BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10368_c0_seq1-m.143 complete 369-1601(-) 411 (-)
         (410 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|19111963|ref|NP_595171.1| G2/M B-type cyclin Cdc13 [Schizosac...   389   e-106   Schizosaccharomyces pombe 972h-
gi|213408975|ref|XP_002175258.1| G2/mitotic-specific cyclin cdc1...   375   e-102   Schizosaccharomyces japonicus yFS275
gi|501752399|emb|CCG83623.1| Cyclin B [Taphrina deformans PYCC 5...   365   1e-98   Taphrina deformans PYCC 5710
gi|430812163|emb|CCJ30385.1| unnamed protein product [Pneumocyst...   362   2e-97   Pneumocystis jirovecii
gi|388582888|gb|EIM23191.1| G2/M-specific cyclin NimE [Wallemia ...   357   2e-96   Wallemia mellicola CBS 633.66
gi|328772487|gb|EGF82525.1| hypothetical protein BATDEDRAFT_1593...   356   6e-96   Batrachochytrium dendrobatidis JAM81
gi|505760096|gb|EOR04170.1| G2/mitotic-specific cyclin cdc13 [Wa...   353   4e-95   Wallemia ichthyophaga EXF-994
gi|3901362|gb|AAC78639.1| cyclin B [Pneumocystis carinii]             353   5e-95   Pneumocystis carinii
gi|501302997|dbj|GAC92516.1| hypothetical protein PHSY_000070 [P...   353   6e-95   Pseudozyma hubeiensis SY62
gi|3860081|gb|AAC72972.1| cell division cycle protein Cdc13 [Pne...   352   8e-95   Pneumocystis carinii
gi|343424831|emb|CBQ68369.1| probable Clb1-B-type cyclin 1 [Spor...   352   9e-95   Sporisorium reilianum SRZ2
gi|470316495|gb|EMR08249.1| hypothetical protein PNEG_03416 [Pne...   350   3e-94   Pneumocystis murina B123
gi|443896858|dbj|GAC74201.1| cyclin B and related kinase-activat...   349   9e-94   Moesziomyces antarcticus T-34
gi|189189570|ref|XP_001931124.1| G2/mitotic-specific cyclin CYB1...   348   2e-93   Pyrenophora tritici-repentis Pt-1C-BFP
gi|452988416|gb|EME88171.1| hypothetical protein MYCFIDRAFT_8600...   348   2e-93   Cercospora fijiensis CIRAD86
gi|169608081|ref|XP_001797460.1| hypothetical protein SNOG_07107...   347   4e-93   Parastagonospora nodorum SN15
gi|330938255|ref|XP_003305714.1| hypothetical protein PTT_18629 ...   347   4e-93   Pyrenophora teres f. teres 0-1
gi|451999197|gb|EMD91660.1| hypothetical protein COCHEDRAFT_1156...   347   5e-93   Bipolaris maydis C5
gi|451848164|gb|EMD61470.1| hypothetical protein COCSADRAFT_2318...   347   5e-93   Bipolaris sorokiniana ND90Pr
gi|407924550|gb|EKG17586.1| Cyclin [Macrophomina phaseolina MS6]      346   7e-93   Macrophomina phaseolina MS6
gi|482805063|gb|EOA82162.1| hypothetical protein SETTUDRAFT_2340...   346   8e-93   Setosphaeria turcica Et28A
gi|405122876|gb|AFR97642.1| g2/mitotic-specific cyclin cdc13 [Cr...   346   8e-93   Cryptococcus neoformans var. grubii H99
gi|58259721|ref|XP_567273.1| g2/mitotic-specific cyclin cdc13 [C...   346   9e-93   Cryptococcus neoformans var. neoformans JEC21
gi|37706314|gb|AAR01624.1| cyclin [Cryptococcus neoformans var. ...   346   9e-93   Cryptococcus neoformans var. neoformans
gi|342319260|gb|EGU11210.1| G2/mitotic-specific cyclin CYB1 [Rho...   345   1e-92   Rhodotorula toruloides ATCC 204091
gi|472584134|gb|EMS21740.1| G2/mitotic-specific cyclin 1/2 [Rhod...   345   1e-92   Rhodotorula toruloides NP11
gi|388855945|emb|CCF50520.1| probable b-type cyclin 1 [Ustilago ...   344   3e-92   Ustilago hordei
gi|321258490|ref|XP_003193966.1| g2/mitotic-specific cyclin cdc1...   344   3e-92   Cryptococcus gattii WM276
gi|485921531|gb|EOD47223.1| putative g2 mitotic-specific cyclin-...   344   3e-92   Neofusicoccum parvum UCRNP2
gi|396463102|ref|XP_003836162.1| similar to G2/mitotic-specific ...   343   4e-92   Leptosphaeria maculans JN3
gi|512202738|gb|EPE31564.1| Cyclin-like protein [Glarea lozoyens...   343   4e-92   Glarea lozoyensis ATCC 20868
gi|475668917|gb|EMT66703.1| G2/mitotic-specific cyclin-B [Fusari...   340   3e-91   Fusarium oxysporum f. sp. cubense race 4
gi|342890451|gb|EGU89269.1| hypothetical protein FOXB_00222 [Fus...   340   4e-91   Fusarium oxysporum Fo5176
gi|345570476|gb|EGX53297.1| hypothetical protein AOL_s00006g163 ...   340   4e-91   Arthrobotrys oligospora ATCC 24927
gi|350296750|gb|EGZ77727.1| G2/mitotic-specific cyclin-B [Neuros...   340   6e-91   Neurospora tetrasperma FGSC 2509
gi|398411878|ref|XP_003857273.1| hypothetical protein MYCGRDRAFT...   340   7e-91   Zymoseptoria tritici IPO323
gi|336464652|gb|EGO52892.1| G2/mitotic-specific cyclin-B [Neuros...   339   7e-91   Neurospora tetrasperma FGSC 2508
gi|392587877|gb|EIW77210.1| hypothetical protein CONPUDRAFT_1294...   339   9e-91   Coniophora puteana RWD-64-598 SS2
gi|500254274|gb|EON97882.1| putative g2 mitotic-specific cyclin-...   338   1e-90   Phaeoacremonium minimum UCRPA7
gi|85111257|ref|XP_963851.1| G2/mitotic-specific cyclin-B [Neuro...   338   2e-90   Neurospora crassa OR74A
gi|452848135|gb|EME50067.1| hypothetical protein DOTSEDRAFT_6880...   338   2e-90   Dothistroma septosporum NZE10
gi|242768883|ref|XP_002341657.1| G2/M-specific cyclin NimE [Tala...   338   2e-90   Talaromyces stipitatus ATCC 10500
gi|302925436|ref|XP_003054095.1| predicted protein [Nectria haem...   336   6e-90   Nectria haematococca mpVI 77-13-4
gi|336272395|ref|XP_003350954.1| hypothetical protein SMAC_04258...   336   8e-90   Sordaria macrospora k-hell
gi|440637904|gb|ELR07823.1| hypothetical protein GMDG_00444 [Geo...   335   1e-89   Pseudogymnoascus destructans 20631-21
gi|322694995|gb|EFY86811.1| G2/mitotic-specific cyclin-B [Metarh...   335   1e-89   Metarhizium acridum CQMa 102
gi|390599433|gb|EIN08829.1| A/B/D/E cyclin [Punctularia strigoso...   335   1e-89   Punctularia strigosozonata HHB-11173 SS5
gi|225682743|gb|EEH21027.1| G2/mitotic-specific cyclin CYB1 [Par...   335   1e-89   Paracoccidioides brasiliensis Pb03
gi|226290181|gb|EEH45665.1| G2/mitotic-specific cyclin-B [Paraco...   335   1e-89   Paracoccidioides brasiliensis Pb18
gi|453089144|gb|EMF17184.1| A/B/D/E cyclin [Mycosphaerella popul...   335   2e-89   Sphaerulina musiva SO2202
gi|259481818|tpe|CBF75695.1| TPA: G2/mitotic-specific cyclin-B [...   335   2e-89   Aspergillus nidulans FGSC A4
gi|326484581|gb|EGE08591.1| G2/mitotic-specific cyclin-B [Tricho...   335   2e-89   Trichophyton equinum CBS 127.97
gi|67526381|ref|XP_661252.1| CG21_EMENI G2/mitotic-specific cycl...   335   2e-89   Aspergillus nidulans FGSC A4
gi|171680297|ref|XP_001905094.1| hypothetical protein [Podospora...   334   3e-89   Podospora anserina S mat+
gi|46108818|ref|XP_381467.1| hypothetical protein FG01291.1 [Fus...   334   4e-89   
gi|295669528|ref|XP_002795312.1| G2/mitotic-specific cyclin-B [P...   333   4e-89   Paracoccidioides lutzii Pb01
gi|494824149|gb|EON61468.1| hypothetical protein W97_00683 [Coni...   333   5e-89   Coniosporium apollinis CBS 100218
gi|408388548|gb|EKJ68231.1| hypothetical protein FPSE_11602 [Fus...   333   5e-89   Fusarium pseudograminearum CS3096
gi|315042678|ref|XP_003170715.1| G2/mitotic-specific cyclin-B [A...   333   5e-89   Microsporum gypseum CBS 118893
gi|367043426|ref|XP_003652093.1| hypothetical protein THITE_2113...   333   6e-89   Thielavia terrestris NRRL 8126
gi|116206914|ref|XP_001229266.1| hypothetical protein CHGG_02750...   333   6e-89   Chaetomium globosum CBS 148.51
gi|326475660|gb|EGD99669.1| G2/M-specific cyclin NimE [Trichophy...   333   6e-89   Trichophyton tonsurans CBS 112818
gi|255947596|ref|XP_002564565.1| Pc22g05300 [Penicillium chrysog...   333   8e-89   Penicillium rubens Wisconsin 54-1255
gi|358378739|gb|EHK16420.1| hypothetical protein TRIVIDRAFT_1837...   332   1e-88   Trichoderma virens Gv29-8
gi|239613461|gb|EEQ90448.1| nime/cyclinb [Ajellomyces dermatitid...   332   1e-88   Blastomyces dermatitidis ER-3
gi|327355038|gb|EGE83895.1| G2/M-specific cyclin NimE [Ajellomyc...   332   1e-88   Blastomyces dermatitidis ATCC 18188
gi|471568210|gb|EMR67929.1| putative g2 mitotic-specific cyclin-...   332   1e-88   Eutypa lata UCREL1
gi|261194631|ref|XP_002623720.1| G2/M-specific cyclin NimE [Ajel...   332   1e-88   Blastomyces gilchristii SLH14081
gi|425766179|gb|EKV04804.1| G2/M-specific cyclin NimE [Penicilli...   332   1e-88   Penicillium digitatum Pd1
gi|156053169|ref|XP_001592511.1| hypothetical protein SS1G_06752...   331   2e-88   Sclerotinia sclerotiorum 1980 UF-70
gi|340520334|gb|EGR50570.1| predicted protein [Trichoderma reese...   331   2e-88   Trichoderma reesei QM6a
gi|327295590|ref|XP_003232490.1| G2/M-specific cyclin NimE [Tric...   331   2e-88   Trichophyton rubrum CBS 118892
gi|340992774|gb|EGS23329.1| G2/M cyclins accumulate steadily dur...   331   3e-88   Chaetomium thermophilum var. thermophilum DSM 1495
gi|154318239|ref|XP_001558438.1| hypothetical protein BC1G_03287...   331   3e-88   Botrytis cinerea B05.10
gi|296807933|ref|XP_002844305.1| nime/cyclinb [Arthroderma otae ...   331   3e-88   Arthroderma otae CBS 113480
gi|320589047|gb|EFX01515.1| g2 mitotic-specific cyclin-b [Grosma...   330   4e-88   Grosmannia clavigera kw1407
gi|402086426|gb|EJT81324.1| G2/mitotic-specific cyclin-B [Gaeuma...   330   4e-88   Gaeumannomyces graminis var. tritici R3-111a-1
gi|399164713|emb|CCE34407.1| probable G2/mitotic-specific cyclin...   330   5e-88   Claviceps purpurea 20.1
gi|380488482|emb|CCF37342.1| cyclin, partial [Colletotrichum hig...   330   5e-88   Colletotrichum higginsianum
gi|310793248|gb|EFQ28709.1| cyclin domain-containing protein [Gl...   330   5e-88   Colletotrichum graminicola M1.001
gi|477525207|gb|ENH77122.1| g2 mitotic-specific cyclin-b [Collet...   330   5e-88   Colletotrichum orbiculare MAFF 240422
gi|512188916|gb|EPE04685.1| g2 mitotic-specific cyclin-b [Ophios...   328   1e-87   Ophiostoma piceae UAMH 11346
gi|449543795|gb|EMD34770.1| hypothetical protein CERSUDRAFT_1169...   328   2e-87   Gelatoporia subvermispora B
gi|389740963|gb|EIM82153.1| A/B/D/E cyclin, partial [Stereum hir...   328   3e-87   Stereum hirsutum FP-91666 SS1
gi|71019349|ref|XP_759905.1| hypothetical protein UM03758.1 [Ust...   327   4e-87   
gi|409047567|gb|EKM57046.1| hypothetical protein PHACADRAFT_2545...   327   5e-87   Phanerochaete carnosa HHB-10118-sp
gi|406858966|gb|EKD12044.1| G2/mitotic-specific cyclin-B [Marsso...   327   5e-87   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|392578168|gb|EIW71296.1| hypothetical protein TREMEDRAFT_3772...   325   1e-86   Tremella mesenterica DSM 1558
gi|225559765|gb|EEH08047.1| G2/mitotic-specific cyclin-B [Ajello...   325   1e-86   Histoplasma capsulatum G186AR
gi|169867711|ref|XP_001840434.1| g2/mitotic-specific cyclin cdc1...   325   1e-86   Coprinopsis cinerea okayama7#130
gi|426194696|gb|EKV44627.1| hypothetical protein AGABI2DRAFT_194...   325   2e-86   Agaricus bisporus var. bisporus H97
gi|358391194|gb|EHK40598.1| hypothetical protein TRIATDRAFT_3014...   325   2e-86   Trichoderma atroviride IMI 206040
gi|409075274|gb|EKM75656.1| hypothetical protein AGABI1DRAFT_116...   325   2e-86   Agaricus bisporus var. burnettii JB137-S8
gi|429863631|gb|ELA38054.1| g2 mitotic-specific cyclin-b [Collet...   324   2e-86   Colletotrichum gloeosporioides Nara gc5
gi|367020424|ref|XP_003659497.1| hypothetical protein MYCTH_2296...   324   3e-86   Myceliophthora thermophila ATCC 42464
gi|322711525|gb|EFZ03098.1| G2/mitotic-specific cyclin-B [Metarh...   323   5e-86   
gi|400595249|gb|EJP63056.1| cyclin domain-containing protein [Be...   323   7e-86   Beauveria bassiana ARSEF 2860
gi|346326892|gb|EGX96488.1| G2/mitotic-specific cyclin-B [Cordyc...   323   7e-86   Cordyceps militaris CM01
gi|302502557|ref|XP_003013248.1| hypothetical protein ARB_00433 ...   323   8e-86   Arthroderma benhamiae CBS 112371
gi|378729606|gb|EHY56065.1| G2/mitotic-specific cyclin-B [Exophi...   322   9e-86   Exophiala dermatitidis NIH/UT8656
gi|302663034|ref|XP_003023165.1| hypothetical protein TRV_02687 ...   322   1e-85   Trichophyton verrucosum HKI 0517
gi|336375237|gb|EGO03573.1| hypothetical protein SERLA73DRAFT_16...   321   2e-85   Serpula lacrymans var. lacrymans S7.3
gi|212542423|ref|XP_002151366.1| G2/M-specific cyclin NimE [Tala...   321   2e-85   Talaromyces marneffei ATCC 18224
gi|336388249|gb|EGO29393.1| hypothetical protein SERLADRAFT_4129...   320   3e-85   Serpula lacrymans var. lacrymans S7.9
gi|212542425|ref|XP_002151367.1| G2/M-specific cyclin NimE [Tala...   320   3e-85   Talaromyces marneffei ATCC 18224
gi|361130671|gb|EHL02421.1| putative G2/mitotic-specific cyclin-...   320   5e-85   Glarea lozoyensis 74030
gi|119194543|ref|XP_001247875.1| hypothetical protein CIMG_01646...   319   9e-85   Coccidioides immitis RS
gi|240276364|gb|EER39876.1| G2/mitotic-specific cyclin-B [Ajello...   319   1e-84   Histoplasma capsulatum H143
gi|303311187|ref|XP_003065605.1| G2/mitotic-specific cyclin B, p...   319   1e-84   Coccidioides posadasii C735 delta SOWgp
gi|389625769|ref|XP_003710538.1| G2/mitotic-specific cyclin-B [M...   317   3e-84   Magnaporthe oryzae 70-15
gi|159125460|gb|EDP50577.1| G2/M-specific cyclin NimE [Aspergill...   317   5e-84   Aspergillus fumigatus A1163
gi|146323859|ref|XP_751615.2| G2/M-specific cyclin NimE [Aspergi...   317   6e-84   Aspergillus fumigatus Af293
gi|395331486|gb|EJF63867.1| hypothetical protein DICSQDRAFT_8235...   316   8e-84   Dichomitus squalens LYAD-421 SS1
gi|121708239|ref|XP_001272070.1| G2/M-specific cyclin NimE [Aspe...   315   1e-83   Aspergillus clavatus NRRL 1
gi|465792436|emb|CCU97546.1| unnamed protein product [Malassezia...   315   1e-83   Malassezia sympodialis ATCC 42132
gi|449304900|gb|EMD00907.1| hypothetical protein BAUCODRAFT_1186...   315   2e-83   Baudoinia panamericana UAMH 10762
gi|164658149|ref|XP_001730200.1| hypothetical protein MGL_2582 [...   315   2e-83   Malassezia globosa CBS 7966
gi|320039428|gb|EFW21362.1| G2/M-specific cyclin NimE [Coccidioi...   315   2e-83   Coccidioides posadasii str. Silveira
gi|190348407|gb|EDK40854.2| hypothetical protein PGUG_04952 [Mey...   314   3e-83   Meyerozyma guilliermondii ATCC 6260
gi|258567878|ref|XP_002584683.1| G2/mitotic-specific cyclin-B [U...   314   4e-83   Uncinocarpus reesii 1704
gi|443919123|gb|ELU39381.1| g2/mitotic-specific cyclin cdc13 [Rh...   314   4e-83   Rhizoctonia solani AG-1 IA
gi|134055276|emb|CAK96166.1| unnamed protein product [Aspergillu...   313   4e-83   Aspergillus niger
gi|317025479|ref|XP_001389166.2| G2/mitotic-specific cyclin-B [A...   313   4e-83   Aspergillus niger CBS 513.88
gi|115391051|ref|XP_001213030.1| G2/mitotic-specific cyclin-B [A...   313   5e-83   Aspergillus terreus NIH2624
gi|358367025|dbj|GAA83645.1| G2/mitotic-specific cyclin-B [Asper...   313   5e-83   Aspergillus kawachii IFO 4308
gi|392562359|gb|EIW55539.1| A/B/D/E cyclin [Trametes versicolor ...   312   9e-83   Trametes versicolor FP-101664 SS1
gi|391873667|gb|EIT82687.1| cyclin B [Aspergillus oryzae 3.042]       311   2e-82   Aspergillus oryzae 3.042
gi|317144414|ref|XP_001820104.2| G2/mitotic-specific cyclin-B [A...   311   2e-82   Aspergillus oryzae RIB40
gi|406605761|emb|CCH42864.1| G2/mitotic-specific cyclin cdc13 [W...   311   2e-82   Wickerhamomyces ciferrii
gi|83767963|dbj|BAE58102.1| unnamed protein product [Aspergillus...   311   2e-82   Aspergillus oryzae RIB40
gi|448096908|ref|XP_004198544.1| Piso0_001920 [Millerozyma farin...   310   4e-82   Millerozyma farinosa CBS 7064
gi|448110926|ref|XP_004201721.1| Piso0_001920 [Millerozyma farin...   310   7e-82   Millerozyma farinosa CBS 7064
gi|471901968|emb|CCO29823.1| G2/mitotic-specific cyclin cdc13 [R...   309   9e-82   Rhizoctonia solani AG-1 IB
gi|50405559|ref|XP_456415.1| DEHA2A01760p [Debaryomyces hansenii...   309   1e-81   Debaryomyces hansenii CBS767
gi|406701613|gb|EKD04729.1| g2/mitotic-specific cyclin cdc13 [Tr...   308   2e-81   Trichosporon asahii var. asahii CBS 8904
gi|328857548|gb|EGG06664.1| hypothetical protein MELLADRAFT_4346...   307   3e-81   Melampsora larici-populina 98AG31
gi|403414025|emb|CCM00725.1| predicted protein [Fibroporia radic...   307   4e-81   Fibroporia radiculosa
gi|119500124|ref|XP_001266819.1| G2/M-specific cyclin NimE [Neos...   306   6e-81   Aspergillus fischeri NRRL 181
gi|358058255|dbj|GAA95932.1| hypothetical protein E5Q_02590 [Mix...   306   6e-81   Mixia osmundae IAM 14324
gi|459373877|gb|EMG50962.1| G2/mitotic-specific cyclin CYB1, par...   305   1e-80   Candida maltosa Xu316
gi|393219901|gb|EJD05387.1| hypothetical protein FOMMEDRAFT_1388...   305   1e-80   Fomitiporia mediterranea MF3/22
gi|401881453|gb|EJT45753.1| g2/mitotic-specific cyclin cdc13 [Tr...   305   2e-80   Trichosporon asahii var. asahii CBS 2479
gi|149248462|ref|XP_001528618.1| conserved hypothetical protein ...   305   2e-80   Lodderomyces elongisporus NRRL YB-4239
gi|255723996|ref|XP_002546927.1| G2/mitotic-specific cyclin CYB1...   303   4e-80   Candida tropicalis MYA-3404
gi|146414053|ref|XP_001482997.1| hypothetical protein PGUG_04952...   303   6e-80   Meyerozyma guilliermondii ATCC 6260
gi|403166750|ref|XP_003326611.2| G2/mitotic-specific cyclin 1/2 ...   300   4e-79   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|448514616|ref|XP_003867157.1| Clb2 B-type mitotic cyclin (cyc...   300   4e-79   Candida orthopsilosis Co 90-125
