01557 [Sclerotinia sclerotiorum 1980]
 gi|154696893|gb|EDN96631.1| hypothetical protein SS1G_01557 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 375

 Score = 80.9 bits (198), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 101/193 (52%), Gaps = 22/193 (11%)

Query: 106 PKQQGSSTSVFSVPMTPSNASSVMQHH------NSVIHPHPPYQQQRVSLGGAAT-GANG 158
           P  Q ++ S F++P  P+ +  ++Q         ++  P     ++   +GG AT  A  
Sbjct: 80  PATQTAAKSSFALPPPPTRSRKIIQMKPRGQADETMNSP-----EENTKIGGKATPNAPK 134

Query: 159 DKQ--LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSA 216
            KQ   T+   R++ARK +HS IERRRR ++N++   LK++IP+C  +  +HKL+ILQ++
Sbjct: 135 KKQPSSTSVAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACTGE--MHKLAILQAS 192

Query: 217 IEYIQYLQGCVAESRKREGNNNSEERFTKRSKFDRYEIPIPKHLKDDNTDKSEYKRKNNS 276
           I+Y++YL+ CV++ +      NS   F+  +    + +P   H    +  + EY  + + 
Sbjct: 193 IDYVKYLEDCVSKLKA----ENSRGHFSTNT--GEFTLPPAAHRGSYDPSRHEYSARESE 246

Query: 277 GKFSDSDGENNVT 289
                +  EN  T
Sbjct: 247 EDTEMTGSENRST 259



>gi|380480201|emb|CCF42572.1| helix-loop-helix DNA-binding domain-containing protein
           [Colletotrichum higginsianum]
          Length = 397

 Score = 80.9 bits (198), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 2/78 (2%)

Query: 152 AATGANGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLS 211
           AA G       T+   R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+
Sbjct: 137 AAQGKKKQPSATSVAGRKIARKTAHSLIERRRRSKMNEEFAVLKGMIPACTGE--MHKLA 194

Query: 212 ILQSAIEYIQYLQGCVAE 229
           ILQ++IEY++YL+ CVA+
Sbjct: 195 ILQASIEYVRYLEDCVAK 212



>gi|302922398|ref|XP_003053457.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256734398|gb|EEU47744.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 409

 Score = 80.9 bits (198), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/85 (45%), Positives = 58/85 (68%), Gaps = 5/85 (5%)

Query: 148 SLGGAATGANGDKQ---LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQ 204
           + G  A    G K+    T+A  R++ARK +HS IERRRR ++N++   LK +IP+C   
Sbjct: 153 TAGDVAADEKGKKKQPSATSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKNMIPACTGD 212

Query: 205 DHLHKLSILQSAIEYIQYLQGCVAE 229
             +HKLSILQ++IEYI+YL+ CV++
Sbjct: 213 --MHKLSILQASIEYIRYLEDCVSK 235



>gi|408399693|gb|EKJ78787.1| hypothetical protein FPSE_01025 [Fusarium pseudograminearum CS3096]
          Length = 404

 Score = 80.9 bits (198), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 58/79 (73%), Gaps = 2/79 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C     +HKLSILQ++IEYI+Y
Sbjct: 169 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGMIPACTGD--MHKLSILQASIEYIRY 226

Query: 223 LQGCVAESRKREGNNNSEE 241
           L+ CV++ + ++ ++   E
Sbjct: 227 LEDCVSKLKAQQEDDGQTE 245



>gi|358395957|gb|EHK45344.1| hypothetical protein TRIATDRAFT_198898 [Trichoderma atroviride IMI
           206040]
          Length = 403

 Score = 80.9 bits (198), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 53/67 (79%), Gaps = 2/67 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 172 TSAAGRKIARKTAHSLIERRRRSKMNEEFALLKSMIPACTGE--MHKLAILQASIEYVRY 229

Query: 223 LQGCVAE 229
           L+ CVA+
Sbjct: 230 LEDCVAK 236



>gi|389642593|ref|XP_003718929.1| hypothetical protein MGG_00190 [Magnaporthe oryzae 70-15]
 gi|351641482|gb|EHA49345.1| hypothetical protein MGG_00190 [Magnaporthe oryzae 70-15]
 gi|440464784|gb|ELQ34152.1| hypothetical protein OOU_Y34scaffold00793g34 [Magnaporthe oryzae
           Y34]
 gi|440489172|gb|ELQ68847.1| hypothetical protein OOW_P131scaffold00214g8 [Magnaporthe oryzae
           P131]
          Length = 484

 Score = 80.5 bits (197), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 60/88 (68%), Gaps = 7/88 (7%)

