BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10365_c0_seq1-m.141 complete 18-800(+) 261 (+)
         (260 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384496600|gb|EIE87091.1| 30S ribosomal protein S8e [Rhizopus ...   448   e-124   Rhizopus delemar RA 99-880
gi|384493321|gb|EIE83812.1| 30S ribosomal protein S8e [Rhizopus ...   447   e-123   Rhizopus delemar RA 99-880
gi|511001693|gb|EPB83157.1| ribosome biogenesis protein N [Mucor...   445   e-123   Mucor circinelloides f. circinelloides 1006PhL
gi|470323579|ref|XP_004349529.1| TGF beta-inducible nuclear prot...   431   e-119   
gi|328772985|gb|EGF83022.1| hypothetical protein BATDEDRAFT_8454...   424   e-117   Batrachochytrium dendrobatidis JAM81
gi|156364831|ref|XP_001626548.1| predicted protein [Nematostella...   418   e-115   Nematostella vectensis
gi|443715026|gb|ELU07178.1| hypothetical protein CAPTEDRAFT_1837...   408   e-112   Capitella teleta
gi|405974460|gb|EKC39103.1| Ribosome biogenesis protein NSA2-lik...   403   e-110   Crassostrea gigas
gi|317575593|ref|NP_001187984.1| ribosome biogenesis protein NSA...   402   e-110   Ictalurus punctatus
gi|72013892|ref|XP_783243.1| PREDICTED: ribosome biogenesis prot...   402   e-110   Strongylocentrotus purpuratus [purple urchin]
gi|167518800|ref|XP_001743740.1| hypothetical protein [Monosiga ...   402   e-110   Monosiga brevicollis MX1
gi|308321383|gb|ADO27843.1| ribosome biogenesis protein nsa2-lik...   401   e-110   Ictalurus furcatus
gi|471368047|ref|XP_004374552.1| PREDICTED: ribosome biogenesis ...   401   e-109   Trichechus manatus latirostris
gi|128485562|ref|NP_599242.2| ribosome biogenesis protein NSA2 h...   400   e-109   Rattus norvegicus [brown rat]
gi|336371552|gb|EGN99891.1| hypothetical protein SERLA73DRAFT_18...   400   e-109   Serpula lacrymans var. lacrymans S7.3
gi|327262989|ref|XP_003216304.1| PREDICTED: ribosome biogenesis ...   400   e-109   Anolis carolinensis [Carolina anole]
gi|387762960|ref|NP_001248690.1| ribosome biogenesis protein NSA...   400   e-109   Macaca mulatta [rhesus macaque]
gi|62859971|ref|NP_001017326.1| NSA2 ribosome biogenesis homolog...   400   e-109   Xenopus tropicalis [western clawed frog]
gi|7662677|ref|NP_055701.1| ribosome biogenesis protein NSA2 hom...   399   e-109   Homo sapiens [man]
gi|410948810|ref|XP_003981122.1| PREDICTED: ribosome biogenesis ...   399   e-109   Felis catus [cat]
gi|432884751|ref|XP_004074570.1| PREDICTED: ribosome biogenesis ...   399   e-109   Oryzias latipes [Japanese rice fish]
gi|488510108|ref|XP_004447146.1| PREDICTED: ribosome biogenesis ...   399   e-109   Dasypus novemcinctus
gi|466014066|ref|XP_004270862.1| PREDICTED: ribosome biogenesis ...   399   e-109   Orcinus orca [Orca]
gi|229366240|gb|ACQ58100.1| TGF-beta-inducible nuclear protein 1...   399   e-109   Anoplopoma fimbria
gi|291409757|ref|XP_002721160.1| PREDICTED: NSA2 ribosome biogen...   399   e-109   Oryctolagus cuniculus [European rabbit]
gi|68534732|gb|AAH98657.1| Cdk105 protein [Rattus norvegicus]         399   e-109   Rattus norvegicus [brown rat]
gi|77736039|ref|NP_001029718.1| ribosome biogenesis protein NSA2...   399   e-109   Bos taurus [bovine]
gi|507534802|ref|XP_004651445.1| PREDICTED: ribosome biogenesis ...   399   e-109   
gi|354491792|ref|XP_003508038.1| PREDICTED: ribosome biogenesis ...   398   e-109   Cricetulus griseus [Chinese hamsters]
gi|348552286|ref|XP_003461959.1| PREDICTED: ribosome biogenesis ...   398   e-109   
gi|512006079|ref|XP_004820477.1| PREDICTED: ribosome biogenesis ...   398   e-109   
gi|392569720|gb|EIW62893.1| TGF beta-inducible nuclear protein 1...   398   e-109   Trametes versicolor FP-101664 SS1
gi|465967573|gb|EMP31416.1| Ribosome biogenesis protein NSA2 lik...   398   e-109   Chelonia mydas [green seaturtle]
gi|410903652|ref|XP_003965307.1| PREDICTED: ribosome biogenesis ...   398   e-109   Takifugu rubripes [tiger puffer]
gi|332233849|ref|XP_003266117.1| PREDICTED: ribosome biogenesis ...   398   e-109   Nomascus leucogenys [White-cheeked Gibbon]
gi|332244783|ref|XP_003271553.1| PREDICTED: ribosome biogenesis ...   397   e-108   Nomascus leucogenys [White-cheeked Gibbon]
gi|209733510|gb|ACI67624.1| Ribosome biogenesis protein NSA2 hom...   397   e-108   Salmo salar
gi|395510515|ref|XP_003759520.1| PREDICTED: ribosome biogenesis ...   397   e-108   
gi|301763671|ref|XP_002917254.1| PREDICTED: ribosome biogenesis ...   397   e-108   Ailuropoda melanoleuca
gi|291290923|ref|NP_001167492.1| NSA2 ribosome biogenesis homolo...   397   e-108   Xenopus laevis [clawed frog]
gi|507641045|ref|XP_004701549.1| PREDICTED: ribosome biogenesis ...   397   e-108   Echinops telfairi [lesser hedgehog tenrec]
gi|34924868|sp|Q9QYU7.2|NSA2_RAT RecName: Full=Ribosome biogenes...   397   e-108   Rattus norvegicus [brown rat]
gi|12856931|dbj|BAB30834.1| unnamed protein product [Mus musculus]    397   e-108   Mus musculus [mouse]
gi|221114265|ref|XP_002157278.1| PREDICTED: ribosome biogenesis ...   397   e-108   Hydra vulgaris
gi|478492474|ref|XP_004420595.1| PREDICTED: ribosome biogenesis ...   396   e-108   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|344247161|gb|EGW03265.1| Ribosome biogenesis protein NSA2-lik...   396   e-108   Cricetulus griseus [Chinese hamsters]
gi|504147826|ref|XP_004586325.1| PREDICTED: ribosome biogenesis ...   396   e-108   
gi|348524400|ref|XP_003449711.1| PREDICTED: ribosome biogenesis ...   396   e-108   Oreochromis niloticus
gi|299751221|ref|XP_002911607.1| ribosome biogenesis protein NSA...   396   e-108   Coprinopsis cinerea okayama7#130
gi|355749994|gb|EHH54332.1| TGF-beta-inducible nuclear protein 1...   396   e-108   Macaca fascicularis [crab eating macaque]
gi|126320630|ref|XP_001368321.1| PREDICTED: ribosome biogenesis ...   395   e-108   
gi|225715214|gb|ACO13453.1| Ribosome biogenesis protein NSA2 hom...   395   e-108   Esox lucius
gi|213514458|ref|NP_001134933.1| ribosome biogenesis protein NSA...   395   e-108   Salmo salar
gi|507934540|ref|XP_004678503.1| PREDICTED: ribosome biogenesis ...   395   e-108   
gi|340379695|ref|XP_003388362.1| PREDICTED: ribosome biogenesis ...   395   e-108   
gi|501755029|emb|CCG81676.1| Ribosome biogenesis protein nsa2 [T...   395   e-108   Taphrina deformans PYCC 5710
gi|170117381|ref|XP_001889878.1| ribosome biogenesis protein NSA...   395   e-108   Laccaria bicolor S238N-H82
gi|295314938|gb|ADF97619.1| TGF-beta-inducible nuclear protein 1...   395   e-108   Hypophthalmichthys molitrix
gi|426246763|ref|XP_004017159.1| PREDICTED: ribosome biogenesis ...   394   e-108   
gi|317171912|ref|NP_955862.2| ribosome biogenesis protein NSA2 h...   394   e-108   Danio rerio [leopard danio]
gi|409080654|gb|EKM81014.1| hypothetical protein AGABI1DRAFT_112...   394   e-107   Agaricus bisporus var. burnettii JB137-S8
gi|225707726|gb|ACO09709.1| TGF-beta-inducible nuclear protein 1...   394   e-107   Osmerus mordax
gi|395332673|gb|EJF65051.1| TGF beta-inducible nuclear protein 1...   394   e-107   Dichomitus squalens LYAD-421 SS1
gi|426220753|ref|XP_004004578.1| PREDICTED: ribosome biogenesis ...   394   e-107   Ovis aries [domestic sheep]
gi|392593600|gb|EIW82925.1| TGF beta-inducible nuclear protein 1...   394   e-107   Coniophora puteana RWD-64-598 SS2
gi|28278483|gb|AAH46083.1| Zgc:56334 [Danio rerio]                    393   e-107   Danio rerio [leopard danio]
gi|291406641|ref|XP_002719652.1| PREDICTED: NSA2 ribosome biogen...   392   e-107   
gi|409044907|gb|EKM54388.1| hypothetical protein PHACADRAFT_1627...   392   e-107   Phanerochaete carnosa HHB-10118-sp
gi|242208727|ref|XP_002470213.1| TGF beta-inducible nuclear prot...   392   e-107   Postia placenta Mad-698-R
gi|350537199|ref|NP_001232280.1| putative TGF beta-inducible nuc...   392   e-107   Taeniopygia guttata
gi|325183542|emb|CCA18003.1| ribosome biogenesis protein NSA2 pu...   392   e-107   Albugo laibachii Nc14
gi|403266452|ref|XP_003925395.1| PREDICTED: ribosome biogenesis ...   392   e-107   
gi|387915612|gb|AFK11415.1| NSA2 ribosome biogenesis-like protei...   391   e-107   Callorhinchus milii [Australian ghost shark]
gi|57528133|ref|NP_001006579.1| ribosome biogenesis protein NSA2...   391   e-107   Gallus gallus [bantam]
gi|326934942|ref|XP_003213541.1| PREDICTED: ribosome biogenesis ...   390   e-106   
gi|444708480|gb|ELW49543.1| Ribosome biogenesis protein NSA2 lik...   390   e-106   Tupaia chinensis
gi|149408559|ref|XP_001513525.1| PREDICTED: ribosome biogenesis ...   390   e-106   
gi|351701860|gb|EHB04779.1| Ribosome biogenesis protein NSA2-lik...   390   e-106   Heterocephalus glaber [naked mole rat]
gi|465795212|emb|CCU99855.1| unnamed protein product [Malassezia...   389   e-106   Malassezia sympodialis ATCC 42132
gi|196002397|ref|XP_002111066.1| hypothetical protein TRIADDRAFT...   389   e-106   Trichoplax adhaerens
gi|444723493|gb|ELW64148.1| Ribosome biogenesis protein NSA2 lik...   389   e-106   Tupaia chinensis
gi|198412361|ref|XP_002127830.1| PREDICTED: ribosome biogenesis ...   388   e-106   Ciona intestinalis [sea vase]
gi|260829883|ref|XP_002609891.1| hypothetical protein BRAFLDRAFT...   388   e-105   Branchiostoma floridae
gi|392881190|gb|AFM89427.1| NSA2 ribosome biogenesis-like protei...   387   e-105   Callorhinchus milii [Australian ghost shark]
gi|472586713|gb|EMS24232.1| ribosomal protein S8e/ribosomal biog...   387   e-105   Rhodotorula toruloides NP11
gi|209734004|gb|ACI67871.1| Ribosome biogenesis protein NSA2 hom...   387   e-105   Salmo salar
gi|393217161|gb|EJD02650.1| hypothetical protein FOMMEDRAFT_4224...   387   e-105   Fomitiporia mediterranea MF3/22
gi|213404554|ref|XP_002173049.1| ribosome biogenesis protein NSA...   386   e-105   Schizosaccharomyces japonicus yFS275
gi|19076061|ref|NP_588561.1| ribosome biogenesis protein nsa2 [S...   386   e-105   Schizosaccharomyces pombe 972h-
gi|112984142|ref|NP_001037438.1| TGF beta-inducible nuclear prot...   386   e-105   Bombyx mori [silk moth]
gi|301120312|ref|XP_002907883.1| ribosome biogenesis protein NSA...   386   e-105   Phytophthora infestans T30-4
gi|443893911|dbj|GAC71367.1| hypothetical protein PANT_2d00073 [...   385   e-105   Moesziomyces antarcticus T-34
gi|66804290|ref|XP_635924.1| hypothetical protein DDB_G0290031 [...   385   e-105   Dictyostelium discoideum AX4
gi|343428895|emb|CBQ72440.1| probable NSA2-involved in biogenesi...   385   e-105   Sporisorium reilianum SRZ2
gi|302679422|ref|XP_003029393.1| hypothetical protein SCHCODRAFT...   385   e-105   Schizophyllum commune H4-8
gi|389741916|gb|EIM83104.1| TGF beta-inducible nuclear protein 1...   385   e-105   Stereum hirsutum FP-91666 SS1
gi|298708726|emb|CBJ30688.1| conserved unknown protein [Ectocarp...   384   e-104   Ectocarpus siliculosus
gi|56540978|gb|AAH86776.1| 5730427N09Rik protein [Mus musculus]       384   e-104   Mus musculus [mouse]
gi|405123588|gb|AFR98352.1| TGF beta-inducible nuclear protein 1...   384   e-104   Cryptococcus neoformans var. grubii H99
gi|355691394|gb|EHH26579.1| TGF-beta-inducible nuclear protein 1...   384   e-104   Macaca mulatta [rhesus macaque]
gi|388856750|emb|CCF49710.1| probable NSA2-involved in biogenesi...   383   e-104   Ustilago hordei
gi|501303612|dbj|GAC93033.1| hypothetical protein PHSY_000594 [P...   383   e-104   Pseudozyma hubeiensis SY62
gi|87248237|gb|ABD36171.1| hairy cell leukemia protein 1 [Bombyx...   383   e-104   Bombyx mori [silk moth]
gi|281209877|gb|EFA84045.1| TGF beta-inducible nuclear protein [...   382   e-104   Polysphondylium pallidum PN500
gi|449546392|gb|EMD37361.1| hypothetical protein CERSUDRAFT_1053...   381   e-104   Gelatoporia subvermispora B
gi|472396301|ref|XP_004417379.1| PREDICTED: ribosome biogenesis ...   381   e-103   
gi|393234712|gb|EJD42272.1| TGF beta-inducible nuclear protein 1...   380   e-103   Auricularia subglabra TFB-10046 SS5
gi|71022307|ref|XP_761383.1| hypothetical protein UM05236.1 [Ust...   380   e-103   
gi|332376065|gb|AEE63173.1| unknown [Dendroctonus ponderosae]         380   e-103   Dendroctonus ponderosae
gi|507697014|ref|XP_004643547.1| PREDICTED: ribosome biogenesis ...   380   e-103   Octodon degus
gi|330799257|ref|XP_003287663.1| hypothetical protein DICPUDRAFT...   380   e-103   Dictyostelium purpureum
gi|389610189|dbj|BAM18706.1| conserved hypothetical protein [Pap...   380   e-103   Papilio xuthus [Chinese swallowtail]
gi|322802243|gb|EFZ22639.1| hypothetical protein SINV_00582 [Sol...   380   e-103   Solenopsis invicta [imported red fire ant]
gi|164660746|ref|XP_001731496.1| hypothetical protein MGL_1679 [...   380   e-103   Malassezia globosa CBS 7966
gi|325296819|ref|NP_001191651.1| TGF beta-inducible nuclear prot...   379   e-103   Aplysia californica
gi|357627501|gb|EHJ77180.1| hairy cell leukemia protein 1 [Danau...   379   e-103   Danaus plexippus [American monarch]
gi|333449477|gb|AEF33424.1| ribosome biogenesis protein nsa2-lik...   379   e-103   Crassostrea ariakensis
gi|380011074|ref|XP_003689638.1| PREDICTED: ribosome biogenesis ...   379   e-103   Apis florea [dwarf honeybee]
gi|332024400|gb|EGI64598.1| Ribosome biogenesis protein NSA2-lik...   378   e-103   Acromyrmex echinatior
gi|403416887|emb|CCM03587.1| predicted protein [Fibroporia radic...   378   e-103   Fibroporia radiculosa
gi|321468461|gb|EFX79446.1| hypothetical protein DAPPUDRAFT_2310...   378   e-102   Daphnia pulex
gi|240952276|ref|XP_002399367.1| conserved hypothetical protein ...   377   e-102   Ixodes scapularis [blacklegged tick]
gi|390601926|gb|EIN11319.1| TGF beta-inducible nuclear protein 1...   377   e-102   Punctularia strigosozonata HHB-11173 SS5
gi|350423324|ref|XP_003493444.1| PREDICTED: ribosome biogenesis ...   377   e-102   
gi|307172444|gb|EFN63897.1| Ribosome biogenesis protein NSA2-lik...   376   e-102   Camponotus floridanus
gi|307184032|gb|EFN70586.1| Ribosome biogenesis protein NSA2-lik...   375   e-102   Camponotus floridanus
gi|307203226|gb|EFN82381.1| Ribosome biogenesis protein NSA2-lik...   375   e-102   Harpegnathos saltator
gi|297806661|ref|XP_002871214.1| ribosomal protein S8e family pr...   374   e-101   Arabidopsis lyrata subsp. lyrata
gi|255085034|ref|XP_002504948.1| ribosomal protein S8E [Micromon...   374   e-101   Micromonas commoda
gi|303282749|ref|XP_003060666.1| ribosomal protein S8e [Micromon...   374   e-101   Micromonas pusilla CCMP1545
gi|482557095|gb|EOA21287.1| hypothetical protein CARUB_v10001640...   373   e-101   Capsella rubella
gi|300121439|emb|CBK21958.2| unnamed protein product [Blastocyst...   373   e-101   Blastocystis hominis
gi|300122920|emb|CBK23927.2| unnamed protein product [Blastocyst...   373   e-101   Blastocystis hominis
gi|470236960|ref|XP_004350433.1| TGF beta-inducible nuclear prot...   373   e-101   Dictyostelium fasciculatum
gi|58262054|ref|XP_568437.1| ribosomal large subunit biogenesis-...   372   e-101   Cryptococcus neoformans var. neoformans JEC21
gi|242020114|ref|XP_002430501.1| TGF-beta-inducible nuclear prot...   372   e-101   Pediculus humanus corporis [human body lice]
gi|449269898|gb|EMC80636.1| Ribosome biogenesis protein NSA2 lik...   371   e-101   Columba livia [carrier pigeon]
gi|383863294|ref|XP_003707116.1| PREDICTED: ribosome biogenesis ...   371   e-101   Megachile rotundata
gi|449523511|ref|XP_004168767.1| PREDICTED: ribosome biogenesis ...   371   e-101   
gi|391335954|ref|XP_003742350.1| PREDICTED: ribosome biogenesis ...   371   e-101   Metaseiulus occidentalis
gi|449451181|ref|XP_004143340.1| PREDICTED: ribosome biogenesis ...   371   e-100   Cucumis sativus [cucumbers]
gi|470512286|ref|XP_004352466.1| ribosomal protein S8e, putative...   370   e-100   Acanthamoeba castellanii str. Neff
gi|358249178|ref|NP_001239750.1| uncharacterized protein LOC1008...   370   e-100   Glycine max [soybeans]
gi|460405047|ref|XP_004247989.1| PREDICTED: ribosome biogenesis ...   370   e-100   Solanum lycopersicum
gi|470320051|gb|EMR11647.1| 30S ribosomal protein S8e [Pneumocys...   370   e-100   Pneumocystis murina B123
gi|26344332|dbj|BAB22128.2| unnamed protein product [Mus musculus]    370   e-100   Mus musculus [mouse]
gi|321265083|ref|XP_003197258.1| constituent of 66S pre-ribosoma...   370   e-100   Cryptococcus gattii WM276
gi|302833141|ref|XP_002948134.1| hypothetical protein VOLCADRAFT...   369   e-100   Volvox carteri f. nagariensis
gi|15240023|ref|NP_196254.1| ribosomal protein S8e family protei...   369   e-100   Arabidopsis thaliana [mouse-ear cress]
gi|359806220|ref|NP_001240952.1| uncharacterized protein LOC1008...   368   e-100   Glycine max [soybeans]
gi|356537190|ref|XP_003537112.1| PREDICTED: uncharacterized prot...   368   e-100   
gi|478253535|gb|ENN73853.1| hypothetical protein YQE_09545, part...   368   e-100   Dendroctonus ponderosae
gi|298398978|gb|ADI80856.1| hairy cell leukemia [Heliconius melp...   368   e-100   Heliconius melpomene melpomene
gi|159465249|ref|XP_001690835.1| low-CO2-inducible protein [Chla...   368   1e-99   Chlamydomonas reinhardtii
gi|168037726|ref|XP_001771354.1| predicted protein [Physcomitrel...   367   1e-99   Physcomitrella patens
gi|397633125|gb|EJK70845.1| hypothetical protein THAOC_07765 [Th...   367   1e-99   Thalassiosira oceanica
gi|357121530|ref|XP_003562472.1| PREDICTED: ribosome biogenesis ...   367   2e-99   
gi|384247429|gb|EIE20916.1| low-CO2-inducible protein [Coccomyxa...   367   2e-99   Coccomyxa subellipsoidea C-169
gi|475482586|gb|EMT02990.1| Ribosome biogenesis NSA2-like protei...   367   2e-99   Aegilops tauschii
gi|508716577|gb|EOY08474.1| Ribosomal protein S8e family protein...   367   2e-99   Theobroma cacao [chocolate]
gi|507114352|emb|CDF37911.1| probable constituent of 66S pre-rib...   367   2e-99   Chondrus crispus [Irish moss]
gi|121543937|gb|ABM55633.1| putative TGF beta-inducible nuclear ...   366   3e-99   Maconellicoccus hirsutus [pink hibiscus mealybug]
gi|91077774|ref|XP_968953.1| PREDICTED: similar to TGF beta-indu...   366   3e-99   Tribolium castaneum [rust-red flour beetle]
gi|298398980|gb|ADI80857.1| hairy cell leukemia [Heliconius melp...   366   3e-99   Heliconius melpomene melpomene
gi|255586521|ref|XP_002533899.1| TGF-beta-inducible nuclear prot...   366   3e-99   Ricinus communis
gi|444729299|gb|ELW69724.1| Ribosome biogenesis protein NSA2 lik...   365   5e-99   Tupaia chinensis
gi|490262983|gb|AGL09514.1| ribosomal protein S8e family protein...   365   5e-99   Hydnora visseri
gi|298399060|gb|ADI80897.1| hairy cell leukemia [Heliconius cydn...   365   5e-99   Heliconius cydno cordula
gi|225439438|ref|XP_002266163.1| PREDICTED: ribosome biogenesis ...   365   5e-99   Vitis vinifera
gi|145355626|ref|XP_001422059.1| predicted protein [Ostreococcus...   365   5e-99   Ostreococcus lucimarinus CCE9901
gi|302804476|ref|XP_002983990.1| hypothetical protein SELMODRAFT...   365   5e-99   Selaginella moellendorffii
gi|224003827|ref|XP_002291585.1| predicted protein [Thalassiosir...   365   7e-99   Thalassiosira pseudonana CCMP1335
gi|118481073|gb|ABK92490.1| unknown [Populus trichocarpa]             365   8e-99   Populus trichocarpa [western balsam poplar]
gi|294898564|ref|XP_002776277.1| conserved protein, COG SSU ribo...   365   9e-99   Perkinsus marinus ATCC 50983
gi|157136375|ref|XP_001663728.1| hypothetical protein AaeL_AAEL0...   364   9e-99   Aedes aegypti
gi|505802295|ref|XP_004608616.1| PREDICTED: ribosome biogenesis ...   364   9e-99   Sorex araneus [Eurasian shrew]
gi|412985367|emb|CCO18813.1| predicted protein [Bathycoccus pras...   364   1e-98   Bathycoccus prasinos
gi|224088085|ref|XP_002308319.1| predicted protein [Populus tric...   364   1e-98   Populus trichocarpa [western balsam poplar]
gi|224140024|ref|XP_002323387.1| predicted protein [Populus tric...   364   1e-98   
gi|392579278|gb|EIW72405.1| hypothetical protein TREMEDRAFT_7071...   363   2e-98   Tremella mesenterica DSM 1558
gi|118484685|gb|ABK94213.1| unknown [Populus trichocarpa]             363   2e-98   Populus trichocarpa [western balsam poplar]
gi|296083154|emb|CBI22790.3| unnamed protein product [Vitis vini...   363   2e-98   Vitis vinifera
gi|403285044|ref|XP_003933851.1| PREDICTED: uncharacterized prot...   363   2e-98   Saimiri boliviensis boliviensis
gi|298398990|gb|ADI80862.1| hairy cell leukemia [Heliconius melp...   363   2e-98   Heliconius melpomene melpomene
gi|21553587|gb|AAM62680.1| unknown [Arabidopsis thaliana]             363   3e-98   Arabidopsis thaliana [mouse-ear cress]
gi|358057138|dbj|GAA97045.1| hypothetical protein E5Q_03720 [Mix...   363   3e-98   Mixia osmundae IAM 14324
gi|345803027|ref|XP_003434993.1| PREDICTED: ribosome biogenesis ...   363   3e-98   
gi|323452658|gb|EGB08531.1| hypothetical protein AURANDRAFT_6006...   363   3e-98   Aureococcus anophagefferens
gi|9438133|gb|AAF87579.1|AF275672_1 unknown [Ochlerotatus triser...   363   3e-98   Ochlerotatus triseriatus
gi|170033236|ref|XP_001844484.1| conserved hypothetical protein ...   362   5e-98   Culex quinquefasciatus
gi|388502420|gb|AFK39276.1| unknown [Lotus japonicus]                 362   6e-98   Lotus japonicus
gi|302753448|ref|XP_002960148.1| hypothetical protein SELMODRAFT...   362   6e-98   Selaginella moellendorffii
gi|298399016|gb|ADI80875.1| hairy cell leukemia [Heliconius melp...   361   9e-98   Heliconius melpomene melpomene
gi|298399022|gb|ADI80878.1| hairy cell leukemia [Heliconius heur...   361   1e-97   Heliconius heurippa
gi|56417598|gb|AAV90740.1| hairy cell leukemia protein 1 [Aedes ...   361   1e-97   Aedes albopictus [forest day mosquito]
gi|242051254|ref|XP_002463371.1| hypothetical protein SORBIDRAFT...   360   2e-97   Sorghum bicolor [broomcorn]
gi|308813407|ref|XP_003084010.1| unnamed protein product [Ostreo...   360   2e-97   Ostreococcus tauri
gi|212274853|ref|NP_001130223.1| TGF-beta-inducible nuclear prot...   360   2e-97   Zea mays [maize]
gi|388582303|gb|EIM22608.1| ribosomal protein S8e [Wallemia sebi...   360   2e-97   Wallemia mellicola CBS 633.66
gi|462408655|gb|EMJ13989.1| hypothetical protein PRUPE_ppa020054...   360   2e-97   Prunus persica
gi|452819416|gb|EME26475.1| ribosomal protein S8e family protein...   359   4e-97   Galdieria sulphuraria
gi|339233928|ref|XP_003382081.1| ribosome biogenesis protein NSA...   359   5e-97   Trichinella spiralis
gi|298399084|gb|ADI80909.1| hairy cell leukemia [Heliconius cydn...   358   5e-97   Heliconius cydno cordula
gi|402224390|gb|EJU04453.1| TGF beta-inducible nuclear protein 1...   358   6e-97   Dacryopinax primogenitus
gi|313213629|emb|CBY40547.1| unnamed protein product [Oikopleura...   358   1e-96   Oikopleura dioica
gi|195146886|ref|XP_002014415.1| GL18965 [Drosophila persimilis]...   357   2e-96   Drosophila persimilis
gi|148681918|gb|EDL13865.1| mCG13462 [Mus musculus]                   357   2e-96   Mus musculus [mouse]
gi|403169356|ref|XP_003328804.2| ribosome biogenesis protein NSA...   356   3e-96   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|237835005|ref|XP_002366800.1| TGF-beta-inducible nuclear prot...   356   4e-96   Toxoplasma gondii ME49
gi|341885338|gb|EGT41273.1| hypothetical protein CAEBREN_06101 [...   356   4e-96   Caenorhabditis brenneri
gi|58390056|ref|XP_317465.2| AGAP008001-PA [Anopheles gambiae st...   355   5e-96   Anopheles gambiae str. PEST
gi|268570180|ref|XP_002640711.1| Hypothetical protein CBG19778 [...   355   5e-96   Caenorhabditis briggsae
gi|388510868|gb|AFK43500.1| unknown [Medicago truncatula]             355   5e-96   Medicago truncatula
gi|308490624|ref|XP_003107504.1| hypothetical protein CRE_14053 ...   355   6e-96   Caenorhabditis remanei
gi|115474013|ref|NP_001060605.1| Os07g0673100 [Oryza sativa Japo...   355   7e-96   
gi|502122269|ref|XP_004497662.1| PREDICTED: ribosome biogenesis ...   353   3e-95   Cicer arietinum [garbanzo]
gi|17509649|ref|NP_493387.1| Protein W09C5.1 [Caenorhabditis ele...   353   3e-95   Caenorhabditis elegans [roundworm]
gi|218200239|gb|EEC82666.1| hypothetical protein OsI_27295 [Oryz...   353   3e-95   Oryza sativa Indica Group [Indian rice]
gi|428165460|gb|EKX34454.1| hypothetical protein GUITHDRAFT_9808...   353   4e-95   Guillardia theta CCMP2712
gi|146102560|ref|XP_001469365.1| putative 40S ribosomal protein ...   351   9e-95   Leishmania infantum JPCM5
gi|393908459|gb|EFO19300.2| 30S ribosomal protein S8e [Loa loa]       351   9e-95   Loa loa
gi|459366812|gb|EMG46026.1| Ribosome biogenesis protein NSA2 [Ca...   351   9e-95   Candida maltosa Xu316
gi|498980880|ref|XP_004549923.1| PREDICTED: ribosome biogenesis ...   351   1e-94   
gi|281339399|gb|EFB14983.1| hypothetical protein PANDA_005460 [A...   351   1e-94   Ailuropoda melanoleuca
gi|154346696|ref|XP_001569285.1| putative 40S ribosomal protein ...   351   1e-94   Leishmania braziliensis MHOM/BR/75/M2904
gi|66359552|ref|XP_626954.1| conserved protein, COG SSU ribosoma...   350   1e-94   Cryptosporidium parvum Iowa II
gi|498932366|ref|XP_004519373.1| PREDICTED: ribosome biogenesis ...   350   1e-94   Ceratitis capitata
gi|444319186|ref|XP_004180250.1| hypothetical protein TBLA_0D022...   350   2e-94   Tetrapisispora blattae CBS 6284
gi|157877865|ref|XP_001687230.1| putative 40S ribosomal protein ...   350   2e-94   Leishmania major strain Friedlin
gi|195116687|ref|XP_002002883.1| GI10609 [Drosophila mojavensis]...   350   2e-94   Drosophila mojavensis
gi|444706572|gb|ELW47907.1| Ribosome biogenesis protein NSA2 lik...   350   3e-94   Tupaia chinensis
gi|241953581|ref|XP_002419512.1| ribosome biogenesis protein NSA...   349   3e-94   Candida dubliniensis CD36
gi|209881993|ref|XP_002142434.1| ribosome biogenesis protein NSA...   349   3e-94   Cryptosporidium muris RN66
gi|195457478|ref|XP_002075582.1| GK19000 [Drosophila willistoni]...   349   4e-94   Drosophila willistoni
gi|407849631|gb|EKG04317.1| 40S ribosomal protein S8, putative [...   349   4e-94   Trypanosoma cruzi
gi|68479839|ref|XP_716088.1| potential ribosome maturation facto...   349   5e-94   Candida albicans SC5314
gi|240848741|ref|NP_001155554.1| ribosome biogenesis protein NSA...   349   5e-94   Acyrthosiphon pisum
gi|71408532|ref|XP_806665.1| 40S ribosomal protein S8 [Trypanoso...   348   5e-94   Trypanosoma cruzi strain CL Brener
gi|71663239|ref|XP_818615.1| 40S ribosomal protein S8 [Trypanoso...   348   6e-94   Trypanosoma cruzi strain CL Brener
gi|149240589|ref|XP_001526170.1| TGF beta-inducible nuclear prot...   348   6e-94   Lodderomyces elongisporus NRRL YB-4239
gi|255726060|ref|XP_002547956.1| TGF beta-inducible nuclear prot...   348   7e-94   Candida tropicalis MYA-3404
gi|312085664|ref|XP_003144769.1| TGF beta-inducible nuclear prot...   348   8e-94   Loa loa
gi|402586319|gb|EJW80257.1| 30S ribosomal protein S8e, partial [...   348   9e-94   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|45185638|ref|NP_983354.1| ribosome biogenesis protein NSA2 [A...   347   1e-93   Eremothecium gossypii ATCC 10895
gi|453088574|gb|EMF16614.1| ribosomal protein S8e [Mycosphaerell...   347   1e-93   Sphaerulina musiva SO2202
gi|452847851|gb|EME49783.1| hypothetical protein DOTSEDRAFT_6853...   347   1e-93   Dothistroma septosporum NZE10
gi|170593877|ref|XP_001901690.1| TGF beta-inducible nuclear prot...   347   1e-93   Brugia malayi [agent of lymphatic filariasis]
gi|406604901|emb|CCH43678.1| Ribosome biogenesis protein [Wicker...   347   2e-93   Wickerhamomyces ciferrii
gi|407404076|gb|EKF29702.1| 40S ribosomal protein S8, putative [...   347   2e-93   Trypanosoma cruzi marinkellei
gi|513031190|gb|AGO11214.1| AaceriACL050Wp [Saccharomycetaceae s...   347   2e-93   Saccharomycetaceae sp. 'Ashbya aceri'
gi|256080875|ref|XP_002576701.1| Ribosome biogenesis protein NSA...   347   2e-93   
gi|195387455|ref|XP_002052411.1| GJ21832 [Drosophila virilis] >g...   346   3e-93   Drosophila virilis
gi|71747900|ref|XP_823005.1| 40S ribosomal protein S8 [Trypanoso...   346   3e-93   Trypanosoma brucei brucei TREU927
gi|50552742|ref|XP_503781.1| ribosome biogenesis protein NSA2 [Y...   346   3e-93   Yarrowia lipolytica CLIB122
gi|302922412|ref|XP_003053460.1| ribosome biogenesis protein NSA...   346   3e-93   Nectria haematococca mpVI 77-13-4
gi|342879586|gb|EGU80831.1| hypothetical protein FOXB_08698 [Fus...   346   4e-93   Fusarium oxysporum Fo5176
gi|483522426|gb|EOB07121.1| Ribosome biogenesis protein NSA2-lik...   346   4e-93   Anas platyrhynchos [duck]
gi|449297569|gb|EMC93587.1| hypothetical protein BAUCODRAFT_2461...   346   4e-93   Baudoinia panamericana UAMH 10762
gi|367015238|ref|XP_003682118.1| ribosome biogenesis protein NSA...   345   5e-93   Torulaspora delbrueckii
gi|358388936|gb|EHK26529.1| hypothetical protein TRIVIDRAFT_2153...   345   5e-93   Trichoderma virens Gv29-8
gi|46108506|ref|XP_381311.1| hypothetical protein FG01135.1 [Fus...   345   5e-93   
gi|219119093|ref|XP_002180313.1| predicted protein [Phaeodactylu...   345   5e-93   Phaeodactylum tricornutum CCAP 1055/1
gi|358395961|gb|EHK45348.1| hypothetical protein TRIATDRAFT_2437...   345   6e-93   Trichoderma atroviride IMI 206040
gi|396471036|ref|XP_003838774.1| similar to TGF-beta-inducible n...   345   6e-93   Leptosphaeria maculans JN3
gi|344301410|gb|EGW31722.1| ribosome biogenesis protein NSA2 [Sp...   345   6e-93   Spathaspora passalidarum NRRL Y-27907
gi|353241402|emb|CCA73219.1| probable NSA2-involved in biogenesi...   345   6e-93   Serendipita indica DSM 11827
gi|195050549|ref|XP_001992917.1| GH13541 [Drosophila grimshawi] ...   345   6e-93   Drosophila grimshawi
gi|448522506|ref|XP_003868706.1| Nsa2 protein constituent of 66S...   345   6e-93   Candida orthopsilosis Co 90-125
gi|398409706|ref|XP_003856318.1| ribosome biogenesis protein nsa...   345   7e-93   Zymoseptoria tritici IPO323
gi|17137580|ref|NP_477379.1| intronic protein 259, isoform A [Dr...   345   7e-93   Drosophila melanogaster
gi|410076124|ref|XP_003955644.1| hypothetical protein KAFR_0B021...   345   8e-93   Kazachstania africana CBS 2517
gi|194761814|ref|XP_001963118.1| GF15782 [Drosophila ananassae] ...   345   8e-93   Drosophila ananassae
gi|502136112|ref|XP_004502564.1| PREDICTED: ribosome biogenesis ...   344   1e-92   Cicer arietinum [garbanzo]
gi|169602631|ref|XP_001794737.1| hypothetical protein SNOG_04319...   344   1e-92   Parastagonospora nodorum SN15
gi|7542542|gb|AAF63492.1|AF238866_1 LNR42 [Mus musculus]              344   1e-92   Mus musculus [mouse]
gi|255714991|ref|XP_002553777.1| ribosome biogenesis protein NSA...   344   1e-92   Lachancea thermotolerans CBS 6340
gi|354547948|emb|CCE44683.1| hypothetical protein CPAR2_404870 [...   344   2e-92   Candida parapsilosis
gi|408399697|gb|EKJ78791.1| hypothetical protein FPSE_01029 [Fus...   344   2e-92   Fusarium pseudograminearum CS3096
gi|50291779|ref|XP_448322.1| ribosome biogenesis protein NSA2 [C...   343   2e-92   Candida glabrata CBS 138
gi|340057364|emb|CCC51709.1| putative 40S ribosomal protein S8 [...   343   2e-92   
gi|363756534|ref|XP_003648483.1| hypothetical protein Ecym_8396 ...   343   2e-92   
gi|226482576|emb|CAX73887.1| TGF-beta-inducible nuclear protein ...   343   2e-92   
gi|296423874|ref|XP_002841477.1| ribosome biogenesis protein NSA...   343   2e-92   
gi|391870530|gb|EIT79710.1| hypothetical protein Ao3042_03814 [A...   343   2e-92   
gi|345096379|gb|AEN67691.1| hairy cell leukemia [Heliconius numa...   343   3e-92   
gi|47228386|emb|CAG05206.1| unnamed protein product [Tetraodon n...   343   3e-92   
gi|126133268|ref|XP_001383159.1| ribosome biogenesis protein NSA...   343   3e-92   
gi|448107293|ref|XP_004205319.1| Piso0_003562 [Millerozyma farin...   343   4e-92   
gi|347838652|emb|CCD53224.1| similar to TGF beta-inducible nucle...   342   4e-92   
gi|378734693|gb|EHY61152.1| ribosome biogenesis protein n [Exoph...   342   5e-92   
gi|500254164|gb|EON97802.1| putative ribosomal large subunit pro...   342   5e-92   
gi|322696897|gb|EFY88683.1| ribosomal large subunit [Metarhizium...   342   5e-92   
gi|260949217|ref|XP_002618905.1| hypothetical protein CLUG_00064...   342   5e-92   
gi|366990287|ref|XP_003674911.1| hypothetical protein NCAS_0B045...   342   6e-92   
gi|254586477|ref|XP_002498806.1| ribosome biogenesis protein NSA...   342   6e-92   
gi|345096381|gb|AEN67692.1| hairy cell leukemia [Heliconius numa...   342   6e-92   
gi|226468266|emb|CAX69810.1| TGF-beta-inducible nuclear protein ...   342   7e-92   
gi|156845541|ref|XP_001645661.1| hypothetical protein Kpol_541p4...   342   7e-92   
gi|226292634|gb|EEH48054.1| TGF-beta-inducible nuclear protein [...   342   7e-92   
gi|323309434|gb|EGA62651.1| Nsa2p [Saccharomyces cerevisiae Fost...   342   8e-92   
gi|206558233|sp|Q5B954.2|NSA2_EMENI RecName: Full=Ribosome bioge...   341   9e-92   
gi|50309117|ref|XP_454564.1| ribosome biogenesis protein NSA2 [K...   341   9e-92   
gi|6320973|ref|NP_011052.1| Nsa2p [Saccharomyces cerevisiae S288...   341   9e-92   
gi|322708574|gb|EFZ00151.1| ribosomal large subunit [Metarhizium...   341   1e-91   
gi|223590107|sp|A5DCN7.2|NSA2_PICGU RecName: Full=Ribosome bioge...   341   1e-91   
gi|512930852|ref|XP_004906774.1| PREDICTED: ribosome biogenesis ...   341   1e-91   
gi|345096447|gb|AEN67725.1| hairy cell leukemia [Heliconius numa...   341   1e-91   
gi|345096389|gb|AEN67696.1| hairy cell leukemia [Heliconius numa...   340   2e-91   
gi|365983384|ref|XP_003668525.1| hypothetical protein NDAI_0B024...   340   2e-91   
gi|365761109|gb|EHN02785.1| Nsa2p [Saccharomyces cerevisiae x Sa...   340   2e-91   
gi|380477659|emb|CCF44032.1| ribosome biogenesis protein nsa-2 [...   340   2e-91   
gi|154279222|ref|XP_001540424.1| ribosome biogenesis protein NSA...   340   2e-91   
gi|425765668|gb|EKV04337.1| Ribosome biogenesis protein nsa2 [Pe...   340   3e-91   
gi|367003912|ref|XP_003686689.1| ribosome biogenesis protein NSA...   339   3e-91   
gi|403215468|emb|CCK69967.1| hypothetical protein KNAG_0D02170 [...   339   3e-91   
gi|505754805|gb|EOQ99103.1| Ribosome biosis protein NSA2 [Wallem...   339   4e-91   
gi|50419557|ref|XP_458305.1| ribosome biogenesis protein NSA2 [D...   339   4e-91   
gi|146423474|ref|XP_001487665.1| hypothetical protein PGUG_01042...   339   4e-91   
gi|317141360|ref|XP_001818393.2| ribosome biogenesis protein NSA...   339   4e-91   
gi|346320869|gb|EGX90469.1| ribosomal large subunit [Cordyceps m...   339   5e-91   
gi|471574539|gb|EMR72363.1| putative ribosomal large subunit pro...   338   6e-91   
gi|452989473|gb|EME89228.1| hypothetical protein MYCFIDRAFT_1498...   338   6e-91   
gi|253741770|gb|EES98633.1| Hypothetical protein GL50581_4161 [G...   338   7e-91   
gi|344234345|gb|EGV66215.1| ribosomal protein S8e [Candida tenui...   338   9e-91   
gi|225562453|gb|EEH10732.1| ribosomal large subunit [Ajellomyces...   338   9e-91   
gi|345096387|gb|AEN67695.1| hairy cell leukemia [Heliconius numa...   338   1e-90   
gi|85117074|ref|XP_965174.1| ribosome biogenesis protein NSA2 [N...   338   1e-90   
gi|254569934|ref|XP_002492077.1| ribosome biogenesis protein NSA...   338   1e-90   
gi|482809593|gb|EOA86402.1| hypothetical protein SETTUDRAFT_2841...   337   1e-90   
gi|308162339|gb|EFO64744.1| Ribosomal protein S8E [Giardia lambl...   337   1e-90   
gi|358367826|dbj|GAA84444.1| ribosome biogenesis protein Nsa2 [A...   337   1e-90   
gi|239611576|gb|EEQ88563.1| 30S ribosomal protein S8e [Ajellomyc...   337   1e-90   
gi|345096385|gb|AEN67694.1| hairy cell leukemia [Heliconius numa...   337   2e-90   
gi|190358779|sp|Q4WX36.2|NSA2_ASPFU RecName: Full=Ribosome bioge...   337   2e-90   
gi|451849757|gb|EMD63060.1| hypothetical protein COCSADRAFT_1615...   337   2e-90   
gi|189042745|sp|A1D7P0.2|NSA2_NEOFI RecName: Full=Ribosome bioge...   337   2e-90   
gi|307107334|gb|EFN55577.1| hypothetical protein CHLNCDRAFT_2332...   337   2e-90   
gi|336463976|gb|EGO52216.1| hypothetical protein NEUTE1DRAFT_149...   337   3e-90   
gi|171684323|ref|XP_001907103.1| hypothetical protein [Podospora...   337   3e-90   
gi|159116925|ref|XP_001708683.1| Hypothetical protein GL50803_11...   336   3e-90   
gi|71026556|ref|XP_762945.1| hypothetical protein [Theileria par...   336   3e-90   
gi|340515692|gb|EGR45945.1| predicted protein [Trichoderma reese...   335   5e-90   
gi|471231915|ref|XP_004037089.1| tgf beta-inducible nuclear prot...   335   5e-90   
gi|225680924|gb|EEH19208.1| TGF-beta-inducible nuclear protein [...   335   6e-90   
gi|351713922|gb|EHB16841.1| Ribosome biogenesis protein NSA2-lik...   335   7e-90   
gi|400601412|gb|EJP69055.1| ribosomal large subunit [Beauveria b...   335   8e-90   
gi|312371070|gb|EFR19335.1| hypothetical protein AND_22678 [Anop...   335   8e-90   
gi|189203137|ref|XP_001937904.1| ribosome biogenesis protein NSA...   334   1e-89   
gi|115391777|ref|XP_001213393.1| ribosome biogenesis protein NSA...   334   1e-89   
gi|442570239|sp|Q1DQ27.2|NSA2_COCIM RecName: Full=Ribosome bioge...   334   1e-89   
gi|472242566|gb|EMR87254.1| putative ribosome biogenesis protein...   334   1e-89   
gi|403222668|dbj|BAM40799.1| Tgf beta-inducible nuclear protein ...   334   1e-89   
gi|471192499|ref|XP_004185922.1| TGF-beta-inducible nuclear prot...   334   1e-89   
gi|118380460|ref|XP_001023394.1| Ribosomal protein S8e containin...   334   2e-89   
gi|485924147|gb|EOD49054.1| putative ribosome biogenesis protein...   333   2e-89   
gi|255944817|ref|XP_002563176.1| Pc20g06500 [Penicillium chrysog...   332   4e-89   
gi|295672584|ref|XP_002796838.1| ribosome biogenesis protein NSA...   332   4e-89   
gi|340992687|gb|EGS23242.1| hypothetical protein CTHT_0009080 [C...   332   4e-89   
gi|367020662|ref|XP_003659616.1| hypothetical protein MYCTH_6377...   332   4e-89   
gi|83766248|dbj|BAE56391.1| unnamed protein product [Aspergillus...   332   6e-89   
gi|167391038|ref|XP_001739612.1| TGF-beta-inducible nuclear prot...   332   6e-89   
gi|67470618|ref|XP_651272.1| hypothetical protein [Entamoeba his...   332   7e-89   
gi|121705130|ref|XP_001270828.1| ribosome biogenesis protein NSA...   331   9e-89   
gi|485610952|gb|EOD09645.1| hypothetical protein EMIHUDRAFT_9688...   331   1e-88   
gi|367042688|ref|XP_003651724.1| ribosome biogenesis protein NSA...   330   1e-88   
gi|385303895|gb|EIF47940.1| tgf beta-inducible nuclear protein 1...   330   1e-88   
gi|443923471|gb|ELU42709.1| TGF beta-inducible nuclear protein 1...   330   2e-88   
gi|320581832|gb|EFW96051.1| Killer toxin Resistant [Ogataea para...   330   2e-88   
gi|156087509|ref|XP_001611161.1| ribosomal protein Se8 [Babesia ...   330   2e-88   
gi|119492531|ref|XP_001263631.1| ribosome biogenesis protein NSA...   330   2e-88   
gi|261204948|ref|XP_002627211.1| ribosome biogenesis protein NSA...   330   2e-88   
gi|242822692|ref|XP_002487939.1| ribosome biogenesis protein NSA...   330   3e-88   
gi|317027931|ref|XP_003188618.1| ribosome biogenesis protein NSA...   330   3e-88   
gi|440634082|gb|ELR04001.1| ribosome biogenesis protein n [Geomy...   329   3e-88   
gi|389631553|ref|XP_003713429.1| ribosome biogenesis protein nsa...   329   4e-88   
gi|399163784|emb|CCE35305.1| probable NSA2-involved in biogenesi...   329   4e-88   
gi|71000180|ref|XP_754805.1| 60S ribosomal protein Nsa2 [Aspergi...   329   5e-88   
gi|406866047|gb|EKD19087.1| ribosomal large subunit [Marssonina ...   328   6e-88   
gi|222637669|gb|EEE67801.1| hypothetical protein OsJ_25542 [Oryz...   328   7e-88   
gi|154308802|ref|XP_001553736.1| ribosome biogenesis protein NSA...   328   8e-88   
gi|225714224|gb|ACO12958.1| TGF-beta-inducible nuclear protein 1...   328   1e-87   
gi|310793425|gb|EFQ28886.1| ribosomal protein S8e [Glomerella gr...   327   2e-87   
gi|290977246|ref|XP_002671349.1| predicted protein [Naegleria gr...   326   4e-87   
gi|328858175|gb|EGG07288.1| hypothetical protein MELLADRAFT_1057...   326   5e-87   
gi|300176605|emb|CBK24270.2| unnamed protein product [Blastocyst...   325   5e-87   
gi|225710164|gb|ACO10928.1| TGF-beta-inducible nuclear protein 1...   325   5e-87   
gi|67524937|ref|XP_660530.1| hypothetical protein AN2926.2 [Aspe...   325   5e-87   
gi|494824595|gb|EON61849.1| ribosome biogenesis protein n [Conio...   325   9e-87   
gi|345566353|gb|EGX49296.1| hypothetical protein AOL_s00078g329 ...   322   4e-86   
gi|402084058|gb|EJT79076.1| ribosome biogenesis protein nsa-2 [G...   322   5e-86   
gi|350296054|gb|EGZ77031.1| ribosomal protein S8e [Neurospora te...   322   6e-86   
gi|212546665|ref|XP_002153486.1| 60S ribosomal protein Nsa2, put...   322   7e-86   
gi|512207794|gb|EPE36611.1| ribosomal large subunit [Glarea lozo...   322   8e-86   
gi|399219154|emb|CCF76041.1| unnamed protein product [Babesia mi...   320   2e-85   
gi|345096407|gb|AEN67705.1| hairy cell leukemia [Heliconius numa...   319   4e-85   
gi|449015657|dbj|BAM79059.1| probable constituent of 66S pre-rib...   319   4e-85   
gi|85001562|ref|XP_955495.1| tgf beta-inducible nuclear protein(...   319   5e-85   
gi|145486186|ref|XP_001429100.1| hypothetical protein [Parameciu...   319   6e-85   
gi|119177253|ref|XP_001240423.1| ribosome biogenesis protein NSA...   317   1e-84   
gi|402470620|gb|EJW04765.1| hypothetical protein EDEG_01055 [Edh...   317   2e-84   
gi|327292743|ref|XP_003231069.1| ribosome biogenesis protein NSA...   317   2e-84   
gi|350635031|gb|EHA23393.1| hypothetical protein ASPNIDRAFT_1261...   315   5e-84   
gi|477531915|gb|ENH83586.1| ribosomal large subunit [Colletotric...   313   3e-83   
gi|346978396|gb|EGY21848.1| TGF-beta-inducible nuclear protein [...   313   3e-83   
gi|302411710|ref|XP_003003688.1| ribosome biogenesis protein NSA...   312   4e-83   
gi|326482343|gb|EGE06353.1| 60S ribosomal protein N [Trichophyto...   311   1e-82   
gi|326475348|gb|EGD99357.1| ribosome biogenesis protein N [Trich...   311   2e-82   
gi|403336466|gb|EJY67432.1| TGF-beta-inducible nuclear protein 1...   310   2e-82   
gi|215740799|dbj|BAG96955.1| unnamed protein product [Oryza sati...   310   2e-82   
gi|345096397|gb|AEN67700.1| hairy cell leukemia [Heliconius numa...   310   2e-82   
gi|156094818|ref|XP_001613445.1| ribosomal protein S8e [Plasmodi...   310   3e-82   
gi|291222747|ref|XP_002731376.1| PREDICTED: NSA2 ribosome biogen...   309   4e-82   
gi|221051960|ref|XP_002257556.1| ribosomal protein S8e [Plasmodi...   308   6e-82   
gi|124511720|ref|XP_001348993.1| cdk105, putative [Plasmodium fa...   308   9e-82   
gi|68077059|ref|XP_680449.1| hypothetical protein [Plasmodium be...   308   1e-81   
gi|19074881|ref|NP_586387.1| ribosome biogenesis protein NSA2 [E...   308   1e-81   
gi|76156500|gb|AAX27698.2| SJCHGC06987 protein [Schistosoma japo...   308   1e-81   
gi|484851883|gb|EOB11225.1| hypothetical protein NBO_1395gi001 [...   307   2e-81   
gi|83032719|ref|XP_729163.1| hairy cell leukemia protein 1 [Plas...   307   2e-81   
gi|512190132|gb|EPE05897.1| tgf beta-inducible nuclear protein 1...   306   2e-81   
gi|401828064|ref|XP_003888324.1| putative 40S ribosomal protein ...   306   4e-81   
gi|457867560|ref|XP_004220703.1| ribosomal protein S8e, partial ...   305   5e-81   
gi|342326366|gb|AEL23098.1| ribosome biogenesis protein NSA2-lik...   305   8e-81   
gi|396082441|gb|AFN84050.1| ribosomal protein S8e [Encephalitozo...   305   8e-81   
gi|315042470|ref|XP_003170611.1| ribosome biogenesis protein NSA...   304   1e-80   
gi|336273924|ref|XP_003351716.1| ribosome biogenesis protein NSA...   304   1e-80   
gi|303316091|ref|XP_003068050.1| ribosome biogenesis protein NSA...   304   1e-80   
gi|302502768|ref|XP_003013345.1| hypothetical protein ARB_00530 ...   303   3e-80   
gi|296807361|ref|XP_002844200.1| ribosome biogenesis protein NSA...   303   3e-80   
gi|507649893|ref|XP_004703732.1| PREDICTED: ribosome biogenesis ...   303   4e-80   
gi|303391397|ref|XP_003073928.1| ribosome biogenesis protein NSA...   301   1e-79   
gi|444728528|gb|ELW68984.1| Ribosome biogenesis protein NSA2 lik...   298   1e-78   
gi|358339378|dbj|GAA47453.1| ribosome biogenesis protein NSA2 [C...   298   1e-78   
gi|320588180|gb|EFX00655.1| 40S ribosomal protein [Grosmannia cl...   295   7e-78   
gi|444730389|gb|ELW70775.1| Ribosome biogenesis protein NSA2 lik...   295   1e-77   
gi|387593589|gb|EIJ88613.1| 30S ribosomal protein S8e [Nematocid...   294   1e-77   
gi|510908867|ref|XP_004832572.1| conserved hypothetical protein ...   294   1e-77   
gi|429963379|gb|ELA42923.1| hypothetical protein VICG_00238 [Vit...   293   2e-77   
gi|154414029|ref|XP_001580043.1| hypothetical protein [Trichomon...   293   2e-77   
gi|156062578|ref|XP_001597211.1| ribosome biogenesis protein NSA...   288   1e-75   
gi|116192293|ref|XP_001221959.1| hypothetical protein CHGG_05864...   285   7e-75   
gi|148677766|gb|EDL09713.1| mCG125162 [Mus musculus]                  285   7e-75   
gi|401884677|gb|EJT48827.1| hypothetical protein A1Q1_02162 [Tri...   284   1e-74   
gi|429965462|gb|ELA47459.1| hypothetical protein VCUG_01110 [Vav...   283   2e-74   
gi|258564360|ref|XP_002582925.1| TGF beta-inducible nuclear prot...   283   3e-74   
gi|406694267|gb|EKC97598.1| hypothetical protein A1Q2_08136 [Tri...   283   3e-74   
gi|238484759|ref|XP_002373618.1| ribosome biogenesis protein NSA...   283   4e-74   
gi|429854337|gb|ELA29357.1| 40s ribosomal protein [Colletotrichu...   281   8e-74   
gi|238571463|ref|XP_002387045.1| hypothetical protein MPER_14452...   273   2e-71   
gi|344247374|gb|EGW03478.1| Ribosome biogenesis protein NSA2-lik...   273   3e-71   
gi|395735915|ref|XP_003780338.1| PREDICTED: LOW QUALITY PROTEIN:...   273   4e-71   
gi|94442902|emb|CAJ91144.1| TGF-beta inducible protein [Platanus...   271   9e-71   
gi|145490604|ref|XP_001431302.1| hypothetical protein [Parameciu...   268   1e-69   
gi|361127329|gb|EHK99302.1| putative Ribosome biogenesis protein...   259   6e-67   
gi|169806551|ref|XP_001828020.1| ribosome biogenesis protein NSA...   258   1e-66   
gi|322712708|gb|EFZ04281.1| Ribosome biogenesis protein nsa2 [Me...   255   7e-66   
gi|478269870|gb|ENN83414.1| hypothetical protein YQE_00228, part...   254   2e-65   
gi|440492454|gb|ELQ75019.1| hypothetical protein THOM_2062, part...   252   7e-65   
gi|351695997|gb|EHA98915.1| Ribosome biogenesis protein NSA2-lik...   251   9e-65   
gi|395825690|ref|XP_003786056.1| PREDICTED: ribosome biogenesis ...   249   4e-64   
gi|490262987|gb|AGL09516.1| ribosomal protein S8e family protein...   247   2e-63   
gi|490262973|gb|AGL09510.1| ribosomal protein S8e family protein...   247   2e-63   
gi|490262992|gb|AGL09518.1| ribosomal protein S8e family protein...   246   4e-63   
gi|490262976|gb|AGL09511.1| ribosomal protein S8e family protein...   246   4e-63   
gi|490262989|gb|AGL09517.1| ribosomal protein S8e family protein...   244   1e-62   
gi|511931133|ref|XP_004784591.1| PREDICTED: LOW QUALITY PROTEIN:...   244   2e-62   
gi|490262996|gb|AGL09520.1| ribosomal protein S8e family protein...   243   3e-62   
gi|444722400|gb|ELW63097.1| Ribosome biogenesis protein NSA2 lik...   241   9e-62   
gi|490262994|gb|AGL09519.1| ribosomal protein S8e family protein...   239   7e-61   
gi|490263000|gb|AGL09522.1| ribosomal protein S8e family protein...   238   1e-60   
gi|490262978|gb|AGL09512.1| ribosomal protein S8e family protein...   237   2e-60   
gi|410651502|ref|NP_001258594.1| ribosome biogenesis protein NSA...   237   2e-60   
gi|358340953|dbj|GAA48742.1| ribosome biogenesis protein NSA2 [C...   237   2e-60   
gi|490262985|gb|AGL09515.1| ribosomal protein S8e family protein...   236   5e-60   
gi|327358531|gb|AEA51112.1| TGF-beta-inducible nuclear protein 1...   234   2e-59   
gi|407262866|ref|XP_003945373.1| PREDICTED: ribosome biogenesis ...   233   4e-59   
gi|511902885|ref|XP_004770949.1| PREDICTED: ribosome biogenesis ...   232   8e-59   
gi|407260969|ref|XP_003946107.1| PREDICTED: ribosome biogenesis ...   230   3e-58   
gi|37779040|gb|AAP20180.1| hypothetical protein [Pagrus major]        229   4e-58   
gi|430810879|emb|CCJ31587.1| unnamed protein product, partial [P...   227   2e-57   
gi|414888075|tpg|DAA64089.1| TPA: hypothetical protein ZEAMMB73_...   224   2e-56   
gi|378755178|gb|EHY65205.1| 30S ribosomal protein S8e [Nematocid...   219   5e-55   
gi|217069876|gb|ACJ83298.1| unknown [Medicago truncatula]             219   7e-55   
gi|68478741|ref|XP_716639.1| potential ribosome maturation facto...   218   1e-54   
gi|440902724|gb|ELR53479.1| Ribosome biogenesis protein NSA2-lik...   215   9e-54   
gi|70922462|ref|XP_734393.1| hypothetical protein [Plasmodium ch...   214   1e-53   
gi|401405140|ref|XP_003882020.1| putative TGF-beta-inducible nuc...   214   2e-53   
gi|422293641|gb|EKU20941.1| ribosome biogenesis nsa2-like protei...   212   6e-53   
gi|345318630|ref|XP_001506501.2| PREDICTED: ribosome biogenesis ...   209   4e-52   
gi|293350685|ref|XP_002727567.1| PREDICTED: ribosome biogenesis ...   205   7e-51   
gi|224140026|ref|XP_002323388.1| predicted protein [Populus tric...   196   3e-48   
gi|148680980|gb|EDL12927.1| mCG50381 [Mus musculus]                   192   5e-47   
gi|444516113|gb|ELV11057.1| Ribosome biogenesis protein NSA2 lik...   189   7e-46   
gi|444721927|gb|ELW62634.1| Ribosome biogenesis protein NSA2 lik...   186   3e-45   
gi|490262980|gb|AGL09513.1| ribosomal protein S8e family protein...   186   5e-45   
gi|395544454|ref|XP_003774125.1| PREDICTED: LOW QUALITY PROTEIN:...   186   7e-45   
gi|5931739|emb|CAB56622.1| CDK105 [Rattus norvegicus]                 180   4e-43   
gi|484856868|gb|EOB14629.1| Ribosome biogenesis protein NSA2 [No...   179   5e-43   
gi|397577231|gb|EJK50512.1| hypothetical protein THAOC_30488, pa...   179   6e-43   
gi|80474402|gb|AAI08366.1| 5730427N09Rik protein [Mus musculus]       174   2e-41   