gi|320580090|gb|EFW94313.1| B-type cyclin [Ogataea parapolymorph...   300   5e-79   
gi|238486190|ref|XP_002374333.1| G2/M-specific cyclin NimE [Aspe...   299   9e-79   Aspergillus flavus NRRL3357
gi|50307537|ref|XP_453748.1| hypothetical protein [Kluyveromyces...   298   1e-78   Kluyveromyces lactis NRRL Y-1140
gi|344303249|gb|EGW33523.1| hypothetical protein SPAPADRAFT_6086...   298   2e-78   Spathaspora passalidarum NRRL Y-27907
gi|336370345|gb|EGN98685.1| hypothetical protein SERLA73DRAFT_18...   298   3e-78   Serpula lacrymans var. lacrymans S7.3
gi|50546897|ref|XP_500918.1| YALI0B15180p [Yarrowia lipolytica] ...   298   3e-78   Yarrowia lipolytica CLIB122
gi|45184922|ref|NP_982640.1| AAR099Wp [Ashbya gossypii ATCC 1089...   298   3e-78   Eremothecium gossypii ATCC 10895
gi|374105839|gb|AEY94750.1| FAAR099Wp [Ashbya gossypii FDAG1]         297   3e-78   Eremothecium gossypii FDAG1
gi|513030045|gb|AGO10089.1| AaceriAAR099Wp [Saccharomycetaceae s...   297   4e-78   Saccharomycetaceae sp. 'Ashbya aceri'
gi|50547241|ref|XP_501090.1| YALI0B19206p [Yarrowia lipolytica] ...   296   7e-78   Yarrowia lipolytica CLIB122
gi|354547027|emb|CCE43760.1| hypothetical protein CPAR2_214040 [...   296   7e-78   Candida parapsilosis
gi|363752153|ref|XP_003646293.1| hypothetical protein Ecym_4429 ...   296   1e-77   Eremothecium cymbalariae DBVPG#7215
gi|511007021|gb|EPB88323.1| G2/mitotic-specific cyclin 1/2 [Muco...   295   2e-77   Mucor circinelloides f. circinelloides 1006PhL
gi|393247224|gb|EJD54732.1| A/B/D/E cyclin [Auricularia delicata...   294   3e-77   Auricularia subglabra TFB-10046 SS5
gi|299749762|ref|XP_001836312.2| cyclin [Coprinopsis cinerea oka...   293   5e-77   Coprinopsis cinerea okayama7#130
gi|443894528|dbj|GAC71876.1| hypothetical protein PANT_5d00112 [...   292   1e-76   Moesziomyces antarcticus T-34
gi|58267898|ref|XP_571105.1| cyclin-dependent protein kinase reg...   292   1e-76   Cryptococcus neoformans var. neoformans JEC21
gi|134112383|ref|XP_775167.1| hypothetical protein CNBE4400 [Cry...   292   1e-76   Cryptococcus neoformans var. neoformans B-3501A
gi|392870101|gb|EAS27260.2| G2/mitotic-specific cyclin cdc13 [Co...   292   2e-76   
gi|385304656|gb|EIF48665.1| putative g2 b-type cyclin [Dekkera b...   291   2e-76   Brettanomyces bruxellensis AWRI1499
gi|258566718|ref|XP_002584103.1| G2/mitotic-specific cyclin 3 [U...   291   2e-76   Uncinocarpus reesii 1704
gi|405120953|gb|AFR95723.1| cyclin [Cryptococcus neoformans var....   291   3e-76   Cryptococcus neoformans var. grubii H99
gi|321259415|ref|XP_003194428.1| cyclin-dependent protein kinase...   291   3e-76   Cryptococcus gattii WM276
gi|320037767|gb|EFW19704.1| G2/mitotic-specific cyclin-B1 [Cocci...   291   3e-76   Coccidioides posadasii str. Silveira
gi|303314823|ref|XP_003067420.1| cyclin domain containing protei...   290   4e-76   Coccidioides posadasii C735 delta SOWgp
gi|388853627|emb|CCF52799.1| probable b-type cyclin 2 [Ustilago ...   290   4e-76   Ustilago hordei
gi|366988667|ref|XP_003674101.1| hypothetical protein NCAS_0A116...   290   5e-76   Naumovozyma castellii CBS 4309
gi|6325376|ref|NP_015444.1| Clb2p [Saccharomyces cerevisiae S288...   290   7e-76   Saccharomyces cerevisiae S288c
gi|393242173|gb|EJD49692.1| hypothetical protein AURDEDRAFT_5933...   289   8e-76   Auricularia subglabra TFB-10046 SS5
gi|388579640|gb|EIM19962.1| hypothetical protein WALSEDRAFT_3003...   289   8e-76   Wallemia mellicola CBS 633.66
gi|343429395|emb|CBQ72968.1| b-type cyclin 2 [Sporisorium reilia...   289   1e-75   Sporisorium reilianum SRZ2
gi|296419994|ref|XP_002839571.1| hypothetical protein [Tuber mel...   289   1e-75   Tuber melanosporum Mel28
gi|426199341|gb|EKV49266.1| hypothetical protein AGABI2DRAFT_134...   288   2e-75   Agaricus bisporus var. bisporus H97
gi|401623164|gb|EJS41271.1| clb2p [Saccharomyces arboricola H-6]      288   2e-75   Saccharomyces arboricola H-6
gi|255714853|ref|XP_002553708.1| KLTH0E05192p [Lachancea thermot...   288   2e-75   Lachancea thermotolerans CBS 6340
gi|409078350|gb|EKM78713.1| hypothetical protein AGABI1DRAFT_856...   288   2e-75   Agaricus bisporus var. burnettii JB137-S8
gi|403213919|emb|CCK68421.1| hypothetical protein KNAG_0A07680 [...   288   2e-75   Kazachstania naganishii CBS 8797
gi|344233975|gb|EGV65845.1| hypothetical protein CANTEDRAFT_1186...   288   3e-75   Candida tenuis ATCC 10573
gi|150864121|ref|XP_001382825.2| G2/mitotic-specific cyclin [Sch...   287   4e-75   Scheffersomyces stipitis CBS 6054
gi|344233976|gb|EGV65846.1| A/B/D/E cyclin [Candida tenuis ATCC ...   287   4e-75   Candida tenuis ATCC 10573
gi|238488495|ref|XP_002375485.1| G2/mitotic-specific cyclin (Clb...   287   4e-75   Aspergillus flavus NRRL3357
gi|317136730|ref|XP_001727241.2| G2/mitotic-specific cyclin [Asp...   287   4e-75   Aspergillus oryzae RIB40
gi|83770269|dbj|BAE60402.1| unnamed protein product [Aspergillus...   287   4e-75   Aspergillus oryzae RIB40
gi|392574233|gb|EIW67370.1| hypothetical protein TREMEDRAFT_4050...   287   4e-75   Tremella mesenterica DSM 1558
gi|367015716|ref|XP_003682357.1| hypothetical protein TDEL_0F033...   287   5e-75   Torulaspora delbrueckii
gi|505760579|gb|EOR04644.1| G2/mitotic-specific cyclin cdc13 [Wa...   286   6e-75   Wallemia ichthyophaga EXF-994
gi|485923574|gb|EOD48693.1| putative g2 mitotic-specific cyclin ...   286   7e-75   Neofusicoccum parvum UCRNP2
gi|327352501|gb|EGE81358.1| G2/mitotic-specific cyclin cdc13 [Aj...   286   8e-75   
gi|296416356|ref|XP_002837846.1| hypothetical protein [Tuber mel...   286   9e-75   Tuber melanosporum Mel28
gi|240278503|gb|EER42009.1| G2/mitotic-specific cyclin cdc13 [Aj...   286   1e-74   Histoplasma capsulatum H143
gi|115388003|ref|XP_001211507.1| G2/mitotic-specific cyclin cdc1...   286   1e-74   Aspergillus terreus NIH2624
gi|50286369|ref|XP_445613.1| hypothetical protein [Candida glabr...   286   1e-74   Candida glabrata CBS 138
gi|410075059|ref|XP_003955112.1| hypothetical protein KAFR_0A054...   286   1e-74   Kazachstania africana CBS 2517
gi|472585584|gb|EMS23135.1| G2/mitotic-specific cyclin 3/4 [Rhod...   285   1e-74   Rhodotorula toruloides NP11
gi|336266658|ref|XP_003348096.1| hypothetical protein SMAC_03942...   285   1e-74   Sordaria macrospora k-hell
gi|407927499|gb|EKG20391.1| Cyclin [Macrophomina phaseolina MS6]      285   1e-74   Macrophomina phaseolina MS6
gi|512192134|gb|EPE07894.1| g2 mitotic-specific cyclin [Ophiosto...   285   2e-74   Ophiostoma piceae UAMH 11346
gi|154275998|ref|XP_001538844.1| hypothetical protein HCAG_06449...   285   2e-74   Histoplasma capsulatum NAm1
gi|444319955|ref|XP_004180634.1| hypothetical protein TBLA_0E005...   285   2e-74   Tetrapisispora blattae CBS 6284
gi|367001472|ref|XP_003685471.1| hypothetical protein TPHA_0D040...   285   2e-74   Tetrapisispora phaffii CBS 4417
gi|212530754|ref|XP_002145534.1| G2/mitotic-specific cyclin (Clb...   285   2e-74   Talaromyces marneffei ATCC 18224
gi|378726127|gb|EHY52586.1| G2/mitotic-specific cyclin 3/4 [Exop...   285   2e-74   Exophiala dermatitidis NIH/UT8656
gi|302497055|ref|XP_003010528.1| hypothetical protein ARB_03229 ...   284   3e-74   Arthroderma benhamiae CBS 112371
gi|367024095|ref|XP_003661332.1| hypothetical protein MYCTH_2300...   284   3e-74   Myceliophthora thermophila ATCC 42464
gi|302663426|ref|XP_003023355.1| hypothetical protein TRV_02457 ...   284   3e-74   Trichophyton verrucosum HKI 0517
gi|156839549|ref|XP_001643464.1| hypothetical protein Kpol_1006p...   284   3e-74   Vanderwaltozyma polyspora DSM 70294
gi|443921549|gb|ELU41141.1| g2/mitotic-specific cyclin cdc13 [Rh...   284   3e-74   Rhizoctonia solani AG-1 IA
gi|327300008|ref|XP_003234697.1| G2/mitotic-specific cyclin cdc1...   284   4e-74   Trichophyton rubrum CBS 118892
gi|121716748|ref|XP_001275899.1| G2/mitotic-specific cyclin, put...   284   4e-74   Aspergillus clavatus NRRL 1
gi|254567748|ref|XP_002490984.1| B-type cyclin involved in cell ...   284   4e-74   Komagataella phaffii GS115
gi|310792596|gb|EFQ28123.1| cyclin domain-containing protein [Gl...   283   4e-74   Colletotrichum graminicola M1.001
gi|326480210|gb|EGE04220.1| G2/mitotic-specific cyclin cdc13 [Tr...   283   5e-74   Trichophyton equinum CBS 127.97
gi|296815994|ref|XP_002848334.1| G2/mitotic-specific cyclin-3 [A...   283   5e-74   Arthroderma otae CBS 113480
gi|315042381|ref|XP_003170567.1| G2/mitotic-specific cyclin-3 [A...   283   6e-74   Microsporum gypseum CBS 118893
gi|71014611|ref|XP_758735.1| hypothetical protein UM02588.1 [Ust...   283   6e-74   
gi|401888094|gb|EJT52061.1| hypothetical protein A1Q1_06691 [Tri...   283   6e-74   Trichosporon asahii var. asahii CBS 2479
gi|242817649|ref|XP_002486999.1| G2/mitotic-specific cyclin (Clb...   283   6e-74   Talaromyces stipitatus ATCC 10500
gi|440632419|gb|ELR02338.1| hypothetical protein GMDG_05405 [Geo...   283   7e-74   Pseudogymnoascus destructans 20631-21
gi|365982063|ref|XP_003667865.1| hypothetical protein NDAI_0A046...   283   7e-74   Naumovozyma dairenensis CBS 421
gi|512204782|gb|EPE33604.1| Cyclin-like protein [Glarea lozoyens...   283   8e-74   Glarea lozoyensis ATCC 20868
gi|302678331|ref|XP_003028848.1| hypothetical protein SCHCODRAFT...   283   9e-74   Schizophyllum commune H4-8
gi|358389795|gb|EHK27387.1| hypothetical protein TRIVIDRAFT_3461...   282   1e-73   Trichoderma virens Gv29-8
gi|254579869|ref|XP_002495920.1| ZYRO0C06138p [Zygosaccharomyces...   282   1e-73   Zygosaccharomyces rouxii CBS 732
gi|380489622|emb|CCF36585.1| cyclin [Colletotrichum higginsianum]     282   1e-73   Colletotrichum higginsianum
gi|406608177|emb|CCH40611.1| G2/mitotic-specific cyclin-B1 [Wick...   282   1e-73   Wickerhamomyces ciferrii
gi|68466601|ref|XP_722496.1| likely G2 B-type cyclin [Candida al...   282   1e-73   Candida albicans SC5314
gi|241950769|ref|XP_002418107.1| G2/mitotic-specific cyclin, put...   282   1e-73   Candida dubliniensis CD36
gi|429852555|gb|ELA27687.1| g2 mitotic-specific cyclin cdc13 [Co...   282   2e-73   Colletotrichum gloeosporioides Nara gc5
gi|238881947|gb|EEQ45585.1| conserved hypothetical protein [Cand...   281   2e-73   Candida albicans WO-1
gi|501304845|dbj|GAC94124.1| hypothetical protein PHSY_001693 [P...   281   2e-73   Pseudozyma hubeiensis SY62
gi|336472682|gb|EGO60842.1| hypothetical protein NEUTE1DRAFT_119...   281   2e-73   Neurospora tetrasperma FGSC 2508
gi|392564147|gb|EIW57325.1| hypothetical protein TRAVEDRAFT_1260...   281   3e-73   Trametes versicolor FP-101664 SS1
gi|451997873|gb|EMD90338.1| hypothetical protein COCHEDRAFT_1157...   281   3e-73   Bipolaris maydis C5
gi|367036907|ref|XP_003648834.1| hypothetical protein THITE_2106...   281   3e-73   Thielavia terrestris NRRL 8126
gi|494827097|gb|EON64113.1| hypothetical protein W97_03343 [Coni...   281   4e-73   Coniosporium apollinis CBS 100218
gi|90888880|gb|AAP94020.2| B-type cyclin 2 [Ustilago maydis]          280   4e-73   Ustilago maydis
gi|392594698|gb|EIW84022.1| hypothetical protein CONPUDRAFT_4952...   280   4e-73   Coniophora puteana RWD-64-598 SS2
gi|451847193|gb|EMD60501.1| hypothetical protein COCSADRAFT_1747...   280   4e-73   Bipolaris sorokiniana ND90Pr
gi|156041186|ref|XP_001587579.1| hypothetical protein SS1G_11572...   280   5e-73   Sclerotinia sclerotiorum 1980 UF-70
gi|71002538|ref|XP_755950.1| G2/mitotic-specific cyclin (Clb3) [...   280   6e-73   Aspergillus fumigatus Af293
gi|119482101|ref|XP_001261079.1| G2/mitotic-specific cyclin, put...   280   6e-73   Aspergillus fischeri NRRL 181
gi|164426098|ref|XP_961608.2| hypothetical protein NCU01242 [Neu...   280   7e-73   Neurospora crassa OR74A
gi|395332283|gb|EJF64662.1| hypothetical protein DICSQDRAFT_5254...   279   9e-73   Dichomitus squalens LYAD-421 SS1
gi|477527005|gb|ENH78858.1| g2 mitotic-specific [Colletotrichum ...   279   9e-73   Colletotrichum orbiculare MAFF 240422
gi|472240461|gb|EMR85232.1| putative g2 mitotic-specific cyclin ...   279   1e-72   Botrytis cinerea BcDW1
gi|154299530|ref|XP_001550184.1| hypothetical protein BC1G_11027...   279   1e-72   Botrytis cinerea B05.10
gi|443925573|gb|ELU44380.1| g2/mitotic-specific cyclin cdc13 [Rh...   279   1e-72   Rhizoctonia solani AG-1 IA
gi|449302454|gb|EMC98463.1| hypothetical protein BAUCODRAFT_1213...   279   1e-72   Baudoinia panamericana UAMH 10762
gi|189207833|ref|XP_001940250.1| G2/mitotic-specific cyclin 3 [P...   279   1e-72   Pyrenophora tritici-repentis Pt-1C-BFP
gi|425767638|gb|EKV06206.1| G2/mitotic-specific cyclin (Clb3), p...   279   1e-72   Penicillium digitatum Pd1
gi|320588695|gb|EFX01163.1| g2 mitotic-specific cyclin [Grosmann...   279   1e-72   Grosmannia clavigera kw1407
gi|1345739|sp|P47829.1|CG21_CANAL RecName: Full=G2/mitotic-speci...   279   1e-72   Candida albicans
gi|67523361|ref|XP_659741.1| hypothetical protein AN2137.2 [Aspe...   278   2e-72   Aspergillus nidulans FGSC A4
gi|330918432|ref|XP_003298220.1| hypothetical protein PTT_08855 ...   278   2e-72   Pyrenophora teres f. teres 0-1
gi|409048724|gb|EKM58202.1| hypothetical protein PHACADRAFT_2523...   278   2e-72   Phanerochaete carnosa HHB-10118-sp
gi|406865003|gb|EKD18046.1| hypothetical protein MBM_03818 [Mars...   278   2e-72   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|401625623|gb|EJS43622.1| clb1p [Saccharomyces arboricola H-6]      278   2e-72   Saccharomyces arboricola H-6
gi|164655761|ref|XP_001729009.1| hypothetical protein MGL_3797 [...   278   2e-72   Malassezia globosa CBS 7966
gi|116206764|ref|XP_001229191.1| hypothetical protein CHGG_02675...   278   2e-72   Chaetomium globosum CBS 148.51
gi|470318733|gb|EMR10386.1| hypothetical protein PNEG_01639 [Pne...   278   2e-72   Pneumocystis murina B123
gi|213403752|ref|XP_002172648.1| G2/mitotic-specific cyclin cig2...   278   2e-72   Schizosaccharomyces japonicus yFS275
gi|340514632|gb|EGR44892.1| predicted protein [Trichoderma reese...   278   2e-72   Trichoderma reesei QM6a
gi|482813630|gb|EOA90321.1| hypothetical protein SETTUDRAFT_1460...   278   3e-72   Setosphaeria turcica Et28A
gi|358401294|gb|EHK50600.1| hypothetical protein TRIATDRAFT_1736...   277   4e-72   Trichoderma atroviride IMI 206040
gi|452845302|gb|EME47235.1| hypothetical protein DOTSEDRAFT_1661...   277   5e-72   Dothistroma septosporum NZE10
gi|255953007|ref|XP_002567256.1| Pc21g01910 [Penicillium chrysog...   276   7e-72   Penicillium rubens Wisconsin 54-1255
gi|331239034|ref|XP_003332171.1| cyclin B [Puccinia graminis f. ...   276   7e-72   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|393221491|gb|EJD06976.1| hypothetical protein FOMMEDRAFT_7576...   276   7e-72   Fomitiporia mediterranea MF3/22
gi|396485487|ref|XP_003842183.1| similar to G2/mitotic-specific ...   276   7e-72   Leptosphaeria maculans JN3
gi|367001284|ref|XP_003685377.1| hypothetical protein TPHA_0D030...   276   7e-72   Tetrapisispora phaffii CBS 4417
gi|406605762|emb|CCH42865.1| G2/mitotic-specific cyclin-B2 [Wick...   276   7e-72   Wickerhamomyces ciferrii
gi|403417613|emb|CCM04313.1| predicted protein [Fibroporia radic...   276   8e-72   Fibroporia radiculosa
gi|402224605|gb|EJU04667.1| hypothetical protein DACRYDRAFT_4733...   276   9e-72   
gi|317035914|ref|XP_001397178.2| G2/mitotic-specific cyclin [Asp...   276   1e-71   
gi|350636501|gb|EHA24861.1| hypothetical protein ASPNIDRAFT_4078...   276   1e-71   
gi|134082710|emb|CAK42602.1| unnamed protein product [Aspergillu...   276   1e-71   
gi|465794347|emb|CCU99131.1| unnamed protein product [Malassezia...   276   1e-71   
gi|170098913|ref|XP_001880675.1| predicted protein [Laccaria bic...   275   1e-71   
gi|328858694|gb|EGG07806.1| hypothetical protein MELLADRAFT_4308...   275   1e-71   
gi|358374922|dbj|GAA91510.1| G2/mitotic-specific cyclin [Aspergi...   275   2e-71   
gi|448103996|ref|XP_004200176.1| Piso0_002751 [Millerozyma farin...   275   2e-71   
gi|149235546|ref|XP_001523651.1| G2/mitotic-specific cyclin-4 [L...   275   2e-71   
gi|430812883|emb|CCJ29716.1| unnamed protein product [Pneumocyst...   275   2e-71   
gi|390594319|gb|EIN03731.1| hypothetical protein PUNSTDRAFT_9374...   275   2e-71   
gi|452986370|gb|EME86126.1| hypothetical protein MYCFIDRAFT_1167...   275   2e-71   
gi|389635187|ref|XP_003715246.1| G2/mitotic-specific cyclin-B [M...   274   3e-71   
gi|453087558|gb|EMF15599.1| Cyclin_N-domain-containing protein [...   274   3e-71   
gi|299740023|ref|XP_001840419.2| nime/cyclinb [Coprinopsis ciner...   274   4e-71   
gi|448100293|ref|XP_004199317.1| Piso0_002751 [Millerozyma farin...   273   5e-71   
gi|302684047|ref|XP_003031704.1| hypothetical protein SCHCODRAFT...   273   6e-71   
gi|402085350|gb|EJT80248.1| G2/mitotic-specific cyclin-B [Gaeuma...   273   7e-71   
gi|261200279|ref|XP_002626540.1| G2/mitotic-specific cyclin cdc1...   273   8e-71   
gi|239607511|gb|EEQ84498.1| G2/mitotic-specific cyclin cdc13 [Aj...   273   9e-71   
gi|399166302|emb|CCE32860.1| related to cyclin B3 [Claviceps pur...   273   9e-71   