Query: 147 VSLGGAATGA-----NGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSC 201
           +S   AATGA           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C
Sbjct: 167 ISAPPAATGAPVATKKKTPSATSAAGRKIARKTAHSLIERRRRSKMNEEFATLKNMIPAC 226

Query: 202 ADQDHLHKLSILQSAIEYIQYLQGCVAE 229
             +  +HKL+ILQ++I+YI+YL+ CV++
Sbjct: 227 TGE--MHKLAILQASIDYIRYLEDCVSK 252



>gi|295659717|ref|XP_002790416.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226281593|gb|EEH37159.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 521

 Score = 80.5 bits (197), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 62/94 (65%), Gaps = 5/94 (5%)

Query: 148 SLGGAATGANGDKQ----LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCAD 203
           +   + +GA   K+     TTA  R++ARK +HS IERRRR ++N++   LK +IP+C  
Sbjct: 138 TFASSGSGAGSKKKQASGATTAAGRKIARKTAHSMIERRRRSKMNEEFTTLKNMIPACRG 197

Query: 204 QDHLHKLSILQSAIEYIQYLQGCVAESRKREGNN 237
           Q+ +HKL+ILQ++I+Y+ YL+ C+ + +    N+
Sbjct: 198 QE-MHKLAILQASIDYMNYLEQCINDLKAANSND 230



>gi|384495856|gb|EIE86347.1| hypothetical protein RO3G_11058 [Rhizopus delemar RA 99-880]
          Length = 241

 Score = 80.5 bits (197), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 60/69 (86%)

Query: 161 QLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYI 220
           Q +TAD+RE ARK+SHSAIERRRRERINDKI QLK+LIPSCA++ +LHK+++LQ AI+YI
Sbjct: 89  QSSTADEREQARKISHSAIERRRRERINDKISQLKDLIPSCAERSNLHKMTVLQGAIDYI 148

Query: 221 QYLQGCVAE 229
            YL+  + +
Sbjct: 149 VYLRKVMKD 157



>gi|310793365|gb|EFQ28826.1| helix-loop-helix DNA-binding domain-containing protein [Glomerella
           graminicola M1.001]
          Length = 395

 Score = 80.5 bits (197), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 53/67 (79%), Gaps = 2/67 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 162 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGMIPACTGE--MHKLAILQASIEYVRY 219

Query: 223 LQGCVAE 229
           L+ CVA+
Sbjct: 220 LEDCVAK 226



>gi|328767300|gb|EGF77350.1| hypothetical protein BATDEDRAFT_91690 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 212

 Score = 80.1 bits (196), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (75%)

Query: 164 TADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYL 223
           T + R+  RK +HSAIERRRRER NDKI QLK+++PSCA +  LHKL+IL+  I+Y + L
Sbjct: 8   TRESRDRRRKATHSAIERRRRERTNDKIAQLKDMLPSCAGRSGLHKLTILEEGIQYTRML 67

Query: 224 QGCVAE 229
           +G + E
Sbjct: 68  EGQIRE 73



>gi|328767408|gb|EGF77458.1| hypothetical protein BATDEDRAFT_27662 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 208

 Score = 79.7 bits (195), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 50/66 (75%)

Query: 164 TADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYL 223
           T + R+  RK +HSAIERRRRER NDKI QLK+++PSCA +  LHKL+IL+  I+Y + L
Sbjct: 4   TRESRDRRRKATHSAIERRRRERTNDKIAQLKDMLPSCAGRSGLHKLTILEEGIQYTRML 63

Query: 224 QGCVAE 229
           +G + E
Sbjct: 64  EGQIRE 69



>gi|320589151|gb|EFX01613.1| hlh transcription factor [Grosmannia clavigera kw1407]
          Length = 748

 Score = 79.7 bits (195), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 52/66 (78%), Gaps = 2/66 (3%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 193 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKNMIPACTGE--MHKLAILQASIEYVRY 250

Query: 223 LQGCVA 228
           L+ CVA
Sbjct: 251 LEDCVA 256



>gi|255937003|ref|XP_002559528.1| Pc13g11100 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211584148|emb|CAP92179.1| Pc13g11100 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 358

 Score = 79.7 bits (195), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 52/65 (80%), Gaps = 1/65 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++I+Y+ Y
Sbjct: 132 TSAAGRKIARKTAHSLIERRRRSKMNEEFGTLKDMIPACTGQE-MHKLAILQASIDYVNY 190

Query: 223 LQGCV 227
           L+ C+
Sbjct: 191 LEKCI 195



>gi|396462450|ref|XP_003835836.1| hypothetical protein LEMA_P051770.1 [Leptosphaeria maculans JN3]
 gi|312212388|emb|CBX92471.1| hypothetical protein LEMA_P051770.1 [Leptosphaeria maculans JN3]
          Length = 592