>gi|384496600|gb|EIE87091.1| 30S ribosomal protein S8e [Rhizopus delemar RA 99-880]
          Length = 260

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 209/260 (80%), Positives = 234/260 (90%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IEE IK+HGRRLDY            H +S  AQK+HG++AKL+NKKRHAEKI+
Sbjct: 1   MPQNEHIEEHIKRHGRRLDYEERKRKREARMAHKSSQIAQKLHGLKAKLHNKKRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IKQH+EK+ KQK   AVPEGA+P YLLDREG+ RAKILSNM+KQKRKEKAGKW+VP
Sbjct: 61  MKKAIKQHEEKNAKQKTADAVPEGAVPTYLLDREGEDRAKILSNMVKQKRKEKAGKWSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP VRGIAEDEMFKV+K+GKN++KQWKR++TKATFVG+GFTRKPPKYERF+RPMALRYKK
Sbjct: 121 LPTVRGIAEDEMFKVMKSGKNKSKQWKRLVTKATFVGEGFTRKPPKYERFVRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNPQSPLYTQLGV+TKGTV+EVNVSELGLVTT GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIIGVKKNPQSPLYTQLGVITKGTVLEVNVSELGLVTTGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|384493321|gb|EIE83812.1| 30S ribosomal protein S8e [Rhizopus delemar RA 99-880]
          Length = 260

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 209/260 (80%), Positives = 233/260 (89%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IEE IK+HGRRLDY            H +S  AQK+HG++AKL+NKKRHAEKI+
Sbjct: 1   MPQNEHIEEHIKRHGRRLDYEERKRKKEARMAHKSSQIAQKLHGLKAKLHNKKRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IKQH+EK+ KQK   AVPEGA+P YLLDREG+ RAKILSNM+KQKRKEKAGKW+VP
Sbjct: 61  MKKAIKQHEEKNAKQKTADAVPEGAVPTYLLDREGEDRAKILSNMVKQKRKEKAGKWSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP VRGIAEDEMFKV+KTGKN++KQWKR++TKATFVG+GFTRKPPKYERF+RPM LRYKK
Sbjct: 121 LPTVRGIAEDEMFKVMKTGKNKSKQWKRLVTKATFVGEGFTRKPPKYERFVRPMGLRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNPQSPLYTQLGV+TKGTV+EVNVSELGLVTT GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIIGVKKNPQSPLYTQLGVITKGTVLEVNVSELGLVTTGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|511001693|gb|EPB83157.1| ribosome biogenesis protein N [Mucor circinelloides f.
           circinelloides 1006PhL]
 gi|511002634|gb|EPB84063.1| ribosome biogenesis protein N [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 260

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/260 (80%), Positives = 232/260 (89%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IEE IK+HGRRLDY            H  S +AQKVHG++AK+ NKKRHAEKI+
Sbjct: 1   MPQNEHIEEHIKRHGRRLDYEERKRKREARQAHKASQYAQKVHGLKAKMLNKKRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IKQH+EK+ KQK   A+PEGA+P YLLDREG+ RAKILSNM+KQKRKEKAGKW+VP
Sbjct: 61  MKKTIKQHEEKNAKQKSADAIPEGAVPTYLLDREGEDRAKILSNMVKQKRKEKAGKWSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP VRG+AEDEMFKVVKTGK++TKQWKR++TKATFVG+GFTRKPPKYERF+RPM LRYKK
Sbjct: 121 LPTVRGMAEDEMFKVVKTGKHKTKQWKRLVTKATFVGEGFTRKPPKYERFVRPMGLRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNPQSPLYTQLGV+TKGTV+EVNVSELGLVTT GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIIGVKKNPQSPLYTQLGVITKGTVLEVNVSELGLVTTGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|470323579|ref|XP_004349529.1| TGF beta-inducible nuclear protein 1 [Capsaspora owczarzaki ATCC
           30864]
 gi|320167852|gb|EFW44751.1| TGF beta-inducible nuclear protein 1 [Capsaspora owczarzaki ATCC
           30864]
          Length = 272

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/260 (77%), Positives = 228/260 (87%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           +PQNEYIE++ K+HG R+D+            H+ S +AQ V G++AKLYNKKRH EKIE
Sbjct: 13  VPQNEYIEQARKRHGYRMDHFERLRKREAREGHNRSEYAQNVTGLKAKLYNKKRHTEKIE 72

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK HQE+S KQKDD AVP+GA+PAYLLDREGQ RAK+LSNM+KQKRKEKAGKW+VP
Sbjct: 73  MKKTIKMHQERSNKQKDDSAVPQGAVPAYLLDREGQSRAKVLSNMVKQKRKEKAGKWDVP 132

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGI E E+F+VVKTGK + K WKRM+TKATFVG+GFTRKPPKYERFIRPM LR+KK
Sbjct: 133 LPKVRGIGESEVFRVVKTGKRKIKGWKRMVTKATFVGEGFTRKPPKYERFIRPMGLRFKK 192

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNPQSPLYTQLGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 193 AHVTHPELSATFCLPIVGVKKNPQSPLYTQLGVITKGTIIEVNVSELGLVTQNGKVVWGK 252

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 253 YAQVTNNPENDGCINAVLLV 272



>gi|328772985|gb|EGF83022.1| hypothetical protein BATDEDRAFT_84545 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 261

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 201/261 (77%), Positives = 228/261 (87%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQN YIEE+IKKHGRRLD+            H TSA AQK+HG +AKLYNKKRH+EKI+
Sbjct: 1   MPQNFYIEEAIKKHGRRLDHEERKRKREAREVHKTSAKAQKLHGFKAKLYNKKRHSEKIQ 60

Query: 61  MKKKIKQHQEKSTKQK-DDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           MKK IK H+E++ K K +DQ V EGA+P YLLDRE Q RAK+LSNMIKQKRKEKAGKW V
Sbjct: 61  MKKTIKMHEERNNKHKTNDQPVQEGAVPTYLLDRENQTRAKVLSNMIKQKRKEKAGKWQV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PLPKV+G+ E E+FKVV++GK + KQWKR++TKATFVG+GFTRKPPKYERFIRPMALRYK
Sbjct: 121 PLPKVKGMDEAEVFKVVRSGKRKIKQWKRIVTKATFVGEGFTRKPPKYERFIRPMALRYK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KAHVTHPELGATFCLPI+GVKKNP SP+YTQLGV+TKGTVIEVNVSELGLVT +GKVVWG
Sbjct: 181 KAHVTHPELGATFCLPILGVKKNPSSPMYTQLGVMTKGTVIEVNVSELGLVTQTGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQ+TNNPENDGC+NAVLLV
Sbjct: 241 KYAQITNNPENDGCINAVLLV 261



>gi|156364831|ref|XP_001626548.1| predicted protein [Nematostella vectensis]
 gi|156213428|gb|EDO34448.1| predicted protein [Nematostella vectensis]
          Length = 260

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/260 (75%), Positives = 225/260 (86%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE+S K+HG RLD+            H  +  A+K+HG++AKLYNKKRHAEK++
Sbjct: 1   MPQNEHIEQSRKRHGYRLDHFERKRKKEGRQPHEQAERAKKLHGLKAKLYNKKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+EK TK ++++ VPEGA+PAYLLDREGQ RAK+LSNM+KQKRKEKAGKW+VP
Sbjct: 61  MKKTMKLHEEKKTKARNNEKVPEGAVPAYLLDREGQSRAKVLSNMVKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR + EDE+FKV+KTGK R K WKRM+TKA FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAVGEDEVFKVIKTGKTRRKGWKRMVTKACFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNPQS LYTQLGV+TKGTV+EVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIIGVKKNPQSSLYTQLGVITKGTVVEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|443715026|gb|ELU07178.1| hypothetical protein CAPTEDRAFT_183717 [Capitella teleta]
          Length = 269

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/259 (73%), Positives = 222/259 (85%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNE+IE+ I++HGRRLDY            H  S  AQ + G++AK+Y+KKR +EK++M
Sbjct: 11  PQNEHIEQHIRRHGRRLDYHEKKRKKESREAHERSKKAQGLKGLKAKIYHKKRQSEKVQM 70

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           K+ IK HQ++ TKQK ++ VPEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW+VPL
Sbjct: 71  KRTIKMHQQRKTKQKTEENVPEGAVPAYLLDREGQTRAKVLSNMIKQKRKEKAGKWDVPL 130

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKV+G++E ++FKVVKTGK R K WKRM+TKA FVG+GFTRKPPKYERFIRPM LR KKA
Sbjct: 131 PKVKGVSESDVFKVVKTGKTRRKGWKRMVTKACFVGEGFTRKPPKYERFIRPMGLRVKKA 190

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SP+YTQLGVLTKGT+IEVNVSELG+VT  GKVVWGK+
Sbjct: 191 HVTHPELKATFCLPILGVKKNPTSPMYTQLGVLTKGTIIEVNVSELGMVTQGGKVVWGKF 250

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGCVNAVLLV
Sbjct: 251 AQVTNNPENDGCVNAVLLV 269



>gi|405974460|gb|EKC39103.1| Ribosome biogenesis protein NSA2-like protein [Crassostrea gigas]
          Length = 260

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 220/260 (84%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLDY            H  +  A+K+ GIRAKLYNKKRHAEK++
Sbjct: 1   MPQNEHIELHRKRHGYRLDYHERKRKKEGRKAHEMAEKAKKLRGIRAKLYNKKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+E+ TKQK++  VPEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKTIKMHEERKTKQKNNDEVPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRG++E E+FKV+K+GK + K WKRM+TK  +VG+GFTRKPPK+ERFIRPM LR+ K
Sbjct: 121 LPKVRGMSEAEVFKVIKSGKTKRKGWKRMVTKVCYVGEGFTRKPPKFERFIRPMGLRFNK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGT+IEVN+SELGLVT +GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPIIGVKKNPTSTMYTSLGVITKGTIIEVNISELGLVTQAGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|317575593|ref|NP_001187984.1| ribosome biogenesis protein NSA2 homolog [Ictalurus punctatus]
 gi|308324517|gb|ADO29393.1| ribosome biogenesis protein nsa2-like protein [Ictalurus punctatus]
          Length = 260

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/260 (73%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++AKLYNK+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHERKRKKESREAHERSHKAKKLIGLKAKLYNKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK HQ++ TKQKDD   PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHQQRRTKQKDDDKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVN+SELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNISELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|72013892|ref|XP_783243.1| PREDICTED: ribosome biogenesis protein NSA2 homolog
           [Strongylocentrotus purpuratus]
          Length = 260

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 222/260 (85%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++G+RLD+            H  +  A+ + GI+AKLYNKKRH EKI+
Sbjct: 1   MPQNEHIELHRKRYGQRLDHEERKRKKEAREPHERAHKARMLTGIKAKLYNKKRHNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+EK TK+++ + VPEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKTIKMHEEKKTKKRNKEEVPEGAVPAYLLDREGQTRAKVLSNMIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRG  E+E+FKV++TGK +TK WKRM+TK T+VG+GFTRKPPKYERFIRPMALR+KK
Sbjct: 121 LPKVRGQGENEVFKVIRTGKRKTKAWKRMVTKVTYVGEGFTRKPPKYERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLP+IGVKKNP SP+YT LGV+TKGT+IEVNVSELG+VT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPLIGVKKNPSSPMYTSLGVITKGTIIEVNVSELGMVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|167518800|ref|XP_001743740.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163777702|gb|EDQ91318.1| predicted protein [Monosiga brevicollis MX1]
          Length = 260

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/260 (73%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   K HGRR+D+            H  S  AQK+ G++AKL NKKRHAEKI+
Sbjct: 1   MPQNEYMERHRKLHGRRMDHEERLRKKEARSAHRASEQAQKLRGLKAKLLNKKRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I  H+EK +K +    VP+GAIPAYL+DREG+ RAK LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKTIAMHEEKKSKLRKTPDVPDGAIPAYLMDREGEARAKALSNMIKQKRKEKAGKWSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR + EDE+ KVV+TGK + K WKRMITK TFVG+GFTRKPPKYERF+RPMALR KK
Sbjct: 121 LPKVRAMGEDEVMKVVRTGKRQKKAWKRMITKHTFVGEGFTRKPPKYERFVRPMALRTKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP SP++TQLGV+TKGT+IEVNVSELGLVTT GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIIGVKKNPNSPMFTQLGVITKGTIIEVNVSELGLVTTGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|308321383|gb|ADO27843.1| ribosome biogenesis protein nsa2-like protein [Ictalurus furcatus]
          Length = 260

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++AKLYNK+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHERKRKKESREAHERSHKAKKLIGLKAKLYNKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK HQ++ TKQ+DD   PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHQQRRTKQRDDAKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVN+SELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNISELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|471368047|ref|XP_004374552.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Trichechus
           manatus latirostris]
          Length = 260

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K+HG RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRHGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|128485562|ref|NP_599242.2| ribosome biogenesis protein NSA2 homolog [Rattus norvegicus]
 gi|148540168|ref|NP_067527.3| ribosome biogenesis protein NSA2 homolog [Mus musculus]
 gi|82922210|ref|XP_920204.1| PREDICTED: ribosome biogenesis protein NSA2 homolog isoform 1 [Mus
           musculus]
 gi|34925411|sp|Q9CR47.1|NSA2_MOUSE RecName: Full=Ribosome biogenesis protein NSA2 homolog; AltName:
           Full=L-name-related protein 42; Short=LNR42; AltName:
           Full=TGF-beta-inducible nuclear protein 1
 gi|12849836|dbj|BAB28500.1| unnamed protein product [Mus musculus]
 gi|12852013|dbj|BAB29237.1| unnamed protein product [Mus musculus]
 gi|26347269|dbj|BAC37283.1| unnamed protein product [Mus musculus]
 gi|86129704|gb|ABC86561.1| TGF beta-inducible nuclear protein [Rattus norvegicus]
 gi|117558655|gb|AAI26977.1| RIKEN cDNA 5730427N09 gene [Mus musculus]
 gi|148668559|gb|EDL00878.1| mCG114602 [Mus musculus]
 gi|148693548|gb|EDL25495.1| mCG15429 [Mus musculus]
 gi|148709646|gb|EDL41592.1| mCG8932 [Mus musculus]
 gi|149059121|gb|EDM10128.1| rCG44568 [Rattus norvegicus]
          Length = 260

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQKDD+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|336371552|gb|EGN99891.1| hypothetical protein SERLA73DRAFT_180173 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336384311|gb|EGO25459.1| hypothetical protein SERLADRAFT_465654 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 260

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/260 (73%), Positives = 219/260 (84%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLDY            H  SA AQK  G++AKL + KRHAEK++
Sbjct: 1   MPQNEYIEEHIKRHGRRLDYYERKRKKEARAVHRASATAQKAFGLKAKLLHAKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK +K H E++ KQ D   VPEGA+P YLLDREGQK AK LS+ IKQKRK+KA K+ VP
Sbjct: 61  LKKTLKAHDERNVKQADSSTVPEGALPTYLLDREGQKDAKALSSAIKQKRKDKAAKYAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKV++TGK+++K WKRM+TKATFVG+GFTRKP K ERFIRPMALRYKK
Sbjct: 121 LPKVRGIAEDEMFKVMRTGKSKSKAWKRMVTKATFVGEGFTRKPVKMERFIRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VTT GKVV+GK
Sbjct: 181 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTTGGKVVFGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|327262989|ref|XP_003216304.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Anolis
           carolinensis]
          Length = 260