gi|410074179|ref|XP_003954672.1| hypothetical protein KAFR_0A009...   273   9e-71   
gi|389749601|gb|EIM90772.1| hypothetical protein STEHIDRAFT_4890...   273   1e-70   
gi|501755242|emb|CCG81465.1| Related to cyclin B3 [Taphrina defo...   272   1e-70   
gi|325090580|gb|EGC43890.1| G2/mitotic-specific cyclin cdc13 [Aj...   272   1e-70   
gi|344299709|gb|EGW30062.1| B-type cyclin [Spathaspora passalida...   272   1e-70   
gi|322705712|gb|EFY97296.1| G2/mitotic-specific cyclin (Clb3), p...   272   1e-70   
gi|19114801|ref|NP_593889.1| G1/S-specific B-type cyclin Cig2 [S...   272   1e-70   
gi|326472882|gb|EGD96891.1| G2/mitotic-specific cyclin cdc13 [Tr...   271   2e-70   
gi|471568383|gb|EMR68062.1| putative g2 mitotic-specific cyclin-...   271   3e-70   
gi|225556007|gb|EEH04297.1| G2/mitotic-specific cyclin cdc13 [Aj...   271   3e-70   
gi|440466190|gb|ELQ35472.1| G2/mitotic-specific cyclin-B [Magnap...   270   4e-70   
gi|398407925|ref|XP_003855428.1| hypothetical protein MYCGRDRAFT...   270   5e-70   
gi|459369102|gb|EMG47603.1| hypothetical protein G210_1991 [Cand...   270   5e-70   
gi|302421068|ref|XP_003008364.1| G2/mitotic-specific cyclin cdc1...   270   6e-70   
gi|7547487|gb|AAB29297.2| B-type cyclin Cig2 [Schizosaccharomyce...   270   8e-70   
gi|254573868|ref|XP_002494043.1| B-type cyclin involved in cell ...   269   9e-70   
gi|346974548|gb|EGY18000.1| G2/mitotic-specific cyclin-3 [Vertic...   269   9e-70   
gi|353238399|emb|CCA70346.1| related to b-type cyclin 1 [Pirifor...   269   1e-69   
gi|448536224|ref|XP_003871070.1| Clb4 B-type mitotic cyclin [Can...   269   1e-69   
gi|340923788|gb|EGS18691.1| cyclin-dependent protein kinase regu...   268   2e-69   
gi|353234652|emb|CCA66675.1| related to b-type cyclin 2 [Pirifor...   268   2e-69   
gi|207340290|gb|EDZ68685.1| YPR119Wp-like protein [Saccharomyces...   268   2e-69   
gi|354548497|emb|CCE45233.1| hypothetical protein CPAR2_702460 [...   268   3e-69   
gi|302910922|ref|XP_003050379.1| predicted protein [Nectria haem...   268   3e-69   
gi|449543166|gb|EMD34143.1| hypothetical protein CERSUDRAFT_5562...   268   3e-69   
gi|260948934|ref|XP_002618764.1| hypothetical protein CLUG_02223...   267   3e-69   
gi|294660145|ref|XP_462589.2| DEHA2G24134p [Debaryomyces hanseni...   267   4e-69   
gi|408396558|gb|EKJ75714.1| hypothetical protein FPSE_04096 [Fus...   267   5e-69   
gi|366993531|ref|XP_003676530.1| hypothetical protein NCAS_0E009...   267   6e-69   
gi|342866465|gb|EGU72126.1| hypothetical protein FOXB_17370 [Fus...   266   8e-69   
gi|433702|emb|CAA49640.1| mitotic B-type cyclin [Schizosaccharom...   266   8e-69   
gi|156838831|ref|XP_001643114.1| hypothetical protein Kpol_461p1...   265   2e-68   
gi|336389526|gb|EGO30669.1| hypothetical protein SERLADRAFT_3449...   265   2e-68   
gi|150864310|ref|XP_001383074.2| B-type cyclin [Scheffersomyces ...   264   3e-68   
gi|255731936|ref|XP_002550892.1| hypothetical protein CTRG_05190...   264   3e-68   
gi|46125509|ref|XP_387308.1| hypothetical protein FG07132.1 [Fus...   263   6e-68   
gi|190347647|gb|EDK39961.2| hypothetical protein PGUG_04059 [Mey...   263   7e-68   
gi|346321853|gb|EGX91452.1| G2/mitotic-specific cyclin (Clb3), p...   263   8e-68   
gi|213408126|ref|XP_002174834.1| G2/mitotic-specific cyclin cig1...   263   9e-68   
gi|323346329|gb|EGA80619.1| Clb2p [Saccharomyces cerevisiae Lalv...   262   1e-67   
gi|50305949|ref|XP_452935.1| hypothetical protein [Kluyveromyces...   261   2e-67   
gi|323306847|gb|EGA60132.1| Clb2p [Saccharomyces cerevisiae Fost...   261   3e-67   
gi|358054471|dbj|GAA99397.1| hypothetical protein E5Q_06095 [Mix...   261   3e-67   
gi|241957699|ref|XP_002421569.1| G2/mitotic-specific (B-type) cy...   260   4e-67   
gi|500260266|gb|EOO02955.1| putative g2 mitotic-specific cyclin ...   260   4e-67   
gi|3929290|gb|AAC79857.1| B-type cyclin [Candida albicans]            260   5e-67   
gi|68481734|ref|XP_715235.1| hypothetical protein CaO19.7186 [Ca...   260   6e-67   
gi|344228658|gb|EGV60544.1| hypothetical protein CANTEDRAFT_1370...   259   7e-67   
gi|401841716|gb|EJT44063.1| CLB1-like protein [Saccharomyces kud...   259   1e-66   
gi|344228659|gb|EGV60545.1| hypothetical protein CANTEDRAFT_1370...   258   2e-66   
gi|6321545|ref|NP_011622.1| Clb1p [Saccharomyces cerevisiae S288...   258   2e-66   
gi|190406873|gb|EDV10140.1| G2/mitotic-specific cyclin-1 [Saccha...   258   2e-66   
gi|169614600|ref|XP_001800716.1| hypothetical protein SNOG_10446...   258   2e-66   
gi|256272024|gb|EEU07039.1| Clb1p [Saccharomyces cerevisiae JAY291]   258   2e-66   
gi|365992020|ref|XP_003672838.1| hypothetical protein NDAI_0L011...   258   3e-66   
gi|146414720|ref|XP_001483330.1| hypothetical protein PGUG_04059...   257   3e-66   
gi|207345114|gb|EDZ72040.1| YGR108Wp-like protein [Saccharomyces...   257   4e-66   
gi|402219251|gb|EJT99325.1| hypothetical protein DACRYDRAFT_2390...   257   4e-66   
gi|384486595|gb|EIE78775.1| hypothetical protein RO3G_03480 [Rhi...   257   5e-66   
gi|322701505|gb|EFY93254.1| G2/mitotic-specific cyclin (Clb3), p...   257   6e-66   
gi|151943389|gb|EDN61700.1| B-type cyclin [Saccharomyces cerevis...   256   7e-66   
gi|471903544|emb|CCO29483.1| G2/mitotic-specific cyclin-B [Rhizo...   256   8e-66   
gi|171692295|ref|XP_001911072.1| hypothetical protein [Podospora...   256   9e-66   
gi|374107380|gb|AEY96288.1| FADR068Wp [Ashbya gossypii FDAG1]         256   1e-65   
gi|170112230|ref|XP_001887317.1| predicted protein [Laccaria bic...   255   2e-65   
gi|349578319|dbj|GAA23485.1| K7_Clb1p [Saccharomyces cerevisiae ...   255   2e-65   
gi|444321272|ref|XP_004181292.1| hypothetical protein TBLA_0F023...   254   3e-65   
gi|45187941|ref|NP_984164.1| ADR068Wp [Ashbya gossypii ATCC 1089...   254   3e-65   
gi|513031828|gb|AGO11837.1| AaceriADR068Wp [Saccharomycetaceae s...   254   5e-65   
gi|336382401|gb|EGO23551.1| hypothetical protein SERLADRAFT_3618...   253   5e-65   
gi|363755956|ref|XP_003648194.1| hypothetical protein Ecym_8082 ...   252   1e-64   
gi|320581790|gb|EFW96009.1| G2/mitotic-specific cyclin-4 [Ogatae...   251   3e-64   
gi|254584248|ref|XP_002497692.1| ZYRO0F11352p [Zygosaccharomyces...   250   4e-64   
gi|366995938|ref|XP_003677732.1| hypothetical protein NCAS_0H007...   250   6e-64   
gi|323348620|gb|EGA82864.1| Clb1p [Saccharomyces cerevisiae Lalv...   250   6e-64   
gi|471900769|emb|CCO30086.1| G2/mitotic-specific cyclin cdc13 [R...   249   9e-64   
gi|336365068|gb|EGN93420.1| hypothetical protein SERLA73DRAFT_64...   247   4e-63   
gi|367011627|ref|XP_003680314.1| hypothetical protein TDEL_0C021...   247   5e-63   
gi|323336471|gb|EGA77738.1| Clb4p [Saccharomyces cerevisiae Vin13]    246   9e-63   
gi|323303867|gb|EGA57649.1| Clb4p [Saccharomyces cerevisiae Fost...   246   1e-62   
gi|365764054|gb|EHN05579.1| Clb4p [Saccharomyces cerevisiae x Sa...   246   1e-62   
gi|6323239|ref|NP_013311.1| Clb4p [Saccharomyces cerevisiae S288...   246   1e-62   
gi|151941051|gb|EDN59431.1| B-type cyclin [Saccharomyces cerevis...   246   1e-62   
gi|365985580|ref|XP_003669622.1| hypothetical protein NDAI_0D006...   246   1e-62   
gi|259148193|emb|CAY81440.1| Clb4p [Saccharomyces cerevisiae EC1...   246   1e-62   
gi|367005392|ref|XP_003687428.1| hypothetical protein TPHA_0J017...   244   3e-62   
gi|401624623|gb|EJS42678.1| clb4p [Saccharomyces arboricola H-6]      244   3e-62   
gi|401626461|gb|EJS44407.1| clb3p [Saccharomyces arboricola H-6]      244   4e-62   
gi|336377637|gb|EGO18798.1| hypothetical protein SERLADRAFT_3531...   244   4e-62   
gi|401838973|gb|EJT42366.1| CLB4-like protein [Saccharomyces kud...   244   5e-62   
gi|63054436|ref|NP_588110.2| cyclin Cig1 [Schizosaccharomyces po...   243   5e-62   
gi|320580110|gb|EFW94333.1| G2/mitotic-specific (B-type) cyclin,...   243   8e-62   
gi|323353789|gb|EGA85644.1| Clb4p [Saccharomyces cerevisiae VL3]      243   1e-61   
gi|400602361|gb|EJP69963.1| cyclin domain-containing protein [Be...   241   2e-61   
gi|173351|gb|AAA35288.1| B-type cyclin [Schizosaccharomyces pombe]    240   5e-61   
gi|385305580|gb|EIF49542.1| g2 mitotic-specific cyclin-4 [Dekker...   238   2e-60   
gi|50289943|ref|XP_447403.1| hypothetical protein [Candida glabr...   238   3e-60   
gi|323308035|gb|EGA61289.1| Clb4p [Saccharomyces cerevisiae Fost...   237   5e-60   
gi|259013474|ref|NP_001158480.1| cyclin B [Saccoglossus kowalevs...   237   5e-60   
gi|50291319|ref|XP_448092.1| hypothetical protein [Candida glabr...   236   6e-60   
gi|444317873|ref|XP_004179594.1| hypothetical protein TBLA_0C026...   236   8e-60   
gi|1705774|sp|P51987.1|CCNB_CHLVR RecName: Full=G2/mitotic-speci...   235   2e-59   
gi|253970798|gb|ACT37345.1| cyclin B [Tachypleus tridentatus]         235   2e-59   
gi|410075892|ref|XP_003955528.1| hypothetical protein KAFR_0B009...   235   2e-59   
gi|443696570|gb|ELT97248.1| hypothetical protein CAPTEDRAFT_1517...   234   2e-59   
gi|403214990|emb|CCK69490.1| hypothetical protein KNAG_0C03860 [...   234   3e-59   
gi|295661853|ref|XP_002791481.1| G2/mitotic-specific cyclin-B [P...   234   4e-59   
gi|226289306|gb|EEH44818.1| G2/mitotic-specific cyclin-B [Paraco...   233   7e-59   
gi|225682123|gb|EEH20407.1| G2/mitotic-specific cyclin-4 [Paraco...   233   9e-59   
gi|323338410|gb|EGA79635.1| Clb3p [Saccharomyces cerevisiae Vin13]    233   1e-58   
gi|256273593|gb|EEU08526.1| Clb3p [Saccharomyces cerevisiae JAY291]   233   1e-58   
gi|207347075|gb|EDZ73381.1| YDL155Wp-like protein [Saccharomyces...   233   1e-58   
gi|255719344|ref|XP_002555952.1| KLTH0H01694p [Lachancea thermot...   232   1e-58   
gi|6320046|ref|NP_010126.1| Clb3p [Saccharomyces cerevisiae S288...   232   1e-58   
gi|5525|emb|CAA49201.1| CLB3 [Saccharomyces cerevisiae]               232   1e-58   
gi|190405154|gb|EDV08421.1| G2/mitotic-specific cyclin-3 [Saccha...   232   1e-58   
gi|349576925|dbj|GAA22094.1| K7_Clb3p [Saccharomyces cerevisiae ...   232   1e-58   
gi|365761747|gb|EHN03384.1| Clb3p [Saccharomyces cerevisiae x Sa...   232   2e-58   
gi|401840859|gb|EJT43505.1| CLB3-like protein [Saccharomyces kud...   231   2e-58   
gi|116179|sp|P24862.1|CCNB_PATVU RecName: Full=G2/mitotic-specif...   230   6e-58   
gi|116177|sp|P15206.1|CCNB_MARGL RecName: Full=G2/mitotic-specif...   230   6e-58   
gi|147905963|ref|NP_001081268.1| G2/mitotic-specific cyclin-B2 [...   229   8e-58   
gi|238578780|ref|XP_002388833.1| hypothetical protein MPER_12107...   229   1e-57   
gi|89272831|emb|CAJ83630.1| cyclin B2 [Xenopus (Silurana) tropic...   229   1e-57   
gi|166796559|gb|AAI58911.1| Unknown (protein for MGC:135190) [Xe...   229   1e-57   
gi|410084619|ref|XP_003959886.1| hypothetical protein KAFR_0L014...   229   1e-57   
gi|223950615|ref|NP_001138848.1| cyclin B2 [Xenopus (Silurana) t...   228   2e-57   
gi|475667430|gb|EMT65219.1| G2/mitotic-specific cyclin-4 [Fusari...   228   4e-57   
gi|148222908|ref|NP_001083368.1| uncharacterized protein LOC3988...   227   4e-57   
gi|323347425|gb|EGA81696.1| Clb4p [Saccharomyces cerevisiae Lalv...   226   1e-56   
gi|505777658|ref|XP_004602843.1| PREDICTED: G2/mitotic-specific ...   226   1e-56   
gi|206558340|emb|CAO99272.1| cyclin B [Astropecten aranciacus]        225   2e-56   
gi|310697400|gb|ADP06655.1| cyclin B [Haliotis diversicolor supe...   225   2e-56   
gi|126697422|gb|ABO26668.1| cyclin B [Haliotis discus discus]         225   2e-56   
gi|403214043|emb|CCK68544.1| hypothetical protein KNAG_0B00970 [...   224   3e-56   
gi|24415064|emb|CAD55604.1| Cyclin B [Marthasterias glacialis]        224   3e-56   
gi|465992596|gb|EMP38992.1| G2/mitotic-specific cyclin-B2 [Chelo...   224   3e-56   
gi|426379256|ref|XP_004056317.1| PREDICTED: G2/mitotic-specific ...   224   4e-56   
gi|38156578|gb|AAR12911.1| cyclin B2 [Bufo gargarizans]               224   4e-56   
gi|439146|emb|CAA51408.1| B-type cyclin [Saccharomyces cerevisiae]    224   5e-56   
gi|323354808|gb|EGA86641.1| Clb6p [Saccharomyces cerevisiae VL3]      224   5e-56   
gi|21263455|sp|Q9DGA4.1|CCNB1_ORYCU RecName: Full=G2/mitotic-spe...   223   5e-56   
gi|166796057|ref|NP_001107754.1| G2/mitotic-specific cyclin-B2 [...   223   6e-56   
gi|326926530|ref|XP_003209452.1| PREDICTED: g2/mitotic-specific ...   223   6e-56   
gi|349578320|dbj|GAA23486.1| K7_Clb6p [Saccharomyces cerevisiae ...   223   7e-56   
gi|398365719|ref|NP_011623.3| Clb6p [Saccharomyces cerevisiae S2...   223   7e-56   
gi|478494690|ref|XP_004421693.1| PREDICTED: G2/mitotic-specific ...   223   8e-56   
gi|395822255|ref|XP_003784437.1| PREDICTED: G2/mitotic-specific ...   223   8e-56   
gi|116180|sp|P13952.1|CCNB_SPISO RecName: Full=G2/mitotic-specif...   223   9e-56   
gi|54695782|gb|AAV38263.1| cyclin B2 [synthetic construct] >gi|5...   223   9e-56   
gi|348505166|ref|XP_003440132.1| PREDICTED: G2/mitotic-specific ...   223   1e-55   
gi|4757930|ref|NP_004692.1| G2/mitotic-specific cyclin-B2 [Homo ...   223   1e-55   
gi|114657328|ref|XP_510447.2| PREDICTED: G2/mitotic-specific cyc...   223   1e-55   
gi|397515423|ref|XP_003827951.1| PREDICTED: G2/mitotic-specific ...   223   1e-55   
gi|156364707|ref|XP_001626487.1| predicted protein [Nematostella...   223   1e-55   
gi|66773974|sp|Q60FX9.1|CCNB2_ANGJA RecName: Full=G2/mitotic-spe...   223   1e-55   
gi|116173|sp|P07818.1|CCNB_ARBPU RecName: Full=G2/mitotic-specif...   222   1e-55   
gi|507962819|ref|XP_004687790.1| PREDICTED: G2/mitotic-specific ...   222   1e-55   
gi|365981535|ref|XP_003667601.1| hypothetical protein NDAI_0A020...   222   1e-55   
gi|3608418|gb|AAC35952.1| cyclin B [Dreissena polymorpha]             222   1e-55   
gi|62896781|dbj|BAD96331.1| cyclin B2 variant [Homo sapiens]          222   1e-55   
gi|190406872|gb|EDV10139.1| S-phase entry cyclin-6 [Saccharomyce...   222   1e-55   
gi|444319953|ref|XP_004180633.1| hypothetical protein TBLA_0E005...   222   2e-55   
gi|348555453|ref|XP_003463538.1| PREDICTED: G2/mitotic-specific ...   221   2e-55   
gi|242218311|ref|XP_002474947.1| predicted protein [Postia place...   221   2e-55   
gi|57108241|ref|XP_535499.1| PREDICTED: G2/mitotic-specific cycl...   221   2e-55   
gi|15667690|gb|AAL05452.1|AF334142_1 cyclin B [Patiria pectinifera]   221   2e-55   
gi|281347132|gb|EFB22716.1| hypothetical protein PANDA_016266 [A...   221   2e-55   
gi|306482566|ref|NP_001182327.1| cyclin B5 [Xenopus (Silurana) t...   221   3e-55   
gi|403214211|emb|CCK68712.1| hypothetical protein KNAG_0B02690 [...   221   3e-55   
gi|402874438|ref|XP_003901045.1| PREDICTED: G2/mitotic-specific ...   221   3e-55   
gi|355692755|gb|EHH27358.1| G2/mitotic-specific cyclin-B2 [Macac...   221   3e-55   
gi|75076653|sp|Q4R7A8.1|CCNB2_MACFA RecName: Full=G2/mitotic-spe...   221   3e-55   
gi|332235800|ref|XP_003267092.1| PREDICTED: G2/mitotic-specific ...   221   3e-55   
gi|396499|emb|CAA49894.1| cyclin [Saccharomyces cerevisiae] >gi|...   221   3e-55   
gi|301782365|ref|XP_002926596.1| PREDICTED: g2/mitotic-specific ...   221   3e-55   
gi|21263452|sp|Q9DGA0.2|CCNB1_ORYJA RecName: Full=G2/mitotic-spe...   221   4e-55   
gi|67969659|dbj|BAE01178.1| unnamed protein product [Macaca fasc...   221   4e-55   
gi|126277144|ref|XP_001368039.1| PREDICTED: g2/mitotic-specific ...   221   4e-55   
gi|291402918|ref|XP_002718251.1| PREDICTED: cyclin B2 [Oryctolag...   221   4e-55   
gi|466032999|ref|XP_004274735.1| PREDICTED: G2/mitotic-specific ...   221   4e-55   
gi|297696758|ref|XP_002825549.1| PREDICTED: G2/mitotic-specific ...   220   5e-55   
gi|511916061|ref|XP_004777332.1| PREDICTED: G2/mitotic-specific ...   220   5e-55   
gi|371905558|emb|CAO99274.1| cyclin B2 [Homo sapiens]                 220   5e-55   
gi|410961145|ref|XP_003987145.1| PREDICTED: G2/mitotic-specific ...   220   6e-55   
gi|512987711|ref|XP_004855784.1| PREDICTED: G2/mitotic-specific ...   220   6e-55   
gi|440910845|gb|ELR60598.1| G2/mitotic-specific cyclin-B2 [Bos g...   220   8e-55   
gi|54695786|gb|AAV38265.1| cyclin B2 [Homo sapiens]                   220   8e-55   
gi|432100487|gb|ELK29104.1| G2/mitotic-specific cyclin-B2 [Myoti...   219   9e-55   
gi|498925765|ref|XP_004538525.1| PREDICTED: G2/mitotic-specific ...   219   9e-55   
gi|73949659|ref|XP_850398.1| PREDICTED: G2/mitotic-specific cycl...   219   9e-55   
gi|197700144|gb|ACH72072.1| cyclin B [Penaeus monodon]                219   9e-55   
gi|327263169|ref|XP_003216393.1| PREDICTED: g2/mitotic-specific ...   219   9e-55   
gi|426233208|ref|XP_004010609.1| PREDICTED: G2/mitotic-specific ...   219   9e-55   
gi|60097921|ref|NP_776689.2| G2/mitotic-specific cyclin-B2 [Bos ...   219   9e-55   
gi|68839680|sp|O77689.2|CCNB2_BOVIN RecName: Full=G2/mitotic-spe...   219   9e-55   
gi|21263449|sp|Q9DG97.1|CCNB1_ORYLU RecName: Full=G2/mitotic-spe...   219   9e-55   
gi|59857889|gb|AAX08779.1| cyclin B2 [Bos taurus] >gi|59858009|g...   219   1e-54   
gi|52138633|ref|NP_001004369.1| G2/mitotic-specific cyclin-B2 [G...   219   1e-54   