 Score = 79.3 bits (194), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 77/133 (57%), Gaps = 11/133 (8%)

Query: 101 EQRILPKQQGSSTSVFSVPMTPSNASSVMQHHNSVIHPHPPYQQQRVSLGGAATGANGDK 160
           EQ I+ K+       +S+P  P+ +  ++Q       P    Q Q           N  K
Sbjct: 258 EQAIITKED------YSLPPPPTRSRKIIQMKPKEAQPVSKSQAQSQGAKSTTGSTNASK 311

Query: 161 QL----TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSA 216
           +     +TA  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++
Sbjct: 312 KKQGGNSTAAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACRGQE-MHKLAILQAS 370

Query: 217 IEYIQYLQGCVAE 229
           IEY++YL+ C+++
Sbjct: 371 IEYMRYLEKCLSD 383



>gi|477525094|gb|ENH77009.1| helix-loop-helix dna-binding domain-containing protein
           [Colletotrichum orbiculare MAFF 240422]
          Length = 450

 Score = 79.3 bits (194), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 53/67 (79%), Gaps = 2/67 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 172 TSAAGRKIARKTAHSLIERRRRSKMNEEFTVLKNMIPACTGE--MHKLAILQASIEYVRY 229

Query: 223 LQGCVAE 229
           L+ CV++
Sbjct: 230 LEDCVSK 236



>gi|406862693|gb|EKD15742.1| helix-loop-helix DNA-binding domain-containing protein [Marssonina
           brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 382

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 57/77 (74%), Gaps = 2/77 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  +  +HKL+ILQ++I+Y++Y
Sbjct: 149 TSATGRKIARKTAHSLIERRRRSKMNEEFGILKDMIPACTGE--MHKLAILQASIDYVRY 206

Query: 223 LQGCVAESRKREGNNNS 239
           L+ CVA+ +      N+
Sbjct: 207 LEDCVAKLKAENNRTNA 223



>gi|425767227|gb|EKV05801.1| putative bhlh transcription factor [Penicillium digitatum PHI26]
 gi|425780078|gb|EKV18098.1| putative bhlh transcription factor [Penicillium digitatum Pd1]
          Length = 358

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 52/65 (80%), Gaps = 1/65 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK++IP+C  Q+ +HKL+ILQ++I+Y+ Y
Sbjct: 132 TSAAGRKIARKTAHSLIERRRRSKMNEEFGTLKDMIPACTGQE-MHKLAILQASIDYVNY 190

Query: 223 LQGCV 227
           L+ C+
Sbjct: 191 LEKCI 195



>gi|512207852|gb|EPE36669.1| HLH, helix-loop-helix DNA-binding protein [Glarea lozoyensis ATCC
           20868]
          Length = 355

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 70/115 (60%), Gaps = 10/115 (8%)

Query: 153 ATGANGDKQ--LTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKL 210
           AT A   KQ   T+   R++ARK +HS IERRRR ++N++   LK++IP+C  +  +HKL
Sbjct: 135 ATPAAKKKQPSSTSVAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACTGE--MHKL 192

Query: 211 SILQSAIEYIQYLQGCVAESRKREGNNNSEERFTKRSKFDRYEIPIPKHLKDDNT 265
           +ILQ++I+Y++YL+ CV    K +  NN   R  K    +R+ +P P      +T
Sbjct: 193 AILQASIDYVRYLEDCVT---KLKAENN---RTIKTPINERFVLPPPARADSQST 241



>gi|346978325|gb|EGY21777.1| hypothetical protein VDAG_03217 [Verticillium dahliae VdLs.17]
          Length = 397

 Score = 78.6 bits (192), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 53/67 (79%), Gaps = 2/67 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C  +  +HKL+ILQ++IEY++Y
Sbjct: 151 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGMIPACTGE--MHKLAILQASIEYVRY 208

Query: 223 LQGCVAE 229
           L+ CV++
Sbjct: 209 LEDCVSK 215



>gi|471559522|gb|EMR61872.1| putative helix-loop-helix dna-binding domain-containing protein
           [Eutypa lata UCREL1]
          Length = 457

 Score = 77.4 bits (189), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 53/67 (79%), Gaps = 2/67 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK LIP+C  +  +HKL+ILQ++I+Y++Y
Sbjct: 155 TSAAGRKIARKTAHSLIERRRRSKMNEEFAVLKGLIPACTGE--MHKLAILQASIDYVRY 212