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 VPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTSLGVITKGTVIEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|387762960|ref|NP_001248690.1| ribosome biogenesis protein NSA2 homolog [Macaca mulatta]
 gi|402871852|ref|XP_003899862.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Papio anubis]
          Length = 260

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KVV+TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVVRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|62859971|ref|NP_001017326.1| NSA2 ribosome biogenesis homolog [Xenopus (Silurana) tropicalis]
 gi|89272759|emb|CAJ83866.1| TGF beta-inducible nuclear protein 1 [Xenopus (Silurana)
           tropicalis]
 gi|134025771|gb|AAI35792.1| TGF beta-inducible nuclear protein 1 [Xenopus (Silurana)
           tropicalis]
          Length = 260

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQN+YIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNDYIELHRKRYGYRLDYHEKKRKKESREAHERSQKAKKLIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPEGAVPAYLLDREGQTRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|7662677|ref|NP_055701.1| ribosome biogenesis protein NSA2 homolog isoform 1 [Homo sapiens]
 gi|350539367|ref|NP_001233567.1| ribosome biogenesis protein NSA2 homolog [Pan troglodytes]
 gi|296194335|ref|XP_002744907.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Callithrix
           jacchus]
 gi|344272657|ref|XP_003408148.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Loxodonta
           africana]
 gi|397478370|ref|XP_003810521.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Pan paniscus]
 gi|403256466|ref|XP_003920897.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Saimiri
           boliviensis boliviensis]
 gi|512852630|ref|XP_004887605.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Heterocephalus
           glaber]
 gi|513026054|ref|XP_004874204.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Heterocephalus
           glaber]
 gi|34925050|sp|O95478.1|NSA2_HUMAN RecName: Full=Ribosome biogenesis protein NSA2 homolog; AltName:
           Full=Hairy cell leukemia protein 1; AltName:
           Full=TGF-beta-inducible nuclear protein 1
 gi|11999092|gb|AAG43048.1|AF077615_1 TGF beta inducible nuclear protein TINP1 [Homo sapiens]
 gi|14091475|gb|AAK53761.1|AF372458_1 hairy cell leukemia protein 1 [Homo sapiens]
 gi|3881976|emb|CAA10008.1| hypothetical protein [Homo sapiens]
 gi|13528996|gb|AAH05288.1| TGF beta-inducible nuclear protein 1 [Homo sapiens]
 gi|41323756|gb|AAS00024.1| TGF-beta inducible nuclear protein [Homo sapiens]
 gi|119616155|gb|EAW95749.1| TGF beta-inducible nuclear protein 1 [Homo sapiens]
 gi|189054015|dbj|BAG36522.1| unnamed protein product [Homo sapiens]
 gi|312150720|gb|ADQ31872.1| TGF beta-inducible nuclear protein 1 [synthetic construct]
 gi|343958636|dbj|BAK63173.1| TGF-beta-inducible nuclear protein 1 [Pan troglodytes]
          Length = 260

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|410948810|ref|XP_003981122.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Felis catus]
          Length = 260

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTSLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|432884751|ref|XP_004074570.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Oryzias
           latipes]
          Length = 260

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHERKRKKESREAHERSHKAKKLIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+++ TKQK+D   PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRKTKQKNDDKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV+KTGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIKTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTSLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|488510108|ref|XP_004447146.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Dasypus
           novemcinctus]
          Length = 260

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGT+IEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTIIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|466014066|ref|XP_004270862.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Orcinus orca]
 gi|470615160|ref|XP_004316946.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Tursiops
           truncatus]
          Length = 260

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTALGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|229366240|gb|ACQ58100.1| TGF-beta-inducible nuclear protein 1 [Anoplopoma fimbria]
          Length = 260

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H+ S  A+K+ G++AKLY+K+RH+EKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHEKKRKKESREVHARSHKARKLIGLKAKLYHKQRHSEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+++ TKQK+D+  PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRRTKQKNDEKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV+KTGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIKTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTV+EVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTSLGVITKGTVVEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|291409757|ref|XP_002721160.1| PREDICTED: NSA2 ribosome biogenesis homolog [Oryctolagus cuniculus]
          Length = 260

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPKGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|68534732|gb|AAH98657.1| Cdk105 protein [Rattus norvegicus]
          Length = 260

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQKDD+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLV   GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVAQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|77736039|ref|NP_001029718.1| ribosome biogenesis protein NSA2 homolog [Bos taurus]
 gi|73949746|ref|XP_850805.1| PREDICTED: ribosome biogenesis protein NSA2 homolog isoform 2
           [Canis lupus familiaris]
 gi|149726539|ref|XP_001504729.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Equus
           caballus]
 gi|311249668|ref|XP_003123751.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Sus scrofa]
 gi|472393834|ref|XP_004416179.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Odobenus
           rosmarus divergens]
 gi|511894583|ref|XP_004766920.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Mustela
           putorius furo]
 gi|91208027|sp|Q3SX11.1|NSA2_BOVIN RecName: Full=Ribosome biogenesis protein NSA2 homolog; AltName:
           Full=TGF-beta-inducible nuclear protein 1
 gi|74356279|gb|AAI04564.1| TGF beta-inducible nuclear protein 1 (L-name related LNR42) [Bos
           taurus]
 gi|296475430|tpg|DAA17545.1| TPA: NSA2 ribosome biogenesis homolog [Bos taurus]
 gi|296475919|tpg|DAA18034.1| TPA: ribosome biogenesis protein NSA2 homolog [Bos taurus]
 gi|431907830|gb|ELK11437.1| Ribosome biogenesis protein NSA2 like protein [Pteropus alecto]
          Length = 260

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|507534802|ref|XP_004651445.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Jaculus
           jaculus]
          Length = 426

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/259 (72%), Positives = 216/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 168 PQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 227

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQKDD+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 228 KKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 287

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 288 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 347

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 348 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 407

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 408 AQVTNNPENDGCINAVLLV 426



>gi|354491792|ref|XP_003508038.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Cricetulus
           griseus]
          Length = 260

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D   P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDDKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|348552286|ref|XP_003461959.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Cavia
           porcellus]
          Length = 343

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/259 (72%), Positives = 216/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 85  PQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 144

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 145 KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 204

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 205 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 264

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 265 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 324

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 325 AQVTNNPENDGCINAVLLV 343



>gi|512006079|ref|XP_004820477.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Mustela
           putorius furo]
          Length = 260

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVYFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|392569720|gb|EIW62893.1| TGF beta-inducible nuclear protein 1 [Trametes versicolor FP-101664
           SS1]
          Length = 260

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 218/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLDY            H +SA AQK  G++AK+ + KRHAEK++
Sbjct: 1   MPQNEYIEEHIKRHGRRLDYFEKKRKREAREAHRSSAVAQKAFGLKAKILHAKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E++ KQKD  + PEGA+P YLLDREGQK AK LS  IK+KRK+KA K+ VP
Sbjct: 61  MKKTLKAHDERNVKQKDSSSAPEGALPTYLLDREGQKDAKALSTAIKEKRKDKAAKYAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKV++TGK++ K WKRM+TKATFVG+GFTRKP K ERFIRPMALRYKK
Sbjct: 121 LPKVRGIAEDEMFKVMRTGKSKKKAWKRMVTKATFVGEGFTRKPVKMERFIRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VT  GKVV+GK
Sbjct: 181 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTAGGKVVFGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGC+NAVLLV
Sbjct: 241 YAQITNNPENDGCINAVLLV 260



>gi|465967573|gb|EMP31416.1| Ribosome biogenesis protein NSA2 like protein [Chelonia mydas]
          Length = 275

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQN+YIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 16  MPQNDYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKLIGLKAKLYHKQRHAEKIQ 75

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 76  MKKTIKMHEKRNTKQKNDEKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 135

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 136 VPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 195

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 196 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 255

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 256 YAQVTNNPENDGCINAVLLV 275



>gi|410903652|ref|XP_003965307.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Takifugu
           rubripes]
          Length = 260

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHEKKRKKESREAHERSHKARKLIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D   P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRNTKQKNDDKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV+KTGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIKTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLP++GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPLLGVKKNPSSPLYTSLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|332233849|ref|XP_003266117.1| PREDICTED: ribosome biogenesis protein NSA2 homolog isoform 1
           [Nomascus leucogenys]
          Length = 260

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKIHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLL+
Sbjct: 241 YAQVTNNPENDGCINAVLLI 260



>gi|332244783|ref|XP_003271553.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Nomascus
           leucogenys]
          Length = 260

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/260 (71%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYI+   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIQLHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLL+
Sbjct: 241 YAQVTNNPENDGCINAVLLI 260



>gi|209733510|gb|ACI67624.1| Ribosome biogenesis protein NSA2 homolog [Salmo salar]
          Length = 260

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/260 (71%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG+RLD+            H  S  A+K+ G++AKLY+K+RH+EKI+
Sbjct: 1   MPQNEHIELHRKRHGQRLDHQERKRKKESREAHERSHKARKMIGLKAKLYHKQRHSEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+++ TKQK+D   PEGA+PAYLLDREGQ RAKILSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTLKMHEQRKTKQKNDDKTPEGAVPAYLLDREGQSRAKILSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TKA FVGD FTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKACFVGDNFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTV+EVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVVEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|395510515|ref|XP_003759520.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Sarcophilus
           harrisii]
          Length = 306

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/259 (72%), Positives = 216/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 48  PQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 107

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 108 KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 167

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 168 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 227

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 228 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 287

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 288 AQVTNNPENDGCINAVLLV 306



>gi|301763671|ref|XP_002917254.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Ailuropoda
           melanoleuca]
          Length = 260

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K+ G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRCGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|291290923|ref|NP_001167492.1| NSA2 ribosome biogenesis homolog [Xenopus laevis]
 gi|49118803|gb|AAH73255.1| Unknown (protein for MGC:80606) [Xenopus laevis]
          Length = 260

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQN+YIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNDYIELHRKRYGYRLDYHEKKRKKESREAHERSQKAKKLIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H++++TKQK+++  PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTLKMHEKRNTKQKNEEKTPEGAVPAYLLDREGQTRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|507641045|ref|XP_004701549.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Echinops
           telfairi]
          Length = 260

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRYGYRLDYHERKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|34924868|sp|Q9QYU7.2|NSA2_RAT RecName: Full=Ribosome biogenesis protein NSA2 homolog; AltName:
           Full=Protein CDK105; AltName: Full=TGF-beta-inducible
           nuclear protein 1
          Length = 260

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/260 (71%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQKDD+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW  P
Sbjct: 61  MKKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWESP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K W+RM+TK  FVGDGFTRKPPKYE+FIRPM LR+KK
Sbjct: 121 LPKVRAQGETELLKVIRTGKRKKKAWRRMVTKVCFVGDGFTRKPPKYEKFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|12856931|dbj|BAB30834.1| unnamed protein product [Mus musculus]
          Length = 260

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQKDD+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+ GK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQEGKVICGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|221114265|ref|XP_002157278.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Hydra
           magnipapillata]
          Length = 260

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/260 (73%), Positives = 222/260 (85%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE SIK+HGR+LDY            H  +  A+K+ G++AK+YNKKRHAEK++
Sbjct: 1   MPQNEHIELSIKRHGRQLDYHEKRRKKEGREPHKLALKAKKLIGLKAKIYNKKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK +K H+EK TK KD    PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  LKKTLKMHEEKKTKTKDTSKTPEGAVPAYLLDREGQTRAKVLSNMIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKV+ I EDE+F+VV+TGK++ K WKRM+TK T+VGD FTRKPPK+ERFIRPM LR+KK
Sbjct: 121 LPKVKAIGEDEVFRVVRTGKSKRKCWKRMVTKVTYVGDEFTRKPPKFERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNPQSP+YT LGV+TKGTVIEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIIGVKKNPQSPMYTSLGVITKGTVIEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|478492474|ref|XP_004420595.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Ceratotherium
           simum simum]
          Length = 261

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/259 (72%), Positives = 216/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 3   PQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 62

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 63  KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 122

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 123 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 182

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 183 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 242

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 243 AQVTNNPENDGCINAVLLV 261



>gi|344247161|gb|EGW03265.1| Ribosome biogenesis protein NSA2-like [Cricetulus griseus]
          Length = 260

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/259 (72%), Positives = 215/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 2   PQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 61

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D   P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 62  KKTIKMHEKRNTKQKNDDKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 121

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 122 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 181

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 182 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 241

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 242 AQVTNNPENDGCINAVLLV 260



>gi|504147826|ref|XP_004586325.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Ochotona
           princeps]
          Length = 280

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/259 (72%), Positives = 216/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 22  PQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 81

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 82  KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 141

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 142 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 201

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 202 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 261

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 262 AQVTNNPENDGCINAVLLV 280



>gi|348524400|ref|XP_003449711.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Oreochromis
           niloticus]
 gi|498980884|ref|XP_004549924.1| PREDICTED: ribosome biogenesis protein NSA2 homolog isoform X2
           [Maylandia zebra]
          Length = 260

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 214/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHERKRKKESREAHERSHKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+++ TKQK+D   PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRKTKQKNDDKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRP  LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTSLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|299751221|ref|XP_002911607.1| ribosome biogenesis protein NSA2 [Coprinopsis cinerea okayama7#130]
 gi|298409275|gb|EFI28113.1| hypothetical protein CC1G_14140 [Coprinopsis cinerea okayama7#130]
          Length = 292

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 220/260 (84%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLDY            H  SA AQK+ GI+AK+ + KRHAEK++
Sbjct: 33  MPQNEYIEEHIKRHGRRLDYFERKRKREARAVHKQSAVAQKLFGIKAKILHAKRHAEKVQ 92

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E++ KQ D  AV + A+P YLLDRE QK AK LS+ IKQKRK+KA K++VP
Sbjct: 93  MKKTLKAHDERNVKQPDTAAVSQDALPTYLLDRENQKDAKALSSAIKQKRKDKAAKYSVP 152

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKV++TGK+++K WKRM+TKATFVG+GFTRKPPK ERF+RPMALRYKK
Sbjct: 153 LPKVRGIAEDEMFKVMRTGKSKSKSWKRMVTKATFVGEGFTRKPPKMERFVRPMALRYKK 212

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VTT GKVV+GK
Sbjct: 213 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTTGGKVVFGK 272

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGC+NAVLLV
Sbjct: 273 YAQITNNPENDGCINAVLLV 292



>gi|355749994|gb|EHH54332.1| TGF-beta-inducible nuclear protein 1, partial [Macaca fascicularis]
          Length = 259

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/259 (72%), Positives = 215/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 1   PQNEYIELHHKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 60

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 61  KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 120

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KVV+TG  + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 121 PKVRAQGETEVLKVVRTGNRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 180

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 181 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 240

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 241 AQVTNNPENDGCINAVLLV 259



>gi|126320630|ref|XP_001368321.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Monodelphis
           domestica]
          Length = 357

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/259 (72%), Positives = 216/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 99  PQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 158

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 159 KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 218

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 219 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 278

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 279 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 338

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 339 AQVTNNPENDGCINAVLLV 357



>gi|225715214|gb|ACO13453.1| Ribosome biogenesis protein NSA2 homolog [Esox lucius]
          Length = 260

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/260 (71%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG+RLD+            H  S  A+K+ G++AKLY+K+RH+EKI+
Sbjct: 1   MPQNEHIELHRKRHGQRLDHHERKRKKESREAHERSHKARKMIGLKAKLYHKQRHSEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+++ TKQK+D   PEGA+PAYLLDREGQ RAKILSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTLKMHEQRKTKQKNDDKTPEGAVPAYLLDREGQSRAKILSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGD FTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDNFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|213514458|ref|NP_001134933.1| ribosome biogenesis protein NSA2 homolog [Salmo salar]
 gi|197632297|gb|ACH70872.1| TGF beta-inducible nuclear protein 1 [Salmo salar]
 gi|209732090|gb|ACI66914.1| Ribosome biogenesis protein NSA2 homolog [Salmo salar]
 gi|209737356|gb|ACI69547.1| Ribosome biogenesis protein NSA2 homolog [Salmo salar]
          Length = 260

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG+RLD+            H  S  A+K+ G++AKLY+K+RH+EKI+
Sbjct: 1   MPQNEHIELHRKRHGQRLDHQERKRKKESREAHERSHKARKMIGLKAKLYHKQRHSEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+++ TKQK+D   PEGA+PAYLLDREGQ RAKILSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTLKMHEQRKTKQKNDDKTPEGAVPAYLLDREGQSRAKILSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGD FTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDNFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTV+EVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVVEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|507934540|ref|XP_004678503.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Condylura
           cristata]
          Length = 271

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/259 (72%), Positives = 215/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 13  PQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 72

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D   P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 73  KKTIKMHEKRNTKQKNDDKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 132

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 133 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 192

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 193 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 252

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 253 AQVTNNPENDGCINAVLLV 271



>gi|340379695|ref|XP_003388362.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Amphimedon
           queenslandica]
          Length = 262

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 220/259 (84%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNE+IE + K+HG RLD+            H+ S + +++HG++AKLYNKKR AEK+ M
Sbjct: 4   PQNEHIELARKRHGYRLDHHERKRKKQGREPHAHSKYVKRLHGLKAKLYNKKRFAEKVAM 63

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           K+KIK H+++ TK K ++  P+GA+PAYLLDREGQ RAK+LSN IKQKRKEKAGKW VPL
Sbjct: 64  KRKIKLHEKRETKNKKEEDTPKGAVPAYLLDREGQSRAKVLSNTIKQKRKEKAGKWTVPL 123

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKV+ + EDE+FKV++TGK + K WKRMITK T+VG+GFTRKPPKYERFIRPMALR+KKA
Sbjct: 124 PKVKAVGEDEVFKVLRTGKRKKKAWKRMITKVTYVGEGFTRKPPKYERFIRPMALRFKKA 183

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATF LPIIGVKKNPQ+ LYTQLGV+TKGT+IEVNVS+LGLVT SGKV+WGKY
Sbjct: 184 HVTHPELKATFSLPIIGVKKNPQTALYTQLGVITKGTIIEVNVSDLGLVTQSGKVIWGKY 243

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 244 AQVTNNPENDGCINAVLLV 262



>gi|501755029|emb|CCG81676.1| Ribosome biogenesis protein nsa2 [Taphrina deformans PYCC 5710]
          Length = 260

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 218/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE  K++G+RLD+            H+ SA AQKV GI+AK+ NKK   EKI+
Sbjct: 1   MPQNEYIEEHQKRYGKRLDHEERKRKKTAREAHAKSAHAQKVTGIKAKILNKKNANEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK ++QH+E++TKQK   A P+GA+PAYLLDREG+K AK+LSNM+KQKRKEKA K++VP
Sbjct: 61  LKKTLRQHEERNTKQKAADATPQGAVPAYLLDREGEKSAKMLSNMVKQKRKEKAAKYSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKVVKTGK   K WKRM+TKATFVGDGFTR+P KYERFIRPMALR KK
Sbjct: 121 LPKVRGIAEDEMFKVVKTGKKNQKAWKRMLTKATFVGDGFTRRPVKYERFIRPMALRQKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL  T   PI+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VT  GKVVWGK
Sbjct: 181 ANVTHPELRVTMQFPILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTAGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPE DGCVNA+LLV
Sbjct: 241 YAQITNNPEMDGCVNAILLV 260



>gi|170117381|ref|XP_001889878.1| ribosome biogenesis protein NSA2 [Laccaria bicolor S238N-H82]
 gi|164635218|gb|EDQ99529.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 260

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 219/260 (84%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEESIK+HGRRLD+            H  SA+AQK  GI+ KL + KRHA+K++
Sbjct: 1   MPQNEYIEESIKRHGRRLDHFERKRKREAREAHRASAYAQKAFGIKGKLLHAKRHAQKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E++ KQ D   VP+GA+P +LLDREGQK AK +S+ IKQKRK+KA K+ VP
Sbjct: 61  MKKTLKAHDERNVKQPDSGTVPDGALPTFLLDREGQKDAKAMSSAIKQKRKDKAAKYAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKV+KTGK+++K WKRM+TKATFVG+GFTRKP K ERFIRPMALRYKK
Sbjct: 121 LPKVRGIAEDEMFKVMKTGKSKSKAWKRMVTKATFVGEGFTRKPVKMERFIRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGV+TKGTVIEVNVSELG+VT  GKVV+GK
Sbjct: 181 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVMTKGTVIEVNVSELGMVTAGGKVVFGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGC+NAVLLV
Sbjct: 241 YAQITNNPENDGCINAVLLV 260



>gi|295314938|gb|ADF97619.1| TGF-beta-inducible nuclear protein 1 [Hypophthalmichthys molitrix]
          Length = 260

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/260 (71%), Positives = 214/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHERKRKKESREAHERSHKARKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+++ +KQKDD   PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRKSKQKDDDKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP S LYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSSLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLLV
Sbjct: 241 FAQVTNNPENDGCINAVLLV 260



>gi|426246763|ref|XP_004017159.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Ovis aries]
          Length = 306

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/260 (71%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           +PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 47  LPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 106

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 107 MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 166

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 167 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 226

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT L V+TKGT+IEVN+SELGLVT  GKV+WGK
Sbjct: 227 AHVTHPELKATFCLPILGVKKNPSSPLYTTLDVITKGTIIEVNISELGLVTQGGKVIWGK 286

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 287 YAQVTNNPENDGCINAVLLV 306



>gi|317171912|ref|NP_955862.2| ribosome biogenesis protein NSA2 homolog [Danio rerio]
          Length = 260

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/260 (71%), Positives = 213/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHEKKRKKESREAHERSHKARKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+++ +KQKDD   PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRKSKQKDDDKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+ K
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFNK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP S LYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSSLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|409080654|gb|EKM81014.1| hypothetical protein AGABI1DRAFT_112716 [Agaricus bisporus var.
           burnettii JB137-S8]
 gi|426197568|gb|EKV47495.1| hypothetical protein AGABI2DRAFT_192681 [Agaricus bisporus var.
           bisporus H97]
          Length = 260

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/260 (72%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLDY            H +SA AQK  G++AKL + KRH EK++
Sbjct: 1   MPQNEYIEEHIKRHGRRLDYYERKRKREARAAHKSSAVAQKAFGLKAKLLHAKRHREKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K +K H E++ K+ D  +VP+ A+P YLLDREGQK AK LS  IKQKRK+KA K+ VP
Sbjct: 61  MQKTLKAHDERNIKKADSGSVPDAALPTYLLDREGQKDAKALSTAIKQKRKDKAAKYAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKVVKTGK+++K WKRM+TKATFVG+GFTRKP K ERFIRPMALRYKK
Sbjct: 121 LPKVRGIAEDEMFKVVKTGKSKSKAWKRMVTKATFVGEGFTRKPVKMERFIRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VT  GKVV+GK
Sbjct: 181 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTAGGKVVFGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|225707726|gb|ACO09709.1| TGF-beta-inducible nuclear protein 1 [Osmerus mordax]
          Length = 260

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/260 (71%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++AKLY+K+RH+EK++
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHERKRKKESREAHERSHKARKMIGLKAKLYHKQRHSEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+++ TKQK+D   PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRKTKQKNDDKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVG+GFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGEGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTV+EVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVVEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|395332673|gb|EJF65051.1| TGF beta-inducible nuclear protein 1 [Dichomitus squalens LYAD-421
           SS1]
          Length = 260

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLDY            H  SA AQK  G++AK+ + KRHAEK++
Sbjct: 1   MPQNEYIEEHIKRHGRRLDYFERKRKREARSVHRASATAQKAFGLKAKILHAKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E++ KQKD  + PEGA+P YLLDREGQK AK LS  IK+KRK+KA K+ VP
Sbjct: 61  MKKTLKAHDERNAKQKDSSSAPEGALPTYLLDREGQKDAKALSTAIKEKRKDKAAKYAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDE FKV++TGK++ K WKRM+TKATFVG+GFTRKP K ERFIRPMALRYKK
Sbjct: 121 LPKVRGIAEDEAFKVMRTGKSKKKAWKRMVTKATFVGEGFTRKPVKMERFIRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGT+IEVNVSELG+VT  GKVV+GK
Sbjct: 181 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGMVTAGGKVVFGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGC+NAVLLV
Sbjct: 241 YAQITNNPENDGCINAVLLV 260



>gi|426220753|ref|XP_004004578.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Ovis aries]
          Length = 260

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/260 (71%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+ HAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQHHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEV VSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVKVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|392593600|gb|EIW82925.1| TGF beta-inducible nuclear protein 1 [Coniophora puteana RWD-64-598
           SS2]
          Length = 260

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 218/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           M QNEYIEE IK+HGRRLDY            H  S+ AQK+ G++AKL + KRHAEK++
Sbjct: 1   MVQNEYIEEHIKRHGRRLDYYERKRKKEARAVHKASSTAQKMFGLKAKLLHAKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK +K H E++ KQ D  AVP+GA+P YLLDREGQK AK LS+ IKQKRK+KA K+ VP
Sbjct: 61  LKKTLKAHDERNVKQTDSSAVPDGALPTYLLDREGQKDAKALSSAIKQKRKDKAAKYAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VRGIAEDEMFKV++TGK + K WKRM+TKATFVG+GFTRKP K ERF+RPMALRYKK
Sbjct: 121 LPQVRGIAEDEMFKVMRTGKRKQKSWKRMVTKATFVGEGFTRKPVKMERFVRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VTT GKVV+GK
Sbjct: 181 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTTGGKVVFGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGC+NAVLLV
Sbjct: 241 YAQITNNPENDGCINAVLLV 260



>gi|28278483|gb|AAH46083.1| Zgc:56334 [Danio rerio]
          Length = 260

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 213/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++A+LY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHEKKRKKESREAHERSHKARKMIGLKAELYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+++ +KQKDD   PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRKSKQKDDDKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+ K
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFNK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP S LYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSSLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|291406641|ref|XP_002719652.1| PREDICTED: NSA2 ribosome biogenesis homolog [Oryctolagus cuniculus]
          Length = 260

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S   +K+ G++AKLY+++RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKERKKQSREAHERSKKTKKMIGLKAKLYHEQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PA LLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPKGAVPACLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|409044907|gb|EKM54388.1| hypothetical protein PHACADRAFT_162767 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 274

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/258 (71%), Positives = 217/258 (84%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLDY            H +SA AQK  G++AK+ + KRHAEK++
Sbjct: 1   MPQNEYIEEHIKRHGRRLDYYERKRKREAREAHKSSAVAQKAFGLKAKILHAKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK +K H E++ KQKD+  VPEGA+P YLLDREGQK AK LS  IK+KRK+KA K+ VP
Sbjct: 61  LKKTLKAHDERNVKQKDNAVVPEGALPTYLLDREGQKDAKALSTAIKEKRKDKAAKYAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKV++TGK++ K WKRM+TKATFVG+GFTRKP K ERF+RPMALRYKK
Sbjct: 121 LPKVRGIAEDEMFKVMRTGKSKKKAWKRMVTKATFVGEGFTRKPVKMERFVRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VT  GKVV+GK
Sbjct: 181 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTAGGKVVFGK 240

Query: 241 YAQVTNNPENDGCVNAVL 258
           YAQ+TNNPENDGC+NAVL
Sbjct: 241 YAQITNNPENDGCINAVL 258



>gi|242208727|ref|XP_002470213.1| TGF beta-inducible nuclear protein 1 [Postia placenta Mad-698-R]
 gi|220730663|gb|EED84516.1| TGF beta-inducible nuclear protein 1 [Postia placenta Mad-698-R]
          Length = 260

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLDY            H  SA AQK  G++AKL + KRHAEK++
Sbjct: 1   MPQNEYIEEHIKRHGRRLDYYERKRKREARSAHRDSATAQKAFGLKAKLLHAKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E++ KQKD  +VP+GA+P YLLDRE +K AK LS  IK+KRK+KA K+ VP
Sbjct: 61  MKKTLKAHDERNIKQKDSGSVPDGALPTYLLDRESEKNAKALSTAIKEKRKDKAAKYAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKV++TGK++ K WKRM+TKATFVG+GFTRKP K ERFIRPMALRYKK
Sbjct: 121 LPKVRGIAEDEMFKVMRTGKSKKKAWKRMVTKATFVGEGFTRKPVKMERFIRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTV+EVNVSELG+VT  GKVV+GK
Sbjct: 181 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVVEVNVSELGMVTAGGKVVFGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGC+NAVLLV
Sbjct: 241 YAQITNNPENDGCINAVLLV 260



>gi|350537199|ref|NP_001232280.1| putative TGF beta-inducible nuclear protein 1 [Taeniopygia guttata]
 gi|197127237|gb|ACH43735.1| putative TGF beta-inducible nuclear protein 1 [Taeniopygia guttata]
          Length = 260

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRYGYRLDYHEKRRKKEGREAHERSRKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKSDEKTPKGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRK PKYERFIRPM LR+KK
Sbjct: 121 VPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKLPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYTQLGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTQLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NA+LLV
Sbjct: 241 YAQVTNNPENDGCINAILLV 260



>gi|325183542|emb|CCA18003.1| ribosome biogenesis protein NSA2 putative [Albugo laibachii Nc14]
          Length = 260

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ+E+IE   K+HG RLD             H  S FAQKVHG+RAKLYN+KR  EK  
Sbjct: 1   MPQHEHIELHKKRHGVRLDQPERHRKKEAREAHRRSQFAQKVHGLRAKLYNQKRFKEKAA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  HQE++ KQ ++ A+P+GA+P+YLLDREG  +AKILSN +KQKRKEKAGKW+VP
Sbjct: 61  MKKTVAMHQERTNKQGNNDAIPDGAVPSYLLDREGVSKAKILSNTVKQKRKEKAGKWSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+ IA+DEMFKV+++GK R K WKRMITKATFVG+ FTRKPPKYERFIRP A+R+KK
Sbjct: 121 IPKVKPIADDEMFKVLRSGKRRNKSWKRMITKATFVGENFTRKPPKYERFIRPSAMRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNPQSPLYTQLGV+TKGT+IEVNVSELGLVTTSGKVVWGK
Sbjct: 181 AHVTHPELQTTFQLAIIGVKKNPQSPLYTQLGVMTKGTIIEVNVSELGLVTTSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TN PENDGC+NAVLLV
Sbjct: 241 YAQITNVPENDGCINAVLLV 260



>gi|403266452|ref|XP_003925395.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Saimiri
           boliviensis boliviensis]
          Length = 260

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/260 (71%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I+ H++++TKQK+D+  P+GA+PAYLLDREGQ RA++LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIEMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRARVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL AT CLPI+ VKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATLCLPILCVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|387915612|gb|AFK11415.1| NSA2 ribosome biogenesis-like protein [Callorhinchus milii]
 gi|392879948|gb|AFM88806.1| NSA2 ribosome biogenesis-like protein [Callorhinchus milii]
 gi|392880246|gb|AFM88955.1| NSA2 ribosome biogenesis-like protein [Callorhinchus milii]
          Length = 260

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 214/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSHKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TK+K+D   P+GA+P YLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRNTKKKNDDNTPKGAVPPYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK R K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRRKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+ VKKNP SPLYT LGV+TKG+VIEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPILAVKKNPSSPLYTTLGVITKGSVIEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLLV
Sbjct: 241 FAQVTNNPENDGCINAVLLV 260



>gi|57528133|ref|NP_001006579.1| ribosome biogenesis protein NSA2 homolog [Gallus gallus]
 gi|53127362|emb|CAG31064.1| hypothetical protein RCJMB04_2a2 [Gallus gallus]
          Length = 260

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/260 (71%), Positives = 217/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRYGYRLDYHERKRKKEGREAHERSRKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TK+K+++  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKEKNEEKTPKGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 VPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTSLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|326934942|ref|XP_003213541.1| PREDICTED: ribosome biogenesis protein NSA2 homolog, partial
           [Meleagris gallopavo]
          Length = 268

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/259 (71%), Positives = 216/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNE+IE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 10  PQNEHIELHRKRYGYRLDYHERKRKKEGREAHERSRKAKKMIGLKAKLYHKQRHAEKIQM 69

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TK+K+++  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 70  KKTIKMHEKRNTKEKNEEKTPKGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 129

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 130 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 189

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 190 HVTHPELKATFCLPILGVKKNPSSPLYTSLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 249

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 250 AQVTNNPENDGCINAVLLV 268



>gi|444708480|gb|ELW49543.1| Ribosome biogenesis protein NSA2 like protein [Tupaia chinensis]
          Length = 261

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/261 (71%), Positives = 215/261 (82%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHECSKKAKKMTGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRP-MALRYK 179
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPP+YERFIR  M LR+K
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPQYERFIRTLMGLRFK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KAHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GK +WG
Sbjct: 181 KAHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKAIWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQVTNNPENDGC+NAVLLV
Sbjct: 241 KYAQVTNNPENDGCINAVLLV 261



>gi|149408559|ref|XP_001513525.1| PREDICTED: ribosome biogenesis protein NSA2 homolog
           [Ornithorhynchus anatinus]
          Length = 275

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 215/259 (83%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQN+YI+   K++G RLDY            H  S  A+K+ G++AKLY+K+RH EKI+M
Sbjct: 17  PQNDYIDLHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHVEKIQM 76

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 77  KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 136

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 137 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 196

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPL+T LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 197 HVTHPELKATFCLPILGVKKNPSSPLFTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 256

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 257 AQVTNNPENDGCINAVLLV 275



>gi|351701860|gb|EHB04779.1| Ribosome biogenesis protein NSA2-like protein [Heterocephalus
           glaber]
          Length = 407

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 217/272 (79%), Gaps = 12/272 (4%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 136 MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 195

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 196 MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 255

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 256 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 315

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGV------------LTKGTVIEVNVSELG 228
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV            +TKGTVIEVNVSELG
Sbjct: 316 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVIITKGTVIEVNVSELG 375

Query: 229 LVTTSGKVVWGKYAQVTNNPENDGCVNAVLLV 260
           LVT  GKV+WGKYAQVTNNPENDGC+NAVLLV
Sbjct: 376 LVTQGGKVIWGKYAQVTNNPENDGCINAVLLV 407



>gi|465795212|emb|CCU99855.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 262

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLD+            H  SA AQK  G++AK+ NKKR AEK++
Sbjct: 1   MPQNEYIEEHIKRHGRRLDHEERMRKREARSAHRASAVAQKTIGLKAKMLNKKRRAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IKQH+E+  K+    + PE A+PAYLLDREGQK AK LS+ +K++RK+KA +++VP
Sbjct: 61  MKKSIKQHEERDVKKSAAPSNPETALPAYLLDREGQKDAKALSSAVKERRKDKAARYSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VRGIA+DE FKVVKTGK +   WKRM+TKATFVGD FTRKPPK ERFIRPM LR+KK
Sbjct: 121 LPQVRGIADDEAFKVVKTGKRKQNGWKRMVTKATFVGDNFTRKPPKLERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AH+THP+L ATF LPIIGVKKNPQSP+YTQLGVLTKGT+IEVNVS+LG+VT+ GKVVWGK
Sbjct: 181 AHITHPDLKATFQLPIIGVKKNPQSPMYTQLGVLTKGTIIEVNVSDLGMVTSGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGCVN VLL+
Sbjct: 241 YAQVTNNPENDGCVNGVLLL 260



>gi|196002397|ref|XP_002111066.1| hypothetical protein TRIADDRAFT_54620 [Trichoplax adhaerens]
 gi|190587017|gb|EDV27070.1| hypothetical protein TRIADDRAFT_54620 [Trichoplax adhaerens]
          Length = 260

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/260 (70%), Positives = 223/260 (85%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE + K+HG+RLD+            H+ +  A+K+ GI+AKLY+K+R++EK++
Sbjct: 1   MPQNEYIELARKRHGQRLDHFERMRKREARKPHALAQKAKKLKGIKAKLYHKQRYSEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K +K H++K +K K + AVPEGA+PAYLL+REGQ RAKILSNM+KQKRKEKAGKW VP
Sbjct: 61  MQKTLKMHEKKKSKTKKEDAVPEGAVPAYLLEREGQSRAKILSNMVKQKRKEKAGKWTVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR + E+E+FKV++TGK+R K WKRMITKA +VG+ FTRKP K+ERFIRPM LR+KK
Sbjct: 121 LPKVRAVGEEEVFKVLRTGKSRKKGWKRMITKACYVGENFTRKPAKFERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNPQSP++TQLGV+TKGTV+EVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIIGVKKNPQSPMFTQLGVITKGTVVEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|444723493|gb|ELW64148.1| Ribosome biogenesis protein NSA2 like protein [Tupaia chinensis]
          Length = 260

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/260 (71%), Positives = 214/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RL+Y            H  S   +K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLNYHKKKRKKESREAHECSKKTKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
            KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  RKKIIKMHEKRTTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM L +KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLCFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|198412361|ref|XP_002127830.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Ciona
           intestinalis]
          Length = 260

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 214/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  +  A+K+ G++AKLYNK+RH EKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDFHERKRKKEGRMAHDRAKKAKKLIGLKAKLYNKQRHHEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H +++TKQKD++  P+GA+PAYLLDRE Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKTLKMHDKRNTKQKDNEKTPDGAVPAYLLDRESQSRAKVLSNMIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  +E E+F+VV TGK + K WKRM TK  FV D FTRKPPKYERFIRPMALR+KK
Sbjct: 121 IPKVRAQSEAEVFRVVTTGKRKKKAWKRMCTKVCFVPDNFTRKPPKYERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLP+IGVKKNP SP+YT LGV+TKGTVIE+NVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPVIGVKKNPSSPMYTSLGVITKGTVIEINVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|260829883|ref|XP_002609891.1| hypothetical protein BRAFLDRAFT_60200 [Branchiostoma floridae]
 gi|229295253|gb|EEN65901.1| hypothetical protein BRAFLDRAFT_60200 [Branchiostoma floridae]
          Length = 260

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/260 (73%), Positives = 219/260 (84%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLDY            H  +  A+K+ G++AKLYNKKRHAEK++
Sbjct: 1   MPQNEHIELHRKRHGYRLDYHERKRKKEARRPHEMAEKAKKLKGLKAKLYNKKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+E+ TK++ D  VP+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTLKMHEERKTKERKDDKVPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR  +E E+F+VVKTGK++ K WKRM+TK T+VG+GFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQSEAEVFRVVKTGKSKKKAWKRMVTKVTYVGEGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPIIGVKKNPTSPLYTSLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|392881190|gb|AFM89427.1| NSA2 ribosome biogenesis-like protein [Callorhinchus milii]
          Length = 260

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/260 (71%), Positives = 213/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSHKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TK+K+D    +GA+P YLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRNTKKKNDDNTLKGAVPPYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK R K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRRKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+ VKKNP SPLYT LGV+TKG+VIEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPILAVKKNPSSPLYTTLGVITKGSVIEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLLV
Sbjct: 241 FAQVTNNPENDGCINAVLLV 260