>gi|19111963|ref|NP_595171.1| G2/M B-type cyclin Cdc13 [Schizosaccharomyces pombe 972h-]
 gi|116156|sp|P10815.1|CG23_SCHPO RecName: Full=G2/mitotic-specific cyclin cdc13
 gi|4923|emb|CAA31070.1| unnamed protein product [Schizosaccharomyces pombe]
 gi|5420439|emb|CAB46666.1| G2/M B-type cyclin Cdc13 [Schizosaccharomyces pombe]
          Length = 482

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/285 (62%), Positives = 219/285 (76%)

Query: 121 EIYEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQ 180
           +I +  R   +  ++QDW+DLDA+D+ DP+M+SEY VDIF+YL +LE E MP P YM  Q
Sbjct: 169 DIPKLHRDSVESPESQDWDDLDAEDWADPLMVSEYVVDIFEYLNELEIETMPSPTYMDRQ 228

Query: 181 SELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFI 240
            EL+W+MRGIL DWLIEVH +FRLLPETLFLAVNIIDRFLS+RV SL KLQLVGI  LFI
Sbjct: 229 KELAWKMRGILTDWLIEVHSRFRLLPETLFLAVNIIDRFLSLRVCSLNKLQLVGIAALFI 288

Query: 241 AAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADH 300
           A+KYEE++ PS++NF+YMAD GY EEEIL+AERY+L  ++F L YPNPMNFLRR SKAD 
Sbjct: 289 ASKYEEVMCPSVQNFVYMADGGYDEEEILQAERYILRVLEFNLAYPNPMNFLRRISKADF 348

Query: 301 FDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXX 360
           +DIQ RTVAKYL+EI L+D+K LP PPS   AAA+YL+R+ML R  W+ NL+HYS Y   
Sbjct: 349 YDIQTRTVAKYLVEIGLLDHKLLPYPPSQQCAAAMYLAREMLGRGPWNRNLVHYSGYEEY 408

Query: 361 XXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKN 405
                         KP +HE  +KKYA+K+FMKAS+FV+DWI KN
Sbjct: 409 QLISVVKKMINYLQKPVQHEAFFKKYASKKFMKASLFVRDWIKKN 453



>gi|213408975|ref|XP_002175258.1| G2/mitotic-specific cyclin cdc13 [Schizosaccharomyces japonicus
           yFS275]
 gi|212003305|gb|EEB08965.1| G2/mitotic-specific cyclin cdc13 [Schizosaccharomyces japonicus
           yFS275]
          Length = 495

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 166/281 (59%), Positives = 215/281 (76%)

Query: 126 DRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSW 185
           +R+   K   QDW+DLDA+D+ DP+M+SEY  +IF Y++ LE + +P P YM  Q EL+W
Sbjct: 190 EREVPTKPSEQDWDDLDAEDWADPLMVSEYVNEIFDYMRKLEIQTLPSPTYMDRQKELAW 249

Query: 186 RMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYE 245
           +MRGIL DWLIEVH +FRLLPETLFL+VNIIDRFLS+RV SL KLQLVGIT LFIA+KYE
Sbjct: 250 KMRGILTDWLIEVHSRFRLLPETLFLSVNIIDRFLSLRVCSLSKLQLVGITALFIASKYE 309

Query: 246 ELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQA 305
           E++ PS++NF+YMAD GY EEEIL+AE+Y+L  +++ L YPNPMNFLRR SKAD++DIQ 
Sbjct: 310 EVMCPSVQNFVYMADGGYDEEEILQAEQYILRVLEYNLAYPNPMNFLRRISKADYYDIQT 369

Query: 306 RTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXX 365
           RTVAKYL+EI L+D++ +  PPS   AAA+Y++R+ML R  W+ NL+HYS Y        
Sbjct: 370 RTVAKYLVEIGLLDHRLIRYPPSQQCAAAMYIAREMLGRGPWNRNLVHYSGYEERELIPV 429

Query: 366 XXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
                    KP +HE  +KKYA+K+FMKAS+FV+DW+ KN 
Sbjct: 430 VAKMISYLQKPVQHEAFFKKYASKKFMKASLFVRDWVKKNA 470



>gi|501752399|emb|CCG83623.1| Cyclin B [Taphrina deformans PYCC 5710]
          Length = 432

 Score =  365 bits (938), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 166/256 (64%), Positives = 204/256 (79%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M+SEY V+IF+YL++ E   +P PDYM  Q EL W+MRGILVDWL+EVH KFRLLPET
Sbjct: 153 PLMVSEYVVEIFEYLREQELLTLPTPDYMERQKELHWKMRGILVDWLVEVHQKFRLLPET 212

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNIIDRFLS+RV SL KLQLVGIT LFIA+KYEE++ PSI+NFIYMAD GYT++EI
Sbjct: 213 LFLAVNIIDRFLSLRVCSLPKLQLVGITALFIASKYEEVMCPSIQNFIYMADGGYTDDEI 272

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           LKAE+YVL  ++F L  PNPMNFLRR SKAD +DIQ RTVAKYL+EISLVD++FL  PPS
Sbjct: 273 LKAEQYVLQVLEFNLSSPNPMNFLRRVSKADQYDIQVRTVAKYLLEISLVDHRFLVYPPS 332

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
           ++AAA +YL+R ML+R +W ANL+HYS YT                KP +HE  YKKYA+
Sbjct: 333 LVAAAGMYLARYMLDRGDWDANLVHYSGYTESQLIGCVRLMIDYLTKPVRHEAFYKKYAS 392

Query: 389 KRFMKASIFVKDWISK 404
           K+F+KAS++V  W++K
Sbjct: 393 KKFIKASLYVTQWVNK 408



>gi|430812163|emb|CCJ30385.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 529

 Score =  362 bits (928), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 203/442 (45%), Positives = 263/442 (59%), Gaps = 55/442 (12%)

Query: 20  RAPMAAHRDENVVATKQLAIREGVNNVTAIPQKKLGVVTRKRAVLMDRTNVSLKQNSV-- 77
           +  +++  DEN +  +   ++      +    K   V TRKRA L D +NV+ K+N V  
Sbjct: 10  QTALSSVNDENKLHGQATRVKLTSTQSSESHAKPWTVATRKRAALGDVSNVNNKENMVSK 69

Query: 78  ------NEQTHDITKPII-----KENVNLGFQDIRSKEKHELSFDTTLATTAESEIYEFD 126
                 N +   +TKP +     KE+  L  Q +++ E  +L          +  + E  
Sbjct: 70  TKTQPLNTKARVVTKPTVPVLQTKESTQL-IQPVQTAETMQLVQSVQPIPLVDPHVEETT 128

Query: 127 RKR--------------------SKKQKTQDWEDLDADDFYD------------------ 148
           RKR                    SKK + +   +   D   D                  
Sbjct: 129 RKRRTSKVLKEQKQPVGVKQTQASKKVRVESLSNTATDMVVDATVPSQDWDDLDADDAHD 188

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M+SEY  +I  Y+++LE   +P PDYM  Q EL W+MRGILVDWLIEVH KFRLLPET
Sbjct: 189 PLMVSEYVEEIMNYMRELEVLTLPLPDYMDRQKELQWKMRGILVDWLIEVHAKFRLLPET 248