Query: 223 LQGCVAE 229
           L+ C+++
Sbjct: 213 LEDCISK 219



>gi|296422172|ref|XP_002840636.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636856|emb|CAZ84827.1| unnamed protein product [Tuber melanosporum]
          Length = 351

 Score = 77.0 bits (188), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/81 (45%), Positives = 59/81 (72%), Gaps = 1/81 (1%)

Query: 159 DKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIE 218
           D++ TTA  R++ARK +HS IERRRR ++N++   LK +IP+C   + +HKL+ILQS+IE
Sbjct: 146 DEKPTTAVGRKIARKTAHSLIERRRRFKMNEEFGVLKGMIPACRGVE-MHKLAILQSSIE 204

Query: 219 YIQYLQGCVAESRKREGNNNS 239
           Y++YL+ CV + +     ++S
Sbjct: 205 YLRYLEKCVEDLKTSNAASSS 225



>gi|296816431|ref|XP_002848552.1| extensin [Arthroderma otae CBS 113480]
 gi|238839005|gb|EEQ28667.1| extensin [Arthroderma otae CBS 113480]
          Length = 316

 Score = 76.6 bits (187), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 52/71 (73%), Gaps = 1/71 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
            TA  R++AR+ +HS IERRRR ++N +   LK++IP+C   + +HKL+ILQ++IEY+ Y
Sbjct: 98  ATAAGRKIARRTAHSLIERRRRSKMNQEFATLKDMIPACRGHE-MHKLAILQASIEYVNY 156

Query: 223 LQGCVAESRKR 233
           L+ CV + + R
Sbjct: 157 LESCVKDLKAR 167



>gi|154299982|ref|XP_001550408.1| hypothetical protein BC1G_11180 [Botryotinia fuckeliana B05.10]
 gi|347832041|emb|CCD47738.1| similar to transcription factor bHLH [Botryotinia fuckeliana T4]
 gi|472241749|gb|EMR86460.1| putative helix-loop-helix dna-binding domain-containing protein
           [Botryotinia fuckeliana BcDW1]
          Length = 375

 Score = 76.6 bits (187), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 55/76 (72%), Gaps = 2/76 (2%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+   R++ARK +HS IERRRR ++N++   LK++IP+C  +  +HKL+ILQ++I+Y++Y
Sbjct: 141 TSVAGRKIARKTAHSLIERRRRSKMNEEFGVLKDMIPACTGE--MHKLAILQASIDYVRY 198

Query: 223 LQGCVAESRKREGNNN 238
           L+ CV++ +      N
Sbjct: 199 LEDCVSKLKAENSRGN 214



>gi|328773465|gb|EGF83502.1| hypothetical protein BATDEDRAFT_22254 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 494

 Score = 75.9 bits (185), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 65/113 (57%), Gaps = 10/113 (8%)

Query: 148 SLGGAATGANGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHL 207
           S+  AA  A   K  +T D +E  R+V H A+ER RRERI  K+ +LK +IPSCA     
Sbjct: 217 SVSTAAIAA--AKTSSTVDDKEALRRVVHCAVERERRERIKVKLDELKAVIPSCASMAST 274

Query: 208 HKLSILQSAIEYIQYLQGCVAESRKR----EGNNN-SEER---FTKRSKFDRY 252
            K+ +L+SA+ YI+ L+  + +   R    EG +N SEER   F++    DRY
Sbjct: 275 QKIVLLESAVTYIKSLEMLIGDLESRLSQYEGTSNVSEERSPPFSETQLVDRY 327



>gi|302663223|ref|XP_003023256.1| HLH transcription factor, putative [Trichophyton verrucosum HKI
           0517]
 gi|291187245|gb|EFE42638.1| HLH transcription factor, putative [Trichophyton verrucosum HKI
           0517]
          Length = 354

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 49/64 (76%), Gaps = 1/64 (1%)

Query: 164 TADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYL 223
           TA  R++AR+ +HS IERRRR ++N +   LK++IP+C   + +HKL+ILQ++IEY+ YL
Sbjct: 105 TAAGRKIARRTAHSLIERRRRSKMNQEFATLKDMIPACRGHE-MHKLAILQASIEYVNYL 163

Query: 224 QGCV 227
           + CV
Sbjct: 164 ESCV 167



>gi|302496170|ref|XP_003010088.1| HLH transcription factor, putative [Arthroderma benhamiae CBS
           112371]
 gi|291173626|gb|EFE29448.1| HLH transcription factor, putative [Arthroderma benhamiae CBS
           112371]
          Length = 355

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 49/64 (76%), Gaps = 1/64 (1%)