>gi|472586713|gb|EMS24232.1| ribosomal protein S8e/ribosomal biogenesis NSA2 family protein
           [Rhodosporidium toruloides NP11]
          Length = 260

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 214/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEESI+++GRRLD+            H  S  AQ +HG +AK+ +++R+AEK+ 
Sbjct: 1   MPQNEYIEESIRRNGRRLDHEERKRKRAAREAHKASHVAQTLHGHKAKMLHQRRYAEKVA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+E+  K KD  A+PEGA+P YLLDREGQ  AK LS+ +KQKRKEKAGK+ VP
Sbjct: 61  MKKTIKAHEERDVKAKDASAMPEGALPTYLLDREGQNDAKALSSAVKQKRKEKAGKFAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKV+KTGK++ K WKRM+TKATFVG+ FTRKPPK ERFIRP ALR KK
Sbjct: 121 LPKVRGIAEDEMFKVIKTGKSKRKGWKRMVTKATFVGEDFTRKPPKLERFIRPSALRMKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL ATF LPIIGVKKNPQSP+YTQLGV+TKGTVIEVNVSELGLVT  GKVVWGK
Sbjct: 181 ANVTHPELKATFQLPIIGVKKNPQSPMYTQLGVITKGTVIEVNVSELGLVTAGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPE DGC NA+LL 
Sbjct: 241 YAQVTNNPELDGCCNALLLT 260



>gi|209734004|gb|ACI67871.1| Ribosome biogenesis protein NSA2 homolog [Salmo salar]
 gi|303664731|gb|ADM16159.1| Ribosome biogenesis protein NSA2 homolog [Salmo salar]
          Length = 258

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/260 (70%), Positives = 214/260 (82%), Gaps = 2/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG+RLD+            H  S  A+K+ G++AKLY+K+RH+EKI+
Sbjct: 1   MPQNEHIELHRKRHGQRLDHQERKKESREA--HERSHKARKMIGLKAKLYHKQRHSEKIQ 58

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+++  KQK+D   PEGA+PAYLLDREGQ RAKILSNMIK+KRKEKAGKW VP
Sbjct: 59  MKKTLKMHEQRKAKQKNDDKTPEGAVPAYLLDREGQSRAKILSNMIKRKRKEKAGKWEVP 118

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGD FTRKPPKYERFIRPM LR+KK
Sbjct: 119 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDNFTRKPPKYERFIRPMGLRFKK 178

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTV+EVNVSELGLVT  GKV+WGK
Sbjct: 179 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVVEVNVSELGLVTQGGKVIWGK 238

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 239 YAQVTNNPENDGCINAVLLV 258



>gi|393217161|gb|EJD02650.1| hypothetical protein FOMMEDRAFT_42245, partial [Fomitiporia
           mediterranea MF3/22]
          Length = 255

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/255 (70%), Positives = 216/255 (84%)

Query: 4   NEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEMKK 63
           NEYIEE IK+HGRRLDY            H +SA AQK  G++AKL + KRHAEK+++KK
Sbjct: 1   NEYIEEHIKRHGRRLDYYEKKRKREARAAHKSSAVAQKAFGLKAKLLHAKRHAEKVQLKK 60

Query: 64  KIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPLPK 123
            +K H E++ KQKD  + PEGA+P +LLDREGQK AK +S+ IKQ+RKEKA K+ VPLPK
Sbjct: 61  TLKAHDERNVKQKDAASTPEGALPTFLLDREGQKDAKAMSSAIKQRRKEKAAKYAVPLPK 120

Query: 124 VRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKAHV 183
           VRG+AE+E+FKV++TGKN++K WKRM+TKATFVG+GFTRKP K ERF+RPMALRYKKA+V
Sbjct: 121 VRGVAEEEVFKVMRTGKNKSKSWKRMVTKATFVGEGFTRKPVKMERFVRPMALRYKKANV 180

Query: 184 THPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKYAQ 243
           THP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VTT GKVV+GKYAQ
Sbjct: 181 THPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTTGGKVVFGKYAQ 240

Query: 244 VTNNPENDGCVNAVL 258
           +TNNPENDGC+NAVL
Sbjct: 241 ITNNPENDGCINAVL 255



>gi|213404554|ref|XP_002173049.1| ribosome biogenesis protein NSA2 [Schizosaccharomyces japonicus
           yFS275]
 gi|212001096|gb|EEB06756.1| ribosome biogenesis protein Nsa2 [Schizosaccharomyces japonicus
           yFS275]
          Length = 260

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/259 (70%), Positives = 215/259 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE+I+KHGRR DY            H +S +AQKV GI+AKLY +KR  EKI+
Sbjct: 1   MPQNEYIEEAIRKHGRRFDYEEKKRKKAAREVHESSKYAQKVRGIKAKLYQEKRRKEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK+H E++T Q+  +   +GA+P YLLDRE + +AK+LSN +KQKRKEKA K++VP
Sbjct: 61  MKKTIKEHDERNTTQRGSEPEVQGAVPTYLLDREQESQAKMLSNAVKQKRKEKAAKFSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VRG++E+EMFKVV+TGK++   WKRMITKATFVGDGFTR+P KYERFIRPMALR KK
Sbjct: 121 LPQVRGVSEEEMFKVVRTGKSKKNAWKRMITKATFVGDGFTRRPVKYERFIRPMALRQKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTH ELG T  LPIIGVKKNPQSP+YTQLGVLTKGT+IEVNVSELGLVT  GKVVWGK
Sbjct: 181 ANVTHRELGVTMQLPIIGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLL 259
           YAQVTNNPE DGCVNA+LL
Sbjct: 241 YAQVTNNPELDGCVNALLL 259



>gi|19076061|ref|NP_588561.1| ribosome biogenesis protein nsa2 [Schizosaccharomyces pombe 972h-]
 gi|74625990|sp|Q9UU79.1|NSA2_SCHPO RecName: Full=Ribosome biogenesis protein nsa2
 gi|5832418|emb|CAB54867.1| ribosome biogenesis protein Nsa2 (predicted) [Schizosaccharomyces
           pombe]
          Length = 260

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 213/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEESI+KHGRR D+            H  S +AQK  GI+AKLY +KR  EKI+
Sbjct: 1   MPQNEYIEESIRKHGRRFDHEERKRKKAAREAHDASLYAQKTRGIKAKLYQEKRRKEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IKQH+E++  Q+   A  +GA+P YLLDRE + +AK+LS+ +KQKRKEKA K++VP
Sbjct: 61  MKKTIKQHEERNATQRGSDAQTQGAVPTYLLDREQESQAKMLSSAVKQKRKEKAAKYSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VRG+AE+EMFKV++TGK++   WKRMITKATFVGDGFTR+P KYERFIRPMALR KK
Sbjct: 121 LPQVRGVAEEEMFKVIRTGKSKKNSWKRMITKATFVGDGFTRRPVKYERFIRPMALRQKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTH ELG T  LPIIGVKKNPQSP YTQLGVLTKGTVIEVNVSELGLVT+ GKVVWGK
Sbjct: 181 ANVTHKELGVTMQLPIIGVKKNPQSPTYTQLGVLTKGTVIEVNVSELGLVTSGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPE DGCVNA+LL 
Sbjct: 241 YAQITNNPELDGCVNALLLT 260



>gi|112984142|ref|NP_001037438.1| TGF beta-inducible nuclear protein 1 [Bombyx mori]
 gi|90018289|gb|ABD83950.1| TGF beta-inducible nuclear protein 1 [Bombyx mori]
          Length = 259

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/260 (70%), Positives = 217/260 (83%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKREAREPHKRAEKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ KQ + + V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVKQ-NTEKVAEGALPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP SP+YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSPMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|301120312|ref|XP_002907883.1| ribosome biogenesis protein NSA2 [Phytophthora infestans T30-4]
 gi|262102914|gb|EEY60966.1| ribosome biogenesis protein NSA2 [Phytophthora infestans T30-4]
 gi|348677432|gb|EGZ17249.1| hypothetical protein PHYSODRAFT_351148 [Phytophthora sojae]
          Length = 260

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/260 (69%), Positives = 213/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ+E++E   K+HG R+D             H  S FAQKVHG+RAKLYN+KR  EK  
Sbjct: 1   MPQHEHMEMHRKRHGVRMDAAEKKRKKEAREVHRRSQFAQKVHGLRAKLYNQKRFKEKAA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H E++ K  +D  +P+GA+P+YLLDREG  RAK+LSN +KQKRKEKAGKW+VP
Sbjct: 61  MKKTLALHNERTNKHANDDEIPDGAVPSYLLDREGVSRAKVLSNTVKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+ IA+DEMFKV+++GK R K WKRMITKATFVG+ FTRKPPKYERFIRP A+R+KK
Sbjct: 121 IPKVKPIADDEMFKVLRSGKRRNKAWKRMITKATFVGENFTRKPPKYERFIRPSAMRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L I+GVKKNPQSPLYTQLGV+TKGT+IEVNVSELGLVTTSGKVVWGK
Sbjct: 181 AHVTHPELKTTFQLDILGVKKNPQSPLYTQLGVMTKGTIIEVNVSELGLVTTSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TN PENDGC+NAVLLV
Sbjct: 241 YAQITNVPENDGCINAVLLV 260



>gi|443893911|dbj|GAC71367.1| hypothetical protein PANT_2d00073 [Pseudozyma antarctica T-34]
          Length = 262

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/260 (69%), Positives = 212/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQN+YIEE I++HGRRLD+            H  SA AQKV G++AK+ NKKR  EKI+
Sbjct: 1   MPQNDYIEEHIRRHGRRLDHEERQRKRAAREVHKASAVAQKVTGLKAKMLNKKRRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+E+  KQ    + P  A+P YLLDREGQK AK LS+ +K++RK+KA +++VP
Sbjct: 61  MKKTLKAHEERDVKQASTASDPNQALPTYLLDREGQKDAKALSSAVKERRKDKAARYSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VRGIAEDE FKVVKTGK + K WKRM+TK TFVG+ FTRKPPK ERFIRPM LRY K
Sbjct: 121 LPQVRGIAEDEAFKVVKTGKRKQKGWKRMVTKPTFVGESFTRKPPKLERFIRPMGLRYNK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL A+F LPI+GVKKNPQSPLYTQLGVLTKGT+IEVNVSELG+ TT+GKVVWGK
Sbjct: 181 AHVTHPELKASFNLPIVGVKKNPQSPLYTQLGVLTKGTIIEVNVSELGMTTTTGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGCVNAVLL+
Sbjct: 241 YAQVTNNPENDGCVNAVLLL 260



>gi|66804290|ref|XP_635924.1| hypothetical protein DDB_G0290031 [Dictyostelium discoideum AX4]
 gi|74851989|sp|Q54GN8.1|NSA2_DICDI RecName: Full=Ribosome biogenesis protein NSA2 homolog
 gi|60464270|gb|EAL62421.1| hypothetical protein DDB_G0290031 [Dictyostelium discoideum AX4]
          Length = 260

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 212/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ ++IE   K+ GRRLD+            H  SA AQKV G++AKLYNKKR++EK E
Sbjct: 1   MPQGDHIELHQKRFGRRLDHYEKVRKKTARAAHKRSAIAQKVTGLKAKLYNKKRYSEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I  HQE++ K+  D  V EGA+PAYLLDREG  RAK+LSNM+KQKRKEKAGKW+VP
Sbjct: 61  MKKTIAMHQERTNKKASDDKVKEGAVPAYLLDREGVSRAKVLSNMVKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR I+EDEMFKVVK+GK + K WKR +TK TFVG+GFTRKPPKYERFIRP  LR+KK
Sbjct: 121 LPKVRAISEDEMFKVVKSGKRQKKAWKRFVTKVTFVGEGFTRKPPKYERFIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL +TF L I+ VKKNPQSP YTQLGV+TKGT++EVNVS+LGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKSTFYLDILSVKKNPQSPTYTQLGVITKGTILEVNVSDLGLVTQTGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
            AQVTNNPENDGC+NAVLLV
Sbjct: 241 MAQVTNNPENDGCINAVLLV 260



>gi|343428895|emb|CBQ72440.1| probable NSA2-involved in biogenesis of ribosomal large subunit
           [Sporisorium reilianum SRZ2]
          Length = 262

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 212/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQN+YIEE I++HGRRLD+            H  SA AQKV G++AK+ NKKR  EKI+
Sbjct: 1   MPQNDYIEEHIRRHGRRLDHEERQRKRAAREVHKASAVAQKVTGLKAKMLNKKRRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+E+  KQ    + P  A+P YLLDREGQK AK LS+ +K++RK+KA +++VP
Sbjct: 61  MKKTLKAHEERDVKQASTSSDPNQALPTYLLDREGQKDAKALSSAVKERRKDKAARYSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VRGIAEDE FKV+KTGK + K WKRM+TK TFVG+ FTRKPPK ERFIRPM LRY K
Sbjct: 121 LPQVRGIAEDEAFKVIKTGKRKQKGWKRMVTKPTFVGESFTRKPPKLERFIRPMGLRYNK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL A+F LPI+GVKKNPQSPLYTQLGVLTKGT+IEVNVSELG+ TT+GKVVWGK
Sbjct: 181 AHVTHPELKASFNLPIVGVKKNPQSPLYTQLGVLTKGTIIEVNVSELGMTTTTGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGCVNAVLL+
Sbjct: 241 YAQVTNNPENDGCVNAVLLL 260



>gi|302679422|ref|XP_003029393.1| hypothetical protein SCHCODRAFT_236636 [Schizophyllum commune H4-8]
 gi|300103083|gb|EFI94490.1| hypothetical protein SCHCODRAFT_236636 [Schizophyllum commune H4-8]
          Length = 384

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/255 (70%), Positives = 214/255 (83%)

Query: 4   NEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEMKK 63
           NEYIEE IK+HGRRLDY            H  SA AQK  G++AK+ + +RHAEK+++KK
Sbjct: 2   NEYIEEHIKRHGRRLDYFEKKRKKEAREAHKFSAHAQKAFGLKAKILHARRHAEKVQLKK 61

Query: 64  KIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPLPK 123
            +K H E++ KQ D  A PEGA+P YLLDREGQK AK LS+ IKQKRK+KA K+ VPLPK
Sbjct: 62  TLKAHDERNVKQADSSATPEGALPTYLLDREGQKDAKALSSAIKQKRKDKAAKYAVPLPK 121

Query: 124 VRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKAHV 183
           VRGIAEDEMFKV++TGK+++K WKRM+TKATFVG+GFTRKP K ERF+RPMALRYKKA+V
Sbjct: 122 VRGIAEDEMFKVMRTGKSKSKSWKRMVTKATFVGEGFTRKPVKMERFVRPMALRYKKANV 181

Query: 184 THPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKYAQ 243
           THP+L ATF L I+GVKKNPQSP+YTQLGV+TKGTVIEVNVSELG+VTT GKVV+GKYAQ
Sbjct: 182 THPDLKATFQLQILGVKKNPQSPMYTQLGVMTKGTVIEVNVSELGMVTTGGKVVFGKYAQ 241

Query: 244 VTNNPENDGCVNAVL 258
           +TNNPENDGC+NAVL
Sbjct: 242 ITNNPENDGCINAVL 256



>gi|389741916|gb|EIM83104.1| TGF beta-inducible nuclear protein 1 [Stereum hirsutum FP-91666
           SS1]
          Length = 295

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/257 (72%), Positives = 215/257 (83%), Gaps = 1/257 (0%)

Query: 3   QNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEMK 62
           QNEYIEE IK+HGRRLDY            H  SA AQ   GI+AKL + KRHAEK+++K
Sbjct: 19  QNEYIEEHIKRHGRRLDYYEKKRKREARAVHRQSAVAQSAFGIKAKLLHAKRHAEKVQLK 78

Query: 63  KKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPLP 122
           K +K H E++ KQ D  +VPEGA+P YLLDREGQK AK LS+ IKQKRK+KA K+ VPLP
Sbjct: 79  KTLKAHDERNVKQADS-SVPEGALPTYLLDREGQKDAKALSSAIKQKRKDKAAKFAVPLP 137

Query: 123 KVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKAH 182
           KVRGIAEDEMFKV++TGK+++K WKRM+TKATFVG+GFTRKP K ERFIRPMALR+KKA+
Sbjct: 138 KVRGIAEDEMFKVMRTGKSKSKSWKRMVTKATFVGEGFTRKPVKMERFIRPMALRFKKAN 197

Query: 183 VTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKYA 242
           VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VT  GKVV+GKYA
Sbjct: 198 VTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTAGGKVVFGKYA 257

Query: 243 QVTNNPENDGCVNAVLL 259
           QVTNNPENDGC+NAVLL
Sbjct: 258 QVTNNPENDGCINAVLL 274



>gi|298708726|emb|CBJ30688.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 260

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/260 (69%), Positives = 211/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ+EY+E   K+HG R+D             H  S FAQKVHGIRAKLY +KR  EK  
Sbjct: 1   MPQHEYMEAHKKRHGERMDRAEKRRKKDAREVHKRSEFAQKVHGIRAKLYQRKRFKEKAT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K I  HQE++ K  +D AVP+GA+PAYLLDREG  RAK+LSN +KQKRKEKAGKW+VP
Sbjct: 61  MRKTIAMHQERTNKHANDDAVPDGAVPAYLLDREGVSRAKVLSNTVKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+ +A+DEMFKV+++GK + K WKRM+TK TFVG+GFTRK PKYERFIRP  LR+KK
Sbjct: 121 IPKVKPVADDEMFKVLRSGKRKNKAWKRMVTKVTFVGEGFTRKAPKYERFIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF L I+GVKKNP SPLYTQLGV+TKGTVIEVNVS+LGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKATFHLDILGVKKNPSSPLYTQLGVMTKGTVIEVNVSDLGLVTQSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTN+PE DGC+NAVLLV
Sbjct: 241 YAQVTNSPELDGCINAVLLV 260



>gi|56540978|gb|AAH86776.1| 5730427N09Rik protein [Mus musculus]
          Length = 248

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/248 (72%), Positives = 208/248 (83%)

Query: 13  KHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEMKKKIKQHQEKS 72
           ++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+MKK IK H++++
Sbjct: 1   RYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQMKKTIKMHEKRN 60

Query: 73  TKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPLPKVRGIAEDEM 132
           TKQKDD+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPLPKVR   E E+
Sbjct: 61  TKQKDDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPLPKVRAQGETEV 120

Query: 133 FKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKAHVTHPELGATF 192
            KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKAHVTHPEL ATF
Sbjct: 121 LKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKAHVTHPELKATF 180

Query: 193 CLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKYAQVTNNPENDG 252
           CLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKYAQVTNNPENDG
Sbjct: 181 CLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKYAQVTNNPENDG 240

Query: 253 CVNAVLLV 260
           C+NAVLLV
Sbjct: 241 CINAVLLV 248



>gi|405123588|gb|AFR98352.1| TGF beta-inducible nuclear protein 1 [Cryptococcus neoformans var.
           grubii H99]
          Length = 260

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+EE  K+HGRRLDY            H  SA AQK+ G +AKL++ +RHAEK++
Sbjct: 1   MPQNEYMEEHRKRHGRRLDYEEKKRKRTAREAHKASADAQKIFGHKAKLHHARRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E++ KQKDD AV EGA+PAYLLDR+ QK AK LS+ +K +RK++A K++VP
Sbjct: 61  MKKTLKAHDERNVKQKDDGAVKEGALPAYLLDRDSQKDAKALSSAVKDRRKDRAAKYSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAE+EMFKV+KTGK+++K WKRM+ KATFVG+GFTRKP K ERFIRPM LR  K
Sbjct: 121 LPKVRGIAEEEMFKVIKTGKSKSKSWKRMVNKATFVGEGFTRKPVKLERFIRPMGLRMTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL  TF LPI+GVKKNPQSPLYT LGVLTKGT++EVNVSELG+VTT GKVVW K
Sbjct: 181 ANVTHPELKTTFQLPILGVKKNPQSPLYTSLGVLTKGTILEVNVSELGMVTTGGKVVWSK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGC+N+VLLV
Sbjct: 241 YAQITNNPENDGCINSVLLV 260



>gi|355691394|gb|EHH26579.1| TGF-beta-inducible nuclear protein 1, partial [Macaca mulatta]
          Length = 258

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/259 (71%), Positives = 213/259 (82%), Gaps = 1/259 (0%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 1   PQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 60

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 61  KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 120

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGF RKPPKYERFIRPM LR+KKA
Sbjct: 121 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFIRKPPKYERFIRPMGLRFKKA 180

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TK TVIEVNVS+LGLVT  GKV+WGKY
Sbjct: 181 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITK-TVIEVNVSKLGLVTQGGKVIWGKY 239

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAV LV
Sbjct: 240 AQVTNNPENDGCINAVSLV 258



>gi|388856750|emb|CCF49710.1| probable NSA2-involved in biogenesis of ribosomal large subunit
           [Ustilago hordei]
          Length = 262

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 211/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQN+YIEE I++HGRRLD+            H  SA AQKV G++AK+ NKKR  EKI+
Sbjct: 1   MPQNDYIEEHIRRHGRRLDHEERQRKRAAREVHKASAVAQKVTGLKAKMLNKKRRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+E+  KQ    + P  A+P YLLDREGQK AK LS+ +K++RK+KA +++VP
Sbjct: 61  MKKTLKAHEERDVKQASASSDPNQALPTYLLDREGQKDAKALSSAVKERRKDKAARYSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VRGIAEDE FKV+KTGK + K WKRM+TK TFVG+ FTRKPPK ERFIRPM LRY K
Sbjct: 121 LPQVRGIAEDEAFKVIKTGKRKQKGWKRMVTKPTFVGESFTRKPPKLERFIRPMGLRYNK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
            HVTHPEL A+F LPI+GVKKNPQSPLYTQLGVLTKGT+IEVNVSELG+ TT+GKVVWGK
Sbjct: 181 VHVTHPELKASFNLPIVGVKKNPQSPLYTQLGVLTKGTIIEVNVSELGMTTTTGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGCVNAVLL+
Sbjct: 241 YAQVTNNPENDGCVNAVLLL 260



>gi|501303612|dbj|GAC93033.1| hypothetical protein PHSY_000594 [Pseudozyma hubeiensis SY62]
          Length = 301

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 212/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQN+YIEE I+++GRRLD+            H  SA AQKV G++AK+ NKKR  EKI+
Sbjct: 40  MPQNDYIEEHIRRNGRRLDHEERQRKRAAREVHKASAVAQKVTGLKAKMLNKKRRNEKIQ 99

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+E+  KQ    + P  A+P YLLDREGQK AK LS+ +K++RK+KA +++VP
Sbjct: 100 MKKTLKAHEERDVKQASTSSDPNQALPTYLLDREGQKDAKALSSAVKERRKDKAARYSVP 159

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VRGIAEDE FKV+KTGK + K WKRM+TK TFVG+ FTRKPPK ERFIRPM LRY K
Sbjct: 160 LPQVRGIAEDEAFKVIKTGKRKQKGWKRMVTKPTFVGESFTRKPPKLERFIRPMGLRYNK 219

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL A+F LPI+GVKKNPQSPLYTQLGVLTKGT+IEVNVSELG+ TT+GKVVWGK
Sbjct: 220 AHVTHPELKASFNLPIVGVKKNPQSPLYTQLGVLTKGTIIEVNVSELGMTTTTGKVVWGK 279

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGCVNAVLL+
Sbjct: 280 YAQVTNNPENDGCVNAVLLL 299



>gi|87248237|gb|ABD36171.1| hairy cell leukemia protein 1 [Bombyx mori]
 gi|221579705|gb|ACM24351.1| TGF-beta-inducible nuclear protein 1 [Bombyx mori]
          Length = 259

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 216/260 (83%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKREAREPHKRAEKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ KQ + + V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVKQ-NTEKVAEGALPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|281209877|gb|EFA84045.1| TGF beta-inducible nuclear protein [Polysphondylium pallidum PN500]
          Length = 260

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/260 (69%), Positives = 211/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           M Q +YIE   K+ GRR D+            H  SA AQKV+GI+AKL NKKR++EK E
Sbjct: 1   MAQGDYIELHRKRFGRRFDHYEKLRKRTSRETHKKSALAQKVYGIKAKLLNKKRYSEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MK+ I  HQE++ K+  D+ V EGA+P YLLDREG  RAK+LSNM+K+KRKEKAGKW VP
Sbjct: 61  MKRTIAMHQERTNKKATDEKVKEGAVPGYLLDREGVSRAKVLSNMVKEKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR I+EDEMFKVVKTGK + K WKRM+TK TFVG+GFTRK PKYERFIRP  LR+KK
Sbjct: 121 LPKVRAISEDEMFKVVKTGKRQKKAWKRMVTKVTFVGEGFTRKAPKYERFIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL +TF L I+GVKKNPQSP YTQLGV+TKGT+IEVNVS+LGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKSTFYLDILGVKKNPQSPTYTQLGVITKGTIIEVNVSDLGLVTQTGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NA+LLV
Sbjct: 241 FAQVTNNPENDGCINALLLV 260



>gi|449546392|gb|EMD37361.1| hypothetical protein CERSUDRAFT_105386 [Ceriporiopsis subvermispora
           B]
          Length = 254

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 180/254 (70%), Positives = 214/254 (84%)

Query: 7   IEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEMKKKIK 66
           + E IK+HGRRLDY            H +SA AQK  G++AKL + KRH+EK+++KK +K
Sbjct: 1   MSEHIKRHGRRLDYYERKRKREARAVHHSSAVAQKTFGLKAKLLHAKRHSEKVQLKKTLK 60

Query: 67  QHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPLPKVRG 126
            H E++ KQKD+ +VP+GA+P YLLDREGQK AK LS  IK+KRK+KA K+ VPLPKVRG
Sbjct: 61  AHDERNVKQKDNSSVPDGALPTYLLDREGQKDAKALSTAIKEKRKDKAAKYAVPLPKVRG 120

Query: 127 IAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKAHVTHP 186
           IAEDEMFKV++TGK++ K WKRM+TKATFVG+GFTRKP K ERFIRPMALRYKKA+VTHP
Sbjct: 121 IAEDEMFKVMRTGKSKKKAWKRMVTKATFVGEGFTRKPVKMERFIRPMALRYKKANVTHP 180

Query: 187 ELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKYAQVTN 246
           +L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VTT GKVV+GKYAQ+TN
Sbjct: 181 DLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTTGGKVVFGKYAQITN 240

Query: 247 NPENDGCVNAVLLV 260
           NPENDGC+NAVLLV
Sbjct: 241 NPENDGCINAVLLV 254



>gi|472396301|ref|XP_004417379.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Odobenus
           rosmarus divergens]
          Length = 260

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/260 (71%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++ KLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKTKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+ AYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVSAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WK+M+TK  FVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRKKKAWKKMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|393234712|gb|EJD42272.1| TGF beta-inducible nuclear protein 1 [Auricularia delicata
           TFB-10046 SS5]
          Length = 260

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/260 (69%), Positives = 213/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLDY            H  SA AQK+ G +AKL + +RHAEK++
Sbjct: 1   MPQNEYIEEHIKRHGRRLDYDERKRKREAREAHRASAHAQKLFGHKAKLLHARRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++K ++ H E++ K  D  A  +GA PAYLLDRE Q  AK LS  +KQKRK+KA ++ VP
Sbjct: 61  LRKTLRAHDERNVKAADASAPADGARPAYLLDREQQTDAKALSTALKQKRKDKAARFAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKV+KTGK+++K WKRM+TKATFVG+GFTRKP K ERFIRPMALRYKK
Sbjct: 121 LPKVRGIAEDEMFKVIKTGKSKSKAWKRMVTKATFVGEGFTRKPVKLERFIRPMALRYKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL ATF L I+GVKKNPQSP+YTQLGV+TKGTVIEVNVSELG+VT  GKVV+GK
Sbjct: 181 ANVTHPELKATFQLQILGVKKNPQSPMYTQLGVMTKGTVIEVNVSELGMVTAGGKVVFGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGC+NAVLLV
Sbjct: 241 YAQITNNPENDGCINAVLLV 260



>gi|71022307|ref|XP_761383.1| hypothetical protein UM05236.1 [Ustilago maydis 521]
 gi|74699905|sp|Q4P3S7.1|NSA2_USTMA RecName: Full=Ribosome biogenesis protein NSA2
 gi|46097616|gb|EAK82849.1| hypothetical protein UM05236.1 [Ustilago maydis 521]
          Length = 273

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/258 (68%), Positives = 210/258 (81%)

Query: 3   QNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEMK 62
           QN+YIEE I++HGRRLD+            H  SA AQKV G++AK+ NKKR  EKI+MK
Sbjct: 14  QNDYIEEHIRRHGRRLDHEERQRKRAAREVHKASAVAQKVTGLKAKMLNKKRRNEKIQMK 73

Query: 63  KKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPLP 122
           K +K H+E+  KQ    + P  A+P YLLDREGQK AK LS+ +K++RK+KA +++VPLP
Sbjct: 74  KTLKAHEERDVKQASTSSDPNQALPTYLLDREGQKDAKALSSAVKERRKDKAARYSVPLP 133

Query: 123 KVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKAH 182
           +VRGIAEDE FKV+KTGK + K WKRM+TK TFVG+ FTRKPPK ERFIRPM LRY KAH
Sbjct: 134 QVRGIAEDEAFKVIKTGKRKQKGWKRMVTKPTFVGESFTRKPPKLERFIRPMGLRYNKAH 193

Query: 183 VTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKYA 242
           VTHPEL A+F LPI+GVKKNPQSPLYTQLGVLTKGT+IEVNVSELG+ TT+GKVVWGKYA
Sbjct: 194 VTHPELKASFNLPIVGVKKNPQSPLYTQLGVLTKGTIIEVNVSELGMTTTTGKVVWGKYA 253

Query: 243 QVTNNPENDGCVNAVLLV 260
           QVTNNPENDGCVNAVLL+
Sbjct: 254 QVTNNPENDGCVNAVLLL 271



>gi|332376065|gb|AEE63173.1| unknown [Dendroctonus ponderosae]
          Length = 259

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 214/260 (82%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K HGRRLDY            H  +  A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHRKLHGRRLDYEERKRKREAREPHKRAETARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK TK K ++ V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKKTK-KVNENVAEGALPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+ +VV++GK + K WKRM+TK TFVG+GFTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADSEVMRVVRSGKTKRKAWKRMVTKVTFVGEGFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSTMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|507697014|ref|XP_004643547.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Octodon degus]
          Length = 260

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/260 (71%), Positives = 214/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEYIELHRKRYGYRLDYHEKKRKKESREAHERSKKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++T K + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR KK
Sbjct: 121 LPKVRAQGETEVLKVIRTAKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRLKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI GVKKNP SPLYT LGV+TKGTVIEVNVSELGL+T  GKV+WGK
Sbjct: 181 AHVTHPELKATFCLPIFGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLLTQGGKVIWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|330799257|ref|XP_003287663.1| hypothetical protein DICPUDRAFT_32773 [Dictyostelium purpureum]
 gi|325082341|gb|EGC35826.1| hypothetical protein DICPUDRAFT_32773 [Dictyostelium purpureum]
          Length = 260

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 210/260 (80%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ ++IE   K+ GRRLD+            H  SA AQKV G++AKL NKKR+AEK E
Sbjct: 1   MPQGDHIELHQKRFGRRLDHYEKVRKKQAREVHKRSAIAQKVFGLKAKLLNKKRYAEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I  HQE++ K+  D  V EGA+PAYLLDRE   RAK+LSNM+KQKRKEKAGKW+VP
Sbjct: 61  MKKTIAMHQERNNKKAADNKVKEGAVPAYLLDRENVSRAKVLSNMVKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR I+E+EMFKV+KTGK + K WKR++TK TFVG+ FTRKPPKYERFIRP  LR+KK
Sbjct: 121 LPKVRAISENEMFKVIKTGKRQKKAWKRLVTKVTFVGESFTRKPPKYERFIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL +TF L I+ VKKNPQSP YTQLGV+TKGTVIEVNVS+LGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKSTFYLDILSVKKNPQSPTYTQLGVITKGTVIEVNVSDLGLVTQSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
            AQVTNNPENDGC+NAVLLV
Sbjct: 241 MAQVTNNPENDGCINAVLLV 260



>gi|389610189|dbj|BAM18706.1| conserved hypothetical protein [Papilio xuthus]
          Length = 259

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/260 (69%), Positives = 215/260 (82%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  AQK+ GI+AK+YNK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKKEAREPHKRAEKAQKLRGIKAKIYNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+E++ KQ + + V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEERNVKQ-NTEKVSEGALPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQV+NNPENDG +NA+LLV
Sbjct: 240 YAQVSNNPENDGVINAILLV 259



>gi|322802243|gb|EFZ22639.1| hypothetical protein SINV_00582 [Solenopsis invicta]
          Length = 259

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 213/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+ + G++AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHRKLYGRRLDYEERKRKREARAPHKRAEQARSLRGLKAKMFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK  K+K D+ +PEGA+P YLLDR+  KRAK+LSNMIKQKRKEK GKW+VP
Sbjct: 61  MKKKIKAHEEKKVKEKSDK-LPEGALPVYLLDRDVTKRAKVLSNMIKQKRKEKVGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  +E E+FKVV++GK + K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+K 
Sbjct: 120 IPKVRAQSESEVFKVVRSGKTKRKSWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKT 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SP+YT LGV+TKGT+IEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFSLPIIGVKKNPSSPMYTTLGVITKGTIIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+N+VLLV
Sbjct: 240 YAQVTNNPENDGCINSVLLV 259



>gi|164660746|ref|XP_001731496.1| hypothetical protein MGL_1679 [Malassezia globosa CBS 7966]
 gi|159105396|gb|EDP44282.1| hypothetical protein MGL_1679 [Malassezia globosa CBS 7966]
          Length = 262

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/260 (67%), Positives = 214/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQN+YIEE IK+HGRRLD+            H  +A A+   G++AK+ NKKR AEK++
Sbjct: 1   MPQNDYIEEHIKRHGRRLDHEERMRKREARSAHRAAAQARNTIGLKAKMLNKKRRAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IKQH+E+  K+    + P+ A+PAYLLDREGQ+ AK LS+ +K++RK+KA +++VP
Sbjct: 61  MKKTIKQHEERDVKKAAPPSNPDTALPAYLLDREGQRDAKALSSAVKERRKDKAARYSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VRGIAEDE F+VVKTGK +   WKRM+TKATFVGD FTRKPPK ERFIRP  LR+KK
Sbjct: 121 LPQVRGIAEDEAFRVVKTGKRKQNGWKRMVTKATFVGDNFTRKPPKLERFIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AH+THP+L ATF LPIIGVKKNPQSP+YTQLGVLTKGT+IEVNVS+LG+VTTSGKVVWGK
Sbjct: 181 AHITHPDLKATFQLPIIGVKKNPQSPMYTQLGVLTKGTIIEVNVSDLGMVTTSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGCVN VLL+
Sbjct: 241 YAQITNNPENDGCVNGVLLL 260



>gi|325296819|ref|NP_001191651.1| TGF beta-inducible nuclear protein [Aplysia californica]
 gi|51511757|gb|AAU05111.1| TGF beta-inducible nuclear protein [Aplysia californica]
          Length = 260

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/260 (70%), Positives = 212/260 (81%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K+HGRRLDY            H  +  A+K+ GI+AKLYNKKRHAEK++
Sbjct: 1   MPQNEYIELHTKRHGRRLDYEEKKRKKEGRRPHEMAVKAKKLRGIKAKLYNKKRHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+EK TKQK      +   P+YLL+RE Q RAK+LSN IKQKRKEKAGKWNVP
Sbjct: 61  MKKTIKMHEEKKTKQKSADNDSQFGNPSYLLERENQIRAKVLSNTIKQKRKEKAGKWNVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+G++E E+FKVVKTGK + K WKRM+TK T+VG+GFTRKP K+ERFIRPM LR+KK
Sbjct: 121 IPKVKGVSEAEVFKVVKTGKTKRKGWKRMVTKVTYVGEGFTRKPVKFERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL A+F LPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 181 ANVTHPELKASFFLPIIGVKKNPSSTMYTSLGVITKGTVIEVNISELGLVTHSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|357627501|gb|EHJ77180.1| hairy cell leukemia protein 1 [Danaus plexippus]
          Length = 259

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/260 (69%), Positives = 215/260 (82%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKKEAREPHKRAEKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ KQ + + V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVKQ-NTEKVAEGAVPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDG +NA+LLV
Sbjct: 240 YAQVTNNPENDGVINAILLV 259



>gi|333449477|gb|AEF33424.1| ribosome biogenesis protein nsa2-like protein, partial [Crassostrea
           ariakensis]
          Length = 229

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 204/228 (89%)

Query: 33  HSTSAFAQKVHGIRAKLYNKKRHAEKIEMKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLD 92
           H  +  A+K+ GIRAKLYNKKRHAEK++MKK IK H+E+ TKQK++  VPEGA+PAYLLD
Sbjct: 2   HEMAEKAKKLRGIRAKLYNKKRHAEKVQMKKTIKMHEERKTKQKNNDEVPEGAVPAYLLD 61

Query: 93  REGQKRAKILSNMIKQKRKEKAGKWNVPLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITK 152
           REGQ RAK+LSNMIKQKRKEKAGKW+VPLPKVRG++E E+FKV+K+GK + K WKRM+TK
Sbjct: 62  REGQSRAKVLSNMIKQKRKEKAGKWDVPLPKVRGMSEAEVFKVIKSGKTKRKGWKRMVTK 121

Query: 153 ATFVGDGFTRKPPKYERFIRPMALRYKKAHVTHPELGATFCLPIIGVKKNPQSPLYTQLG 212
             +VG+GFTRKPPK+ERFIRPM LR+ KAHVTHPEL ATFCLPIIGVKKNP S +YT LG
Sbjct: 122 VCYVGEGFTRKPPKFERFIRPMGLRFNKAHVTHPELKATFCLPIIGVKKNPTSTMYTSLG 181

Query: 213 VLTKGTVIEVNVSELGLVTTSGKVVWGKYAQVTNNPENDGCVNAVLLV 260
           V+TKGT+IEVN+SELGLVT +GKV+WGKYAQVTNNPENDGC+NAVLLV
Sbjct: 182 VITKGTIIEVNISELGLVTQAGKVIWGKYAQVTNNPENDGCINAVLLV 229



>gi|380011074|ref|XP_003689638.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Apis florea]
          Length = 259