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFL+VNIIDRFLS+RV SL KLQLVGIT LFIAAKYEE++ PSIKNFIYMAD GYT EEI
Sbjct: 249 LFLSVNIIDRFLSLRVCSLPKLQLVGITALFIAAKYEEVMCPSIKNFIYMADGGYTNEEI 308

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           LKAE+YVL  + + + YPNPMNFLRR SKAD++DIQ RTVAKYL+EISL+D++FLP  PS
Sbjct: 309 LKAEQYVLQVLGYDMSYPNPMNFLRRVSKADNYDIQTRTVAKYLIEISLLDHRFLPFVPS 368

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP-TKHEQLYKKYA 387
            IAA+ +YL+R M+   +W+ANLIHYS Y                 +   KHE  +KKYA
Sbjct: 369 NIAASGIYLARIMVTGGDWNANLIHYSGYKESDLMPCSKMMLDYLSRSVVKHEAFFKKYA 428

Query: 388 AKRFMKASIFVKDWISK--NVE 407
           +K+FMKAS+FV+DW+ K  NVE
Sbjct: 429 SKKFMKASLFVRDWVKKHYNVE 450



>gi|388582888|gb|EIM23191.1| G2/M-specific cyclin NimE [Wallemia sebi CBS 633.66]
          Length = 507

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 164/292 (56%), Positives = 215/292 (73%), Gaps = 9/292 (3%)

Query: 119 ESEIYEFDRKRSKKQKT--------QDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEI 170
           E++ +E D +R +  K         + WEDLDA+D  DP+M+SEY V+IF+Y+K LE + 
Sbjct: 187 EAQRFEADEERRRLAKAKQNLPAADEGWEDLDAEDEGDPLMVSEYVVEIFEYMKVLEQQT 246

Query: 171 MPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKL 230
           MP P+YM +Q EL WRMRG+LVDWLIE+HHKFRLLPETLFLA+NI+DRFLS+R+VS++KL
Sbjct: 247 MPNPNYMDNQKELRWRMRGVLVDWLIEIHHKFRLLPETLFLAINIVDRFLSLRIVSIIKL 306

Query: 231 QLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMN 290
           QLVG+T + IAAKYEE++ P++ N +YM+D GY E E+LKAE+YVL  + + L YPNP++
Sbjct: 307 QLVGLTAMLIAAKYEEVMCPTVANVVYMSDGGYEESELLKAEQYVLQILSWDLSYPNPIH 366

Query: 291 FLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHAN 350
           FLRR SKAD +DI+ RT+AKY MEIS V+ K L  PPS IAAAA YLSR  L+R EW AN
Sbjct: 367 FLRRVSKADDYDIETRTLAKYFMEISCVEEKLLRFPPSQIAAAATYLSRMCLDRGEWSAN 426

Query: 351 LIHYSQYTXXXXXXXXXXXXX-XXMKPTKHEQLYKKYAAKRFMKASIFVKDW 401
           L+HYS Y+                 K  KH+  Y+KYA+K+F+KAS FV++W
Sbjct: 427 LVHYSGYSVLELLPCAQVMLDYVKSKDIKHDAFYRKYASKKFLKASTFVREW 478



>gi|328772487|gb|EGF82525.1| hypothetical protein BATDEDRAFT_15932 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 369

 Score =  356 bits (914), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 208/258 (80%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M+SEY  +IF+Y+  LE++ M  P+YM  Q+EL W+MR ILVDWLIEVH+KFRLL ETLF
Sbjct: 1   MLSEYVQEIFEYMHTLENQTMANPNYMEQQNELQWKMRSILVDWLIEVHNKFRLLAETLF 60

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           LAVNI+DRFLS+RVVSLVKLQLVG+T +FIAAKYEE+++PSI++F+YMAD GYT++EIL+
Sbjct: 61  LAVNIVDRFLSLRVVSLVKLQLVGVTAMFIAAKYEEVVSPSIQSFLYMADGGYTDDEILR 120

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AERYVL  +DF L YP PM+FLRR SKAD +DIQ RT+AKYLME+SLVD++F+ +PPS I
Sbjct: 121 AERYVLQVLDFALQYPTPMSFLRRCSKADGYDIQTRTLAKYLMEVSLVDHRFISIPPSQI 180

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AA+ LYL+R+ML+RS W+ NLIHYS Y                 KP K+E LYKKY+A++
Sbjct: 181 AASGLYLARRMLDRSPWNPNLIHYSSYKEEELQECSELVLDYLSKPVKYEALYKKYSARK 240

Query: 391 FMKASIFVKDWISKNVER 408
           F+K +IFV+DWI+K  ++
Sbjct: 241 FLKVAIFVEDWIAKQKDK 258



>gi|505760096|gb|EOR04170.1| G2/mitotic-specific cyclin cdc13 [Wallemia ichthyophaga EXF-994]
          Length = 503

 Score =  353 bits (907), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 162/292 (55%), Positives = 212/292 (72%), Gaps = 9/292 (3%)

Query: 119 ESEIYEFDRKRSKKQKT--------QDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEI 170
           E++ +E D  R +  KT        + WEDLDA+D  DP+M+SEY ++IF+Y+K LE   
Sbjct: 183 EAQRFEADEDRRRLAKTNANLPPADEGWEDLDAEDEGDPLMVSEYVIEIFEYMKVLEQNT 242

Query: 171 MPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKL 230
           MP P+YM +Q EL WRMRG+LVDWLIE+HHKFRLLPETLFLAVNI+DRFLS+R+VS++KL
Sbjct: 243 MPNPNYMDNQKELRWRMRGVLVDWLIEIHHKFRLLPETLFLAVNIVDRFLSLRIVSIIKL 302

Query: 231 QLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMN 290
           QLVG+T + IAAKYEE++ P++ N +YM+D GY E E+LKAE+YVL  + + L YPNP++
Sbjct: 303 QLVGLTAMLIAAKYEEVMCPTVSNVVYMSDGGYEESELLKAEQYVLQILSWDLSYPNPIH 362

Query: 291 FLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHAN 350
           FLRR SKAD +DI+ RT+AKY MEIS V+ K L  PPS IAAA  YL+R  L+R EW  N
Sbjct: 363 FLRRVSKADDYDIETRTLAKYFMEISCVEEKLLQFPPSQIAAAGTYLARMCLDRGEWTPN 422

Query: 351 LIHYSQYTXXXXXXXXXXXXX-XXMKPTKHEQLYKKYAAKRFMKASIFVKDW 401
           L+HYS Y+                 K  KH+  Y+KYA+K+F+KAS FV++W
Sbjct: 423 LVHYSSYSVLELCPCAQVMLDYVKSKDIKHDAFYRKYASKKFLKASTFVREW 474



>gi|3901362|gb|AAC78639.1| cyclin B [Pneumocystis carinii]
          Length = 459

 Score =  353 bits (906), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 195/406 (48%), Positives = 250/406 (61%), Gaps = 45/406 (11%)

Query: 32  VATKQLAIREGVNNVTAIPQKKLGVVTRKRAVLMDRTNVSLKQNSVNEQTHDITKPIIKE 91
           V+T+ L   EGVN       K     TRKRA L D +NV    N  N+     T+P+  +
Sbjct: 32  VSTQGL---EGVN-------KPWTAATRKRAALGDVSNV---HNKENQTAKTKTQPLSTK 78

Query: 92  N---VNLGFQDIRSKEK------HELSFDTTLATTAESEIYEFDRKRSKKQKTQDWEDLD 142
                  G Q  +SKE        EL  + T      S++    +   + ++TQ  + + 
Sbjct: 79  ARVVTKTGVQSHQSKESVHTVPTGELRGEETTRKRRTSKVLTEQKVIIEVEQTQASKKVR 138

Query: 143 ADDFYD----------------------PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQ 180
            D   +                      P+M+SEY  +I  Y+++LE   +P PDYM  Q
Sbjct: 139 TDGLLNGSVQEHPASQDWDDLDADDAHDPLMVSEYVEEIMGYMRELEVLTLPLPDYMDRQ 198

Query: 181 SELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFI 240
            EL W+MRGILVDWLIEVH KFRLLPETLFL+VNIIDRFLS+RV SL KLQLVGIT LFI
Sbjct: 199 KELQWKMRGILVDWLIEVHAKFRLLPETLFLSVNIIDRFLSLRVCSLPKLQLVGITALFI 258

Query: 241 AAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADH 300
           AAKYEE++ PSI+NF+YMAD GYT EEILKAE+YVL  + + + YPNP+NFLRR SKAD+
Sbjct: 259 AAKYEEVMCPSIQNFMYMADGGYTNEEILKAEQYVLQVLGYDMSYPNPINFLRRVSKADN 318

Query: 301 FDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXX 360
           +DIQ RTVAKYLMEISL+D++FLP  PS IAA+ +YL+R M+    W+ANLIHYS Y   
Sbjct: 319 YDIQTRTVAKYLMEISLLDHRFLPFVPSNIAASGIYLARIMVTGGNWNANLIHYSGYKES 378

Query: 361 XXXXXXXXXXXXXMKPT-KHEQLYKKYAAKRFMKASIFVKDWISKN 405
                         +   KHE  +KKYA+K+FMKAS+FV+DW+ K+
Sbjct: 379 DLVPCSKMMLDYLSRSVIKHEAFFKKYASKKFMKASLFVRDWVKKH 424



>gi|501302997|dbj|GAC92516.1| hypothetical protein PHSY_000070 [Pseudozyma hubeiensis SY62]
          Length = 682

 Score =  353 bits (906), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 159/275 (57%), Positives = 208/275 (75%)

Query: 131 KKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGI 190
           K  K + WEDLDA+D  DP+M++EY  DIF+Y+K+LE   MP  DYM++Q E++W +R I
Sbjct: 289 KPAKDEGWEDLDAEDAEDPLMVAEYVNDIFEYMKELEIINMPNGDYMANQKEINWDVRAI 348

Query: 191 LVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAP 250
           LVDWL++VH KFRLLPETL+LAVNIIDRFLS R +SL KLQLVG+T +FIA+KYEE++ P
Sbjct: 349 LVDWLVDVHAKFRLLPETLYLAVNIIDRFLSRRTISLSKLQLVGVTAMFIASKYEEVMCP 408

Query: 251 SIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAK 310
           SI+NF Y+AD GYT+ EILKAERYVL  +DF + Y NPMNFLRR SKAD++DIQ RTVAK
Sbjct: 409 SIQNFYYLADGGYTDVEILKAERYVLKVLDFSMSYANPMNFLRRISKADNYDIQTRTVAK 468

Query: 311 YLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXX 370
           Y MEISL+DY+ +  PPS++AAA+++L+R++L R EW   L+HYS Y+            
Sbjct: 469 YFMEISLLDYRLMEHPPSLVAAASVWLAREVLERGEWTPTLVHYSTYSEQELLGTAEIML 528

Query: 371 XXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKN 405
              ++P  H+  +KKYA K+FM+AS +V DW  K 
Sbjct: 529 DYCLRPITHQFFHKKYAHKKFMRASTYVIDWAHKG 563



>gi|3860081|gb|AAC72972.1| cell division cycle protein Cdc13 [Pneumocystis carinii]
          Length = 459

 Score =  352 bits (904), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 199/406 (49%), Positives = 254/406 (62%), Gaps = 45/406 (11%)

Query: 32  VATKQLAIREGVNNVTAIPQKKLGVVTRKRAVLMDRTNVSLKQNSVNEQTHDITKPIIKE 91
           V+T+ L   EGVN       K     TRKRA L D +NV    N  N+     T+P+  +
Sbjct: 32  VSTQGL---EGVN-------KPWTAATRKRAALGDVSNV---HNKENQTAKTKTQPLSTK 78

Query: 92  N---VNLGFQDIRSKEK------HELSFD-------TTLATTAESEIYEFDRKR-SKKQK 134
                  G Q  +SKE        EL  +       T+   T +  I E ++ + SKK +
Sbjct: 79  ARVVTKTGVQSHQSKESVHTVPTGELRGEETTRKRRTSKVLTEQEVIIEVEQTQASKKVR 138

Query: 135 TQDWEDLDADDF--------------YDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQ 180
           T    +    +               +DP+M+SEY  +I  Y+++LE   +P PDYM  Q
Sbjct: 139 TDGLLNGSVQEHPASQDWDDLDADDAHDPLMVSEYVEEIMGYMRELEVLTLPLPDYMDRQ 198

Query: 181 SELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFI 240
            EL W+MRGILVDWLIEVH KFRLLPETLFL+VNIIDRFLS+RV SL KLQLVGIT LFI
Sbjct: 199 KELQWKMRGILVDWLIEVHAKFRLLPETLFLSVNIIDRFLSLRVCSLPKLQLVGITALFI 258

Query: 241 AAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADH 300
           AAKYEE++ PSI+NF+YMAD GYT EEILKAE+YVL  + + + YPNP+NFLRR SKAD+
Sbjct: 259 AAKYEEVMCPSIQNFMYMADGGYTNEEILKAEQYVLQVLGYDMSYPNPINFLRRVSKADN 318

Query: 301 FDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXX 360
           +DIQ RTVAKYLMEISL+D++FLP  PS IAA+ +YL+R M+    W+ANLIHYS Y   
Sbjct: 319 YDIQTRTVAKYLMEISLLDHRFLPFVPSNIAASGIYLARIMVTGGNWNANLIHYSGYKES 378

Query: 361 XXXXXXXXXXXXXMKPT-KHEQLYKKYAAKRFMKASIFVKDWISKN 405
                         +   KHE  +KKYA+K+FMKAS+FV+DW+ K+
Sbjct: 379 DLVPCSKMMLDYLSRSVIKHEAFFKKYASKKFMKASLFVRDWVKKH 424



>gi|343424831|emb|CBQ68369.1| probable Clb1-B-type cyclin 1 [Sporisorium reilianum SRZ2]
          Length = 669

 Score =  352 bits (904), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 213/288 (73%), Gaps = 7/288 (2%)

Query: 130 SKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRG 189
           +K  K + WEDLDA+D  DP+M++EY  DIF+Y+K+LE   MP  DYM +Q+E++W +R 
Sbjct: 280 NKPAKDEGWEDLDAEDAEDPLMVAEYVNDIFEYMKELEIVNMPNGDYMLTQNEINWDVRA 339

Query: 190 ILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLA 249
           ILVDWL++VH KFRLLPETL+LAVNIIDRFLS R +SL KLQLVG+T +FIA+KYEE++ 
Sbjct: 340 ILVDWLVDVHAKFRLLPETLYLAVNIIDRFLSRRTISLSKLQLVGVTAMFIASKYEEVMC 399

Query: 250 PSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVA 309
           PSI+NF Y+AD GYT+ EIL+AERYVL  +DF + Y NPMNFLRR SKAD++DIQ RTVA
Sbjct: 400 PSIQNFYYLADGGYTDVEILRAERYVLKVLDFSMSYANPMNFLRRISKADNYDIQTRTVA 459

Query: 310 KYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXX 369
           KY MEISL+DY+ +  PPS++AAA+++L+R++L R EW   L+HYS Y+           
Sbjct: 460 KYFMEISLLDYRLMEHPPSLVAAASVWLAREVLERGEWTPTLVHYSTYSEQELLGTAEIM 519

Query: 370 XXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK-------NVERQQ 410
               ++P  H+  +KKYA K+FM+AS +V DW  K        VE QQ
Sbjct: 520 LDYCLRPITHQFFHKKYAHKKFMRASTYVIDWAHKTFPEGVVGVEEQQ 567



>gi|470316495|gb|EMR08249.1| hypothetical protein PNEG_03416 [Pneumocystis murina B123]
          Length = 459

 Score =  350 bits (899), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 190/378 (50%), Positives = 249/378 (65%), Gaps = 31/378 (8%)

Query: 58  TRKRAVLMDRTNVSLKQNS--------VNEQTHDITKPII-----KENVN-LGFQDIRSK 103
           TRKRA L D +NV  K+N         ++ +T  +TK  +     KE+V+ +   D+  +
Sbjct: 48  TRKRAALGDVSNVHNKENQAAKTKAQPLSTKTRVVTKSAVQTHQTKESVHTVPTVDLHGE 107

Query: 104 EKHELSFDTTLATTAESEIYEFDRKR-SKKQKTQDWEDLDADDF--------------YD 148
           E       T+   T +  + E ++ + SKK +T    +  A +               +D
Sbjct: 108 ETTR-KRRTSKVLTEQKLVVEVEQTQASKKVRTDGLLNTSAQEHPPSQDWDDLDADDAHD 166

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M+SEY  +I  Y+++LE   +P PDYM  Q EL W+MRGILVDWLIEVH KFRLLPET
Sbjct: 167 PLMVSEYVEEIMSYMRELEVLTLPLPDYMDRQKELQWKMRGILVDWLIEVHAKFRLLPET 226

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFL+VNIIDRFLS+RV SL KLQLVGIT LFIAAKYEE++ PSI+NF+YMAD GYT EEI
Sbjct: 227 LFLSVNIIDRFLSLRVCSLPKLQLVGITALFIAAKYEEVMCPSIQNFMYMADGGYTNEEI 286

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           LKAE+YVL  + + + YPNP+NFLRR SKAD++DIQ RTVAKYLMEISL+D++FLP  PS
Sbjct: 287 LKAEQYVLQVLGYDMSYPNPINFLRRVSKADNYDIQTRTVAKYLMEISLLDHRFLPFVPS 346

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT-KHEQLYKKYA 387
            IAA+ +YL+R M+    W+ANLIHYS Y                 +   KHE  +KKYA
Sbjct: 347 NIAASGIYLARIMVTGGNWNANLIHYSGYKESDLVPCSKMMLDYLSRSVIKHEAFFKKYA 406

Query: 388 AKRFMKASIFVKDWISKN 405
           +K+FMKAS+FV+DW+ K+
Sbjct: 407 SKKFMKASLFVRDWVKKH 424



>gi|443896858|dbj|GAC74201.1| cyclin B and related kinase-activating proteins [Pseudozyma
           antarctica T-34]
          Length = 923

 Score =  349 bits (895), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 208/275 (75%)

Query: 131 KKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGI 190
           K  K + WEDLDA+D  DP+M++EY  DIF+Y+K+LE   MP  DYM+ Q E++W +R I
Sbjct: 534 KPAKDEGWEDLDAEDAEDPLMVAEYVNDIFEYMKELEIINMPNGDYMAQQKEINWEVRAI 593

Query: 191 LVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAP 250
           L+DWL+++H KFRLLPETL+LAVNIIDRFLS R +SL KLQL+G+T +FIA+KYEE++ P
Sbjct: 594 LIDWLVDIHAKFRLLPETLYLAVNIIDRFLSRRTISLSKLQLIGVTAMFIASKYEEVMCP 653