Query: 164 TADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYL 223
           TA  R++AR+ +HS IERRRR ++N +   LK++IP+C   + +HKL+ILQ++IEY+ YL
Sbjct: 104 TAAGRKIARRTAHSLIERRRRSKMNQEFATLKDMIPACRGHE-MHKLAILQASIEYVNYL 162

Query: 224 QGCV 227
           + CV
Sbjct: 163 ESCV 166



>gi|315050073|ref|XP_003174411.1| hypothetical protein MGYG_04584 [Arthroderma gypseum CBS 118893]
 gi|311342378|gb|EFR01581.1| hypothetical protein MGYG_04584 [Arthroderma gypseum CBS 118893]
          Length = 362

 Score = 75.5 bits (184), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 49/64 (76%), Gaps = 1/64 (1%)

Query: 164 TADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYL 223
           TA  R++AR+ +HS IERRRR ++N +   LK++IP+C   + +HKL+ILQ++IEY+ YL
Sbjct: 119 TAAGRKIARRTAHSLIERRRRSKMNQEFATLKDMIPACRGHE-MHKLAILQASIEYVNYL 177

Query: 224 QGCV 227
           + CV
Sbjct: 178 ESCV 181



>gi|67517875|ref|XP_658718.1| hypothetical protein AN1114.2 [Aspergillus nidulans FGSC A4]
 gi|40747076|gb|EAA66232.1| hypothetical protein AN1114.2 [Aspergillus nidulans FGSC A4]
 gi|259488570|tpe|CBF88111.1| TPA: putative bHLH transcription factor (Eurofung) [Aspergillus
           nidulans FGSC A4]
          Length = 393

 Score = 75.5 bits (184), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 50/65 (76%), Gaps = 1/65 (1%)

Query: 163 TTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQY 222
           T+A  R++ARK +HS IERRRR ++N++   LK +IP+C   + +HKL+ILQ++I+Y+ Y
Sbjct: 152 TSAAGRKIARKTAHSLIERRRRSKMNEEFSTLKNMIPACRGHE-MHKLAILQASIDYVNY 210

Query: 223 LQGCV 227
           L+ C+
Sbjct: 211 LEKCI 215



>gi|326484569|gb|EGE08579.1| HLH transcription factor [Trichophyton equinum CBS 127.97]
          Length = 368

 Score = 75.5 bits (184), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 49/64 (76%), Gaps = 1/64 (1%)

Query: 164 TADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYL 223
           TA  R++AR+ +HS IERRRR ++N +   LK++IP+C   + +HKL+ILQ++IEY+ YL
Sbjct: 119 TAAGRKIARRTAHSLIERRRRSKMNQEFATLKDMIPACRGHE-MHKLAILQASIEYVNYL 177

Query: 224 QGCV 227
           + CV
Sbjct: 178 ESCV 181



>gi|328774270|gb|EGF84307.1| hypothetical protein BATDEDRAFT_22231 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 456

 Score = 75.1 bits (183), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 65/113 (57%), Gaps = 10/113 (8%)

Query: 148 SLGGAATGANGDKQLTTADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHL 207
           S+  AA  A   K  +T D +E  R+V H A+ER RRERI  K+ +LK +IPSCA     
Sbjct: 179 SVSTAAIAA--AKTSSTVDDKEALRRVVHCAVERERRERIKVKLDELKAVIPSCASMAST 236

Query: 208 HKLSILQSAIEYIQYLQGCVAESRKR----EGNNN-SEER---FTKRSKFDRY 252
            K+ +L+SA+ YI+ L+  + +   R    EG +N SEER   F++    DRY
Sbjct: 237 QKIVLLESAVTYIKSLEMLIGDLESRLSQYEGTSNVSEERSPPFSETQLVDRY 289



>gi|327294010|ref|XP_003231701.1| hypothetical protein TERG_08000 [Trichophyton rubrum CBS 118892]
 gi|326466329|gb|EGD91782.1| hypothetical protein TERG_08000 [Trichophyton rubrum CBS 118892]
          Length = 350

 Score = 75.1 bits (183), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 49/64 (76%), Gaps = 1/64 (1%)

Query: 164 TADQRELARKVSHSAIERRRRERINDKILQLKELIPSCADQDHLHKLSILQSAIEYIQYL 223
           TA  R++AR+ +HS IERRRR ++N +   LK++IP+C   + +HKL+ILQ++IEY+ YL
Sbjct: 97  TAAGRKIARRTAHSLIERRRRSKMNQEFATLKDMIPACRGHE-MHKLAILQASIEYVNYL 155

Query: 224 QGCV 227
           + CV
Sbjct: 156 ESCV 159