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 214/260 (82%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+ + GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHRKLYGRRLDYEERKRKKEAREPHKRAERARTLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H EK  K+K +  VPEGA+P YLLDR+ +K AKILSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKCHMEKKVKEKSNN-VPEGALPVYLLDRDIKKDAKILSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+  +E E+FKV+++GK++ K WKRM+TK TFV + FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVKTQSESEVFKVMRSGKSKRKSWKRMVTKVTFVNENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP SP+YT LGV+TKGT+IEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSPMYTSLGVITKGTIIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NA+LLV
Sbjct: 240 YAQVTNNPENDGCINAILLV 259



>gi|332024400|gb|EGI64598.1| Ribosome biogenesis protein NSA2-like protein [Acromyrmex
           echinatior]
          Length = 259

 Score =  378 bits (970), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 212/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K HGRRLDY            H  +  A+ + G++AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHRKLHGRRLDYEERKRKREARAPHKRAERARTLRGLKAKMFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KKKI+ H+EK  K K D+ +PEGA+P YLLDR+  KRAK+LSNMIKQKRKEK GKW+VP
Sbjct: 61  IKKKIRAHEEKKVKVKSDK-LPEGALPVYLLDRDVTKRAKVLSNMIKQKRKEKVGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  +E E+FKVV++GK + K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+K 
Sbjct: 120 IPKVRAQSESEVFKVVRSGKTKRKSWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKT 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SP+YT LGV+TKGT+IEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFSLPIIGVKKNPSSPMYTNLGVITKGTIIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLLV
Sbjct: 240 FAQVTNNPENDGCINAVLLV 259



>gi|403416887|emb|CCM03587.1| predicted protein [Fibroporia radiculosa]
          Length = 504

 Score =  378 bits (970), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/258 (69%), Positives = 210/258 (81%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           P     EE IK+HGRRLDY            H  SA AQK  G++AK+ + KRHAEK++M
Sbjct: 47  PNTNASEEHIKRHGRRLDYYERKRKREARAVHRASATAQKAFGLKAKILHAKRHAEKVQM 106

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK +K H E++ KQKD   VP+GA+P YLLDREGQK AK LS  IK+KRK+KA K+ VPL
Sbjct: 107 KKTLKAHDERNVKQKDSSTVPDGALPTYLLDREGQKDAKALSTAIKEKRKDKAAKYTVPL 166

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVRGIAEDEMFKV++TGK++ K WKRM+TKATFVG+GFTRKP K ERF+RPMALRYKKA
Sbjct: 167 PKVRGIAEDEMFKVMRTGKSKKKAWKRMVTKATFVGEGFTRKPVKMERFVRPMALRYKKA 226

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           +VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VT  GKVV+GKY
Sbjct: 227 NVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTAGGKVVFGKY 286

Query: 242 AQVTNNPENDGCVNAVLL 259
           AQ+TNNPENDGC+NAVLL
Sbjct: 287 AQITNNPENDGCINAVLL 304



>gi|321468461|gb|EFX79446.1| hypothetical protein DAPPUDRAFT_231033 [Daphnia pulex]
          Length = 260

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/260 (67%), Positives = 215/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++G R+DY               S  AQK+ GI+ K++ KKR++EK++
Sbjct: 1   MPQNEHIELFQKRYGFRMDYQERQRKKKAREHKLQSKMAQKLIGIKGKIFAKKRYSEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +K+ IK H+EK T +K+D  VPEGA+PAYLLDRE   +AK+LS+M+KQKRKEKAGKW+VP
Sbjct: 61  LKRTIKAHEEKKTCKKEDGKVPEGAMPAYLLDRENTSQAKLLSSMVKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR  +E E+F+V+KTGK+R K WKR++TK  FVG+GFTRKPPKYERF+RPMALR+KK
Sbjct: 121 LPKVRAQSEAEVFRVLKTGKSRRKGWKRLVTKVCFVGEGFTRKPPKYERFVRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SP+YT LGV+TKGT+IEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIVGVKKNPSSPMYTSLGVITKGTIIEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NA+LLV
Sbjct: 241 YAQVTNNPENDGCINAILLV 260



>gi|240952276|ref|XP_002399367.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215490570|gb|EEC00213.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 260

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 214/260 (82%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   +++G RLD+            H  +  A+ V G++AK+  KKR++EK++
Sbjct: 1   MPQNEHIELHRRRYGYRLDHHERLRKRKGRQVHEDAQKAKTVRGLKAKMLTKKRYSEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+EK TKQ+  +A  +GA+P YLLDRE Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKTLKMHEEKQTKQRGPEAAAQGAVPVYLLDRENQSRAKVLSNMIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVRG+ + E F+V+KTGK + K WKRM+TK TFVG+GFTRKPPK+ERFIRPMALR+KK
Sbjct: 121 VPKVRGVGDAEAFRVLKTGKRKKKAWKRMVTKVTFVGEGFTRKPPKFERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SPLY+QLGV+T+GTV+EVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFYLPIIGVKKNPSSPLYSQLGVVTRGTVLEVNVSELGLVTQGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|390601926|gb|EIN11319.1| TGF beta-inducible nuclear protein 1 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 295

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/260 (72%), Positives = 219/260 (84%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE IK+HGRRLDY            H  SA AQK  GI+AKL + KRHA+K++
Sbjct: 37  MPQNEYIEEHIKRHGRRLDYYERKRKREARESHKASAIAQKTFGIKAKLLHAKRHAQKVQ 96

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E++ KQ D  A PEGA+PAYLLDREGQ+ AK LS+ IK+KRKEKA K+ VP
Sbjct: 97  MKKTLKAHDERNVKQADTSA-PEGALPAYLLDREGQRDAKALSSAIKEKRKEKAAKYAVP 155

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDEMFKV++TGK+++K WKRM+TKATFVG+GFTRKP K ERF+RPMALRYKK
Sbjct: 156 LPKVRGIAEDEMFKVMRTGKSKSKSWKRMVTKATFVGEGFTRKPVKMERFVRPMALRYKK 215

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF L I+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VT  GKVV+GK
Sbjct: 216 ANVTHPDLKATFQLQILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTAGGKVVFGK 275

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGC+NAVLLV
Sbjct: 276 YAQITNNPENDGCINAVLLV 295



>gi|350423324|ref|XP_003493444.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Bombus
           impatiens]
          Length = 259

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 212/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+ + GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHRKLYGRRLDYEERKRKREAREPHKRAERARTLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H  K  K+K    VPEGA+P YLLDR+ +K AK+LSNMIKQKRKEK GKW+VP
Sbjct: 61  MKKKIKSHMVKKVKEKSSN-VPEGALPVYLLDRDIKKDAKVLSNMIKQKRKEKVGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+  +E E+FKV+++GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVKTQSESEVFKVMRSGKSKRKSWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP SP+YT LGV+TKGT+IEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSPMYTSLGVITKGTIIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|307172444|gb|EFN63897.1| Ribosome biogenesis protein NSA2-like protein [Camponotus
           floridanus]
          Length = 259

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 211/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+ + GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHRKLYGRRLDYEERKRKREARAPHKRAEQARTLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK  K+K D+ +P+GA+P YLLDR    RAK+LSNMIKQKRKEK GKW+VP
Sbjct: 61  MKKKIKAHEEKKVKEKSDK-LPDGALPVYLLDRNVTNRAKVLSNMIKQKRKEKVGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  +E E+FKV+++GK + K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+K 
Sbjct: 120 IPKVRAQSESEVFKVLRSGKTKRKSWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKT 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SPLYT LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFSLPIIGVKKNPSSPLYTTLGVITKGTVIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLLV
Sbjct: 240 FAQVTNNPENDGCINAVLLV 259



>gi|307184032|gb|EFN70586.1| Ribosome biogenesis protein NSA2-like protein [Camponotus
           floridanus]
          Length = 259

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/260 (67%), Positives = 212/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+ + GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHRKLYGRRLDYEERKRKREARAPHKRAEQARTLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI+ H+EK  K+K D+ +P+GA+P YLLDR    RAK+LSNMIKQKRKEK GKW+VP
Sbjct: 61  MKKKIRAHEEKKVKEKSDK-LPDGALPVYLLDRNVTNRAKVLSNMIKQKRKEKVGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  +E E+FKV+++GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+K 
Sbjct: 120 IPKVRAQSESEVFKVLRSGKSKRKSWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKT 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SPLYT LGV+TKGT+IE+N+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFSLPIIGVKKNPSSPLYTSLGVITKGTIIEINISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLLV
Sbjct: 240 FAQVTNNPENDGCINAVLLV 259



>gi|307203226|gb|EFN82381.1| Ribosome biogenesis protein NSA2-like protein [Harpegnathos
           saltator]
          Length = 259

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/260 (67%), Positives = 213/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+ + G++AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHRKLYGRRLDYEERKRKREARAPHKRAEQARSLRGLKAKMFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MK+KIK H+EK  KQK D+ +PEGA+P YLLDR+  +RAK+LSNMIKQKRKEK GKW+VP
Sbjct: 61  MKRKIKAHEEKKIKQKSDK-LPEGALPWYLLDRDVTERAKVLSNMIKQKRKEKVGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  +E E+FKV+++GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+K 
Sbjct: 120 IPKVRAQSESEVFKVLRSGKSKRKSWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKT 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPII VKKNP SP+YT LGV+TKGT+IEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFSLPIINVKKNPSSPMYTSLGVITKGTIIEVNISELGLVTQTGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|297806661|ref|XP_002871214.1| ribosomal protein S8e family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297317051|gb|EFH47473.1| ribosomal protein S8e family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 260

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 208/260 (80%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YI+  IK++G RLD+            H  SA AQK  GI+ K+  KK +AEK  
Sbjct: 1   MPQGDYIDLHIKRNGYRLDHHERLRKKEARAVHKRSAMAQKSLGIKGKMIAKKNYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+E S+++K D+ V EGA+PAYLLDRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLKMHEESSSRRKADENVQEGAVPAYLLDREDTTRAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMF+V+++GK +TKQWKRM+TKATFVG  FTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFRVIRSGKRKTKQWKRMVTKATFVGPAFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TFCL IIG+KKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFCLEIIGIKKNPNGPMYTSLGVMTRGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|255085034|ref|XP_002504948.1| ribosomal protein S8E [Micromonas sp. RCC299]
 gi|226520217|gb|ACO66206.1| ribosomal protein S8E [Micromonas sp. RCC299]
          Length = 260

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++GRRLDY            H  SA A+K+ G++AKLY KKRH+EKI 
Sbjct: 1   MPQNEHIELFQKRYGRRLDYYEKKRKKEAREPHKRSAVAKKLIGLKAKLYAKKRHSEKIT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I+QH E++ K K ++    GAIPAYLLDRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTIQQHSERTNKHKVEEEAAPGAIPAYLLDREQTSRAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR IAEDEMF+V+++GK + K WKRMITKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPIAEDEMFRVMRSGKRQKKSWKRMITKATFVGPGFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AH+THPEL  TF L I+GVKKNP  P+Y+ LGVLTKGTVIEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHITHPELKCTFQLDILGVKKNPNGPMYSSLGVLTKGTVIEVNVSELGLVTPGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGCVN VLLV
Sbjct: 241 YAQITNNPENDGCVNGVLLV 260



>gi|303282749|ref|XP_003060666.1| ribosomal protein S8e [Micromonas pusilla CCMP1545]
 gi|226458137|gb|EEH55435.1| ribosomal protein S8e [Micromonas pusilla CCMP1545]
          Length = 260

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/260 (69%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++GRRLDY            H  SA A+K+ G++AKLY KKRHAEK+ 
Sbjct: 1   MPQNEHIELFQKRYGRRLDYYEKKRKKEAREPHKRSAVAKKLIGLKAKLYAKKRHAEKVT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I+QH E++ K K ++    GAIPAYL+DRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTIQQHSERTNKHKVEEEAAPGAIPAYLMDREQTSRAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMF+V+++GK + K WKRMITKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFRVMRSGKRQKKSWKRMITKATFVGPGFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AH+THPEL  TF L I+GVKKNP  P+Y+ LGVLTKGTVIEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHITHPELKCTFQLDILGVKKNPNGPMYSSLGVLTKGTVIEVNVSELGLVTPGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGCVN VLLV
Sbjct: 241 YAQVTNNPENDGCVNGVLLV 260



>gi|482557095|gb|EOA21287.1| hypothetical protein CARUB_v10001640mg, partial [Capsella rubella]
          Length = 285

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE+  K++G RLD+            H  S  AQK  GI+ K+  KK +AEK  
Sbjct: 26  MPQGDYIEQHRKRYGYRLDHHERLRKKEARAAHKHSTMAQKSLGIKGKMIAKKNYAEKAL 85

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+E S+++K D+ V EGA+PAYLLDRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 86  MKKTLKMHEESSSRRKADENVQEGAVPAYLLDREETTRAKVLSNTIKQKRKEKAGKWEVP 145

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMF+V+++GK +TKQWKRM+TKATFVG  FTRKPPKYERFIRP  LR+ K
Sbjct: 146 LPKVRPVAEDEMFRVIRSGKRKTKQWKRMVTKATFVGPAFTRKPPKYERFIRPSGLRFTK 205

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TFCL IIGVKKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 206 AHVTHPELKCTFCLEIIGVKKNPNGPMYTSLGVMTRGTIIEVNVSELGLVTPAGKVVWGK 265

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 266 YAQVTNNPENDGCINAVLLV 285



>gi|300121439|emb|CBK21958.2| unnamed protein product [Blastocystis hominis]
          Length = 277

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG R DY            H  + +A+KVHGI+  L++ +R+ EK  
Sbjct: 18  MPQNEFIELHQKRHGVRFDYYERKRKKEARAGHEKAKYAKKVHGIKGILHSAQRYKEKAA 77

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K+IK H+E+S K     A PEGA+PAYLLDREG  R+KILSN +KQKRKEKAGKW VP
Sbjct: 78  MRKEIKMHEERSNKHATTDATPEGALPAYLLDREGVSRSKILSNTVKQKRKEKAGKWTVP 137

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV  IA+ EMF+V+ TGK + KQWKRMITK TFVG+GFTRKPPKYERF+RP  LR+KK
Sbjct: 138 VPKVNPIADAEMFRVLSTGKRKQKQWKRMITKVTFVGEGFTRKPPKYERFVRPTGLRFKK 197

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNPQS LYT+LGV+TKGT+IEVNVSELGLVT SGKVVWGK
Sbjct: 198 AHVTHPELKTTFYLDIIGVKKNPQSKLYTELGVITKGTIIEVNVSELGLVTESGKVVWGK 257

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NA+LLV
Sbjct: 258 YAQVTNNPENDGCINAILLV 277



>gi|300122920|emb|CBK23927.2| unnamed protein product [Blastocystis hominis]
          Length = 277

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG R DY            H  + +A+KVHGI+  L++ +R+ EK  
Sbjct: 18  MPQNEFIELHQKRHGVRFDYYERKRKKEARAGHEKAKYAKKVHGIKGILHSAQRYKEKAA 77

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K+IK H+E+S K     A PEGA+PAYLLDREG  R+KILSN +KQKRKEKAGKW VP
Sbjct: 78  MRKEIKMHEERSNKHATTDATPEGALPAYLLDREGVSRSKILSNTVKQKRKEKAGKWTVP 137

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV  IA+ EMF+V+ TGK + KQWKRMITK TFVG+GFTRKPPKYERF+RP  LR+KK
Sbjct: 138 VPKVNPIADAEMFRVLSTGKRKQKQWKRMITKVTFVGEGFTRKPPKYERFVRPTGLRFKK 197

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNPQS LYT+LGV+TKGT+IEVNVSELGLVT SGKVVWGK
Sbjct: 198 AHVTHPELKTTFYLDIIGVKKNPQSKLYTELGVITKGTIIEVNVSELGLVTESGKVVWGK 257

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NA+LLV
Sbjct: 258 YAQVTNNPENDGCINAILLV 277



>gi|470236960|ref|XP_004350433.1| TGF beta-inducible nuclear protein 1 [Dictyostelium fasciculatum]
 gi|328865343|gb|EGG13729.1| TGF beta-inducible nuclear protein 1 [Dictyostelium fasciculatum]
          Length = 260

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 208/260 (80%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           M Q +YIE   K+ GRR D+            H  SA AQK+ G +AKL NKKR+AEK  
Sbjct: 1   MAQGDYIELHRKRFGRRFDHFEKLRKKTAREGHKRSALAQKLTGFKAKLLNKKRYAEKAA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK+I  HQE++ K+     + EGA+P+YLLDREG  RAK+LSNM+KQKRKEKAGKWNVP
Sbjct: 61  MKKQIALHQERTNKKASTDNIKEGAVPSYLLDREGVSRAKVLSNMVKQKRKEKAGKWNVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR I+EDEMFKV++TGK + K WKRM+TK TFVG+GFTRKPPKYERFIRP  LR+KK
Sbjct: 121 LPKVRAISEDEMFKVIRTGKRQKKAWKRMVTKVTFVGEGFTRKPPKYERFIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL +TF L I+ VKKNPQSP YTQLGV+TKGT+IEVNVS+LGLVT +GKVVWGK
Sbjct: 181 ANVTHPELKSTFYLDILSVKKNPQSPTYTQLGVITKGTIIEVNVSDLGLVTQTGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDG +NA+LLV
Sbjct: 241 YAQVTNNPENDGTINALLLV 260



>gi|58262054|ref|XP_568437.1| ribosomal large subunit biogenesis-related protein [Cryptococcus
           neoformans var. neoformans JEC21]
 gi|134118371|ref|XP_772199.1| ribosome biogenesis protein NSA2 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|338818358|sp|P0CQ61.1|NSA2_CRYNB RecName: Full=Ribosome biogenesis protein NSA2
 gi|338818359|sp|P0CQ60.1|NSA2_CRYNJ RecName: Full=Ribosome biogenesis protein NSA2
 gi|50254807|gb|EAL17552.1| hypothetical protein CNBM1180 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57230610|gb|AAW46920.1| ribosomal large subunit biogenesis-related protein, putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 254

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/254 (68%), Positives = 210/254 (82%)

Query: 7   IEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEMKKKIK 66
           +EE  K+HGRRLDY            H  SA AQK+ G +AKL++ +RHAEK++MKK +K
Sbjct: 1   MEEHRKRHGRRLDYEEKKRKRTAREAHKASADAQKIFGHKAKLHHARRHAEKVQMKKTLK 60

Query: 67  QHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPLPKVRG 126
            H E++ KQKDD AV EGA+PAYLLDR+GQK AK LS+ +K +RK++A K++VPLPKVRG
Sbjct: 61  AHDERNVKQKDDGAVKEGALPAYLLDRDGQKDAKALSSAVKDRRKDRAAKYSVPLPKVRG 120

Query: 127 IAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKAHVTHP 186
           IAE+EMFKV+KTGK+++K WKRM+ KATFVG+GFTRKP K ERFIRPM LR  KA+VTHP
Sbjct: 121 IAEEEMFKVIKTGKSKSKSWKRMVNKATFVGEGFTRKPVKLERFIRPMGLRMTKANVTHP 180

Query: 187 ELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKYAQVTN 246
           EL  TF LPI+GVKKNPQSPLYT LGVLTKGT++EVNVSELG+VTT GKVVW KYAQ+TN
Sbjct: 181 ELKTTFQLPILGVKKNPQSPLYTSLGVLTKGTILEVNVSELGMVTTGGKVVWSKYAQITN 240

Query: 247 NPENDGCVNAVLLV 260
           NPENDGC+N+VLLV
Sbjct: 241 NPENDGCINSVLLV 254



>gi|242020114|ref|XP_002430501.1| TGF-beta-inducible nuclear protein, putative [Pediculus humanus
           corporis]
 gi|212515658|gb|EEB17763.1| TGF-beta-inducible nuclear protein, putative [Pediculus humanus
           corporis]
          Length = 259

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 213/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IK HGRRLDY            H  +  A+ +  ++AK+YNK+R  EKI+
Sbjct: 1   MPQNEYIEKHIKLHGRRLDYHERKRKKEAREPHKRAERARTLRKLKAKIYNKQRRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI+ H+EK TK K+ +   EGA+P YLLDR  Q R+K+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIRMHEEKLTK-KNTEKPKEGALPPYLLDRNIQMRSKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+  A+ E+FKV+++GK+R K WKRM+TK T+VG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVKAQADSEVFKVLRSGKSRRKAWKRMVTKVTYVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSAMYTSLGVITKGTVIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|449269898|gb|EMC80636.1| Ribosome biogenesis protein NSA2 like protein, partial [Columba
           livia]
          Length = 239

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 201/228 (88%)

Query: 33  HSTSAFAQKVHGIRAKLYNKKRHAEKIEMKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLD 92
           H  S  A+K+ G++AKLY+++RH+EKI+MKK IK H++++TK+KDD+  P+GA+PAYLLD
Sbjct: 12  HERSRKAKKMIGLKAKLYHRQRHSEKIQMKKTIKMHEKRNTKKKDDEKTPKGAVPAYLLD 71

Query: 93  REGQKRAKILSNMIKQKRKEKAGKWNVPLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITK 152
           REGQ RAK+LSNMIKQKRKEKAGKW VP+PKVR   E E+ KV++TGK + K WKRM+TK
Sbjct: 72  REGQSRAKVLSNMIKQKRKEKAGKWEVPVPKVRAQGETEVLKVIRTGKRKKKAWKRMVTK 131

Query: 153 ATFVGDGFTRKPPKYERFIRPMALRYKKAHVTHPELGATFCLPIIGVKKNPQSPLYTQLG 212
             FVGDGFTRKPPKYERFIRPM LR+KKAHVTHPEL ATFCLPI+GVKKNP SPLYT LG
Sbjct: 132 VCFVGDGFTRKPPKYERFIRPMGLRFKKAHVTHPELKATFCLPILGVKKNPSSPLYTTLG 191

Query: 213 VLTKGTVIEVNVSELGLVTTSGKVVWGKYAQVTNNPENDGCVNAVLLV 260
           V+TKGTVIEVNVSELGLVT  GKV+WGKYAQVTNNPENDGC+NAVLLV
Sbjct: 192 VITKGTVIEVNVSELGLVTQGGKVIWGKYAQVTNNPENDGCINAVLLV 239



>gi|383863294|ref|XP_003707116.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Megachile
           rotundata]
          Length = 259

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 210/260 (80%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +  A+ + GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHRKLYGRRLDYEERKRKREAREPHKRAERARTLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H EK  K+K +  VP GA+P YLLDR+ +K AK+LSNMIKQKRKEK GKW+VP
Sbjct: 61  MKKKIKSHMEKKVKEKSND-VPNGALPVYLLDRDVKKDAKVLSNMIKQKRKEKVGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+  +E E+FK+++TGK+R K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVKTQSESEVFKIMRTGKSRRKSWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF LPIIGVKKNP S +YT LGV+TKGT+IEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKTTFYLPIIGVKKNPSSSMYTSLGVITKGTIIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|449523511|ref|XP_004168767.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Cucumis
           sativus]
          Length = 260

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 205/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HG R D+            H  SA AQK  GI+ K++ KKR+AEK  
Sbjct: 1   MPQGDYIELHRKRHGYRHDHFERKRKKEAREVHKRSATAQKALGIKGKMFAKKRYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E S+++K D  V EGA+PAYLLDRE   RAKILSN +KQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESSSRRKVDDDVQEGALPAYLLDRENTARAKILSNTVKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV++TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVIRTGKRKTKQWKRMVTKATFVGAGFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P+YT LGV+TKG +IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVMTKGAIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|391335954|ref|XP_003742350.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Metaseiulus
           occidentalis]
          Length = 261

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/261 (70%), Positives = 214/261 (81%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG  LDY            H  +A A+K+ GI+AK++ K+R++EK++
Sbjct: 1   MPQNEHIELHQKRHGYSLDYHERKRKKEARQVHEVAAKAKKLRGIKAKIFAKQRYSEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDD-QAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           MKK IK H+EK TKQK     V +GA+P YLLDREGQ RAK+LSNMIKQKRKEKAGKW+V
Sbjct: 61  MKKTIKMHEEKKTKQKTKEDIVQDGAVPVYLLDREGQSRAKVLSNMIKQKRKEKAGKWDV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           P+PKV  +A+ E F+V+KTGK   K WKRM+TK  +VG+GFTRKPPK+ERFIRPM LR+K
Sbjct: 121 PIPKVATVADAEAFRVIKTGKRAKKAWKRMVTKVCYVGEGFTRKPPKFERFIRPMGLRFK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KAHVTHPEL ATFCLPIIGVKKNP SPLYTQLGV+TKGTVIEVNVSELGLVTT GKVVWG
Sbjct: 181 KAHVTHPELKATFCLPIIGVKKNPSSPLYTQLGVITKGTVIEVNVSELGLVTTGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQVTNNPENDGC+NAVLLV
Sbjct: 241 KYAQVTNNPENDGCINAVLLV 261



>gi|449451181|ref|XP_004143340.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Cucumis
           sativus]
          Length = 260

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 205/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HG R D+            H  SA AQK  GI+ K++ KKR+AEK  
Sbjct: 1   MPQGDYIELHRKRHGYRHDHFERKRKKEAREVHKRSATAQKALGIKGKMFAKKRYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E S+++K D  V EGA+PAYLLDRE   RAKILSN +KQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESSSRRKVDDDVQEGALPAYLLDRENTARAKILSNTVKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV++TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVIRTGKRKTKQWKRMVTKATFVGAGFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P+YT LGV+TKG +IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVITKGAIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|470512286|ref|XP_004352466.1| ribosomal protein S8e, putative [Acanthamoeba castellanii str.
           Neff]
 gi|440802050|gb|ELR22989.1| ribosomal protein S8e, putative [Acanthamoeba castellanii str.
           Neff]
          Length = 259

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 212/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YI+    ++G R+DY            H  S FAQKVHG+RAKLY KKRHAEK+E
Sbjct: 1   MPQGDYIKLHRARYGYRMDYFEKIRKKEARMVHKRSEFAQKVHGLRAKLYAKKRHAEKVE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI  HQ+K+ K  +++ + +GA+PAYLLDRE  +RAK+LSN +KQK+K++AGKW+VP
Sbjct: 61  MKKKIAMHQQKTNKHVEEK-MEKGAVPAYLLDREQTRRAKVLSNTVKQKKKQRAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR I+E EMF VV +GK   K WKRM+ K TFVGD FTRKPPKYERFIRP ALR+KK
Sbjct: 120 LPKVRPISEFEMFGVVASGKRGRKSWKRMVRKVTFVGDNFTRKPPKYERFIRPAALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF L I+GVKKNPQ+PLYTQLGV+TKGT++EVNVS+LGLVT +GKV+WGK
Sbjct: 180 AHVTHPELKATFYLDILGVKKNPQTPLYTQLGVITKGTILEVNVSDLGLVTPAGKVIWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|358249178|ref|NP_001239750.1| uncharacterized protein LOC100812311 [Glycine max]
 gi|255645233|gb|ACU23114.1| unknown [Glycine max]
          Length = 260

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 206/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   + +G RLD+            H  SA AQK  GI+ K+  KK +AEK +
Sbjct: 1   MPQGDYIERHRRDYGYRLDHFERKRKKEARQVHKRSAIAQKALGIKGKMIAKKNYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E S+++K D  V +GA+PAYLLDR+   RAK+LSN IKQKRKEKAGKW+VP
Sbjct: 61  MKKTLAMHEESSSRRKTDDNVQDGAVPAYLLDRDNTTRAKVLSNTIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKVV+TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVVRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L +IGVKKNP  P+YT LGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLELIGVKKNPNGPMYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|460405047|ref|XP_004247989.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Solanum
           lycopersicum]
          Length = 260

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 206/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+ GRR D+            H  S  AQK  GI+ K++ KKR+AEK +
Sbjct: 1   MPQGDYIELHRKRFGRRPDHFERKRKKDAREVHKRSQIAQKALGIKGKMFAKKRYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E S+++K D  V EGA+PAYL+DRE   RAKILSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESSSRRKVDDDVHEGAVPAYLMDRETTTRAKILSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMF+V+++GK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFRVIRSGKRKTKQWKRMVTKATFVGAGFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P+YT LGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|470320051|gb|EMR11647.1| 30S ribosomal protein S8e [Pneumocystis murina B123]
          Length = 260

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/260 (66%), Positives = 216/260 (83%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE  IKK GRRLD+            H  S  ++K+ GI+AK+YNK+R  E I+
Sbjct: 1   MPQGDYIENHIKKRGRRLDFEERKRKREAHLVHKKSECSRKLRGIKAKIYNKQRRQENIK 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K IK+H++++ K+K   ++P+GA+P YLLDR  +K+AKILSNM+KQKRK+K G+++VP
Sbjct: 61  MRKLIKEHEKRNIKEKIPNSIPDGAVPTYLLDRGDEKQAKILSNMVKQKRKDKEGRYSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGI+E+E+FKV+KTGK++ K WKR+ITKATFVG+GFTRKP KYERFIRPMALR KK
Sbjct: 121 LPKVRGISEEEIFKVIKTGKSKKKSWKRLITKATFVGEGFTRKPVKYERFIRPMALRQKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L  T   PI+GVKKNPQSP+YTQLGVLTKGT+IEVNVSE+GLVT  GKVVWGK
Sbjct: 181 ANVTHPKLAVTMQFPILGVKKNPQSPMYTQLGVLTKGTIIEVNVSEMGLVTPGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGCVNA+LLV
Sbjct: 241 YAQITNNPENDGCVNAILLV 260



>gi|26344332|dbj|BAB22128.2| unnamed protein product [Mus musculus]
          Length = 227

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/221 (78%), Positives = 196/221 (88%)

Query: 40  QKVHGIRAKLYNKKRHAEKIEMKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRA 99
           QK   ++AKLY+K+RHAEKI+MKK IK H++++TKQKDD+  P+GA+PAYLLDREGQ RA
Sbjct: 7   QKNDCLKAKLYHKQRHAEKIQMKKTIKMHEKRNTKQKDDEKTPQGAVPAYLLDREGQSRA 66

Query: 100 KILSNMIKQKRKEKAGKWNVPLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDG 159
           K+LSNMIKQKRKEKAGKW VPLPKVR   E E+ KV++TGK + K WKRM+TK  FVGDG
Sbjct: 67  KVLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDG 126

Query: 160 FTRKPPKYERFIRPMALRYKKAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTV 219
           FTRKPPKYERFIRPM LR+KKAHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTV
Sbjct: 127 FTRKPPKYERFIRPMGLRFKKAHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTV 186

Query: 220 IEVNVSELGLVTTSGKVVWGKYAQVTNNPENDGCVNAVLLV 260
           IEVNVSELGLVT  GKV+WGKYAQVTNNPENDGC+NAVLLV
Sbjct: 187 IEVNVSELGLVTQGGKVIWGKYAQVTNNPENDGCINAVLLV 227



>gi|321265083|ref|XP_003197258.1| constituent of 66S pre-ribosomal particles; Nsa2p [Cryptococcus
           gattii WM276]
 gi|317463737|gb|ADV25471.1| Constituent of 66S pre-ribosomal particles, putative; Nsa2p
           [Cryptococcus gattii WM276]
          Length = 254

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/254 (68%), Positives = 209/254 (82%)

Query: 7   IEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEMKKKIK 66
           +EE  K+HGRRLDY            H  SA AQK+ G +AKL++ +RHAEK++MKK +K
Sbjct: 1   MEEHRKRHGRRLDYEEKKRKRTAREAHKASADAQKIFGHKAKLHHARRHAEKVQMKKTLK 60

Query: 67  QHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPLPKVRG 126
            H E++ KQKDD AV EGA+PAYLLDR+ QK AK LS+ +K +RK++A K++VPLPKVRG
Sbjct: 61  AHDERNVKQKDDGAVKEGALPAYLLDRDSQKDAKALSSAVKDRRKDRAAKYSVPLPKVRG 120

Query: 127 IAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKAHVTHP 186
           IAE+EMFKV+KTGK+++K WKRM+ KATFVG+GFTRKP K ERFIRPM LR  KA+VTHP
Sbjct: 121 IAEEEMFKVIKTGKSKSKSWKRMVNKATFVGEGFTRKPVKLERFIRPMGLRMTKANVTHP 180

Query: 187 ELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKYAQVTN 246
           EL  TF LPI+GVKKNPQSPLYT LGVLTKGT++EVNVSELG+VTT GKVVW KYAQ+TN
Sbjct: 181 ELKTTFQLPILGVKKNPQSPLYTSLGVLTKGTILEVNVSELGMVTTGGKVVWSKYAQITN 240

Query: 247 NPENDGCVNAVLLV 260
           NPENDGC+N+VLLV
Sbjct: 241 NPENDGCINSVLLV 254



>gi|302833141|ref|XP_002948134.1| hypothetical protein VOLCADRAFT_109659 [Volvox carteri f.
           nagariensis]
 gi|300266354|gb|EFJ50541.1| hypothetical protein VOLCADRAFT_109659 [Volvox carteri f.
           nagariensis]
          Length = 260

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 201/260 (77%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++GRRLDY            H  S +AQK  GI+ K++ KKRHAEK  
Sbjct: 1   MPQNEHIELHRKRYGRRLDYEERKRKKQAREVHKRSEYAQKALGIKGKMFAKKRHAEKAM 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I  H+E+  K K     P+ A+PAYLL+RE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTIAMHEERDNKHKAVDGAPQNAVPAYLLEREQVDRAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VR IAEDEMFKV+K+GK   K WKRMITK TFVG GFTRKPPKYERFIRP  LR  K
Sbjct: 121 LPQVRPIAEDEMFKVLKSGKRMKKSWKRMITKVTFVGQGFTRKPPKYERFIRPTGLRMNK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCL IIGVKKNP   +Y+QLGV+TKGT+IEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLDIIGVKKNPNGQMYSQLGVVTKGTIIEVNVSELGLVTPGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|15240023|ref|NP_196254.1| ribosomal protein S8e family protein [Arabidopsis thaliana]
 gi|9758416|dbj|BAB08958.1| unnamed protein product [Arabidopsis thaliana]
 gi|16604561|gb|AAL24082.1| unknown protein [Arabidopsis thaliana]
 gi|21280889|gb|AAM45100.1| unknown protein [Arabidopsis thaliana]
 gi|332003623|gb|AED91006.1| Ribosomal protein S8e family protein [Arabidopsis thaliana]
          Length = 260

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 206/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YI+   K++G RLD+            H  S  AQK  GI+ K+  KK +AEK  
Sbjct: 1   MPQGDYIDLHRKRNGYRLDHFERKRKKEAREVHKHSTMAQKSLGIKGKMIAKKNYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+E S+++K D+ V EGA+PAYLLDRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLKMHEESSSRRKADENVQEGAVPAYLLDREDTTRAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMF+V+++GK +TKQWKRM+TKATFVG  FTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFRVIRSGKRKTKQWKRMVTKATFVGPAFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TFCL IIG+KKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFCLEIIGIKKNPNGPMYTSLGVMTRGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|359806220|ref|NP_001240952.1| uncharacterized protein LOC100801671 [Glycine max]
 gi|255648306|gb|ACU24605.1| unknown [Glycine max]
          Length = 260

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 206/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   + +G RLD+            H  SA AQK  GI+ K+  KK +AEK +
Sbjct: 1   MPQGDYIERHRRDYGYRLDHFERKRKKEARQVHKRSAIAQKALGIKGKMIAKKNYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E ++++K D  V +GA+PAYLLDR+   RAK+LSN IKQKRKEKAGKW+VP
Sbjct: 61  MKKTLAMHEESTSRRKTDDNVQDGAVPAYLLDRDNTTRAKVLSNTIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKVV+TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVVRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L +IGVKKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLELIGVKKNPNGPMYTSLGVITRGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|356537190|ref|XP_003537112.1| PREDICTED: uncharacterized protein LOC100782398 [Glycine max]
          Length = 542

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/259 (66%), Positives = 205/259 (79%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQ +YIE   + +G RLD+            H  S+ AQK  GI+ K+  KK +AEK +M
Sbjct: 284 PQGDYIERHRRDYGYRLDHFERKRKKEARQVHKRSSIAQKALGIKGKMIAKKNYAEKAQM 343

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK +  H+E ++++K D  V +GA+PAYLLDR+   RAK+LSN IKQKRKEKAGKW+VPL
Sbjct: 344 KKTLAMHEESTSRRKTDDNVQDGAVPAYLLDRDNTTRAKVLSNTIKQKRKEKAGKWDVPL 403

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR +AEDEMFKVV+TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ KA
Sbjct: 404 PKVRPVAEDEMFKVVRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTKA 463

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL  TF L +IGVKKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGKY
Sbjct: 464 HVTHPELKCTFNLELIGVKKNPNGPMYTSLGVITRGTIIEVNVSELGLVTPAGKVVWGKY 523

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 524 AQVTNNPENDGCINAVLLV 542



>gi|478253535|gb|ENN73853.1| hypothetical protein YQE_09545, partial [Dendroctonus ponderosae]
          Length = 302

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/257 (69%), Positives = 209/257 (81%), Gaps = 1/257 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   K HGRRLD+            H  +  A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYMERHRKLHGRRLDFEERKRKREAREPHKRAETARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK TK K    V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKKTK-KVTGNVAEGALPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+ +VV++GK + K WKRM+TK TFVG+GFTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADSEVMRVVRSGKTKRKAWKRMVTKVTFVGEGFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSAMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAV 257
           YAQVTNNPENDGC+NAV
Sbjct: 240 YAQVTNNPENDGCINAV 256



>gi|298398978|gb|ADI80856.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298398984|gb|ADI80859.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298398986|gb|ADI80860.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298398988|gb|ADI80861.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298398998|gb|ADI80866.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399000|gb|ADI80867.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399002|gb|ADI80868.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399004|gb|ADI80869.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399008|gb|ADI80871.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399010|gb|ADI80872.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399012|gb|ADI80873.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399018|gb|ADI80876.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399020|gb|ADI80877.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399026|gb|ADI80880.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399028|gb|ADI80881.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399030|gb|ADI80882.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399032|gb|ADI80883.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399034|gb|ADI80884.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399036|gb|ADI80885.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399038|gb|ADI80886.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399040|gb|ADI80887.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399042|gb|ADI80888.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399044|gb|ADI80889.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399046|gb|ADI80890.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399048|gb|ADI80891.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399054|gb|ADI80894.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399056|gb|ADI80895.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399058|gb|ADI80896.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399062|gb|ADI80898.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399064|gb|ADI80899.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399070|gb|ADI80902.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399072|gb|ADI80903.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399074|gb|ADI80904.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399076|gb|ADI80905.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399078|gb|ADI80906.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399080|gb|ADI80907.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399090|gb|ADI80912.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399092|gb|ADI80913.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399094|gb|ADI80914.1| hairy cell leukemia [Heliconius cydno cordula]
          Length = 251

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/252 (69%), Positives = 209/252 (82%), Gaps = 1/252 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +A A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKREAREPHKRAAKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ +Q + + V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVRQ-NTEKVAEGAVPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDG 252
           YAQVTNNPENDG
Sbjct: 240 YAQVTNNPENDG 251