Query: 251 SIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAK 310
           SI+NF Y+AD GYT+ EIL+AERYVL  +DF + Y NPMNFLRR SKAD++DIQ RTVAK
Sbjct: 654 SIQNFYYLADGGYTDLEILRAERYVLKVLDFSMSYANPMNFLRRISKADNYDIQTRTVAK 713

Query: 311 YLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXX 370
           Y MEISL+DY+ +  PPS++AAA+++L+R++L R EW   L+HYS Y+            
Sbjct: 714 YFMEISLLDYRLMEHPPSLVAAASVWLAREVLERGEWTPTLVHYSTYSEQELLGTAEIML 773

Query: 371 XXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKN 405
              ++PT H+  +KKYA K+FM+AS +V DW  + 
Sbjct: 774 DYCLRPTAHQFFHKKYAHKKFMRASTYVIDWAKRT 808



>gi|189189570|ref|XP_001931124.1| G2/mitotic-specific cyclin CYB1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187972730|gb|EDU40229.1| G2/mitotic-specific cyclin CYB1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 509

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 156/265 (58%), Positives = 201/265 (75%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           D  DLD +D  DP+M+SEY V+IF+YLK+LE   M  PDYM SQ+EL W+MRGILVDWL+
Sbjct: 219 DGPDLDKEDVDDPLMVSEYVVEIFEYLKELEIATMANPDYMDSQTELEWKMRGILVDWLL 278

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           EVH +FRLLPETLFLAVNIIDRFLS ++V L +LQLVG+T +FIA+KYEE+L+P ++NF 
Sbjct: 279 EVHTRFRLLPETLFLAVNIIDRFLSAKIVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFR 338

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           ++AD+G+TEEEIL AER+VL  +++ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EI 
Sbjct: 339 HVADDGFTEEEILSAERFVLAALNYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEIG 398

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP 376
            +D++FL  PPS +AAAA+YLSR +L R  W A L HY+ YT                 P
Sbjct: 399 CLDHRFLAHPPSQVAAAAMYLSRLVLERGPWDATLTHYAGYTEEEIQPVLQLMIDYLSGP 458

Query: 377 TKHEQLYKKYAAKRFMKASIFVKDW 401
             HE  +KKYA+K+F+KASI ++ W
Sbjct: 459 VVHEAFFKKYASKKFLKASIVLRKW 483



>gi|452988416|gb|EME88171.1| hypothetical protein MYCFIDRAFT_86001 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 502

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 228/315 (72%), Gaps = 1/315 (0%)

Query: 91  ENVNLGFQDIRSKEKHELSFDTTLATTAE-SEIYEFDRKRSKKQKTQDWEDLDADDFYDP 149
           ENV       +SK +   S  + L+   E  +  E+++++S +Q  ++ +DLD++D  DP
Sbjct: 173 ENVPPPTNGAKSKVEKRASVKSMLSEPIELDDDDEYEQEKSLEQLIKEAKDLDSEDLDDP 232

Query: 150 MMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETL 209
           +M++EY  +IF Y+KDLE   +P PDYM++Q++L W+MRGILVDWL+EVH +FRLLPETL
Sbjct: 233 LMVAEYVHEIFDYMKDLEISTLPNPDYMANQTDLEWKMRGILVDWLLEVHARFRLLPETL 292

Query: 210 FLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEIL 269
           FLAVNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P ++NF+++AD+G+ + EIL
Sbjct: 293 FLAVNIIDRFLSCKVVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFVHVADDGFKDTEIL 352

Query: 270 KAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSM 329
            AER+VL+T+D+ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EI  +D++FL  PPS 
Sbjct: 353 SAERFVLSTLDYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEIGCLDHRFLKYPPSQ 412

Query: 330 IAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAK 389
           +AAAA+YL+R  L+R EW A L  Y+ YT                 P  HE  ++KYA+K
Sbjct: 413 VAAAAMYLARLALDRGEWDATLAKYAGYTEADIQPVFKLMVDYLYSPVVHEAFFRKYASK 472

Query: 390 RFMKASIFVKDWISK 404
           +F+KASI ++ W  K
Sbjct: 473 KFLKASIVLRQWAKK 487



>gi|169608081|ref|XP_001797460.1| hypothetical protein SNOG_07107 [Phaeosphaeria nodorum SN15]
 gi|111064638|gb|EAT85758.1| hypothetical protein SNOG_07107 [Phaeosphaeria nodorum SN15]
          Length = 489

 Score =  347 bits (890), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 207/272 (76%)

Query: 135 TQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDW 194
           T+ + DLD +D  DP+M+SEY V+IF+YLK+LE   M  PDYM +Q+EL W+MRGILVDW
Sbjct: 197 TEAFVDLDKEDVDDPLMVSEYVVEIFEYLKELEIATMANPDYMENQNELEWKMRGILVDW 256

Query: 195 LIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKN 254
           L+EVH +FRLLPETLFLAVNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P ++N
Sbjct: 257 LLEVHTRFRLLPETLFLAVNIIDRFLSAKVVQLDRLQLVGVTAMFIASKYEEVLSPHVQN 316

Query: 255 FIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLME 314
           F ++AD+G+TE+EIL AER+VL  +++ L YPNPMNFLRR SKAD++DIQ RT+ KYL+E
Sbjct: 317 FRHVADDGFTEDEILSAERFVLAALNYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLE 376

Query: 315 ISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXM 374
           I  +D++FL  PPS +AAA++YL+R +L+R  W A L+HYS YT                
Sbjct: 377 IGCLDHRFLAHPPSQVAAASMYLARLVLDRGPWDATLVHYSGYTEEEIQPVLQLMIDYLS 436

Query: 375 KPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
            P  HE  +KKYA+K+F+KASI ++ W  K V
Sbjct: 437 SPVIHEAFFKKYASKKFLKASIVLRQWAKKYV 468



>gi|330938255|ref|XP_003305714.1| hypothetical protein PTT_18629 [Pyrenophora teres f. teres 0-1]
 gi|311317140|gb|EFQ86181.1| hypothetical protein PTT_18629 [Pyrenophora teres f. teres 0-1]
          Length = 510

 Score =  347 bits (890), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 201/265 (75%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           D  DLD +D  DP+M+SEY V+IF+YLK+LE   M  PDYM SQ+EL W+MRGILVDWL+
Sbjct: 220 DGPDLDKEDVDDPLMVSEYVVEIFEYLKELEIATMANPDYMDSQTELEWKMRGILVDWLL 279

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           EVH +FRLLPETLFLAVNIIDRFLS ++V L +LQLVG+T +FIA+KYEE+L+P ++NF 
Sbjct: 280 EVHTRFRLLPETLFLAVNIIDRFLSAKIVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFR 339

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           ++AD+G+TEEEIL AER+VL  +++ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EI 
Sbjct: 340 HVADDGFTEEEILSAERFVLAALNYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEIG 399

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP 376
            +D++FL  PPS +AAAA+YL+R +L R  W A L HY+ YT                 P
Sbjct: 400 CLDHRFLAHPPSQVAAAAMYLARLVLERGPWDATLTHYAGYTEEEIQPVLQLMIDYLSGP 459

Query: 377 TKHEQLYKKYAAKRFMKASIFVKDW 401
             HE  +KKYA+K+F+KASI ++ W
Sbjct: 460 VVHEAFFKKYASKKFLKASIVLRKW 484



>gi|451999197|gb|EMD91660.1| hypothetical protein COCHEDRAFT_1156003 [Bipolaris maydis C5]
 gi|477591511|gb|ENI08583.1| hypothetical protein COCC4DRAFT_57321 [Bipolaris maydis ATCC 48331]
          Length = 517

 Score =  347 bits (889), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 156/270 (57%), Positives = 203/270 (75%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           D  DLD +D  DP+M+SEY V+IF+YLK+LE   M  PDYM SQ+EL W+MRGILVDWL+
Sbjct: 227 DGPDLDKEDVDDPLMVSEYVVEIFEYLKELEIATMANPDYMESQTELEWKMRGILVDWLL 286

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           EVH +FRLLPETLFLAVNIIDRFLS ++V L +LQLVG+T +FIA+KYEE+L+P ++NF 
Sbjct: 287 EVHTRFRLLPETLFLAVNIIDRFLSTKIVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFR 346

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           ++AD+G+TEEEIL AER+VL  +++ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EI 
Sbjct: 347 HVADDGFTEEEILSAERFVLAALNYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEIG 406

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP 376
            +D++FL  PPS +AAAA+YL+R +L R  W A L HY+ YT                 P
Sbjct: 407 CLDHRFLAHPPSQVAAAAMYLARLVLERGPWDATLTHYAGYTEQEIQPVLELMIDYLSGP 466

Query: 377 TKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
             HE  +KKYA+K+F+KASI ++ W  + V
Sbjct: 467 VVHEAFFKKYASKKFLKASIVLRKWAKEYV 496



>gi|451848164|gb|EMD61470.1| hypothetical protein COCSADRAFT_231894 [Bipolaris sorokiniana
           ND90Pr]
          Length = 517

 Score =  347 bits (889), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 155/270 (57%), Positives = 203/270 (75%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           D  DLD +D  DP+M+SEY V+IF+YLK+LE   M  PDYM SQ+EL W+MRGIL+DWL+
Sbjct: 227 DGPDLDKEDVDDPLMVSEYVVEIFEYLKELEIATMANPDYMESQTELEWKMRGILIDWLL 286

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           EVH +FRLLPETLFLAVNIIDRFLS ++V L +LQLVG+T +FIA+KYEE+L+P ++NF 
Sbjct: 287 EVHTRFRLLPETLFLAVNIIDRFLSTKIVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFR 346

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           ++AD+G+TEEEIL AER+VL  +++ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EI 
Sbjct: 347 HVADDGFTEEEILSAERFVLAALNYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEIG 406

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP 376
            +D++FL  PPS +AAAA+YL+R +L R  W A L HY+ YT                 P
Sbjct: 407 CLDHRFLAHPPSQVAAAAMYLARLVLERGPWDATLTHYAGYTEQEIQPVLELMIDYLSSP 466

Query: 377 TKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
             HE  +KKYA+K+F+KASI ++ W  + V
Sbjct: 467 VVHEAFFKKYASKKFLKASIVLRKWAKEYV 496



>gi|407924550|gb|EKG17586.1| Cyclin [Macrophomina phaseolina MS6]
          Length = 506

 Score =  346 bits (888), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 202/265 (76%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLD +D  DP+M+SEY  +IF YLK+LE   M  PDYM +QSEL W+MRGILVDWL+EVH
Sbjct: 223 DLDEEDANDPLMVSEYVCEIFDYLKELEIATMANPDYMDNQSELEWKMRGILVDWLLEVH 282

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFLAVNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P ++NF ++A
Sbjct: 283 TRFRLLPETLFLAVNIIDRFLSRKVVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFRHVA 342

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G+TEEEIL AER+VL  +D+ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EIS +D
Sbjct: 343 DDGFTEEEILSAERFVLAALDYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEISCLD 402

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+  PPS I+AAA+YL+R +L+R EW A L HY+ YT                 P  H
Sbjct: 403 HRFIAYPPSQISAAAMYLARLVLDRGEWDAVLAHYAGYTEEEIQPVLALMIDYLKAPVVH 462

Query: 380 EQLYKKYAAKRFMKASIFVKDWISK 404
           E  +KKYA+K+F+KASI ++ W  K
Sbjct: 463 EAFFKKYASKKFLKASIVLRQWAKK 487



>gi|482805063|gb|EOA82162.1| hypothetical protein SETTUDRAFT_23404 [Setosphaeria turcica Et28A]
          Length = 512

 Score =  346 bits (887), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 155/270 (57%), Positives = 203/270 (75%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           D  DLD +D  DP+M+SEY V+IF+YLK+LE   M  PDYM SQ+EL W+MRGILVDWL+
Sbjct: 222 DGPDLDKEDVDDPLMVSEYVVEIFEYLKELEIATMANPDYMESQTELEWKMRGILVDWLL 281

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           EVH +FRLLPETLFLAVNIIDRFLS ++V L +LQLVG+T +FIA+KYEE+L+P ++NF 
Sbjct: 282 EVHTRFRLLPETLFLAVNIIDRFLSTKIVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFR 341

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           ++AD+G+TEEEIL AER+VL  +++ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EI 
Sbjct: 342 HVADDGFTEEEILSAERFVLAALNYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEIG 401

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP 376
            +D++FL  PPS +AAAA+YL+R +L R  W A L HY+ Y+                 P
Sbjct: 402 CLDHRFLAHPPSQVAAAAMYLARLVLERGPWDATLTHYAGYSEEEIQPVLQLMIDYLSGP 461

Query: 377 TKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
             HE  +KKYA+K+F+KASI ++ W  + V
Sbjct: 462 VVHEAFFKKYASKKFLKASIVLRKWAKEYV 491



>gi|405122876|gb|AFR97642.1| g2/mitotic-specific cyclin cdc13 [Cryptococcus neoformans var.
           grubii H99]
          Length = 534

 Score =  346 bits (887), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 153/275 (55%), Positives = 210/275 (76%), Gaps = 2/275 (0%)

Query: 132 KQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGIL 191
           K K + W DLDA+D  DP M+SEY V+ FKY+ D++++ MP P+YM +Q+EL W+MR IL
Sbjct: 212 KAKDEGWTDLDAEDEGDPTMVSEYVVEAFKYMMDIQAQTMPDPEYMDNQAELQWKMRQIL 271

Query: 192 VDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPS 251
           +DW+IEVH KFRLLPETLF+A N++DRFLS RV+SLVK QLVG+T LFIA+KYEE+  P 
Sbjct: 272 MDWIIEVHSKFRLLPETLFIATNLVDRFLSKRVISLVKFQLVGLTALFIASKYEEVCCPG 331

Query: 252 IKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKY 311
           +++F++M+D GYT EE+LKAERY+L+T+ F + YPNP+NF+RR SKAD +DIQ+RTVAKY
Sbjct: 332 VEHFLHMSDGGYTVEELLKAERYMLSTLQFDMSYPNPLNFIRRISKADGYDIQSRTVAKY 391

Query: 312 LMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXX 371
           L+EIS VD++ L   PSM+AAA+++L+R  L R EW+ANL+HYS Y+             
Sbjct: 392 LVEISCVDHRLLGYTPSMLAAASMWLARLCLERGEWNANLVHYSTYSEDEIRPCAQVMLD 451

Query: 372 XXMKPTKHE--QLYKKYAAKRFMKASIFVKDWISK 404
             + P   E    YKKYA+K+ MKAS++V++W ++
Sbjct: 452 YILDPDFDESTSFYKKYASKKHMKASVYVREWATQ 486



>gi|58259721|ref|XP_567273.1| g2/mitotic-specific cyclin cdc13 [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134116772|ref|XP_773058.1| hypothetical protein CNBJ3340 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255678|gb|EAL18411.1| hypothetical protein CNBJ3340 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229323|gb|AAW45756.1| g2/mitotic-specific cyclin cdc13, putative [Cryptococcus neoformans
           var. neoformans JEC21]
          Length = 534

 Score =  346 bits (887), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 156/280 (55%), Positives = 212/280 (75%), Gaps = 4/280 (1%)

Query: 129 RSKKQKTQD--WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWR 186
           RS K K +D  W DLDA+D  DP M+SEY V+ FKY+ D++ + MP P+YM +Q+EL W+
Sbjct: 207 RSPKIKAKDDGWTDLDAEDEGDPTMVSEYVVEAFKYMMDIQGQTMPDPEYMDNQAELQWK 266

Query: 187 MRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEE 246
           MR IL+DW+IEVH KFRLLPETLF+A N++DRFLS RV+SLVK QLVG+T LFIA+KYEE
Sbjct: 267 MRQILMDWIIEVHSKFRLLPETLFIATNLVDRFLSKRVISLVKFQLVGLTALFIASKYEE 326

Query: 247 LLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQAR 306
           +  P +++F++M+D GYT EE+LKAERY+L+T+ F + YPNP+NF+RR SKAD +DIQ+R
Sbjct: 327 VCCPGVEHFLHMSDGGYTVEELLKAERYMLSTLQFDMSYPNPLNFIRRISKADGYDIQSR 386

Query: 307 TVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXX 366
           TVAKYL+EIS VD++ L   PSM+AAA+++L+R  L R EW+ANL+HYS Y+        
Sbjct: 387 TVAKYLVEISCVDHRLLGYTPSMLAAASMWLARLCLERGEWNANLVHYSTYSEDEIRPCA 446

Query: 367 XXXXXXXMKPTKHE--QLYKKYAAKRFMKASIFVKDWISK 404
                  + P   E    YKKYA+K+ MKAS++V++W ++
Sbjct: 447 QVMLDHILDPDFDESTSFYKKYASKKHMKASVYVREWATQ 486



>gi|37706314|gb|AAR01624.1| cyclin [Cryptococcus neoformans var. neoformans]
          Length = 534

 Score =  346 bits (887), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 156/280 (55%), Positives = 212/280 (75%), Gaps = 4/280 (1%)

Query: 129 RSKKQKTQD--WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWR 186
           RS K K +D  W DLDA+D  DP M+SEY V+ FKY+ D++ + MP P+YM +Q+EL W+
Sbjct: 207 RSPKIKAKDDGWTDLDAEDEGDPTMVSEYVVEAFKYMMDIQGQTMPDPEYMDNQAELQWK 266

Query: 187 MRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEE 246
           MR IL+DW+IEVH KFRLLPETLF+A N++DRFLS RV+SLVK QLVG+T LFIA+KYEE
Sbjct: 267 MRQILMDWIIEVHSKFRLLPETLFIATNLVDRFLSKRVISLVKFQLVGLTALFIASKYEE 326

Query: 247 LLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQAR 306
           +  P +++F++M+D GYT EE+LKAERY+L+T+ F + YPNP+NF+RR SKAD +DIQ+R
Sbjct: 327 VCCPGVEHFLHMSDGGYTVEELLKAERYMLSTLQFDMSYPNPLNFIRRISKADGYDIQSR 386

Query: 307 TVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXX 366
           TVAKYL+EIS VD++ L   PSM+AAA+++L+R  L R EW+ANL+HYS Y+        
Sbjct: 387 TVAKYLVEISCVDHRLLGYTPSMLAAASMWLARLCLERGEWNANLVHYSTYSEDEIRPCA 446

Query: 367 XXXXXXXMKPTKHE--QLYKKYAAKRFMKASIFVKDWISK 404
                  + P   E    YKKYA+K+ MKAS++V++W ++
Sbjct: 447 QVMLDRILDPDFDESTSFYKKYASKKHMKASVYVREWATQ 486



>gi|342319260|gb|EGU11210.1| G2/mitotic-specific cyclin CYB1 [Rhodotorula glutinis ATCC 204091]
          Length = 720

 Score =  345 bits (886), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 154/245 (62%), Positives = 202/245 (82%), Gaps = 5/245 (2%)