>gi|159465249|ref|XP_001690835.1| low-CO2-inducible protein [Chlamydomonas reinhardtii]
 gi|158279521|gb|EDP05281.1| low-CO2-inducible protein [Chlamydomonas reinhardtii]
          Length = 260

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 201/260 (77%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++G+RLDY            H  SA+AQK  G++ K++ KKRH EK  
Sbjct: 1   MPQNEHIELHQKRYGKRLDYDERKRKKQAREVHKRSAYAQKALGLKGKMFAKKRHQEKAT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I  H+E+  K K     P+ A+PAYLL+RE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTIAMHEERDNKHKAQDGAPQNAVPAYLLEREQVDRAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP+VR IAEDEMFKV+K+GK   K WKRMITK TFVG GFTRKPPKYERFIRP  LR  K
Sbjct: 121 LPQVRPIAEDEMFKVMKSGKRMKKSWKRMITKVTFVGQGFTRKPPKYERFIRPTGLRMTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCL IIGVKKNP   +Y+QLGV+TKGT++EVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFCLDIIGVKKNPNGQMYSQLGVVTKGTILEVNVSELGLVTPGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|168037726|ref|XP_001771354.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162677443|gb|EDQ63914.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 260

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 204/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ ++I+   K+HG R DY            H  +AFAQK  GI+ K+Y KKR++EK  
Sbjct: 1   MPQGDHIDLHRKRHGYRPDYFERKRKKDAREVHKRAAFAQKALGIKGKMYAKKRYSEKAT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H E++ + K D  V +GA+PAYLLDRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHSERTNRHKADDQVQDGAVPAYLLDREQTARAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR IAEDEMF+V++TGK ++KQWKRM+TK TFVG GFTRKPPKYERFIRPM LR+ K
Sbjct: 121 LPKVRPIAEDEMFRVLRTGKRKSKQWKRMVTKVTFVGPGFTRKPPKYERFIRPMGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P+YT +GV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLDIIGVKKNPNGPMYTSMGVITKGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+N VLLV
Sbjct: 241 YAQVTNNPENDGCINGVLLV 260



>gi|397633125|gb|EJK70845.1| hypothetical protein THAOC_07765 [Thalassiosira oceanica]
          Length = 260

 Score =  367 bits (942), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 176/260 (67%), Positives = 203/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ+E++E   K HGRR D             H  S FAQKVHGIRAKLYN+KR  EK  
Sbjct: 1   MPQHEHMERHRKLHGRRFDAEERERKREARVAHKRSEFAQKVHGIRAKLYNQKRFKEKAT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K I QH E+S K  +D+AV +GA+PAYLLDREG  RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  MRKTIAQHNERSNKHANDEAVADGAVPAYLLDREGVSRAKVLSNTVKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+ +A+DEMFKV++TG  R K WKR++TK TFVGD FTRK PKYERFIRP  LR K+
Sbjct: 121 IPKVKPVADDEMFKVMRTGSKRNKAWKRVVTKCTFVGDNFTRKAPKYERFIRPTGLRMKR 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL  +F L I+GVKKNP S LYT LGVLTKGT+IEVNVS+LGLVTTSGKV WGK
Sbjct: 181 ANVTHPELKTSFQLDILGVKKNPSSSLYTNLGVLTKGTIIEVNVSDLGLVTTSGKVAWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
            AQVTNNPE DGCVNAVLL+
Sbjct: 241 MAQVTNNPELDGCVNAVLLM 260



>gi|357121530|ref|XP_003562472.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Brachypodium
           distachyon]
          Length = 260

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 206/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HGRR+D+               S  A+K+ G + K + KKR+AEK +
Sbjct: 1   MPQGDYIELHQKRHGRRMDFEERKRKKEARSVKKNSKDARKLLGAKGKRFAKKRYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E +++QK D  V EGA+P YLLDR+  +RAK+LSN IKQKRKEKAGKW+VP
Sbjct: 61  MKKTLKMHDESTSRQKVDDDVEEGALPPYLLDRDQTQRAKVLSNTIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRG+AEDEMFKV++TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRGVAEDEMFKVLRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L II VKKNP   +YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLDIISVKKNPNGQMYTSLGVMTRGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|384247429|gb|EIE20916.1| low-CO2-inducible protein [Coccomyxa subellipsoidea C-169]
          Length = 260

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 201/260 (77%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ E+IE   K++G RLDY            H  +AFAQK  G++AK+Y+KKRHAEK  
Sbjct: 1   MPQGEHIELHRKRNGFRLDYHEKKRKKEARSVHKRAAFAQKALGLKAKMYSKKRHAEKAT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I  HQ++  K K +   P+ A+PAYLL+RE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTIAMHQQRDNKHKAEDGAPQSAVPAYLLEREQVDRAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV+ +GK + K WKRM+TK TFVG  FTRKPPKYERFIRP  LR KK
Sbjct: 121 LPKVRPVAEDEMFKVLHSGKRKKKAWKRMVTKVTFVGPSFTRKPPKYERFIRPSGLRMKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TFCL I+GVKKNP    YTQLGV+TKGTVIEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKCTFCLEILGVKKNPNGASYTQLGVITKGTVIEVNVSELGLVTPGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|475482586|gb|EMT02990.1| Ribosome biogenesis NSA2-like protein [Aegilops tauschii]
          Length = 569

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/259 (67%), Positives = 206/259 (79%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQ +YIE   K+HGRR+DY               S  A+K+ G + K + KKR+AEK +M
Sbjct: 311 PQGDYIELHQKRHGRRMDYEERKRKKEARAVKKNSKDARKLLGAKGKRFAKKRYAEKAQM 370

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK +K H E S++QK D  V EGAIP+YLLDR+  +RAK+LSN IKQKRKEKAGKW+VPL
Sbjct: 371 KKTLKMHDESSSRQKVDDDVEEGAIPSYLLDRDPTQRAKVLSNTIKQKRKEKAGKWDVPL 430

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR +AE+EMFKV++TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ KA
Sbjct: 431 PKVRPVAEEEMFKVLRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTKA 490

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL  TF L II VKKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGKY
Sbjct: 491 HVTHPELKCTFNLDIISVKKNPNGPMYTSLGVMTRGTIIEVNVSELGLVTPAGKVVWGKY 550

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 551 AQVTNNPENDGCINAVLLV 569



>gi|508716577|gb|EOY08474.1| Ribosomal protein S8e family protein [Theobroma cacao]
          Length = 338

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 203/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HG RLD+            H  SA AQK  GI+ K+  KK +AEK  
Sbjct: 79  MPQGDYIELHRKRHGYRLDFFERKRKKEARQVHERSAKAQKALGIKGKMIAKKNYAEKAL 138

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E S ++K D  V +GAIPAYL+DRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 139 MKKTLAMHEESSNRRKVDDQVQDGAIPAYLMDRENTTRAKVLSNTIKQKRKEKAGKWEVP 198

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR +AEDEMFKV+++GK +TKQWKRM+TK TFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 199 IPKVRPVAEDEMFKVLRSGKRKTKQWKRMVTKCTFVGPGFTRKPPKYERFIRPSGLRFTK 258

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P+YT LGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 259 AHVTHPELKCTFNLDIIGVKKNPNGPMYTSLGVMTKGTIIEVNVSELGLVTPAGKVVWGK 318

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 319 YAQVTNNPENDGCINAVLLV 338



>gi|507114352|emb|CDF37911.1| probable constituent of 66S pre-ribosomal particles Nsa2p [Chondrus
           crispus]
          Length = 260

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 203/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ EY+E   K++G R+D                S  A+ + GI+AK+YNK+R  EK  
Sbjct: 1   MPQGEYMELHRKRYGVRMDQHERERKRDARAGRRRSEQARTLTGIKAKIYNKQRFKEKAA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I  H EK    K D  V +GA+PAYLLDRE Q R+K+LSN +KQKRKEKAGKW+VP
Sbjct: 61  MKKAINMHFEKDKTAKVDDKVRDGAVPAYLLDREQQTRSKVLSNTLKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR IAEDEMFKVVKTGK + KQWKRM+TK T+VG+GFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRAIAEDEMFKVVKTGKRQKKQWKRMVTKVTYVGEGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TFCL IIGVKKNP S ++T LGV+T+GTVIEVNVSELGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKTTFCLDIIGVKKNPSSQMFTSLGVITRGTVIEVNVSELGLVTNSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVL V
Sbjct: 241 YAQVTNNPENDGCINAVLCV 260



>gi|121543937|gb|ABM55633.1| putative TGF beta-inducible nuclear protein 1 [Maconellicoccus
           hirsutus]
          Length = 259

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 211/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   K +GRRLDY            H  +  A+++ G++AKL+NK+R  EKI+
Sbjct: 1   MPQNEYMERHRKLYGRRLDYEERKRKREAREPHKRAEKARRLRGLKAKLFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI++H+EK  K+K ++   EGA+P YLLDR+ Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIQEHEEKLNKRKTEKP-KEGALPVYLLDRDVQSSAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+++GK+R K WKRM+TK  FVGD FTRKPPK+ERFIRPMALR+ K
Sbjct: 120 IPKVRAQADAEVFKVLRSGKSRRKAWKRMVTKVCFVGDAFTRKPPKFERFIRPMALRFNK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF LPIIGVKKNP SP +T LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKTTFYLPIIGVKKNPNSPTHTNLGVITKGTVIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVL+V
Sbjct: 240 YAQVTNNPENDGCINAVLIV 259



>gi|91077774|ref|XP_968953.1| PREDICTED: similar to TGF beta-inducible nuclear protein 1
           [Tribolium castaneum]
 gi|270002241|gb|EEZ98688.1| hypothetical protein TcasGA2_TC001224 [Tribolium castaneum]
          Length = 259

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 215/260 (82%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   K +GRRLDY            H  +  A+ + GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYVERHRKLYGRRLDYEERKRKKEAREPHKRAQVARSLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK TKQK  + V EGA+PAYLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKKTKQKT-EKVAEGALPAYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  ++ E+ KVVK+GK++ K WKRM+TK TFVG+GFTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQSDAEVLKVVKSGKSKRKAWKRMVTKVTFVGEGFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP S ++T LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFYLPIIGVKKNPSSAMFTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|298398980|gb|ADI80857.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298398982|gb|ADI80858.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298398994|gb|ADI80864.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298398996|gb|ADI80865.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399006|gb|ADI80870.1| hairy cell leukemia [Heliconius melpomene melpomene]
          Length = 251

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 176/252 (69%), Positives = 208/252 (82%), Gaps = 1/252 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +A A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKREAREPHKRAAKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ +Q + + V EGA+P YLLDR  Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVRQ-NTEKVAEGAVPVYLLDRGVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDG 252
           YAQVTNNPENDG
Sbjct: 240 YAQVTNNPENDG 251



>gi|255586521|ref|XP_002533899.1| TGF-beta-inducible nuclear protein, putative [Ricinus communis]
 gi|223526141|gb|EEF28481.1| TGF-beta-inducible nuclear protein, putative [Ricinus communis]
          Length = 260

 Score =  366 bits (939), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 203/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HG RLD+            H  S  AQK  GI+ K+  KK +AEK  
Sbjct: 1   MPQGDYIELHRKRHGYRLDHFERKRKKEAREVHKRSERAQKTLGIKGKMIAKKNYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E S+++K D  V EGA+PAYLLDRE   RAKILSN +KQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESSSRRKVDDDVHEGAVPAYLLDRENTTRAKILSNTVKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV+++GK RTKQWKRM+TK TFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVIRSGKRRTKQWKRMVTKVTFVGPGFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P+YT LGV+TKG++IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVITKGSIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|444729299|gb|ELW69724.1| Ribosome biogenesis protein NSA2 like protein [Tupaia chinensis]
          Length = 259

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 176/260 (67%), Positives = 207/260 (79%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE  +K +G RLDY            H  S  ++K+ G++AK Y+K+RHAEKI+
Sbjct: 1   MPQNEYIELHLKGYGYRLDYHEKKRKKESREAHECSKKSKKMTGLKAKFYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK  ++++TKQK+D+   +GA+PAYL+DREGQ RAK+LS   KQK KEKAGKW VP
Sbjct: 61  MKKTIKMLEKRNTKQKNDEKTAQGAVPAYLMDREGQSRAKVLSEN-KQKWKEKAGKWEVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WK ++TK  FVGDGFTRKPPKYERFIRPM L +KK
Sbjct: 120 LPKVRAQGETEVLKVIRTGKRKKKAWKSLVTKVCFVGDGFTRKPPKYERFIRPMGLHFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 180 AHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVT NPENDGC+NAVLLV
Sbjct: 240 YAQVTYNPENDGCINAVLLV 259



>gi|490262983|gb|AGL09514.1| ribosomal protein S8e family protein, partial [Hydnora visseri]
          Length = 260

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 204/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K++G R D+            H  SA AQK  GI+ K++ KKR+AEK  
Sbjct: 1   MPQGDYIELHQKRYGYRHDHFERKRKKEAREVHKRSAVAQKAIGIKGKMFAKKRYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E S+++K D  V +GAIPAYLLDRE   R KILSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESSSRRKVDDKVHDGAIPAYLLDRETTARTKILSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMF+V+++GK +TKQWKRM+TK TFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFRVIRSGKRKTKQWKRMVTKVTFVGSGFTRKPPKYERFIRPSGLRFNK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P+YT LGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVVTKGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|298399060|gb|ADI80897.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399096|gb|ADI80915.1| hairy cell leukemia [Heliconius cydno cordula]
          Length = 251

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 208/252 (82%), Gaps = 1/252 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +A A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKREAREPHKRAAKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ +  + + V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVRH-NTEKVAEGAVPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPENDG 252
           YAQVTNNPENDG
Sbjct: 240 YAQVTNNPENDG 251



>gi|225439438|ref|XP_002266163.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Vitis
           vinifera]
          Length = 260

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 204/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YI+   K+HG R D+            H  S  AQK  GI+ K++ KKR+AEK +
Sbjct: 1   MPQGDYIDLHRKRHGYRPDHFERKRKKEAREVHKRSEIAQKALGIKGKMFAKKRYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E S+++K D  V EGA+PAYLLDRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESSSRRKVDDDVHEGAVPAYLLDRETTTRAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV++TGK +TKQWKRM+TKATFVG  FTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVLRTGKRKTKQWKRMVTKATFVGPAFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP   +YT LGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGQMYTSLGVMTKGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|145355626|ref|XP_001422059.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144582298|gb|ABP00353.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 260

 Score =  365 bits (938), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 176/260 (67%), Positives = 204/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++G+RLD+            H  S  A+K+ G++AKLY KKRH EK+E
Sbjct: 1   MPQNEHIELFQKRYGKRLDHEERTRKKEAREPHKRSQVAKKLIGLKAKLYAKKRHKEKVE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I  H E++ K K ++    GAIPAYL+DRE   RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  MKKTINSHSERNNKHKVEEKAQPGAIPAYLMDREQTSRAKVLSNTVKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV+++GK   K WKRMITKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVMRSGKRMKKSWKRMITKATFVGPGFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AH+THPEL ATF L I+GVKKNP  P+Y+ LGVLTKGT+IEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHITHPELKATFQLEILGVKKNPNGPMYSSLGVLTKGTIIEVNVSELGLVTPGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGCVN VLLV
Sbjct: 241 YAQITNNPENDGCVNGVLLV 260



>gi|302804476|ref|XP_002983990.1| hypothetical protein SELMODRAFT_180577 [Selaginella moellendorffii]
 gi|300148342|gb|EFJ15002.1| hypothetical protein SELMODRAFT_180577 [Selaginella moellendorffii]
          Length = 260

 Score =  365 bits (937), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 173/260 (66%), Positives = 205/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YI+   K+HG RLDY            H  +A+AQK  G++ K++  KR+ EK  
Sbjct: 1   MPQGDYIDLHRKRHGYRLDYFERKRKKDAREVHKRAAYAQKAIGLKGKMFANKRYKEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK +  H EK+ + K +  V EGAIPAYLLDRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  LKKTLAMHSEKANRHKVEDDVQEGAIPAYLLDREATTRAKVLSNSIKQKRKEKAGKWQVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR IAEDEMF+V+++GK +TKQWKRM+TKATFVG GFTRKPPKYERFIRPM LR+ K
Sbjct: 121 LPKVRPIAEDEMFRVMRSGKRKTKQWKRMVTKATFVGAGFTRKPPKYERFIRPMGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHV+HPEL  TF L I+GVKKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVSHPELKCTFQLEILGVKKNPNGPMYTSLGVITRGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLLV
Sbjct: 241 FAQVTNNPENDGCINAVLLV 260



>gi|224003827|ref|XP_002291585.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220973361|gb|EED91692.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 260

 Score =  365 bits (936), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 174/260 (66%), Positives = 202/260 (77%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ+E++E   K HGRR D             H  S FAQKVHG+RAKLYN++R  EK  
Sbjct: 1   MPQHEHMERHRKLHGRRFDAEERERKREARSAHKRSEFAQKVHGLRAKLYNQRRFKEKAT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K I QH E+S K  +D AV +GA+PAYLLDREG  RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  MRKTIAQHNERSNKHANDDAVADGAVPAYLLDREGVSRAKVLSNTVKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+ +A+DEMFKV++TG  + K WKR++TK TFVGD FTRK PKYERFIRP  LR K+
Sbjct: 121 IPKVKPVADDEMFKVMRTGSKKNKAWKRVVTKCTFVGDNFTRKAPKYERFIRPTGLRMKR 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL  +F L I+GVKKNP S LYT LGVLTKGT+IEVNVS+LGLVTTSGKV WGK
Sbjct: 181 ANVTHPELKTSFQLDILGVKKNPSSSLYTNLGVLTKGTIIEVNVSDLGLVTTSGKVAWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
            AQVTNNPE DGCVNAVLLV
Sbjct: 241 MAQVTNNPELDGCVNAVLLV 260



>gi|118481073|gb|ABK92490.1| unknown [Populus trichocarpa]
          Length = 260

 Score =  365 bits (936), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 203/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HG RLD+            H  S  AQK  GI+ K+  KK +AEK  
Sbjct: 1   MPQGDYIELHRKRHGYRLDHFERKRKKEAREVHKHSERAQKALGIKGKMIAKKNYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E ++++K D  V +GAIPAYLLDRE   RAKILSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESTSRRKVDDDVHDGAIPAYLLDRENTTRAKILSNSIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV+++GK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVIRSGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P YT LGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPTYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|294898564|ref|XP_002776277.1| conserved protein, COG SSU ribosomal protein S8E, putative
           [Perkinsus marinus ATCC 50983]
 gi|294909669|ref|XP_002777822.1| conserved protein, COG SSU ribosomal protein S8E, putative
           [Perkinsus marinus ATCC 50983]
 gi|239883187|gb|EER08093.1| conserved protein, COG SSU ribosomal protein S8E, putative
           [Perkinsus marinus ATCC 50983]
 gi|239885784|gb|EER09617.1| conserved protein, COG SSU ribosomal protein S8E, putative
           [Perkinsus marinus ATCC 50983]
          Length = 261

 Score =  365 bits (936), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 172/261 (65%), Positives = 208/261 (79%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IEE  K+ GRRLDY            H  S  AQK+ GI+AKL++KKR+AEK  
Sbjct: 1   MPQNEHIEEHRKRFGRRLDYEERKRKKDARAVHKQSKTAQKLRGIKAKLFHKKRYAEKAT 60

Query: 61  MKKKIKQHQEKSTKQKD-DQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           M+K IK+HQEK  K+K  + +VP+GA+P YLLDREG  R K+LSNM+KQKR EKAGKW V
Sbjct: 61  MRKTIKKHQEKEGKEKAPEDSVPQGAVPGYLLDREGVNRTKVLSNMVKQKRAEKAGKWQV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           P+PKV+ + EDEMFK++++GK + K WKR++ K  FVG+ FTRKPPKYERFIRP +LR+K
Sbjct: 121 PVPKVKAMTEDEMFKILRSGKRKKKAWKRVVNKICFVGEDFTRKPPKYERFIRPSSLRFK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KAHVTHPEL  TFCL I+ VKKNPQS LY+ LGV+TKGT+IEVNVS+LGLVT +GKVVW 
Sbjct: 181 KAHVTHPELKTTFCLDIVSVKKNPQSELYSSLGVITKGTIIEVNVSDLGLVTQTGKVVWA 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQVTNNPE DGC+NAVLLV
Sbjct: 241 KYAQVTNNPELDGCINAVLLV 261



>gi|157136375|ref|XP_001663728.1| hypothetical protein AaeL_AAEL013533 [Aedes aegypti]
 gi|108869977|gb|EAT34202.1| AAEL013533-PA [Aedes aegypti]
          Length = 259

 Score =  364 bits (935), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 211/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE  IK HGRRLDY               +A A+K+ GI+AKL+ K+R  EKI+
Sbjct: 1   MPQNEYIERHIKLHGRRLDYEERKRKREAREPKKRAAMARKLRGIKAKLFQKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI+ H+EK  K+  ++   +GAIPAYLLDR  Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIQAHEEKKVKKTTEKVE-DGAIPAYLLDRGVQSSAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+++GK + K WKRM+TK T+VG+ FTRKPPK+ERFIRPMALR+ K
Sbjct: 120 IPKVRAQADSEVFKVIRSGKTKRKAWKRMVTKVTYVGENFTRKPPKFERFIRPMALRFNK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SP+YT LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSPMYTSLGVITKGTVIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|505802295|ref|XP_004608616.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Sorex araneus]
          Length = 274

 Score =  364 bits (935), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 171/228 (75%), Positives = 198/228 (86%)

Query: 33  HSTSAFAQKVHGIRAKLYNKKRHAEKIEMKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLD 92
           H  S  A+K+ G++AKLY+K+RHAEKI+MKK IK H++++TKQK+D+  P+GA+P YLLD
Sbjct: 47  HERSRKAKKMIGLKAKLYHKQRHAEKIQMKKTIKMHEKRNTKQKNDEKTPQGAMPEYLLD 106

Query: 93  REGQKRAKILSNMIKQKRKEKAGKWNVPLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITK 152
           RE Q RAK+LSNMIKQKRKEKAGKW VPLPKVR   E E+ KV++TGK + K WKRM+TK
Sbjct: 107 RERQSRAKVLSNMIKQKRKEKAGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRMVTK 166

Query: 153 ATFVGDGFTRKPPKYERFIRPMALRYKKAHVTHPELGATFCLPIIGVKKNPQSPLYTQLG 212
             FVGDGFTRKPPKYERFIRPM LR+KKAHVTHP+L ATFCL I+GVKKNP SPLYT LG
Sbjct: 167 VCFVGDGFTRKPPKYERFIRPMGLRFKKAHVTHPDLKATFCLSILGVKKNPSSPLYTTLG 226

Query: 213 VLTKGTVIEVNVSELGLVTTSGKVVWGKYAQVTNNPENDGCVNAVLLV 260
           V+TKGTVIEVNVSELGLVT  GKV+WGKYAQVTNNPENDGC+NAVLLV
Sbjct: 227 VITKGTVIEVNVSELGLVTQGGKVIWGKYAQVTNNPENDGCINAVLLV 274



>gi|412985367|emb|CCO18813.1| predicted protein [Bathycoccus prasinos]
          Length = 260

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 206/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++G+RLD+            H  SA A+K+ G++AKLY+K+R  EKI 
Sbjct: 1   MPQNEHIELFQKRYGKRLDHEEKARKKEAREPHKRSAMAKKLIGLKAKLYSKERFKEKIT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I QH EK  K+K +  V  GAIPAYL+DRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTINQHGEKGRKRKVEDEVAPGAIPAYLMDRETTSRAKVLSNTIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR IAEDEMF+V+++GK + K WKRMITKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPIAEDEMFRVMRSGKRQKKTWKRMITKATFVGPGFTRKPPKYERFIRPSGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF L I+GVKKNP  P+Y+ LGV+TKGTVIEV+V ELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFQLQILGVKKNPNGPMYSSLGVMTKGTVIEVSVEELGLVTPGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGCVNAVLLV
Sbjct: 241 YAQVTNNPENDGCVNAVLLV 260



>gi|224088085|ref|XP_002308319.1| predicted protein [Populus trichocarpa]
 gi|222854295|gb|EEE91842.1| predicted protein [Populus trichocarpa]
          Length = 260

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 203/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HG RLD+            H  S  AQK  GI+ K+  KK +AEK  
Sbjct: 1   MPQGDYIELHRKRHGYRLDHFERKRKKEAREVHKHSERAQKALGIKGKMIAKKNYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E ++++K D  V +GA+PAYLLDRE   RAKILSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESTSRRKVDDDVQDGAVPAYLLDRENTTRAKILSNSIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV+++GK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVIRSGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P YT LGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPTYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|224140024|ref|XP_002323387.1| predicted protein [Populus trichocarpa]
 gi|222868017|gb|EEF05148.1| predicted protein [Populus trichocarpa]
          Length = 260

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 203/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HG RLD+            H  S  AQK  GI+ K+  KK +AEK  
Sbjct: 1   MPQGDYIELHRKRHGYRLDHFERKRKKEAREVHKHSERAQKALGIKGKMIAKKNYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E ++++K D  V +GA+PAYLLDRE   RAKILSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESTSRRKVDDDVHDGAVPAYLLDRENTTRAKILSNSIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV+++GK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVIRSGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P YT LGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPTYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|392579278|gb|EIW72405.1| hypothetical protein TREMEDRAFT_70712 [Tremella mesenterica DSM
           1558]
          Length = 254

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 173/254 (68%), Positives = 205/254 (80%)

Query: 7   IEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEMKKKIK 66
           ++E  ++HGRRLDY            H TS   QK+ G +AKL + KRH+EK++MKK +K
Sbjct: 1   MDEHRRRHGRRLDYEEKKRKREAREVHKTSQDTQKMFGHKAKLLHAKRHSEKVQMKKTLK 60

Query: 67  QHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPLPKVRG 126
            H E++ KQKDD AV +GA+P YLLDREGQK AK LS+ IK +RK++A K+ VPLPKVRG
Sbjct: 61  AHDERNVKQKDDGAVKDGALPTYLLDREGQKDAKALSSAIKDRRKDRAAKYAVPLPKVRG 120

Query: 127 IAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKAHVTHP 186
           IAE+EMFKV+KTGK++ K WKRM+ KATFVG+GFTRKP K ERFIRPM LR  KA+VTHP
Sbjct: 121 IAEEEMFKVIKTGKSKQKSWKRMVNKATFVGEGFTRKPVKLERFIRPMGLRMTKANVTHP 180

Query: 187 ELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKYAQVTN 246
           EL  TF LPIIGVKKNPQSPLYT LGVLTKGT+IEVNVSELGLV+T GKVVW KYAQ+TN
Sbjct: 181 ELKTTFQLPIIGVKKNPQSPLYTSLGVLTKGTIIEVNVSELGLVSTGGKVVWAKYAQITN 240

Query: 247 NPENDGCVNAVLLV 260
           NPENDGC+N+VLLV
Sbjct: 241 NPENDGCINSVLLV 254



>gi|118484685|gb|ABK94213.1| unknown [Populus trichocarpa]
          Length = 260

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 203/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HG RLD+            H  S  AQK  GI+ K+  KK +AEK  
Sbjct: 1   MPQGDYIELHRKRHGYRLDHFERKRKKEAREVHKHSERAQKALGIKGKMIAKKNYAEKDL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E ++++K D  V +GA+PAYLLDRE   RAKILSN IKQKRKEKAGKW VP
Sbjct: 61  MKKTLAMHEESTSRRKVDDDVQDGAVPAYLLDRENTTRAKILSNSIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV+++GK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVIRSGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P YT LGV+TKGT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPTYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|296083154|emb|CBI22790.3| unnamed protein product [Vitis vinifera]
          Length = 280

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 176/259 (67%), Positives = 203/259 (78%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQ +YI+   K+HG R D+            H  S  AQK  GI+ K++ KKR+AEK +M
Sbjct: 22  PQGDYIDLHRKRHGYRPDHFERKRKKEAREVHKRSEIAQKALGIKGKMFAKKRYAEKAQM 81

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK +  H+E S+++K D  V EGA+PAYLLDRE   RAK+LSN IKQKRKEKAGKW VPL
Sbjct: 82  KKTLAMHEESSSRRKVDDDVHEGAVPAYLLDRETTTRAKVLSNTIKQKRKEKAGKWEVPL 141

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR +AEDEMFKV++TGK +TKQWKRM+TKATFVG  FTRKPPKYERFIRP  LR+ KA
Sbjct: 142 PKVRPVAEDEMFKVLRTGKRKTKQWKRMVTKATFVGPAFTRKPPKYERFIRPSGLRFTKA 201

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL  TF L IIGVKKNP   +YT LGV+TKGT+IEVNVSELGLVT +GKVVWGKY
Sbjct: 202 HVTHPELKCTFNLEIIGVKKNPNGQMYTSLGVMTKGTIIEVNVSELGLVTPAGKVVWGKY 261

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGC+NAVLLV
Sbjct: 262 AQVTNNPENDGCINAVLLV 280



>gi|403285044|ref|XP_003933851.1| PREDICTED: uncharacterized protein LOC101039826 [Saimiri
           boliviensis boliviensis]
          Length = 555

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 179/259 (69%), Positives = 207/259 (79%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE  +K+HG  LDY            H  S  A+K+ G++AKLY+K+R AEKI+M
Sbjct: 297 PQNEYIELHLKRHGYHLDYHEKKRKKENREAHERSKKAKKMIGLKAKLYHKQRQAEKIQM 356

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQK++EKAGKW VPL
Sbjct: 357 KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKQEEKAGKWEVPL 416

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR     E+ KV  TGK + K  KR++TK  FVGDGFT KPPK ERFIRPM LR+KKA
Sbjct: 417 PKVRAQGATEVLKVTPTGKRKKKARKRLVTKVCFVGDGFTTKPPKCERFIRPMGLRFKKA 476

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL AT CLPI+GVKKNP  PLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGKY
Sbjct: 477 HVTHPELKATLCLPILGVKKNPSPPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGKY 536

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGCVNAVLLV
Sbjct: 537 AQVTNNPENDGCVNAVLLV 555



>gi|298398990|gb|ADI80862.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298398992|gb|ADI80863.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399014|gb|ADI80874.1| hairy cell leukemia [Heliconius melpomene melpomene]
 gi|298399066|gb|ADI80900.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399068|gb|ADI80901.1| hairy cell leukemia [Heliconius cydno cordula]
          Length = 249

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 174/250 (69%), Positives = 207/250 (82%), Gaps = 1/250 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +A A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKREAREPHKRAAKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ +Q + + V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVRQ-NTEKVAEGAVPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPEN 250
           YAQVTNNPEN
Sbjct: 240 YAQVTNNPEN 249



>gi|21553587|gb|AAM62680.1| unknown [Arabidopsis thaliana]
          Length = 259

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 174/260 (66%), Positives = 205/260 (78%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YI+   K++G RLD+            H  S  AQK  GI+ K+  KK +AEK  
Sbjct: 1   MPQGDYIDLHRKRNGYRLDHFERKRKKEAREVHKHSTMAQKSLGIKGKMIAKKNYAEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H+E S+++K D+ V EGA+PAYLLDRE   RAK+LSN IKQKRKE AGKW VP
Sbjct: 61  MKKTLKMHEESSSRRKADENVQEGAVPAYLLDREDTTRAKVLSNTIKQKRKE-AGKWEVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMF+V+++GK +TKQWKRM+TKATFVG  FTRKPPKYERFIRP  LR+ K
Sbjct: 120 LPKVRPVAEDEMFRVIRSGKRKTKQWKRMVTKATFVGPAFTRKPPKYERFIRPSGLRFTK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TFCL IIG+KKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKCTFCLEIIGIKKNPNGPMYTSLGVMTRGTIIEVNVSELGLVTPAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|358057138|dbj|GAA97045.1| hypothetical protein E5Q_03720 [Mixia osmundae IAM 14324]
          Length = 260

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE  +++G+RLD+            H  SA AQ +HG +AKL ++KR++EK+ 
Sbjct: 1   MPQNEYIEEHQRRYGKRLDHDERKRKRTAREVHKASAVAQTLHGHKAKLLHQKRYSEKVA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++K IK+H+EK  K + D  V EGA+P YLLDR  +  AK LS  +KQ RKEKAGK+ VP
Sbjct: 61  LRKTIKKHEEKDQKTQSDAPVSEGALPTYLLDRSNENNAKKLSTALKQNRKEKAGKFAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAE+EMFKVV+TGK + K WKRM+TKATFV + FTRKPPK ERFIRP  LR +K
Sbjct: 121 LPKVRGIAEEEMFKVVRTGKTKRKGWKRMVTKATFVPESFTRKPPKLERFIRPTGLRVRK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL ATF LPI+GVKKNPQSP+YTQLGVLTKGT+IEVNVSELGLVTT GKVVWGK
Sbjct: 181 ANVTHPELKATFQLPIVGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGLVTTGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNP+ DGCVN VLLV
Sbjct: 241 YAQVTNNPDLDGCVNCVLLV 260



>gi|345803027|ref|XP_003434993.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Canis lupus
           familiaris]
          Length = 374

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 177/261 (67%), Positives = 206/261 (78%), Gaps = 2/261 (0%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K++G  LDY            H  S  A+K+ G++AKLY+K RHAEKI+M
Sbjct: 114 PQNEYIELHRKRYGYSLDYHEKKRKKEGQEAHECSKKAKKMIGLKAKLYHKPRHAEKIQM 173

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TK K+D+  P+ A+PAYLLDREGQ RAK+LS+MI QKRKEKAGKW VPL
Sbjct: 174 KKTIKMHEKRNTKPKNDEKTPQRAVPAYLLDREGQSRAKVLSSMITQKRKEKAGKWEVPL 233

Query: 122 PKVRGIAEDEMFKVVK--TGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PKVR   E E+ KV++   G  + K WKRM+TK  FVGD FTRKPPK ERFIRPM LR+K
Sbjct: 234 PKVRAQGETEVLKVIRGIPGWQKKKAWKRMVTKVCFVGDSFTRKPPKQERFIRPMGLRFK 293

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KAHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WG
Sbjct: 294 KAHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWG 353

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYA+VTNNPENDGC+ AVLLV
Sbjct: 354 KYARVTNNPENDGCIKAVLLV 374



>gi|323452658|gb|EGB08531.1| hypothetical protein AURANDRAFT_60066 [Aureococcus anophagefferens]
          Length = 260

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 171/260 (65%), Positives = 204/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ+E+I++  K+HG RLD             H  + FA+KVHG+RAKLYNK+R  EK  
Sbjct: 1   MPQHEHIDQHRKRHGERLDAPEKRRKKEARSVHENAKFAKKVHGLRAKLYNKQRFKEKAT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K I  H+EK  + ++D    +GA+PA+LLDREG  RAKILSN IKQKR EKAGKW+VP
Sbjct: 61  MRKTIAMHEEKEARARNDDGANDGAVPAFLLDREGASRAKILSNSIKQKRAEKAGKWSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKV+ +A+DEMF+V ++GK + K WKR++TK TFV   FTRKPPKYERFIRP  L  KK
Sbjct: 121 IPKVKPVADDEMFRVQQSGKRKKKSWKRVVTKVTFVDPNFTRKPPKYERFIRPSGLSMKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCL IIGVKKNP S +YT LGV+TKGTVIEVNVSELGLVTT+G+VVWGK
Sbjct: 181 AHVTHPELKATFCLDIIGVKKNPSSQMYTTLGVITKGTVIEVNVSELGLVTTTGRVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPE DGC+NAVLLV
Sbjct: 241 YAQVTNNPELDGCINAVLLV 260



>gi|9438133|gb|AAF87579.1|AF275672_1 unknown [Ochlerotatus triseriatus]
          Length = 259

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 211/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE  IK HGRRLD+               +A A+K+ GI+AKL+ K+R  EKI+
Sbjct: 1   MPQNEYIERHIKLHGRRLDHEERKRKREAREPKKRAAMARKLRGIKAKLFQKQRRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI+ H+EK  K+  ++   +GAIPAYLLDR  Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIQAHEEKKVKKTTEKVE-DGAIPAYLLDRGVQSSAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+++GK + K WKRM+TK T+VG+ FTRKPPK+ERFIRPMALR+ K
Sbjct: 120 IPKVRAQADSEVFKVIRSGKTKRKAWKRMVTKVTYVGENFTRKPPKFERFIRPMALRFNK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SP+YT LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSPMYTSLGVITKGTVIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|170033236|ref|XP_001844484.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167873891|gb|EDS37274.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 259

 Score =  362 bits (929), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 211/260 (81%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE  IK HGRRLDY               +A A+K+ GI+AKL+ K+R  EKI+
Sbjct: 1   MPQNEYIERHIKLHGRRLDYEERKRKREAREPKKRAAMARKLRGIKAKLFQKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI+ H+EK  K+  ++   +GAIPAYL+DR  Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIQAHEEKKVKKTTEKVE-DGAIPAYLMDRGVQSSAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  ++ E+FKV+++GK + K WKRM+TK T+VG+ FTRKPPK+ERFIRPMALR+ K
Sbjct: 120 IPKVRAQSDAEVFKVIRSGKTKRKAWKRMVTKVTYVGENFTRKPPKFERFIRPMALRFNK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SP+YT LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSPMYTSLGVITKGTVIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|388502420|gb|AFK39276.1| unknown [Lotus japonicus]
          Length = 260

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 174/260 (66%), Positives = 202/260 (77%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   + +G R D+            H  S  AQK  GI+ K+  KK + EK +
Sbjct: 1   MPQGDYIERHRRDYGYRPDHFERKRKKDAREVHKRSQIAQKAIGIKGKMIAKKNYTEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MK+ I  H+E ++++K D  V EGAIPAYL+DRE   RAKI+SN IKQKRKEKAG+W+VP
Sbjct: 61  MKRTIAMHEESTSRRKADDNVQEGAIPAYLMDRENTARAKIISNTIKQKRKEKAGRWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKVV+TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVVRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P+YT LGV+TKGT+IEVN SELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVMTKGTIIEVNCSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|302753448|ref|XP_002960148.1| hypothetical protein SELMODRAFT_402189 [Selaginella moellendorffii]
 gi|300171087|gb|EFJ37687.1| hypothetical protein SELMODRAFT_402189 [Selaginella moellendorffii]
          Length = 260