Query: 119 ESEIYEFDRKRSKKQKTQ-----DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPK 173
           + E  ++++ R  K +T+      W DLDA D  DP+M+S Y V+I++YL++LE   MP 
Sbjct: 308 DKEAVDYEQARVSKWETEVEEKPKWVDLDAGDEEDPLMVSTYVVEIYEYLRELELTTMPD 367

Query: 174 PDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLV 233
           PDY+S+QSE++W+MRGILVDWL+E+H KFRLLPET+FLAVNI+DRFLSVRVVSLVK QLV
Sbjct: 368 PDYISNQSEVTWKMRGILVDWLVEIHTKFRLLPETIFLAVNILDRFLSVRVVSLVKFQLV 427

Query: 234 GITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLR 293
           G+T LFIAAKYEE++ PS++NF++M D G+T+EE+LKAERY+L  IDF L YPNP+NFLR
Sbjct: 428 GVTALFIAAKYEEVVCPSVQNFLFMTDGGFTDEELLKAERYILGIIDFNLSYPNPLNFLR 487

Query: 294 RSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIH 353
           R SKA+ +DIQ RT+AKYLMEIS+VD++F+  PPS+IAAAA +L+R++L + EW ANLIH
Sbjct: 488 RISKAEGYDIQCRTMAKYLMEISIVDHRFMAAPPSLIAAAATWLARRVLEKGEWDANLIH 547

Query: 354 YSQYT 358
           YS YT
Sbjct: 548 YSGYT 552



>gi|472584134|gb|EMS21740.1| G2/mitotic-specific cyclin 1/2 [Rhodosporidium toruloides NP11]
          Length = 653

 Score =  345 bits (885), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 150/221 (67%), Positives = 191/221 (86%)

Query: 138 WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIE 197
           W DLDA D  DP+M+S Y V+I++YL++LE   MP PDY+S+QSE++W+MRGILVDWL+E
Sbjct: 334 WVDLDAGDEEDPLMVSTYVVEIYEYLRELELTTMPDPDYISNQSEVTWKMRGILVDWLVE 393

Query: 198 VHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIY 257
           +H KFRLLPET+FLAVNI+DRFLSVRVVSLVK QLVG+T LFIAAKYEE++ PS++NF++
Sbjct: 394 IHTKFRLLPETIFLAVNILDRFLSVRVVSLVKFQLVGVTALFIAAKYEEVVCPSVQNFLF 453

Query: 258 MADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISL 317
           M D G+T+EE+LKAERY+L  IDF L YPNP+NFLRR SKA+ +DIQ RT+AKYLMEIS+
Sbjct: 454 MTDGGFTDEELLKAERYILGIIDFNLSYPNPLNFLRRISKAEGYDIQCRTMAKYLMEISI 513

Query: 318 VDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYT 358
           VD++F+  PPS+IAAAA +L+R++L + EW ANLIHYS YT
Sbjct: 514 VDHRFMAAPPSLIAAAATWLARRVLEKGEWDANLIHYSGYT 554



>gi|388855945|emb|CCF50520.1| probable b-type cyclin 1 [Ustilago hordei]
          Length = 667

 Score =  344 bits (882), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 207/275 (75%)

Query: 131 KKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGI 190
           K  K + WEDLDA+D  DP+M++EY  DIF+Y+K+LE   MP  DYMS Q E++W +R I
Sbjct: 269 KPPKDEGWEDLDAEDAEDPLMVAEYVNDIFEYMKELEIINMPNGDYMSLQEEINWDVRAI 328

Query: 191 LVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAP 250
           L+DWL++VH KFRLLPETL+LAVNIIDRFLS R +SL KLQLVG+T +FIA+KYEE++ P
Sbjct: 329 LIDWLVDVHTKFRLLPETLYLAVNIIDRFLSRRTISLSKLQLVGVTAMFIASKYEEVMCP 388

Query: 251 SIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAK 310
           SIKNF ++AD GYT+ EIL+AERYVL  +DF + Y NPMNFLRR SKAD++DIQ RTVAK
Sbjct: 389 SIKNFYHIADGGYTDVEILRAERYVLKVLDFSMSYANPMNFLRRISKADNYDIQTRTVAK 448

Query: 311 YLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXX 370
           Y MEISL+DY+ +  PPS+IAAAA +L+R++L R EW   L+HYS Y+            
Sbjct: 449 YFMEISLLDYRLMEHPPSLIAAAAAWLAREVLERGEWTPTLVHYSTYSEQELLGTAEIML 508

Query: 371 XXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKN 405
              ++P  H+  +KKYA K+FM+AS +V DW  K+
Sbjct: 509 DYCLRPITHQFFHKKYAHKKFMRASTYVVDWARKS 543



>gi|321258490|ref|XP_003193966.1| g2/mitotic-specific cyclin cdc13 [Cryptococcus gattii WM276]
 gi|317460436|gb|ADV22179.1| g2/mitotic-specific cyclin cdc13, putative [Cryptococcus gattii
           WM276]
          Length = 534

 Score =  344 bits (882), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 210/275 (76%), Gaps = 2/275 (0%)

Query: 132 KQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGIL 191
           K K + W DLDA+D  DP M+SEY V+ F+Y+ D++++ MP P+YM +Q+EL W+MR IL
Sbjct: 212 KAKDEGWTDLDAEDEGDPTMVSEYVVEAFEYMMDIQAQTMPDPEYMDNQAELQWKMRQIL 271

Query: 192 VDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPS 251
           +DW+IEVH KFRLLPETLF+A N++DRFLS RV+SLVK QLVG+T LFIA+KYEE+  P 
Sbjct: 272 MDWIIEVHSKFRLLPETLFIATNLVDRFLSKRVISLVKFQLVGLTALFIASKYEEVCCPG 331

Query: 252 IKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKY 311
           +++F++M+D GYT EE+LKAERY+L+T+ F + YPNP+NF+RR SKAD +DIQ+RTVAKY
Sbjct: 332 VEHFLHMSDGGYTVEELLKAERYMLSTLQFDMSYPNPLNFIRRISKADGYDIQSRTVAKY 391

Query: 312 LMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXX 371
           L+EIS VD++ L   PSM+AAA+++L+R  L R EW+ANL+HYS Y+             
Sbjct: 392 LVEISCVDHRLLGYTPSMLAAASMWLARLCLERGEWNANLVHYSTYSEDEIRPCAQVMLD 451

Query: 372 XXMKPTKHE--QLYKKYAAKRFMKASIFVKDWISK 404
             + P   E    YKKYA+K+ MKAS++V++W ++
Sbjct: 452 YILDPDFDESSSFYKKYASKKHMKASVYVREWATQ 486



>gi|485921531|gb|EOD47223.1| putative g2 mitotic-specific cyclin-b protein [Neofusicoccum parvum
           UCRNP2]
          Length = 506

 Score =  344 bits (882), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 156/265 (58%), Positives = 202/265 (76%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLD +D  DP+M+SEY  +IF YL++LE   M  PDYM +QSEL W+MRGILVDWL+EVH
Sbjct: 223 DLDEEDANDPLMVSEYVCEIFDYLRELEIATMANPDYMDNQSELEWKMRGILVDWLLEVH 282

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFLAVNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P ++NF ++A
Sbjct: 283 TRFRLLPETLFLAVNIIDRFLSRKVVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFRHVA 342

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G+TEEEIL AER+VL  +D+ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EIS +D
Sbjct: 343 DDGFTEEEILSAERFVLAALDYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEISCLD 402

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+  PPS I+AAA+YL+R +L+R EW A L HY+ YT                 P  H
Sbjct: 403 HRFIAYPPSQISAAAMYLARLVLDRGEWDAVLAHYAGYTEEEIRPVLELMIDYLKAPVVH 462

Query: 380 EQLYKKYAAKRFMKASIFVKDWISK 404
           E  +KKYA+K+F+KASI ++ W  K
Sbjct: 463 EAFFKKYASKKFLKASIVLRQWAKK 487



>gi|396463102|ref|XP_003836162.1| similar to G2/mitotic-specific cyclin-B [Leptosphaeria maculans
           JN3]
 gi|312212714|emb|CBX92797.1| similar to G2/mitotic-specific cyclin-B [Leptosphaeria maculans
           JN3]
          Length = 508

 Score =  343 bits (881), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 154/262 (58%), Positives = 200/262 (76%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +LDA+D  DP+M+SEY V+IF+YLK+LE   M  PDYM SQSEL W+MRGILVDWL+EVH
Sbjct: 221 NLDAEDIDDPLMVSEYVVEIFEYLKELEIATMANPDYMDSQSELEWKMRGILVDWLLEVH 280

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFLAVNIIDRFLS ++V L +LQLVG+T +FIA+KYEE+L+P ++NF ++A
Sbjct: 281 TRFRLLPETLFLAVNIIDRFLSAKIVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFRHVA 340

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G+TEEEIL AER+VL  +++ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EI  +D
Sbjct: 341 DDGFTEEEILSAERFVLAALNYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEIGCLD 400

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++FL  PPS +AAAA+YL+R +L R  W   L HY+ YT                 P  H
Sbjct: 401 HRFLAHPPSQVAAAAMYLARLVLERGPWDVTLAHYAGYTEDEIQPVLQLMIDYLSGPVVH 460

Query: 380 EQLYKKYAAKRFMKASIFVKDW 401
           E  +KKYA+K+F+KASI ++ W
Sbjct: 461 EAFFKKYASKKFLKASIVLRKW 482



>gi|512202738|gb|EPE31564.1| Cyclin-like protein [Glarea lozoyensis ATCC 20868]
          Length = 486

 Score =  343 bits (881), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 209/288 (72%)

Query: 119 ESEIYEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMS 178
           E+E+   D K +  +  +  EDLD +D  DP+M++EY V+IF YLK+LE   +P  DYM 
Sbjct: 183 ETELAIEDEKSTATKFAEGVEDLDKEDMDDPLMVAEYVVEIFDYLKELELSTLPNADYME 242

Query: 179 SQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGL 238
            Q +L W+MRGILVDWLIEVH +F LLPETLFLAVNIIDRFLS + V L +LQLVG+T +
Sbjct: 243 HQEDLEWKMRGILVDWLIEVHTRFHLLPETLFLAVNIIDRFLSAKAVQLDRLQLVGVTAM 302

Query: 239 FIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKA 298
           FIA+KYEE+L+P + NF ++AD+G++E+EIL AERYVLTT+++ L YPNPMNFLRR SKA
Sbjct: 303 FIASKYEEVLSPHVANFKHVADDGFSEQEILSAERYVLTTLNYDLSYPNPMNFLRRISKA 362

Query: 299 DHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYT 358
           D++DIQ RT+ KYLMEISL+D++F+   PS +AAA++YL+R +L R EW A L HYS Y 
Sbjct: 363 DNYDIQTRTLGKYLMEISLLDHRFMHYLPSHVAAASMYLARMILERGEWDATLTHYSGYN 422

Query: 359 XXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
                           +P  HE  +KKYA+K+F+KASI  + W  ++ 
Sbjct: 423 EEEIEPVFRLMVDYLARPVSHEAFFKKYASKKFLKASILTRSWAKRHA 470



>gi|475668917|gb|EMT66703.1| G2/mitotic-specific cyclin-B [Fusarium oxysporum f. sp. cubense
           race 4]
          Length = 479

 Score =  340 bits (873), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 152/268 (56%), Positives = 203/268 (75%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD++D  DP+M++EYA +IF+YL+DLE + +P P YMS Q EL W+ RGILVDWL+EV
Sbjct: 196 KDLDSEDLEDPLMVAEYANEIFEYLRDLECKSIPNPQYMSHQDELEWKTRGILVDWLVEV 255

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLAVN+IDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P ++NF  +
Sbjct: 256 HTRFHLLPETLFLAVNLIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVENFKRI 315

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G+TE EIL AER++L+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEI L+
Sbjct: 316 ADDGFTEAEILSAERFILSTLNYDLSYPNPMNFLRRVSKADNYDIQSRTIGKYLMEIGLL 375

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+   PS IAA A+YL+R ML+R EW   L +Y+ YT                +P  
Sbjct: 376 DHRFMAYRPSHIAAGAMYLARLMLDRGEWDETLSYYAGYTEDEIEPVVHLMVDYLARPVT 435

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKYA+K+F+KASI  + W  KN 
Sbjct: 436 HEAFFKKYASKKFLKASILARQWAKKNA 463



>gi|342890451|gb|EGU89269.1| hypothetical protein FOXB_00222 [Fusarium oxysporum Fo5176]
 gi|477507282|gb|ENH60576.1| G2/mitotic-specific cyclin-B [Fusarium oxysporum f. sp. cubense
           race 1]
          Length = 479

 Score =  340 bits (873), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 152/268 (56%), Positives = 203/268 (75%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD++D  DP+M++EYA +IF+YL+DLE + +P P YMS Q EL W+ RGILVDWL+EV
Sbjct: 196 KDLDSEDLEDPLMVAEYANEIFEYLRDLECKSIPNPQYMSHQDELEWKTRGILVDWLVEV 255

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLAVN+IDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P ++NF  +
Sbjct: 256 HTRFHLLPETLFLAVNLIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVENFKRI 315

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G+TE EIL AER++L+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEI L+
Sbjct: 316 ADDGFTEAEILSAERFILSTLNYDLSYPNPMNFLRRVSKADNYDIQSRTIGKYLMEIGLL 375

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+   PS IAA A+YL+R ML+R EW   L +Y+ YT                +P  
Sbjct: 376 DHRFMAYRPSHIAAGAMYLARLMLDRGEWDETLSYYAGYTEDEIEPVVHLMVDYLARPVT 435

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKYA+K+F+KASI  + W  KN 
Sbjct: 436 HEAFFKKYASKKFLKASILARQWAKKNA 463



>gi|345570476|gb|EGX53297.1| hypothetical protein AOL_s00006g163 [Arthrobotrys oligospora ATCC
           24927]
          Length = 480

 Score =  340 bits (872), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 159/285 (55%), Positives = 211/285 (74%), Gaps = 2/285 (0%)

Query: 119 ESEIY--EFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDY 176
           E E++  E + KR++  + Q    L+ ++  DP+M++EYA +I  YL+DLE + M  P+Y
Sbjct: 178 EGEVFANEPNSKRTRVVEPQPAIILENEEDDDPLMVAEYAEEIDAYLRDLEPKSMANPEY 237

Query: 177 MSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGIT 236
           M  Q EL W+MRGILVDWLIEVH +FRLLPETL+L VNIIDRFL ++ V L KLQLVG+ 
Sbjct: 238 MDHQDELQWKMRGILVDWLIEVHTRFRLLPETLYLTVNIIDRFLGLKQVGLDKLQLVGVA 297

Query: 237 GLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSS 296
            +++AAKYEE+ +PSIKNFIY++D GY E+E+L+AERY+LTT+D+ L YPNPMNFLRR S
Sbjct: 298 AMWVAAKYEEVYSPSIKNFIYVSDGGYVEDELLRAERYILTTLDYDLSYPNPMNFLRRIS 357

Query: 297 KADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQ 356
           KAD +DI+ RT AKYLME+SL+DY+FL  P S++AAAA+Y++RKM NR  W+A+L+HYS 
Sbjct: 358 KADDYDIRTRTFAKYLMEVSLLDYRFLEYPGSLVAAAAMYMARKMYNRGSWNASLVHYSG 417

Query: 357 YTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDW 401
           YT                +P KHE  + KYA K+F KASI V+ W
Sbjct: 418 YTEDEIMPVFKLMVDYLARPVKHEAFFMKYADKKFKKASIKVRSW 462



>gi|350296750|gb|EGZ77727.1| G2/mitotic-specific cyclin-B [Neurospora tetrasperma FGSC 2509]
          Length = 515

 Score =  340 bits (871), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 152/268 (56%), Positives = 205/268 (76%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD +D  DP+M++EYA +IF+YL+DLE + +P P YMS Q +L W+ RGIL+DWLIEV
Sbjct: 224 KDLDTEDLEDPLMVAEYATEIFEYLRDLECKSVPNPQYMSHQDDLEWKTRGILIDWLIEV 283

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +F+A+KYEE+L+P I NF ++
Sbjct: 284 HTRFHLLPETLFLAVNIIDRFLSEKVVQLDRLQLVGITAMFVASKYEEVLSPHIANFRHV 343

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G+TE EIL AER++L+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+
Sbjct: 344 ADDGFTEAEILSAERFILSTLNYDLSYPNPMNFLRRISKADNYDIQSRTLGKYLMEISLL 403

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+P  PS +AAAA+YL+R +L+R EW   + +Y+ YT                +P  
Sbjct: 404 DHRFMPYRPSHVAAAAMYLARLILDRGEWDETIAYYAGYTEEEIEPVFHLMVDYLARPVI 463

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKYA+K+F+KASI  + W  KN 
Sbjct: 464 HEAFFKKYASKKFLKASILTRQWAKKNA 491



>gi|398411878|ref|XP_003857273.1| hypothetical protein MYCGRDRAFT_53364 [Zymoseptoria tritici IPO323]
 gi|339477158|gb|EGP92249.1| hypothetical protein MYCGRDRAFT_53364 [Zymoseptoria tritici IPO323]
          Length = 493

 Score =  340 bits (871), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 150/270 (55%), Positives = 203/270 (75%)

Query: 135 TQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDW 194
           T++ +DLD +D  DP+M++EY  +IF Y+K+LE   MP  DYM +Q EL W+MRGILVDW
Sbjct: 202 TKNAKDLDTEDMDDPLMVAEYVHEIFDYMKELEISTMPNADYMDNQGELEWKMRGILVDW 261

Query: 195 LIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKN 254
           L+EVH +FRLLPETLFLAVNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P ++N
Sbjct: 262 LLEVHTRFRLLPETLFLAVNIIDRFLSCKVVQLDRLQLVGVTAMFIASKYEEVLSPHVQN 321

Query: 255 FIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLME 314
           F+++AD+G+ + EIL AER+VLTT+D+ L YPNPMNFLRR SKAD++DIQ RT+ KYL+E
Sbjct: 322 FVHVADDGFKDTEILSAERFVLTTLDYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLE 381

Query: 315 ISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXM 374
           I  +D++F+  PPS +AA+A+YL+R  L+R EW A L  Y+ YT                
Sbjct: 382 IGCLDHRFMKYPPSQVAASAMYLARLALDRGEWDATLAKYAGYTESEIMPVFNLMVDYLS 441

Query: 375 KPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
            P  HE  ++KYA+K+F+KASI ++ W  K
Sbjct: 442 SPVMHEAFFRKYASKKFLKASIVLRAWAKK 471



>gi|336464652|gb|EGO52892.1| G2/mitotic-specific cyclin-B [Neurospora tetrasperma FGSC 2508]
          Length = 515