 Score =  362 bits (928), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 172/260 (66%), Positives = 204/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YI+   K+HG R DY            H  +A+AQK  G++ K++  KR+ EK  
Sbjct: 1   MPQGDYIDLHRKRHGYRPDYFERKRKKDAREVHKRAAYAQKAIGLKGKMFANKRYKEKAL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK +  H EK+ + K +  V EGAIPAYLLDRE   RAK+LSN IKQKRKEKAGKW VP
Sbjct: 61  LKKTLAMHSEKANRHKVEDDVQEGAIPAYLLDREATTRAKVLSNSIKQKRKEKAGKWQVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR IAEDEMF+V+++GK +TKQWKRM+TKATFVG GFTRKPPKYERFIRPM LR+ K
Sbjct: 121 LPKVRPIAEDEMFRVMRSGKRKTKQWKRMVTKATFVGAGFTRKPPKYERFIRPMGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHV+HPEL  TF L I+GVKKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVSHPELKCTFQLEILGVKKNPNGPMYTSLGVITRGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLLV
Sbjct: 241 FAQVTNNPENDGCINAVLLV 260



>gi|298399016|gb|ADI80875.1| hairy cell leukemia [Heliconius melpomene melpomene]
          Length = 249

 Score =  361 bits (927), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 174/250 (69%), Positives = 206/250 (82%), Gaps = 1/250 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +A A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKREAREPHKRAAKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ +Q + + V EGA+P YLLDR  Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVRQ-NTEKVAEGAVPVYLLDRGVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPEN 250
           YAQVTNNPEN
Sbjct: 240 YAQVTNNPEN 249



>gi|298399022|gb|ADI80878.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399024|gb|ADI80879.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399050|gb|ADI80892.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399052|gb|ADI80893.1| hairy cell leukemia [Heliconius heurippa]
 gi|298399082|gb|ADI80908.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399086|gb|ADI80910.1| hairy cell leukemia [Heliconius cydno cordula]
 gi|298399088|gb|ADI80911.1| hairy cell leukemia [Heliconius cydno cordula]
          Length = 248

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 206/249 (82%), Gaps = 1/249 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +A A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKREAREPHKRAAKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ +Q + + V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVRQ-NTEKVAEGAVPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPE 249
           YAQVTNNPE
Sbjct: 240 YAQVTNNPE 248



>gi|56417598|gb|AAV90740.1| hairy cell leukemia protein 1 [Aedes albopictus]
          Length = 259

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 210/260 (80%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE  IK HGR LDY               +A A+K+ GI+AKL+ K+R  EKI+
Sbjct: 1   MPQNEYIERHIKLHGRWLDYEERKRKREAREPKKRAAMARKLRGIKAKLFQKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI+ H+EK  K+  ++   +GAIPAYLLDR  Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIQAHEEKKVKKTTEKVE-DGAIPAYLLDRGVQSSAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+++GK + K WKRM+TK T+VG+ FTRKPPK+ERFIRPMALR+ K
Sbjct: 120 IPKVRAQADSEVFKVIRSGKTKRKAWKRMVTKVTYVGENFTRKPPKFERFIRPMALRFNK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SP+YT LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSPMYTSLGVITKGTVIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|242051254|ref|XP_002463371.1| hypothetical protein SORBIDRAFT_02g042600 [Sorghum bicolor]
 gi|241926748|gb|EER99892.1| hypothetical protein SORBIDRAFT_02g042600 [Sorghum bicolor]
          Length = 260

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 173/260 (66%), Positives = 205/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ ++IE   K+HG+RLD+            H  S  A+ + G + K + KKR+AEK +
Sbjct: 1   MPQGDHIELHQKRHGKRLDHEERKRKREAREVHRRSKDARNLLGAKGKRFAKKRYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E + +QK D  V EGA+P YLLDR+  +RAK+LSN IKQKRKEKAGKW+VP
Sbjct: 61  MKKTLKMHDESNKRQKVDDDVQEGALPPYLLDRDQTQRAKVLSNTIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AE+EMFKV++TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEEEMFKVLRTGKRKTKQWKRMVTKATFVGAGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L II VKKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLDIISVKKNPNGPMYTSLGVMTRGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|308813407|ref|XP_003084010.1| unnamed protein product [Ostreococcus tauri]
 gi|116055892|emb|CAL57977.1| unnamed protein product [Ostreococcus tauri]
          Length = 260

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 200/260 (76%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K++G+RLD             H  S  A+K+ G++AKLY KKRH EKIE
Sbjct: 1   MPQNEHIELFQKRYGKRLDAEERTRKKEAREPHRRSQVAKKLIGLKAKLYAKKRHKEKIE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK I  H E+  K K ++    GAIPAYL+DRE   RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  MKKTIHSHSERDNKHKVEEKAAPGAIPAYLMDREQTSRAKVLSNTVKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKV+++GK   K WKRMITKATFVG GFTRKPPKYERFIRP  LR  K
Sbjct: 121 LPKVRPVAEDEMFKVMRSGKRMKKSWKRMITKATFVGPGFTRKPPKYERFIRPSGLRMTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF L I+ VKKNP  P+Y+ LGV+TKGT+IEVNVSELGLVT  GKVVWGK
Sbjct: 181 AHVTHPELKATFQLDILSVKKNPNGPMYSSLGVITKGTIIEVNVSELGLVTPGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC NAVLLV
Sbjct: 241 YAQVTNNPENDGCCNAVLLV 260



>gi|212274853|ref|NP_001130223.1| TGF-beta-inducible nuclear protein 1 [Zea mays]
 gi|194688590|gb|ACF78379.1| unknown [Zea mays]
 gi|195628616|gb|ACG36138.1| TGF-beta-inducible nuclear protein 1 [Zea mays]
 gi|224028439|gb|ACN33295.1| unknown [Zea mays]
 gi|238015196|gb|ACR38633.1| unknown [Zea mays]
 gi|238015300|gb|ACR38685.1| unknown [Zea mays]
 gi|414591163|tpg|DAA41734.1| TPA: TGF-beta-inducible nuclear protein 1 [Zea mays]
 gi|414888076|tpg|DAA64090.1| TPA: TGF-beta-inducible nuclear protein 1 [Zea mays]
          Length = 260

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 173/260 (66%), Positives = 205/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ ++IE   K+HG+RLD+            H  S  A+ + G + K + KKR+AEK +
Sbjct: 1   MPQGDHIELHQKRHGKRLDHEERKRKREAREVHRRSKDARNLIGAKGKRFAKKRYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E + +QK D  V EGA+P YLLDR+  +RAK+LSN IKQKRKEKAGKW+VP
Sbjct: 61  MKKTLKMHDESNKRQKVDDDVQEGALPPYLLDRDQTQRAKVLSNTIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AE+EMFKV++TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEEEMFKVLRTGKRKTKQWKRMVTKATFVGAGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L II VKKNP  P+YT LGV+T+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLDIISVKKNPNGPMYTSLGVMTRGTIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|388582303|gb|EIM22608.1| ribosomal protein S8e [Wallemia sebi CBS 633.66]
          Length = 260

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 209/260 (80%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIEE  +++G+RLD+            H  S  A++ HG++AKL +K++HAEK++
Sbjct: 1   MPQNEYIEEHQRRYGKRLDHDEKLRKKEARSVHQNSKLARQTHGLKAKLMHKQKHAEKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E++ K+ +++     A+P YL+DR  Q+ AK +S+ IKQKRK+KA +++VP
Sbjct: 61  MKKTMKNHSERNVKKDEEKPDDSAALPTYLMDRNEQRDAKSISSAIKQKRKDKAARFSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAE+E+FKV+KTG  + K WKRMITK TFVG+ FTRKPPK ERFIRP  LR KK
Sbjct: 121 LPKVRGIAEEEVFKVIKTGSKKQKSWKRMITKPTFVGENFTRKPPKLERFIRPSGLRMKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL  TF LPIIGVKKNPQSPLY+QLGVLTKGTV+EVNVSELG+VTT GKVVWGK
Sbjct: 181 ANVTHPELKTTFQLPIIGVKKNPQSPLYSQLGVLTKGTVLEVNVSELGMVTTGGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQ+TNNPENDGCVNAVLLV
Sbjct: 241 YAQITNNPENDGCVNAVLLV 260



>gi|462408655|gb|EMJ13989.1| hypothetical protein PRUPE_ppa020054mg [Prunus persica]
          Length = 363

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 177/259 (68%), Positives = 203/259 (78%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQ +YIE   K++G R D+            H  S  AQK  GI+ K++ KKR+AEK  M
Sbjct: 105 PQGDYIELHRKRYGYRPDHFERKRKKEARLVHKRSETAQKALGIKGKMFAKKRYAEKALM 164

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK +  H+E ST++K D  V EGA+PAYLLDR+   RAKIL+N IKQKRKEKAGKW VPL
Sbjct: 165 KKTLAMHEESSTRRKVDDDVHEGAVPAYLLDRDNTTRAKILNNTIKQKRKEKAGKWEVPL 224

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR +AEDEMFK++++GK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ KA
Sbjct: 225 PKVRPVAEDEMFKILRSGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPSGLRFTKA 284

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGKY 241
           HVTHPEL  TF L IIGVKKNP   +YT LGVLTKGT+IEVNVSELGLVT +GKVVWGKY
Sbjct: 285 HVTHPELKCTFNLEIIGVKKNPNGQMYTSLGVLTKGTIIEVNVSELGLVTPAGKVVWGKY 344

Query: 242 AQVTNNPENDGCVNAVLLV 260
           AQVTNNPENDGCVNAVLLV
Sbjct: 345 AQVTNNPENDGCVNAVLLV 363



>gi|452819416|gb|EME26475.1| ribosomal protein S8e family protein [Galdieria sulphuraria]
          Length = 260

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 203/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIEE IK+HG RLD+            H  S   ++  G++AKL NK+   +K++
Sbjct: 1   MPQGDYIEEHIKEHGHRLDHFERLRKKEAREPHKKSQIVKRTRGMKAKLLNKQNFVDKVQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
            +KKI    +K   ++ +Q + EG++P YLLDR+    AK+LSN IK+KRKEKAGKW VP
Sbjct: 61  QRKKIAALSQKKVDRRMEQPLVEGSVPPYLLDRQAASSAKVLSNTIKEKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +A++E FKV+ TGK + KQWKRM+TK TFVGDGFTRKPPKYERFIRPM LR+KK
Sbjct: 121 LPKVRPVADEETFKVIYTGKRKKKQWKRMVTKVTFVGDGFTRKPPKYERFIRPMGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCL IIGVKKNPQS LY+ LGV+TKGT+IEVNVSE GLVT +GKVVWGK
Sbjct: 181 AHVTHPELKATFCLDIIGVKKNPQSSLYSSLGVITKGTIIEVNVSEFGLVTNTGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|339233928|ref|XP_003382081.1| ribosome biogenesis protein NSA2-like protein [Trichinella
           spiralis]
 gi|316979011|gb|EFV61879.1| ribosome biogenesis protein NSA2-like protein [Trichinella
           spiralis]
          Length = 260

 Score =  359 bits (921), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 171/260 (65%), Positives = 208/260 (80%), Gaps = 1/260 (0%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNE+IE   +++GRR D+            H  +  A+ + GI+AKLYN+KR+ EK++M
Sbjct: 1   PQNEHIELHRRRYGRRFDHEERERKKISRDRHVLAKKAKTLRGIKAKLYNRKRYTEKVQM 60

Query: 62  KKKIKQHQEKSTK-QKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +K IK H+EK  +  +  +   +GAIP YLLDR+ Q   K+LSNMIKQKRKEKAGKW VP
Sbjct: 61  RKLIKAHEEKQQQGTRKPEKSADGAIPVYLLDRQQQTSGKVLSNMIKQKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKV+ ++E E FKV++TGK+R K WKRM+TK  +VG+GFTRKPPK+ERFIRPM+LR+ K
Sbjct: 121 LPKVKAMSEAETFKVIRTGKSRRKAWKRMVTKVCYVGEGFTRKPPKFERFIRPMSLRFNK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP S +YTQLGV+TKGT+IEVNVSELGLVTTSGKVVWGK
Sbjct: 181 AHVTHPELQATFHLPIIGVKKNPSSTMYTQLGVITKGTIIEVNVSELGLVTTSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|298399084|gb|ADI80909.1| hairy cell leukemia [Heliconius cydno cordula]
          Length = 248

 Score =  358 bits (920), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 205/249 (82%), Gaps = 1/249 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K +GRRLDY            H  +A A+K+ GI+AK++NK+R  EKI+
Sbjct: 1   MPQNEYIERHQKLYGRRLDYEERKRKREAREPHKRAAKARKLRGIKAKIFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK H+EK+ +  + + V EGA+P YLLDR+ Q RAK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKAHEEKNVRH-NTEKVAEGAVPVYLLDRDVQSRAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+K+GK++ K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR+KK
Sbjct: 120 IPKVRAQADAEVFKVLKSGKSKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP S +YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSQMYTSLGVITKGTVIEVNISELGLVTQAGKVVWGK 239

Query: 241 YAQVTNNPE 249
           YAQVTNNPE
Sbjct: 240 YAQVTNNPE 248



>gi|402224390|gb|EJU04453.1| TGF beta-inducible nuclear protein 1 [Dacryopinax sp. DJM-731 SS1]
          Length = 264

 Score =  358 bits (920), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 173/260 (66%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           +PQNEYIEE IK+HGRRLDY            H  SA  Q +HG +AKL+++ +HA+K++
Sbjct: 5   LPQNEYIEEHIKRHGRRLDYEEKKRKRLAREVHRVSAKTQTLHGFKAKLHHQIQHAKKVQ 64

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK +KQH E++TK          A+P YLLDR  +  AK LS  +KQ+RK+KA K++VP
Sbjct: 65  LKKTLKQHDERNTKTTTSTEESGTALPTYLLDRAQENNAKALSTAVKQRRKDKAAKYSVP 124

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRG+AE+E+FKV++TGK + K WKRM+TKATFVG+GFTRKP K ERFIRPM LR KK
Sbjct: 125 LPKVRGVAEEEVFKVLRTGKGKKKAWKRMVTKATFVGEGFTRKPVKLERFIRPMGLRVKK 184

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHP+L ATF LPIIGVKKNPQSP+YT LGVLTKGTVIEVNVSELG+VTT GK VWGK
Sbjct: 185 ANVTHPDLQATFQLPIIGVKKNPQSPMYTSLGVLTKGTVIEVNVSELGIVTTGGKAVWGK 244

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGCVNAVLLV
Sbjct: 245 YAQVTNNPENDGCVNAVLLV 264



>gi|313213629|emb|CBY40547.1| unnamed protein product [Oikopleura dioica]
 gi|313244407|emb|CBY15203.1| unnamed protein product [Oikopleura dioica]
          Length = 259

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/260 (68%), Positives = 214/260 (82%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE+ I++HGRRL+Y            H  S  A+K+ G++AKLYNK+R  EKIE
Sbjct: 1   MPQNEHIEQHIRRHGRRLNYLEKKRKKEGRAAHDRSKKAKKMIGLKAKLYNKERRKEKIE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI  H+++ TKQK ++   EGA+P YLLDRE Q+RAK+LSNM+KQKRKEKAGKW+VP
Sbjct: 61  MKKKILMHEKRDTKQKAEE-TQEGAMPHYLLDRENQQRAKVLSNMVKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR  AE E+FK++ +GK + K WKRM+TK  FV + FTRK PKYERFIRPMA+R+KK
Sbjct: 120 LPKVRAQAEAEVFKMMSSGKRKKKAWKRMVTKVCFVPEDFTRKNPKYERFIRPMAMRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP SP++T LGV+TKGTV+EVN+SELGLVT  GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPSSPMFTSLGVITKGTVLEVNISELGLVTQGGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|195146886|ref|XP_002014415.1| GL18965 [Drosophila persimilis]
 gi|194106368|gb|EDW28411.1| GL18965 [Drosophila persimilis]
          Length = 259

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 174/260 (66%), Positives = 207/260 (79%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   K +GRRLDY               +  A+K+ GI+AKL+NK+R  EKI+
Sbjct: 1   MPQNEYMERHRKLYGRRLDYEERKRKKEARLPKERARKARKLRGIKAKLFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK I+ H+EK  K K D+ V +GA+P YLLDR  Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  IKKNIQSHEEKKLK-KQDEKVEDGALPHYLLDRGVQSSAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  ++ E+FKV+KTGK + K WKRM+TK TFVG+ FTRKPPK+ERFIRPM LR KK
Sbjct: 120 IPKVRAQSDAEVFKVLKTGKTKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMGLRMKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SP++T LGV+TKGTV+EVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSPMFTSLGVITKGTVLEVNISELGLVTQTGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDG +NAVLLV
Sbjct: 240 YAQVTNNPENDGVINAVLLV 259



>gi|148681918|gb|EDL13865.1| mCG13462 [Mus musculus]
          Length = 282

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 167/221 (75%), Positives = 193/221 (87%)

Query: 40  QKVHGIRAKLYNKKRHAEKIEMKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRA 99
           +K+ G++AKLY+K+RHAEKI+MKK IK H++++ KQKD++  P+GA+ AYLLDREGQ RA
Sbjct: 62  KKMIGLKAKLYHKQRHAEKIQMKKTIKMHEKRNPKQKDEEKTPQGAVSAYLLDREGQSRA 121

Query: 100 KILSNMIKQKRKEKAGKWNVPLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDG 159
           K+LSNMIKQKRKEK GKW VPLPKVR   E E+ KV++TGK + K WKR +TK   VGDG
Sbjct: 122 KVLSNMIKQKRKEKVGKWEVPLPKVRAQGETEVLKVIRTGKRKKKAWKRTVTKVCSVGDG 181

Query: 160 FTRKPPKYERFIRPMALRYKKAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTV 219
           FTRKPPKYERFIRPM LR+KKAHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTV
Sbjct: 182 FTRKPPKYERFIRPMGLRFKKAHVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTV 241

Query: 220 IEVNVSELGLVTTSGKVVWGKYAQVTNNPENDGCVNAVLLV 260
           IEVNVSELGLVT  GKV+WGKYAQVTNNPENDGC+NAVLLV
Sbjct: 242 IEVNVSELGLVTQGGKVIWGKYAQVTNNPENDGCINAVLLV 282



>gi|403169356|ref|XP_003328804.2| ribosome biogenesis protein NSA2 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375167923|gb|EFP84385.2| 30S ribosomal protein S8e [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 309

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ EYIEE  K+ G+RLD+            H  S+ +Q +HG +AKL + KR++EK+E
Sbjct: 50  MPQGEYIEEFQKRSGKRLDHDERKRKREAREVHKRSSISQSMHGHKAKLLHAKRYSEKVE 109

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK+I++H++K  K K       GA+P YLLDRE + +AK LS+ +K+KRKEKAGK++VP
Sbjct: 110 MKKRIREHEKKDVKTKSTADDGSGALPTYLLDREKENKAKALSSALKEKRKEKAGKYSVP 169

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVRGIAEDE+FKV+KTGK + K WKRM+TKATFV + FTRKP K ERFIRPM LR KK
Sbjct: 170 LPKVRGIAEDEVFKVMKTGKRKQKAWKRMVTKATFVPENFTRKPVKMERFIRPMGLRVKK 229

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A++THPEL ATF LPIIGVKKNPQSP+YTQLGVLTKGTVIEVNVSELGLVTT GKVVW K
Sbjct: 230 ANITHPELQATFQLPIIGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGLVTTGGKVVWAK 289

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPE DGCVN VLLV
Sbjct: 290 YAQVTNNPELDGCVNGVLLV 309



>gi|237835005|ref|XP_002366800.1| TGF-beta-inducible nuclear protein 1, putative [Toxoplasma gondii
           ME49]
 gi|211964464|gb|EEA99659.1| TGF-beta-inducible nuclear protein 1, putative [Toxoplasma gondii
           ME49]
 gi|221485908|gb|EEE24178.1| conserved hypothetical protein [Toxoplasma gondii GT1]
 gi|221503730|gb|EEE29414.1| conserved hypothetical protein [Toxoplasma gondii VEG]
          Length = 260

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 202/260 (77%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K+ GRRLD+            H  S  A+++ GI++KL+NKKR+ EK  
Sbjct: 1   MPQNEYIELHQKRFGRRLDHHERQRKKAAREPHKLSKQARRLRGIKSKLFNKKRYVEKAT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K  +EK  K  + +  P+GA+PAYLLDRE  KR K+LSNM+KQKRKEKAGKW VP
Sbjct: 61  MKKTLKHFEEKDAKSAEPEQAPDGAVPAYLLDREAVKRTKVLSNMVKQKRKEKAGKWQVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKV+ + EDEMFKV+++GK R K WKR++ K  FVG+ FTRKPPK+ER+IRP  LR+KK
Sbjct: 121 LPKVKAMTEDEMFKVLRSGKRRKKAWKRVVNKVCFVGEDFTRKPPKFERYIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L I+GVKKNPQS LYT LGV+TKGT+IEVNVSELGLVT +GKVVW K
Sbjct: 181 AHVTHPELKTTFHLDIVGVKKNPQSHLYTSLGVITKGTIIEVNVSELGLVTQTGKVVWAK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPE DGC+NAVLLV
Sbjct: 241 YAQVTNNPELDGCINAVLLV 260



>gi|341885338|gb|EGT41273.1| hypothetical protein CAEBREN_06101 [Caenorhabditis brenneri]
 gi|341903732|gb|EGT59667.1| hypothetical protein CAEBREN_23555 [Caenorhabditis brenneri]
          Length = 259

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 170/260 (65%), Positives = 205/260 (78%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HGRRLDY            H  S  A+ + G +AKLY+KKR++EK+E
Sbjct: 1   MPQNEHIELHRKRHGRRLDYEERQRKKLARAAHDRSQMAKTLRGHKAKLYHKKRYSEKVE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K +KQH+EK  K   +Q   +GA+PAYLLDR+ Q    +LSNMIKQKRK+KAGK+NVP
Sbjct: 61  MRKLLKQHEEKEQKNTVEQP-DKGAVPAYLLDRQQQTTGTVLSNMIKQKRKQKAGKFNVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +P+VR +++ E FKVVKTGK   K WKRM+TK TFVG+ FTRKP K+ERFIRPM LR+KK
Sbjct: 120 IPQVRAVSDAEAFKVVKTGKTNRKGWKRMVTKVTFVGESFTRKPAKFERFIRPMGLRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF LPI+GVKKNP S +YT LGV+TKGT+IEVNVSELG+VT  GKVVWGK
Sbjct: 180 AHVTHPELQTTFHLPIVGVKKNPSSQMYTSLGVITKGTIIEVNVSELGMVTQGGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLLV
Sbjct: 240 FAQVTNNPENDGCINAVLLV 259



>gi|58390056|ref|XP_317465.2| AGAP008001-PA [Anopheles gambiae str. PEST]
 gi|55237676|gb|EAA43915.2| AGAP008001-PA [Anopheles gambiae str. PEST]
          Length = 259

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 209/260 (80%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE  IK +GRRLDY               +A A+K+ G++AKL+ K+R  EKI+
Sbjct: 1   MPQNEYIERHIKLYGRRLDYEERKRKREAREPKKRAAMARKLRGMKAKLFQKQRRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MK+KI+ H+EK  K+  ++   +GA+P YL+DR  Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKRKIQAHEEKKVKKTTEKVE-DGALPPYLMDRGIQSNAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  A+ E+FKV+++GK + K WKRM+TK T+VG+ FTRKPPKYERFIRPMALR  K
Sbjct: 120 IPKVRAQADAEVFKVIRSGKTKRKAWKRMVTKVTYVGENFTRKPPKYERFIRPMALRMNK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SP+YT LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSPMYTSLGVITKGTVIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|268570180|ref|XP_002640711.1| Hypothetical protein CBG19778 [Caenorhabditis briggsae]
          Length = 259

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 205/260 (78%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HGRRLDY            H  S  A+ + G +AKLY+KKR++EK+E
Sbjct: 1   MPQNEHIELHRKRHGRRLDYEERQRKKLARAAHDRSQMAKTLRGHKAKLYHKKRYSEKVE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K +KQH+EK  K   +Q   +GA+PAYLLDR+ Q    +LSNMIKQKRK+KAGK+NVP
Sbjct: 61  MRKLLKQHEEKEQKNTVEQP-DKGAVPAYLLDRQQQTSGTVLSNMIKQKRKQKAGKFNVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +P+VR +++ E FKVVKTGK   K WKRM+TK TFVG+ FTRKP K+ERFIRPM LR+KK
Sbjct: 120 IPQVRAVSDAEAFKVVKTGKTNRKGWKRMVTKVTFVGESFTRKPAKFERFIRPMGLRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF LPI+GVKKNP S +YT LGV+TKGT+IEVNVSELG+VT  GKVVWGK
Sbjct: 180 AHVTHPELQTTFHLPIVGVKKNPSSQMYTSLGVITKGTIIEVNVSELGMVTQGGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLL+
Sbjct: 240 FAQVTNNPENDGCINAVLLI 259



>gi|388510868|gb|AFK43500.1| unknown [Medicago truncatula]
          Length = 260

 Score =  355 bits (912), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 205/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   ++HGRR D+            H  S  AQ+  GI+ K   KK +AEK +
Sbjct: 1   MPQNEYMERHRREHGRRFDHEERIRKKEARKAHKHSKQAQQAIGIKGKQIAKKNYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MK+ +  H E ++++K D  V EGA+PAYLLDRE   RAKILSN IKQKRKEKAGKW+VP
Sbjct: 61  MKRTLAMHDESTSRRKADDNVQEGAVPAYLLDRENTTRAKILSNTIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKVV+TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 121 LPKVRPVAEDEMFKVVRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L IIGVKKNP  P+YT LGV+T+G++IEVNVSELGLVT +GKVVWGK
Sbjct: 181 AHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVITRGSIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|308490624|ref|XP_003107504.1| hypothetical protein CRE_14053 [Caenorhabditis remanei]
 gi|308251872|gb|EFO95824.1| hypothetical protein CRE_14053 [Caenorhabditis remanei]
          Length = 259

 Score =  355 bits (911), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 205/260 (78%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HGRRLDY            H  S  A+ + G +AKLY+KKR++EK+E
Sbjct: 1   MPQNEHIELHRKRHGRRLDYEERQRKKLARAAHDRSQMAKTLRGHKAKLYHKKRYSEKVE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K +KQH+EK  K   +Q   +GA+PAYLLDR+ Q    +LSNMIKQKRK+KAGK+NVP
Sbjct: 61  MRKLLKQHEEKEQKNTMEQP-DKGAVPAYLLDRQQQTTGTVLSNMIKQKRKQKAGKFNVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +P+VR +++ E FKVVKTGK   K WKRM+TK TFVG+ FTRKP K+ERFIRPM LR+KK
Sbjct: 120 IPQVRAVSDAEAFKVVKTGKTNRKGWKRMVTKVTFVGESFTRKPAKFERFIRPMGLRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF LPI+GVKKNP S +YT LGV+TKGT+IEVNVSELG+VT  GKVVWGK
Sbjct: 180 AHVTHPELQTTFHLPIVGVKKNPSSQMYTSLGVITKGTIIEVNVSELGMVTQGGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLL+
Sbjct: 240 FAQVTNNPENDGCINAVLLI 259



>gi|115474013|ref|NP_001060605.1| Os07g0673100 [Oryza sativa Japonica Group]
 gi|33146852|dbj|BAC79847.1| putative TGF(transfoming growth factor) beta inducible nuclear
           protein TINP1 [Oryza sativa Japonica Group]
 gi|113612141|dbj|BAF22519.1| Os07g0673100 [Oryza sativa Japonica Group]
          Length = 259

 Score =  355 bits (911), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 173/260 (66%), Positives = 204/260 (78%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ ++IE   K+HGRRLDY            H  S  A+++ G + K + KKR+AEK +
Sbjct: 1   MPQGDHIELHQKRHGRRLDYEERKRKRAAREVHKRSRDARQLLGAKGKRFAKKRYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E +++QK D  V EGA+P YLLDR+  +RAK+LSN IKQKR EKAGKW VP
Sbjct: 61  MKKTLKMHDESTSRQKVDD-VQEGALPPYLLDRDQTQRAKVLSNTIKQKRMEKAGKWEVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AE+EMFKV++TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 120 LPKVRPVAEEEMFKVLRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L II VKKNP   +Y+ LGVLT+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKCTFNLDIISVKKNPNGQMYSTLGVLTRGTIIEVNVSELGLVTPAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|502122269|ref|XP_004497662.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Cicer
           arietinum]
          Length = 260

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 172/260 (66%), Positives = 199/260 (76%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YI+  IK +GRRLDY            H  SA AQK  GI+ K+  KK +AEK +
Sbjct: 1   MPQGDYIDRHIKDYGRRLDYFERKRKKEAREVHRHSAKAQKTLGIKGKMIAKKNYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +  H+E ++++K D  V EGA+PA+LLDRE   RAKILSN IKQKRKEKAGKW+VP
Sbjct: 61  MKKTLAMHEESTSRRKADDNVQEGAVPAFLLDRENTARAKILSNTIKQKRKEKAGKWDVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AEDEMFKVV+TGK +TKQWKRM+TKATFVG GFTRKPPKYER           
Sbjct: 121 LPKVRPVAEDEMFKVVRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERXXXXXXXXXXX 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
            HVTHPEL  TF L IIGVKKNP  P+YT LGV+T+G++IEVNVSELGLVT +GKVVWGK
Sbjct: 181 XHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVITRGSIIEVNVSELGLVTPAGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|17509649|ref|NP_493387.1| Protein W09C5.1 [Caenorhabditis elegans]
 gi|3880592|emb|CAB04941.1| Protein W09C5.1 [Caenorhabditis elegans]
          Length = 259

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 167/260 (64%), Positives = 205/260 (78%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HGRRLD+            H  S  A+ + G +AKLY+KKR++EK+E
Sbjct: 1   MPQNEHIELHRKRHGRRLDHEERQRKKLARAAHDRSQMAKTLRGHKAKLYHKKRYSEKVE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K +KQH+EK  K   +Q   +GA+PAYLLDR+ Q    +LSNMIKQKRK+KAGK+NVP
Sbjct: 61  MRKLLKQHEEKDQKNTVEQP-DKGAVPAYLLDRQQQTSGTVLSNMIKQKRKQKAGKFNVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +P+VR +++ E FKVVKTGK   K WKRM+TK TFVG+ FTRKP K+ERFIRPM LR+KK
Sbjct: 120 IPQVRAVSDAEAFKVVKTGKTNRKGWKRMVTKVTFVGESFTRKPAKFERFIRPMGLRFKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF LPI+GVKKNP S +YT LGV+TKGT++EVNVSELG+VT  GKVVWGK
Sbjct: 180 AHVTHPELQTTFHLPIVGVKKNPSSQMYTSLGVITKGTILEVNVSELGMVTQGGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           +AQVTNNPENDGC+NAVLL+
Sbjct: 240 FAQVTNNPENDGCINAVLLI 259



>gi|218200239|gb|EEC82666.1| hypothetical protein OsI_27295 [Oryza sativa Indica Group]
          Length = 259

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 172/260 (66%), Positives = 204/260 (78%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ ++IE   K+HGRRLDY            H  S  A+++ G + K + KKR+AEK +
Sbjct: 1   MPQGDHIELHQKRHGRRLDYEERKRKRAAREVHKRSRDARQLLGAKGKRFAKKRYAEKAQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK +K H E +++QK +  V EGA+P YLLDR+  +RAK+LSN IKQKR EKAGKW VP
Sbjct: 61  MKKTLKMHDESTSRQKVED-VQEGALPPYLLDRDQTQRAKVLSNTIKQKRMEKAGKWEVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR +AE+EMFKV++TGK +TKQWKRM+TKATFVG GFTRKPPKYERFIRP  LR+ K
Sbjct: 120 LPKVRPVAEEEMFKVLRTGKRKTKQWKRMVTKATFVGPGFTRKPPKYERFIRPTGLRFTK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L II VKKNP   +Y+ LGVLT+GT+IEVNVSELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKCTFNLDIISVKKNPNGQMYSTLGVLTRGTIIEVNVSELGLVTPAGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|428165460|gb|EKX34454.1| hypothetical protein GUITHDRAFT_98082 [Guillardia theta CCMP2712]
          Length = 260

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 172/260 (66%), Positives = 201/260 (77%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQ +YIE   K+HG RLD+            H  + + +K  G++AKL++KKRH EK  
Sbjct: 1   MPQGDYIELHRKRHGFRLDHFERKRKKEARRPHELAEYEKKAFGLKAKLHHKKRHQEKAV 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           M+K I  HQ++  K KD+  +P GA+P+YLLDREG  RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  MRKTIAMHQQRENKHKDEDVIPSGAVPSYLLDREGVSRAKVLSNTVKQKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LP VR IAE+E+FKVVK+GK + K WKRMITK TFVG  FTRKPPK ERFIRPM LR  K
Sbjct: 121 LPSVRPIAEEEVFKVVKSGKRKKKAWKRMITKMTFVGQNFTRKPPKLERFIRPMGLRVTK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           A+VTHPEL ATF L I+GVKKNPQ  + TQLGV+TKGTV+EVNVS+LGLVT SGKVVWGK
Sbjct: 181 ANVTHPELQATFQLEILGVKKNPQGAVTTQLGVITKGTVVEVNVSDLGLVTPSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPE DGCVNAVLLV
Sbjct: 241 YAQVTNNPELDGCVNAVLLV 260



>gi|146102560|ref|XP_001469365.1| putative 40S ribosomal protein S8 [Leishmania infantum JPCM5]
 gi|398025236|ref|XP_003865779.1| 40S ribosomal protein S8, putative [Leishmania donovani]
 gi|401421022|ref|XP_003875000.1| putative 40S ribosomal protein S8 [Leishmania mexicana
           MHOM/GT/2001/U1103]
 gi|134073735|emb|CAM72472.1| putative 40S ribosomal protein S8 [Leishmania infantum JPCM5]
 gi|322491236|emb|CBZ26502.1| putative 40S ribosomal protein S8 [Leishmania mexicana
           MHOM/GT/2001/U1103]
 gi|322504016|emb|CBZ39103.1| 40S ribosomal protein S8, putative [Leishmania donovani]
          Length = 260

 Score =  351 bits (901), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 165/260 (63%), Positives = 204/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE++ K++GRRLD+            H+ + + ++V GI+AKL  K R+AEK E
Sbjct: 1   MPQNEYIEQAQKRYGRRLDHVERTRKREARKAHTDANYLKRVRGIKAKLAQKARYAEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++KKI++H+EK T ++     P+ A+P +L+DR    RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  IRKKIREHEEKQTTERVKDKGPKNALPGFLMDRSEADRAKVLSNSLKQKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           + KV+ ++EDEM K V +GK   K WKR++ K TFVG+ FTR+ PK ERFIRPMALR+KK
Sbjct: 121 IEKVKTVSEDEMLKAVTSGKRGKKSWKRLVNKVTFVGETFTRRMPKMERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPII VKKNPQ  +YT LGV+TKG+VIEVNVSELGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIISVKKNPQGKMYTGLGVITKGSVIEVNVSELGLVTPSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|393908459|gb|EFO19300.2| 30S ribosomal protein S8e [Loa loa]
          Length = 259

 Score =  351 bits (901), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 205/261 (78%), Gaps = 3/261 (1%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HGRRLDY            H  S +A+K+ G +AKLY+KKR+AEK+E
Sbjct: 1   MPQNEHIELHRKRHGRRLDYEERLRKRNARAGHERSQYARKIRGRKAKLYHKKRYAEKVE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPE-GAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           M++ ++QH+EK  KQ      P+ G +PAYLLDR+ Q   K+LS+MIKQKRKEKAGK+ V
Sbjct: 61  MRRLLRQHEEK--KQTGTSEEPDRGVVPAYLLDRQQQTTGKVLSSMIKQKRKEKAGKYQV 118

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           P+P V+ +++ E FKVVKTGK R K WKRM+TK TFVG+ FTRKP K+ERFIRPM LR+K
Sbjct: 119 PIPTVKAVSDAEAFKVVKTGKTRRKGWKRMVTKVTFVGESFTRKPAKFERFIRPMGLRFK 178

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KAHVTHPEL  TF LPI+GVKKNP S LYT LGV+TKGT+IEVN+SELG+VT  GKVVW 
Sbjct: 179 KAHVTHPELQTTFQLPIVGVKKNPSSSLYTSLGVITKGTIIEVNISELGMVTQGGKVVWA 238

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQVTN+PENDGC+NAVLL+
Sbjct: 239 KYAQVTNHPENDGCINAVLLL 259



>gi|459366812|gb|EMG46026.1| Ribosome biogenesis protein NSA2 [Candida maltosa Xu316]
          Length = 261

 Score =  351 bits (901), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 176/261 (67%), Positives = 202/261 (77%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IKKHGRRLDY            H  +  AQ + G R K + KKR+AEK+ 
Sbjct: 1   MPQNEYIEQHIKKHGRRLDYEERKRKKEAREGHRIAKDAQTLKGWRGKQFAKKRYAEKVA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEG-AIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           MKKKIK HQE   K  +   V EG A+P YLLDR+    AK +S+ IKQKR EKA K+ V
Sbjct: 61  MKKKIKAHQESKVKGPNTPKVDEGEALPTYLLDRQTNNSAKAISSSIKQKRLEKADKFQV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PLPKV+GI+E+EMFKV+KTGK++TK WKRMITK TFVG+GFTR+P K ER IRP ALR K
Sbjct: 121 PLPKVKGISEEEMFKVIKTGKSKTKSWKRMITKHTFVGEGFTRRPVKMERIIRPAALRQK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPI+GVKKNPQSP+YTQLGVLTKGT+IEVNVSELGLVT  GKVVWG
Sbjct: 181 KANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQ+TN P+ DGCVNAVLLV
Sbjct: 241 KYAQITNEPDRDGCVNAVLLV 261



>gi|498980880|ref|XP_004549923.1| PREDICTED: ribosome biogenesis protein NSA2 homolog isoform X1
           [Maylandia zebra]
          Length = 291

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 168/239 (70%), Positives = 193/239 (80%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HG RLD+            H  S  A+K+ G++AKLY+K+RHAEKI+
Sbjct: 1   MPQNEHIELHRKRHGYRLDHHERKRKKESREAHERSHKAKKMIGLKAKLYHKQRHAEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IK H+++ TKQK+D   PEGA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VP
Sbjct: 61  MKKTIKMHEQRKTKQKNDDKTPEGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRP  LR+KK
Sbjct: 121 LPKVRAQGETEVLKVIRTGKRQKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           AHVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WG
Sbjct: 181 AHVTHPELKATFCLPILGVKKNPSSPLYTSLGVITKGTVIEVNVSELGLVTQGGKVIWG 239



>gi|281339399|gb|EFB14983.1| hypothetical protein PANDA_005460 [Ailuropoda melanoleuca]
          Length = 239

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 169/239 (70%), Positives = 195/239 (81%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNEYIE   K+ G RLDY            H  S  A+K+ G++AKLY+K+RHAEKI+M
Sbjct: 1   PQNEYIELHRKRCGYRLDYHEKKRKKEGREAHERSKKAKKMIGLKAKLYHKQRHAEKIQM 60

Query: 62  KKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVPL 121
           KK IK H++++TKQK+D+  P+GA+PAYLLDREGQ RAK+LSNMIKQKRKEKAGKW VPL
Sbjct: 61  KKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPL 120

Query: 122 PKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKKA 181
           PKVR   E E+ KV++TGK + K WKRM+TK  FVGDGFTRKPPKYERFIRPM LR+KKA
Sbjct: 121 PKVRAQGETEVLKVIRTGKRKKKAWKRMVTKVCFVGDGFTRKPPKYERFIRPMGLRFKKA 180

Query: 182 HVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           HVTHPEL ATFCLPI+GVKKNP SPLYT LGV+TKGTVIEVNVSELGLVT  GKV+WGK
Sbjct: 181 HVTHPELKATFCLPILGVKKNPSSPLYTTLGVITKGTVIEVNVSELGLVTQGGKVIWGK 239



>gi|154346696|ref|XP_001569285.1| putative 40S ribosomal protein S8 [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134066627|emb|CAM44426.1| putative 40S ribosomal protein S8 [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 260

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 164/260 (63%), Positives = 205/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE++ K++GRRLD+            H+ + + ++V G++AKL  K R+AEK E
Sbjct: 1   MPQNEYIEQAQKRYGRRLDHVERTRKREARKAHTDANYLKRVRGMKAKLAQKARYAEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++KKI++H+EK T ++     P+ A+P++L+DR    RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  IRKKIREHEEKQTTERVKDKGPKNALPSFLMDRSEADRAKVLSNSLKQKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           + KV+ ++EDEM K V +GK   K WKR++ K TFVG+ FTR+ PK ERFIRPMALR+KK
Sbjct: 121 IEKVKTVSEDEMLKAVTSGKRGKKSWKRLVNKVTFVGETFTRRMPKMERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPII VKKNPQ  +YT LGV+TKG+VIEVNVSELGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIIAVKKNPQGRMYTGLGVITKGSVIEVNVSELGLVTPSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|66359552|ref|XP_626954.1| conserved protein, COG SSU ribosomal protein S8E [Cryptosporidium
           parvum Iowa II]
 gi|67588642|ref|XP_665366.1| RIKEN cDNA 5730427N09 gene [Cryptosporidium hominis TU502]
 gi|46228060|gb|EAK88959.1| conserved protein, COG SSU ribosomal protein S8E [Cryptosporidium
           parvum Iowa II]
 gi|54656022|gb|EAL35136.1| RIKEN cDNA 5730427N09 gene [Cryptosporidium hominis]
          Length = 260

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 166/260 (63%), Positives = 201/260 (77%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K+HG R D+            H  S  AQK+ GI+AKLYNKKR+AEK  
Sbjct: 1   MPQNEYIELHRKRHGYRFDHFEKKRKFESRKVHKDSQHAQKLRGIKAKLYNKKRYAEKAT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++K +K ++EK   +KD + V +GA+P+YLLDREG  R KILSNMIKQKRKEK+ KW VP
Sbjct: 61  LRKLVKANEEKDAVEKDPENVQKGAVPSYLLDREGVNRTKILSNMIKQKRKEKSAKWQVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PK++ + EDEMFK+++TGK + K WKR++ K  FVG+ FTRKPPK ER+IRP  LR+KK
Sbjct: 121 IPKIKALNEDEMFKILRTGKRQKKSWKRVVNKVCFVGNDFTRKPPKLERYIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L I+ +KKNPQS LYT LGV+TKGT+IEVNVSELGLVT +GKVVW K
Sbjct: 181 AHVTHPELKTTFYLDIVSIKKNPQSQLYTTLGVITKGTIIEVNVSELGLVTQTGKVVWAK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPE DGC+NAVLLV
Sbjct: 241 YAQVTNNPEIDGCINAVLLV 260



>gi|498932366|ref|XP_004519373.1| PREDICTED: ribosome biogenesis protein NSA2 homolog [Ceratitis
           capitata]
          Length = 259

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 174/260 (66%), Positives = 202/260 (77%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   K +GRRLDY               +  A+K+ GI+AKL+NK+R  EKI 
Sbjct: 1   MPQNEYMERHAKLYGRRLDYEERKRKKEARLPKERARKARKLRGIKAKLFNKERRNEKIL 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           + KKIK HQEK  K K D+ V EGA+P YLLDR  Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  ISKKIKAHQEKKCK-KLDEKVEEGAVPHYLLDRGLQANAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           LPKVR  ++ E+F+ +K+GK + K WKRM+TK TFVG+ FTRKPPK+ERFIRPM LR  K
Sbjct: 120 LPKVRAQSDAEVFRELKSGKTKRKSWKRMVTKVTFVGENFTRKPPKFERFIRPMGLRMNK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF LPIIGVKKNP SP+ T LGV+TKGTVIEVN+S+LGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKTTFYLPIIGVKKNPSSPMLTSLGVMTKGTVIEVNISDLGLVTQTGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDG VNAVLLV
Sbjct: 240 YAQVTNNPENDGVVNAVLLV 259



>gi|444319186|ref|XP_004180250.1| hypothetical protein TBLA_0D02270 [Tetrapisispora blattae CBS 6284]
 gi|387513292|emb|CCH60731.1| hypothetical protein TBLA_0D02270 [Tetrapisispora blattae CBS 6284]
          Length = 261

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 176/264 (66%), Positives = 205/264 (77%), Gaps = 7/264 (2%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IK+HGRRLDY            H  S  AQK+ G + K + KKR+AEK+ 
Sbjct: 1   MPQNEYIEQHIKQHGRRLDYEERKRKREAREAHKVSERAQKLTGWKGKQFAKKRYAEKVA 60

Query: 61  MKKKIKQHQEK----STKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGK 116
           M+KKIK H++     S+K  DD      A+P YLLDRE    AK +S+ IKQKR EKA K
Sbjct: 61  MRKKIKAHEQSKVKGSSKPLDDSG---EALPTYLLDREQSNTAKAISSSIKQKRLEKADK 117

Query: 117 WNVPLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMAL 176
           ++VPLPKVRGI+E+EMFKVVKTGK++TK WKRMITK TFVG+GFTR+P K ER IRP AL
Sbjct: 118 YSVPLPKVRGISEEEMFKVVKTGKSKTKSWKRMITKHTFVGEGFTRRPVKMERIIRPTAL 177

Query: 177 RYKKAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKV 236
           R KKA+VTHPELG T  LPI+GVKKNPQSP+YTQLGVLTKGTVIEVNVSELG+VT+ GKV
Sbjct: 178 RQKKANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTVIEVNVSELGMVTSGGKV 237

Query: 237 VWGKYAQVTNNPENDGCVNAVLLV 260
           VWGKYAQ+TN P+ DGCVNAVLLV
Sbjct: 238 VWGKYAQITNEPDRDGCVNAVLLV 261



>gi|157877865|ref|XP_001687230.1| putative 40S ribosomal protein S8 [Leishmania major strain
           Friedlin]
 gi|68130305|emb|CAJ09617.1| putative 40S ribosomal protein S8 [Leishmania major strain
           Friedlin]
          Length = 260

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 164/260 (63%), Positives = 204/260 (78%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE++ K++GRRLD+            H+ + + ++V G++AKL  K R+AEK E
Sbjct: 1   MPQNEYIEQAQKRYGRRLDHVERTRKREARKAHTDANYLKRVRGMKAKLAQKARYAEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++KKI++H+EK T ++     P+ A+P +L+DR    RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  IRKKIREHEEKQTTERVKDKGPKNALPGFLMDRSEADRAKVLSNSLKQKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           + KV+ ++EDEM K V +GK   K WKR++ K TFVG+ FTR+ PK ERFIRPMALR+KK
Sbjct: 121 IEKVKTVSEDEMLKAVTSGKRGKKSWKRLVNKVTFVGETFTRRMPKMERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPII VKKNPQ  +YT LGV+TKG+VIEVNVSELGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKATFCLPIISVKKNPQGKMYTGLGVITKGSVIEVNVSELGLVTPSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|195116687|ref|XP_002002883.1| GI10609 [Drosophila mojavensis]
 gi|193913458|gb|EDW12325.1| GI10609 [Drosophila mojavensis]
          Length = 259

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 176/260 (67%), Positives = 210/260 (80%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   K +GRRLDY               +  AQK+ GI+AKL+NK+R  EKI+
Sbjct: 1   MPQNEYMERHRKLYGRRLDYEERKRKKEARLPKERARKAQKLRGIKAKLFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKI+ H+EK  K+++++   +GA+P YLLDR  Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIQAHEEKKVKKQEEKVE-DGALPHYLLDRGIQSNAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  ++ E+FKV+KTGK + K WKRM+TK TFVG+ FTRKPPK+ERFIRPMALR KK
Sbjct: 120 IPKVRAQSDAEVFKVLKTGKTKRKAWKRMVTKVTFVGENFTRKPPKFERFIRPMALRMKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP SP++T LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSPMFTSLGVITKGTVIEVNISELGLVTQTGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDG +NAVLLV
Sbjct: 240 YAQVTNNPENDGVINAVLLV 259



>gi|444706572|gb|ELW47907.1| Ribosome biogenesis protein NSA2 like protein [Tupaia chinensis]
          Length = 219

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 189/217 (87%)

Query: 44  GIRAKLYNKKRHAEKIEMKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILS 103
           G++AKLY+K+RHAEK +MKK IK H++++TKQK+D+  P+GAI AYLLDREGQ RAK+LS
Sbjct: 3   GLKAKLYHKQRHAEKTQMKKTIKMHEKRNTKQKNDEKTPQGAILAYLLDREGQPRAKVLS 62

Query: 104 NMIKQKRKEKAGKWNVPLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRK 163
           NMIKQKRKEKAGKW V LPKVR   E ++ KV++TG+ + K WKRM+ K  FVGDGFTRK
Sbjct: 63  NMIKQKRKEKAGKWEVRLPKVRAQGETDVLKVIRTGERKKKAWKRMVIKVCFVGDGFTRK 122

Query: 164 PPKYERFIRPMALRYKKAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVN 223
           PPKYERFIRPM LR+KKAHVTHPEL ATFCLPI+GVKK P SPLYT LGV+TKGTVIEVN
Sbjct: 123 PPKYERFIRPMGLRFKKAHVTHPELKATFCLPILGVKKKPSSPLYTTLGVITKGTVIEVN 182

Query: 224 VSELGLVTTSGKVVWGKYAQVTNNPENDGCVNAVLLV 260
           VSELGLV   GKV+WGKYAQVTNNPENDGC+NA+LLV
Sbjct: 183 VSELGLVAQGGKVIWGKYAQVTNNPENDGCINAILLV 219



>gi|241953581|ref|XP_002419512.1| ribosome biogenesis protein NSA2 [Candida dubliniensis CD36]
 gi|241953631|ref|XP_002419537.1| ribosome biogenesis protein NSA2 [Candida dubliniensis CD36]
 gi|223642852|emb|CAX43107.1| protein constituent of 66S pre-ribosomal particles, putative
           [Candida dubliniensis CD36]
 gi|223642877|emb|CAX43132.1| 66S pre-ribosomal particle component, putative [Candida
           dubliniensis CD36]
          Length = 261

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 175/261 (67%), Positives = 201/261 (77%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IKKHGRRLDY            H  +  AQ + G RAK + KKR+AEK+ 
Sbjct: 1   MPQNEYIEQHIKKHGRRLDYEERKRKKEAREGHRVAKDAQTLKGWRAKQFAKKRYAEKVA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEG-AIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           MKKKIK HQE   K        +G A+P YLLDR+    AK +S+ IKQKR EKA K+ V
Sbjct: 61  MKKKIKAHQESKVKGPSTPKAEDGEALPTYLLDRQTNNTAKAISSSIKQKRLEKADKFQV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PLPKV+GI+E+EMFKVVKTGK+++K WKRMITK TFVG+GFTR+P K ER IRP ALR K
Sbjct: 121 PLPKVKGISEEEMFKVVKTGKSKSKSWKRMITKHTFVGEGFTRRPVKMERIIRPAALRQK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPI+GVKKNPQSP+YTQLGVLTKGT+IEVNVSELGLVT  GKVVWG
Sbjct: 181 KANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQ+TN P+ DGCVNAVLLV
Sbjct: 241 KYAQITNEPDRDGCVNAVLLV 261



>gi|209881993|ref|XP_002142434.1| ribosome biogenesis protein NSA2 [Cryptosporidium muris RN66]
 gi|209558040|gb|EEA08085.1| ribosome biogenesis protein NSA2, putative [Cryptosporidium muris
           RN66]
          Length = 260

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 166/260 (63%), Positives = 200/260 (76%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K++G R D+            H  SA AQK+ GI+AKLYNKKR+AEK+ 
Sbjct: 1   MPQNEYIELHRKRYGYRFDHFEKKRKLESRKVHKNSAKAQKLRGIKAKLYNKKRYAEKVT 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KK +K ++EK  K+     + +GAIPAYLLDRE   R K+LSNMIKQKRKEKA KW VP
Sbjct: 61  LKKALKVNEEKDGKETQSDTIAKGAIPAYLLDREIVNRTKVLSNMIKQKRKEKAAKWKVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PK++ + EDEMFK++++GK + K WKR++ K  FVG  FTRKPPK+ER+IRP  LR+KK
Sbjct: 121 IPKIKALNEDEMFKILRSGKRKKKSWKRIVNKVCFVGSDFTRKPPKFERYIRPTGLRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF L I+ VKKNPQS LYT LGV+TKGTV+EVNVSELGLVT +GKVVW K
Sbjct: 181 AHVTHPELKTTFYLDIVSVKKNPQSQLYTTLGVITKGTVLEVNVSELGLVTQTGKVVWAK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPE DGC+NAVLLV
Sbjct: 241 YAQVTNNPEIDGCINAVLLV 260



>gi|195457478|ref|XP_002075582.1| GK19000 [Drosophila willistoni]
 gi|194171667|gb|EDW86568.1| GK19000 [Drosophila willistoni]
          Length = 259

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 203/260 (78%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   K +GRRLDY               +  A K+ GI+AKL+NK+R  EKI+
Sbjct: 1   MPQNEYMERHRKLYGRRLDYEERKRKREARLPKERARKAHKLRGIKAKLFNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           +KKKI+ H+EK   QK ++    GA+P YLLDR  Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  IKKKIQAHEEKKV-QKQEEKNECGALPHYLLDRGIQSSAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  ++ E+FKV+ TGK + K WKRM+TK TFVG  FTRKPPKYERFIRPMALR KK
Sbjct: 120 IPKVRAQSDAEVFKVLATGKTKRKAWKRMVTKVTFVGVNFTRKPPKYERFIRPMALRMKK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNP S ++T LGV+TKGTVIEVN+SELGLVT SGKVVWGK
Sbjct: 180 AHVTHPELKATFHLPIIGVKKNPSSQMFTSLGVITKGTVIEVNISELGLVTQSGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDG +NAVLLV
Sbjct: 240 YAQVTNNPENDGVINAVLLV 259



>gi|407849631|gb|EKG04317.1| 40S ribosomal protein S8, putative [Trypanosoma cruzi]
          Length = 260

 Score =  349 bits (895), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 166/260 (63%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE + K++GRRLD+            H+ +   + V GI+AK+ +K+R+AEK E
Sbjct: 1   MPQNEYIELAQKRYGRRLDHAERTRKRDARKAHTQAKHLRTVRGIKAKIASKRRYAEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++KKI++H+EK TK++  +  P+ A+P++L+DR    RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  IRKKIREHEEKETKERVKEKGPKNALPSFLMDRSEADRAKVLSNSLKQKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           + KV+ ++EDEM K V +GK   K WKRM+ K TFVG+ FTR+ PK+ERFIRPMALR+KK
Sbjct: 121 IEKVKPVSEDEMMKAVTSGKRGKKSWKRMVNKVTFVGETFTRRMPKHERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNPQ  +YT LGV+TKGTVIEVNVS+LGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKATFHLPIIGVKKNPQGKMYTGLGVITKGTVIEVNVSDLGLVTPSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|68479839|ref|XP_716088.1| potential ribosome maturation factor [Candida albicans SC5314]
 gi|74590344|sp|Q5A2Y7.1|NSA2_CANAL RecName: Full=Ribosome biogenesis protein NSA2
 gi|46437740|gb|EAK97081.1| potential ribosome maturation factor [Candida albicans SC5314]
 gi|238881036|gb|EEQ44674.1| TGF beta-inducible nuclear protein 1 [Candida albicans WO-1]
          Length = 261

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 174/261 (66%), Positives = 201/261 (77%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IKKHGRRLDY            H  +  AQ + G RAK + KKR+AEK+ 
Sbjct: 1   MPQNEYIEQHIKKHGRRLDYEERKRKKEAREGHRVAKDAQTLKGWRAKQFAKKRYAEKVA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEG-AIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           MKKKIK HQE   K        +G A+P YLLDR+    AK +S+ IKQKR EKA K+ V
Sbjct: 61  MKKKIKAHQESKVKGPSTPKAEDGEALPTYLLDRQTNNTAKAISSSIKQKRLEKADKFQV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PLPKV+GI+E+EMFKV+KTGK+++K WKRMITK TFVG+GFTR+P K ER IRP ALR K
Sbjct: 121 PLPKVKGISEEEMFKVIKTGKSKSKSWKRMITKHTFVGEGFTRRPVKMERIIRPAALRQK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPI+GVKKNPQSP+YTQLGVLTKGT+IEVNVSELGLVT  GKVVWG
Sbjct: 181 KANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQ+TN P+ DGCVNAVLLV
Sbjct: 241 KYAQITNEPDRDGCVNAVLLV 261



>gi|240848741|ref|NP_001155554.1| ribosome biogenesis protein NSA2 homolog [Acyrthosiphon pisum]
 gi|239799254|dbj|BAH70557.1| ACYPI003981 [Acyrthosiphon pisum]
          Length = 259

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 178/260 (68%), Positives = 216/260 (83%), Gaps = 1/260 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEY+E   K +GRR+DY            H  S  A+++ G++AKLYNK+R  EKI+
Sbjct: 1   MPQNEYMERHRKLYGRRMDYEQRMRKKEAREPHLRSDKAKRLRGLKAKLYNKERRNEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKKKIK+H+EK  K+K+++   EGA+P YLLDR+ Q  AK+LSNMIKQKRKEKAGKW+VP
Sbjct: 61  MKKKIKEHEEKLQKKKEEKPK-EGALPVYLLDRDVQSSAKVLSNMIKQKRKEKAGKWDVP 119

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +PKVR  +++E+FKV +TGK++ K WKRM+TK  +VG+GFTRKPPK+ERFIRPMALR+ K
Sbjct: 120 IPKVRAQSDNEVFKVFRTGKSKRKGWKRMVTKVCYVGEGFTRKPPKFERFIRPMALRFNK 179

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATFCLPIIGVKKNP SP+YT LGV+TKGTVIEVN+SELGLVT +GKVVWGK
Sbjct: 180 AHVTHPELKATFCLPIIGVKKNPNSPMYTNLGVITKGTVIEVNISELGLVTQTGKVVWGK 239

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 240 YAQVTNNPENDGCINAVLLV 259



>gi|71408532|ref|XP_806665.1| 40S ribosomal protein S8 [Trypanosoma cruzi strain CL Brener]
 gi|70870474|gb|EAN84814.1| 40S ribosomal protein S8, putative [Trypanosoma cruzi]
          Length = 260

 Score =  348 bits (894), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 166/260 (63%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE + K++GRRLD+            H+ +   + V GI+AK+ +K+R+AEK E
Sbjct: 1   MPQNEYIELAQKRYGRRLDHAERTRKRDARKAHTQAKQLRTVRGIKAKIASKRRYAEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++KKI++H+EK TK++  +  P+ A+P++L+DR    RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  IRKKIREHEEKETKERVKEKGPKNALPSFLMDRSEADRAKVLSNSLKQKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           + KV+ ++EDEM K V +GK   K WKRM+ K TFVG+ FTR+ PK+ERFIRPMALR+KK
Sbjct: 121 IEKVKPVSEDEMMKAVTSGKRGKKSWKRMVNKVTFVGETFTRRMPKHERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNPQ  +YT LGV+TKGTVIEVNVS+LGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKATFHLPIIGVKKNPQGKMYTGLGVITKGTVIEVNVSDLGLVTPSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|71663239|ref|XP_818615.1| 40S ribosomal protein S8 [Trypanosoma cruzi strain CL Brener]
 gi|70883876|gb|EAN96764.1| 40S ribosomal protein S8, putative [Trypanosoma cruzi]
          Length = 260

 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 166/260 (63%), Positives = 207/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE + K++GRRLD+            H+ +   + V GI+AK+ +K+R+AEK E
Sbjct: 1   MPQNEYIELAQKRYGRRLDHAERIRKRDARKAHTQAKHLRTVRGIKAKIASKRRYAEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++KKI++H+EK TK++  +  P+ A+P++L+DR    RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  IRKKIREHEEKETKERVKEKGPKNALPSFLMDRSEADRAKVLSNSLKQKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           + KV+ ++EDEM K V +GK   K WKRM+ K TFVG+ FTR+ PK+ERFIRPMALR+KK
Sbjct: 121 IEKVKPVSEDEMMKAVTSGKRGKKSWKRMVNKVTFVGETFTRRMPKHERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNPQ  +YT LGV+TKGTVIEVNVS+LGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKATFHLPIIGVKKNPQGKMYTGLGVITKGTVIEVNVSDLGLVTPSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|149240589|ref|XP_001526170.1| TGF beta-inducible nuclear protein 1 [Lodderomyces elongisporus
           NRRL YB-4239]
 gi|206558164|sp|A5DZE1.1|NSA2_LODEL RecName: Full=Ribosome biogenesis protein NSA2
 gi|146450293|gb|EDK44549.1| TGF beta-inducible nuclear protein 1 [Lodderomyces elongisporus
           NRRL YB-4239]
          Length = 261

 Score =  348 bits (894), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 174/261 (66%), Positives = 202/261 (77%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IK+HGRRLD+            H  +  AQ + G RAK + KKR++EK+ 
Sbjct: 1   MPQNEYIEQHIKQHGRRLDHEERKRKKEAREGHRVAKDAQTLKGWRAKQFAKKRYSEKVS 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEG-AIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           M+KKIK HQE   K        EG A+P YLLDR+    AK LS+ IKQKR EKA K++V
Sbjct: 61  MRKKIKAHQESKVKGPSTPKQDEGEALPTYLLDRQTNNTAKALSSSIKQKRLEKADKFSV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PLPKVRGI+E+EMFKV+KTGK++TK WKRMITK TFVG+GFTR+P K ER IRP ALR K
Sbjct: 121 PLPKVRGISEEEMFKVIKTGKSKTKSWKRMITKHTFVGEGFTRRPVKMERIIRPAALRQK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPI+GVKKNPQSP+YTQLGVLTKGT+IEVNVSELGLVT  GKVVWG
Sbjct: 181 KANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQ+TN P+ DGCVNAVLLV
Sbjct: 241 KYAQITNEPDRDGCVNAVLLV 261



>gi|255726060|ref|XP_002547956.1| TGF beta-inducible nuclear protein 1 [Candida tropicalis MYA-3404]
 gi|240133880|gb|EER33435.1| TGF beta-inducible nuclear protein 1 [Candida tropicalis MYA-3404]
          Length = 261

 Score =  348 bits (893), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 174/261 (66%), Positives = 201/261 (77%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IKKHGRRLDY            H  +  AQ + G R K + KKR+AEK+ 
Sbjct: 1   MPQNEYIEQHIKKHGRRLDYEERKRKKEAREGHRIAKDAQTLKGWRGKQFAKKRYAEKVA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEG-AIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           MKKKIK HQE   K      V +G A+P YLLDR+    AK +S+ IKQKR EKA K+ V
Sbjct: 61  MKKKIKAHQESKVKGPSTPKVDDGEALPTYLLDRQTNNTAKAISSSIKQKRLEKADKFQV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PLPKV+GI+E+EMFKV+KTGK+++K WKRMITK TFVG+GFTR+P K ER IRP ALR K
Sbjct: 121 PLPKVKGISEEEMFKVIKTGKSKSKSWKRMITKHTFVGEGFTRRPVKMERIIRPAALRQK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPI+GVKKNPQSP+YTQLGVLTKGT+IEVNVSELGLVT  GKVVWG
Sbjct: 181 KANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQ+TN P+ DGCVNAVLLV
Sbjct: 241 KYAQITNEPDRDGCVNAVLLV 261



>gi|312085664|ref|XP_003144769.1| TGF beta-inducible nuclear protein 1 [Loa loa]
          Length = 264

 Score =  348 bits (893), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 167/260 (64%), Positives = 204/260 (78%), Gaps = 3/260 (1%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNE+IE   K+HGRRLDY            H  S +A+K+ G +AKLY+KKR+AEK+EM
Sbjct: 7   PQNEHIELHRKRHGRRLDYEERLRKRNARAGHERSQYARKIRGRKAKLYHKKRYAEKVEM 66

Query: 62  KKKIKQHQEKSTKQKDDQAVPE-GAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++ ++QH+EK  KQ      P+ G +PAYLLDR+ Q   K+LS+MIKQKRKEKAGK+ VP
Sbjct: 67  RRLLRQHEEK--KQTGTSEEPDRGVVPAYLLDRQQQTTGKVLSSMIKQKRKEKAGKYQVP 124

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +P V+ +++ E FKVVKTGK R K WKRM+TK TFVG+ FTRKP K+ERFIRPM LR+KK
Sbjct: 125 IPTVKAVSDAEAFKVVKTGKTRRKGWKRMVTKVTFVGESFTRKPAKFERFIRPMGLRFKK 184

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF LPI+GVKKNP S LYT LGV+TKGT+IEVN+SELG+VT  GKVVW K
Sbjct: 185 AHVTHPELQTTFQLPIVGVKKNPSSSLYTSLGVITKGTIIEVNISELGMVTQGGKVVWAK 244

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTN+PENDGC+NAVLL+
Sbjct: 245 YAQVTNHPENDGCINAVLLL 264



>gi|402586319|gb|EJW80257.1| 30S ribosomal protein S8e, partial [Wuchereria bancrofti]
          Length = 258

 Score =  348 bits (893), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 203/260 (78%), Gaps = 3/260 (1%)

Query: 2   PQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIEM 61
           PQNE+IE   K+HGRRLDY            H  S +A+K+ G +AKLY+KKR+AEK+EM
Sbjct: 1   PQNEHIELHRKRHGRRLDYEERLRKRNARAGHEHSQYAKKIRGRKAKLYHKKRYAEKVEM 60

Query: 62  KKKIKQHQEKSTKQKDDQAVPE-GAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++ I+QH+EK  KQ      PE G +PAYLLDR+ Q   K+LS+MIKQKRKEKAGK+ VP
Sbjct: 61  RRLIRQHEEK--KQTGTSEEPERGVVPAYLLDRKQQTTGKVLSSMIKQKRKEKAGKYQVP 118

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           +P V+ +++ E FKVVKTGK R K WKRM+TK TFVG+ FTRKP K+ERFIRPM LR+KK
Sbjct: 119 IPTVKAVSDAEAFKVVKTGKTRRKGWKRMVTKVTFVGESFTRKPAKFERFIRPMGLRFKK 178

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL  TF LPI+GVKKNP S LYT LGV+TKGT+IEVN+SELG+VT  GKVVW K
Sbjct: 179 AHVTHPELQTTFQLPIVGVKKNPSSSLYTSLGVITKGTIIEVNISELGVVTQGGKVVWAK 238

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTN PENDGC+NAVLL+
Sbjct: 239 YAQVTNCPENDGCINAVLLL 258



>gi|45185638|ref|NP_983354.1| ribosome biogenesis protein NSA2 [Ashbya gossypii ATCC 10895]
 gi|74695050|sp|Q75CG9.1|NSA2_ASHGO RecName: Full=Ribosome biogenesis protein NSA2
 gi|44981356|gb|AAS51178.1| ACL050Wp [Ashbya gossypii ATCC 10895]
 gi|374106560|gb|AEY95469.1| FACL050Wp [Ashbya gossypii FDAG1]
          Length = 261

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 174/261 (66%), Positives = 203/261 (77%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IKKHGRRLD+            H  S  AQK+ G + K + KKR+AEK+ 
Sbjct: 1   MPQNEYIEQHIKKHGRRLDHEERKRKREAREAHKISEKAQKLTGWKGKQFAKKRYAEKVA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEG-AIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           M+KKIK H++   K         G A+PAYLLDRE    AK +S+ IKQKR EKA K++V
Sbjct: 61  MRKKIKAHEQSKLKGAAKPLEDSGEALPAYLLDREQANSAKAISSSIKQKRLEKADKFSV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PLPKVRGI+E+EMFKVVKTGK++TK WKRMITK TFVG+GFTR+P K ER IRP ALR K
Sbjct: 121 PLPKVRGISEEEMFKVVKTGKSKTKSWKRMITKHTFVGEGFTRRPVKMERIIRPSALRQK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPI+GVKKNPQSP+YTQLGVLTKGT+IEVNVSELG+VT+ GKVVWG
Sbjct: 181 KANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGMVTSGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQ+TN P+ DGCVNAVLLV
Sbjct: 241 KYAQITNEPDRDGCVNAVLLV 261



>gi|453088574|gb|EMF16614.1| ribosomal protein S8e [Mycosphaerella populorum SO2202]
          Length = 261

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 174/261 (66%), Positives = 197/261 (75%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K+HGRRLD+            H  S  AQ + G+RAKLY +KRH EKI+
Sbjct: 1   MPQNEYIERFTKQHGRRLDHEERTRKRAAREGHKASENAQNLRGLRAKLYQQKRHKEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IKQ +EK+ K  +        +P YLLDR     AK LS+ IK KR EKA K++VP
Sbjct: 61  MKKAIKQQEEKNVKSAEPAEPSSKPLPGYLLDRSNTTNAKALSSAIKNKRAEKAAKFSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQ-WKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           LPKVRGI+E EMFKVVKTGK   K+ WKRMITK TFVG  FTR+P KYERFIRPM LRYK
Sbjct: 121 LPKVRGISEQEMFKVVKTGKKTAKKSWKRMITKPTFVGPDFTRRPVKYERFIRPMGLRYK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPII VKKNPQ+P+YTQLGVLTKGT+IEVNVSELGLVT  GKVVWG
Sbjct: 181 KANVTHPELGVTVQLPIISVKKNPQNPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           ++AQ+TNN ENDGCVNAVLLV
Sbjct: 241 RWAQITNNCENDGCVNAVLLV 261



>gi|452847851|gb|EME49783.1| hypothetical protein DOTSEDRAFT_68530 [Dothistroma septosporum
           NZE10]
          Length = 261

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 173/261 (66%), Positives = 199/261 (76%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE   K+HGRRLD+            H  S  AQ + G+RAKL+ +KRH EKI+
Sbjct: 1   MPQNEYIERFTKQHGRRLDHEERVRKRAAREAHHASKDAQNLRGLRAKLHQQKRHKEKIQ 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           MKK IKQ +EK+ K  +        +P+YLLDR     AK LS+ IK KR EKA K++VP
Sbjct: 61  MKKAIKQQEEKNVKSSEPAQPSSTPLPSYLLDRSNTTNAKALSSAIKNKRAEKAAKFSVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQ-WKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           LPKVRGI+E+EMFKVVKTGK   K+ WKRMITK TFVG  FTR+P KYERFIRPM LRYK
Sbjct: 121 LPKVRGISEEEMFKVVKTGKKTAKKSWKRMITKPTFVGPDFTRRPVKYERFIRPMGLRYK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPII VKKNPQ+P+YTQLGVLTKGT+IEVNVSELGLVT  GKVVWG
Sbjct: 181 KANVTHPELGVTVQLPIISVKKNPQNPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           ++AQ+TNN ENDGCVNAVLLV
Sbjct: 241 RWAQITNNCENDGCVNAVLLV 261



>gi|170593877|ref|XP_001901690.1| TGF beta-inducible nuclear protein 1 [Brugia malayi]
 gi|158590634|gb|EDP29249.1| TGF beta-inducible nuclear protein 1, putative [Brugia malayi]
          Length = 293

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 169/261 (64%), Positives = 204/261 (78%), Gaps = 3/261 (1%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNE+IE   K+HGRRLDY            H  S +A+K+ G +AKLY+KKR+AEK+E
Sbjct: 35  MPQNEHIELHRKRHGRRLDYEERLRKRNARAGHEHSQYAKKIRGRKAKLYHKKRYAEKVE 94

Query: 61  MKKKIKQHQEKSTKQKDDQAVPE-GAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           M++ ++QH+EK  KQ      PE G +PAYLLDR+ Q   K+LS+MIKQKRKEKAGK+ V
Sbjct: 95  MRRLLRQHEEK--KQTGTSEEPERGVVPAYLLDRKQQTTGKVLSSMIKQKRKEKAGKYQV 152

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           P+P V+ +++ E FKVVKTGK R K WKRM+TK TFVG+ FTRKP K+ERFIRPM LR+K
Sbjct: 153 PIPTVKAVSDAEAFKVVKTGKTRRKGWKRMVTKVTFVGESFTRKPAKFERFIRPMGLRFK 212

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KAHVTHPEL  TF LPI+GVKKNP S LYT LGV+TKGT+IEVN+SELG+VT  GKVVW 
Sbjct: 213 KAHVTHPELQTTFQLPIVGVKKNPSSSLYTSLGVITKGTIIEVNISELGVVTQGGKVVWA 272

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQVTN PENDGC+NAVLL+
Sbjct: 273 KYAQVTNCPENDGCINAVLLL 293



>gi|406604901|emb|CCH43678.1| Ribosome biogenesis protein [Wickerhamomyces ciferrii]
          Length = 261

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 173/261 (66%), Positives = 203/261 (77%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IK+HGRRLD+            H  +  AQ + G RAK +NKKR+AEK+ 
Sbjct: 1   MPQNEYIEQHIKQHGRRLDHEERKRKKLAREGHRVAKDAQTLTGWRAKQFNKKRYAEKVA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEG-AIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           +KKKIK H+E   K        +G A+P YLLDR+ Q  AK +S+ IKQKR EKA K++V
Sbjct: 61  LKKKIKAHEESKVKGPTAPVEDDGEALPTYLLDRQDQNSAKAISSSIKQKRMEKADKFSV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PLPKVRGI+E+EMFKVVKTGK+++K WKRMITK TFVG+GFTR+P K ER IRP ALR K
Sbjct: 121 PLPKVRGISEEEMFKVVKTGKSKSKAWKRMITKHTFVGEGFTRRPVKMERIIRPSALRQK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPI+ VKKNPQSP+YTQLGVLTKGT+IEVNVSELG+VT  GKVVWG
Sbjct: 181 KANVTHPELGVTVFLPILAVKKNPQSPMYTQLGVLTKGTIIEVNVSELGMVTAGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQVTN P+ DGCVNAVLLV
Sbjct: 241 KYAQVTNEPDRDGCVNAVLLV 261



>gi|407404076|gb|EKF29702.1| 40S ribosomal protein S8, putative [Trypanosoma cruzi marinkellei]
          Length = 260

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 165/260 (63%), Positives = 206/260 (79%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE + K++GRRLD+            H+ +   + V GI+AK+ +K+R+AEK E
Sbjct: 1   MPQNEYIELAQKRYGRRLDHAERTRKRDARKAHTQAKHLRTVRGIKAKIASKRRYAEKAE 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEGAIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNVP 120
           ++KKI++H+EK T ++  +  P+ A+P++L+DR    RAK+LSN +KQKRKEKAGKW VP
Sbjct: 61  IRKKIREHEEKETTERVKEKGPKNALPSFLMDRSVADRAKVLSNSLKQKRKEKAGKWAVP 120

Query: 121 LPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYKK 180
           + KV+ ++EDEM K V +GK   K WKRM+ K TFVG+ FTR+ PK+ERFIRPMALR+KK
Sbjct: 121 IEKVKPVSEDEMMKAVTSGKRGKKSWKRMVNKVTFVGETFTRRMPKHERFIRPMALRFKK 180

Query: 181 AHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWGK 240
           AHVTHPEL ATF LPIIGVKKNPQ  +YT LGV+TKGTVIEVNVS+LGLVT SGKVVWGK
Sbjct: 181 AHVTHPELKATFHLPIIGVKKNPQGKMYTGLGVITKGTVIEVNVSDLGLVTPSGKVVWGK 240

Query: 241 YAQVTNNPENDGCVNAVLLV 260
           YAQVTNNPENDGC+NAVLLV
Sbjct: 241 YAQVTNNPENDGCINAVLLV 260



>gi|513031190|gb|AGO11214.1| AaceriACL050Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 261

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 174/261 (66%), Positives = 202/261 (77%), Gaps = 1/261 (0%)

Query: 1   MPQNEYIEESIKKHGRRLDYXXXXXXXXXXXXHSTSAFAQKVHGIRAKLYNKKRHAEKIE 60
           MPQNEYIE+ IKKHGRRLD+            H  S  AQK+ G + K + KKR+AEK+ 
Sbjct: 1   MPQNEYIEQHIKKHGRRLDHEERKRKREAREAHKISEKAQKLTGWKGKQFAKKRYAEKVA 60

Query: 61  MKKKIKQHQEKSTKQKDDQAVPEG-AIPAYLLDREGQKRAKILSNMIKQKRKEKAGKWNV 119
           M+KKIK H++   K         G A+PAYLLDRE    AK +S+ IKQKR EKA K++V
Sbjct: 61  MRKKIKAHEQSKLKGAAKPLEDSGEALPAYLLDREQTNSAKAISSSIKQKRLEKADKFSV 120

Query: 120 PLPKVRGIAEDEMFKVVKTGKNRTKQWKRMITKATFVGDGFTRKPPKYERFIRPMALRYK 179
           PLPKVRGI+E+EMFKVVKTGK++TK WKRMITK TFVG+GFTR+P K ER IRP ALR K
Sbjct: 121 PLPKVRGISEEEMFKVVKTGKSKTKSWKRMITKHTFVGEGFTRRPVKMERIIRPSALRQK 180

Query: 180 KAHVTHPELGATFCLPIIGVKKNPQSPLYTQLGVLTKGTVIEVNVSELGLVTTSGKVVWG 239
           KA+VTHPELG T  LPI+GVKKNPQSP+YTQLGVLTKGT+IEVNVSELG+VT  GKVVWG
Sbjct: 181 KANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGMVTAGGKVVWG 240

Query: 240 KYAQVTNNPENDGCVNAVLLV 260
           KYAQ+TN P+ DGCVNAVLLV
Sbjct: 241 KYAQITNEPDRDGCVNAVLLV 261