 Score =  339 bits (870), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 152/268 (56%), Positives = 204/268 (76%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD +D  DP+M++EYA +IF+YL+DLE + +P P YMS Q +L W+ RGIL+DWLIEV
Sbjct: 224 KDLDTEDLEDPLMVAEYATEIFEYLRDLECKSVPNPQYMSHQDDLEWKTRGILIDWLIEV 283

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +F+A+KYEE+L+P I NF ++
Sbjct: 284 HTRFHLLPETLFLAVNIIDRFLSEKVVQLDRLQLVGITAMFVASKYEEVLSPHIANFRHV 343

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G+TE EIL AER++L+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+
Sbjct: 344 ADDGFTEAEILSAERFILSTLNYDLSYPNPMNFLRRISKADNYDIQSRTLGKYLMEISLL 403

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+P  PS +AAAA+YL+R +L R EW   + +Y+ YT                +P  
Sbjct: 404 DHRFMPYRPSHVAAAAMYLARLILGRGEWDETIAYYAGYTEEEIEPVFHLMVDYLARPVI 463

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKYA+K+F+KASI  + W  KN 
Sbjct: 464 HEAFFKKYASKKFLKASILTRQWAKKNA 491



>gi|392587877|gb|EIW77210.1| hypothetical protein CONPUDRAFT_129457 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 611

 Score =  339 bits (870), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 147/264 (55%), Positives = 201/264 (76%)

Query: 138 WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIE 197
           WEDLDA+D  DP+M+SEY  +IF+Y+K+ E   +P P+YM SQ EL+W MRGIL+DWL++
Sbjct: 292 WEDLDAEDVDDPLMVSEYVNEIFEYMKETELTTLPNPNYMESQKELAWSMRGILLDWLVQ 351

Query: 198 VHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIY 257
           VH +FRLLPET FL VNIIDRFLS RVVSL KLQLVGIT LF+AAK EE++APS+ +F++
Sbjct: 352 VHARFRLLPETFFLCVNIIDRFLSARVVSLAKLQLVGITCLFVAAKVEEIIAPSVSHFLH 411

Query: 258 MADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISL 317
            AD+ Y+E EIL+AERY+L TID+ L +PNPM++LRR SKAD ++++ART+ KYL+E+  
Sbjct: 412 CADSSYSEAEILQAERYILKTIDWNLSFPNPMHYLRRISKADEYEVKARTIGKYLIEVGA 471

Query: 318 VDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT 377
           ++++ L  PPS++AAA+++L+R +L   +W  NL HYS Y                +KP 
Sbjct: 472 LEWRLLATPPSLVAAASMWLARLILGYDKWTPNLAHYSSYAESSLIPTANLMLNYVLKPI 531

Query: 378 KHEQLYKKYAAKRFMKASIFVKDW 401
           +HE  YKKYA KRFMK S++V++W
Sbjct: 532 RHESFYKKYAGKRFMKVSVWVREW 555



>gi|500254274|gb|EON97882.1| putative g2 mitotic-specific cyclin-b protein [Togninia minima
           UCRPA7]
          Length = 488

 Score =  338 bits (868), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 149/268 (55%), Positives = 203/268 (75%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD++D  DP+M++EYA +IF+YL+DLE   +P P YMS Q +L W+ RGIL+DWLIEV
Sbjct: 205 KDLDSEDLDDPLMVAEYANEIFEYLRDLECNSVPNPQYMSHQDDLEWKTRGILIDWLIEV 264

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLA+N+IDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P + NF ++
Sbjct: 265 HTRFHLLPETLFLAINVIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVANFRHV 324

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G++E EIL AER++LTT+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+
Sbjct: 325 ADDGFSESEILSAERFILTTLNYDLSYPNPMNFLRRISKADNYDIQSRTIGKYLMEISLL 384

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+   PS +AA A+YL+R +L+R EW   L +Y+ YT                +P  
Sbjct: 385 DHRFMAYRPSHVAAGAMYLARLILDRGEWDETLSYYAGYTEEEIEPVFQLMVDYLARPIV 444

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKYA+K+F+KASI  + W  KN 
Sbjct: 445 HEAFFKKYASKKFLKASILTRQWAKKNA 472



>gi|85111257|ref|XP_963851.1| G2/mitotic-specific cyclin-B [Neurospora crassa OR74A]
 gi|28925592|gb|EAA34615.1| G2/mitotic-specific cyclin-B [Neurospora crassa OR74A]
          Length = 515

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 203/268 (75%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD +D  DP+M++EYA +IF+YL+DLE + +P P YMS Q +L W+ RGIL+DWLIEV
Sbjct: 224 KDLDTEDLEDPLMVAEYATEIFEYLRDLECKSVPNPQYMSHQDDLEWKTRGILIDWLIEV 283

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +F+A+KYEE+L+P I NF ++
Sbjct: 284 HTRFHLLPETLFLAVNIIDRFLSEKVVQLDRLQLVGITAMFVASKYEEVLSPHIANFRHV 343

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G+TE EIL AER++L+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+
Sbjct: 344 ADDGFTEAEILSAERFILSTLNYDLSYPNPMNFLRRISKADNYDIQSRTLGKYLMEISLL 403

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+P  PS +AAAA+YL+R +L R EW   + +Y+ YT                +P  
Sbjct: 404 DHRFMPYRPSHVAAAAMYLARLILGRGEWDKTIAYYAGYTEEEIEPVFHLMVDYLARPVI 463

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKY +K+F+KASI  + W  KN 
Sbjct: 464 HEAFFKKYGSKKFLKASILTRQWAKKNA 491



>gi|452848135|gb|EME50067.1| hypothetical protein DOTSEDRAFT_68804 [Dothistroma septosporum
           NZE10]
          Length = 490

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 152/284 (53%), Positives = 210/284 (73%)

Query: 121 EIYEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQ 180
           E+ + D +++ ++  ++ +DLD +D  DP+M++EY  +IF Y+K+LE    P PDYM SQ
Sbjct: 186 ELDDDDEEKTLEELIKEAKDLDTEDLDDPLMVAEYVHEIFDYMKELEIATQPNPDYMDSQ 245

Query: 181 SELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFI 240
            EL W+MRGILVDWL+EVH +FRLLPETLFLAVNIIDRFLS +VV L +LQLVG+T +FI
Sbjct: 246 GELEWKMRGILVDWLLEVHTRFRLLPETLFLAVNIIDRFLSHKVVQLDRLQLVGVTAMFI 305

Query: 241 AAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADH 300
           A+KYEE+L+P ++NF+++AD+G+ + EIL AER++L T+D+ L YPNPMNFLRR SKAD+
Sbjct: 306 ASKYEEVLSPHVQNFVHVADDGFKDTEILSAERFILATLDYDLSYPNPMNFLRRISKADN 365

Query: 301 FDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXX 360
           +DIQ RT+ KYL+EI  +D++FL  PPS +AAAA+YL+R  L+R EW A L  Y+ YT  
Sbjct: 366 YDIQTRTLGKYLLEIGCLDHRFLEYPPSQVAAAAMYLARLALDRGEWDATLSKYAGYTEA 425

Query: 361 XXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
                          P  HE  ++KYA+K+F+KASI ++ W  K
Sbjct: 426 QIQPVFKLMVEYLYSPVMHEAFFRKYASKKFLKASIVLRQWAKK 469



>gi|242768883|ref|XP_002341657.1| G2/M-specific cyclin NimE [Talaromyces stipitatus ATCC 10500]
 gi|218724853|gb|EED24270.1| G2/M-specific cyclin NimE [Talaromyces stipitatus ATCC 10500]
          Length = 484

 Score =  338 bits (866), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 232/369 (62%), Gaps = 47/369 (12%)

Query: 33  ATKQLAIREGVNNVTAIPQKKLGVVTRKRAVLMDRTNVSLKQNSVNEQTHDITKPIIKEN 92
           ++ Q +++E +N     P+KKLGV  +K  V                    I + II EN
Sbjct: 144 SSSQKSVKEDLNQNEEPPRKKLGVEKKKTEV--------------------IQQQIISEN 183

Query: 93  VNLGFQDIRSKEKHELSFDTTLATTAESEIYEFDRKRSKKQKTQDWEDLDADDFYDPMMI 152
           V                          +E+ E D   +K  + +   DLD +D  DP+M 
Sbjct: 184 V--------------------------TEV-EVDVGGAKDLEAEGVMDLDTEDLDDPLMA 216

Query: 153 SEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLA 212
           +EY V+IF YL+DLE E +P PDY++ Q EL W+MRGIL+DWLIEVH  FRLLPETLFL 
Sbjct: 217 AEYVVEIFDYLRDLEHETLPSPDYINHQPELEWKMRGILIDWLIEVHASFRLLPETLFLT 276

Query: 213 VNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAE 272
           VNIIDRFLS  +VSL +LQLVG+T +FIA+KYEE+L+P + NF  +AD+ ++++EIL AE
Sbjct: 277 VNIIDRFLSAEIVSLDRLQLVGVTAMFIASKYEEILSPHVANFSQVADDTFSDKEILDAE 336

Query: 273 RYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAA 332
           R+VL T+++ + YPNPMNFLRR SKAD++DI+ RT+ KYLMEISL+D+KF+    S +AA
Sbjct: 337 RHVLATLNYNMSYPNPMNFLRRISKADNYDIETRTLGKYLMEISLLDHKFMAYKQSHVAA 396

Query: 333 AALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFM 392
           AA+YL+R +L+R EW A L HYS YT                +P  HE  +KKYA+K+F+
Sbjct: 397 AAMYLARLILDRPEWDATLAHYSGYTEEEIQPVFLLMVDYLHRPVAHEAFFKKYASKKFL 456

Query: 393 KASIFVKDW 401
           KASI  + W
Sbjct: 457 KASIVTRQW 465



>gi|302925436|ref|XP_003054095.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256735036|gb|EEU48382.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 477

 Score =  336 bits (862), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 150/268 (55%), Positives = 204/268 (76%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD++D  DP+M++EYA +IF+YL+DLE + +P PDYM  Q +L W+ RGILVDWL+EV
Sbjct: 194 KDLDSEDLEDPLMVAEYANEIFEYLRDLEVKSIPNPDYMDHQDDLEWKTRGILVDWLVEV 253

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P ++NF  +
Sbjct: 254 HTRFHLLPETLFLAVNIIDRFLSAKVVQLDRLQLVGITAMFIASKYEEVLSPHVENFKRI 313

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G++E EIL AER+VL+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+
Sbjct: 314 ADDGFSEAEILSAERFVLSTLNYDLSYPNPMNFLRRVSKADNYDIQSRTIGKYLMEISLL 373

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+   PS +AA A+YL+R +L+R EW   L +Y+ YT                +P  
Sbjct: 374 DHRFMRYRPSHVAAGAMYLARLLLDRGEWDETLSYYAGYTEDEIEPVVNLMVDYLARPVV 433

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKYA+K+F+K+SI  + W  KN 
Sbjct: 434 HEAFFKKYASKKFLKSSILSRQWAKKNA 461



>gi|336272395|ref|XP_003350954.1| hypothetical protein SMAC_04258 [Sordaria macrospora k-hell]
 gi|380090721|emb|CCC04891.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 515

 Score =  336 bits (861), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 150/268 (55%), Positives = 204/268 (76%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD +D  DP+M++EYA +IF+YL+DLE + +P P YM+ Q +L W+ RGIL+DWLIEV
Sbjct: 224 KDLDTEDLEDPLMVAEYATEIFEYLRDLECKSVPNPQYMNHQDDLEWKTRGILIDWLIEV 283

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +F+A+KYEE+L+P I NF ++
Sbjct: 284 HTRFHLLPETLFLAVNIIDRFLSAKVVQLDRLQLVGITAMFVASKYEEVLSPHIANFRHV 343

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G+TE EIL AER++L+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+
Sbjct: 344 ADDGFTETEILSAERFILSTLNYDLSYPNPMNFLRRISKADNYDIQSRTLGKYLMEISLL 403

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+   PS +AAAA+YL+R +L+R EW   + +Y+ YT                +P  
Sbjct: 404 DHRFMSYRPSHLAAAAMYLARLILDRGEWDETIAYYAGYTEEEIEPVFQLMVDYLARPVI 463

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKYA+K+F+KASI  + W  KN 
Sbjct: 464 HEAFFKKYASKKFLKASILTRQWAKKNA 491



>gi|440637904|gb|ELR07823.1| hypothetical protein GMDG_00444 [Geomyces destructans 20631-21]
          Length = 489

 Score =  335 bits (860), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 151/266 (56%), Positives = 202/266 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D  DP+M++EY  +IF YLK+LE   MP P YM  Q +L W+MRGILVDWLIEVH
Sbjct: 207 DLDAEDIDDPLMVAEYVHEIFDYLKELEVATMPNPVYMKHQEDLEWKMRGILVDWLIEVH 266

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLAVNI+DRFLS +VV L +LQLVG+T +FIA+KYEE+L+P ++NF ++A
Sbjct: 267 TRFHLLPETLFLAVNILDRFLSAKVVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFRHVA 326

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G+TE EIL AERYVL+ +++ L YPNPMNFLRR SKAD++DI+ RT+ KYLMEISL+D
Sbjct: 327 DDGFTEAEILSAERYVLSALNYDLSYPNPMNFLRRISKADNYDIETRTLGKYLMEISLLD 386

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS IAA+++YL+RK+L++  W A + HY+ Y+                +P  H
Sbjct: 387 HRFMGYLPSEIAASSMYLARKILDKGPWDATIAHYAGYSEEQIEPIFILMVDYLARPVTH 446

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKN 405
           E  +KKYA K+FMKASI+ + W SK+
Sbjct: 447 EAFFKKYANKKFMKASIYSRQWSSKH 472



>gi|322694995|gb|EFY86811.1| G2/mitotic-specific cyclin-B [Metarhizium acridum CQMa 102]
          Length = 484

 Score =  335 bits (860), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 206/285 (72%), Gaps = 10/285 (3%)

Query: 132 KQKTQDWED----------LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQS 181
           KQ+T D ED          ++ DD+ DP+M++EYA +IF+YL+DLE   +P PDYMS Q 
Sbjct: 184 KQQTVDDEDKPVPPEGVNVIEEDDWDDPLMVAEYATEIFEYLRDLECRSVPNPDYMSHQD 243

Query: 182 ELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIA 241
           +L W+ RGIL+DWLIEVH +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +FIA
Sbjct: 244 DLEWKTRGILIDWLIEVHTRFHLLPETLFLAVNIIDRFLSAKVVQLDRLQLVGITAMFIA 303

Query: 242 AKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHF 301
           +KYEE+L+P ++NF  + DNG++E EIL AER++L+T+++ L YPNPMNFLRR SKAD++
Sbjct: 304 SKYEEVLSPHVENFKRITDNGFSEAEILSAERFLLSTLNYDLSYPNPMNFLRRVSKADNY 363

Query: 302 DIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXX 361
           DIQ+RT+ KYLMEISL+D++F+   PS  AAAA+YL+R ML+R  W   L +Y+ Y    
Sbjct: 364 DIQSRTIGKYLMEISLLDHRFMSFRPSHCAAAAMYLARMMLDRGPWDEILAYYAGYDKQE 423

Query: 362 XXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
                        +P  HE  +KKYA+K+F+KASI  + W  KN 
Sbjct: 424 VQPLVDLMVDYLARPVVHEAFFKKYASKKFLKASILARQWARKNA 468



>gi|390599433|gb|EIN08829.1| A/B/D/E cyclin [Punctularia strigosozonata HHB-11173 SS5]
          Length = 400

 Score =  335 bits (859), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 161/266 (60%), Positives = 204/266 (76%)

Query: 136 QDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWL 195
           Q W+DLDA+D  DP M+SEY  +IF YLK++E + MP P YM SQ EL+W+MRGIL DWL
Sbjct: 86  QGWDDLDAEDADDPQMVSEYVAEIFAYLKEVEQKTMPSPHYMDSQKELAWKMRGILTDWL 145

Query: 196 IEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNF 255
           I+VH +FRLLPETLFLAVNIIDRFLS RVVSL KLQLVGI  +FIAAK EE++APS  NF
Sbjct: 146 IQVHFRFRLLPETLFLAVNIIDRFLSARVVSLQKLQLVGIVCMFIAAKVEEVVAPSASNF 205

Query: 256 IYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEI 315
           +Y AD+ YTE EIL+AE+Y+L TID+ L YPNPM+FLRR SKAD++D+QARTV KYL+EI
Sbjct: 206 LYCADSTYTENEILQAEKYILKTIDWDLSYPNPMHFLRRISKADNYDVQARTVGKYLLEI 265

Query: 316 SLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMK 375
           S ++++ LP PPS++AAA+++L+R +L R EW  NL HYS Y                +K
Sbjct: 266 SCLEWRLLPAPPSLLAAASIWLARLILGREEWTPNLAHYSSYPEEALIPTANIMLNYILK 325

Query: 376 PTKHEQLYKKYAAKRFMKASIFVKDW 401
           P  HE  +KKYA++++MKAS FV+ W
Sbjct: 326 PVVHESFFKKYASRKYMKASDFVRKW 351



>gi|225682743|gb|EEH21027.1| G2/mitotic-specific cyclin CYB1 [Paracoccidioides brasiliensis
           Pb03]
          Length = 507

 Score =  335 bits (859), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 151/265 (56%), Positives = 196/265 (73%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLD +D YDP+M +EY V+IF YLK++E   MP PDY+  Q EL W+MRGILVDWLIEVH
Sbjct: 213 DLDTEDLYDPLMAAEYVVEIFDYLKEIEPRTMPNPDYIDHQEELEWKMRGILVDWLIEVH 272

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFLAVNIIDRFLS  VV+L +LQLVG+T +FIAAKYEE+L+P + NF ++A
Sbjct: 273 TRFRLLPETLFLAVNIIDRFLSAEVVALDRLQLVGVTAMFIAAKYEEVLSPHVANFSHVA 332

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D  ++++EIL AER+VL T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYL E+SL+D
Sbjct: 333 DETFSDKEILDAERHVLATLNYDISYPNPMNFLRRISKADNYDIQTRTLGKYLTEVSLLD 392

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S +AAAA+YL+R +LN   W A L HY+ YT                +P  H
Sbjct: 393 HRFMAYRQSHVAAAAMYLARLILNSGRWDATLAHYAGYTQEEILPVFRLLIDYLHRPVAH 452

Query: 380 EQLYKKYAAKRFMKASIFVKDWISK 404
           E  +KKYA+K+FMKASI  + W  K
Sbjct: 453 EAFFKKYASKKFMKASIVTRQWAKK 477



>gi|226290181|gb|EEH45665.1| G2/mitotic-specific cyclin-B [Paracoccidioides brasiliensis Pb18]
          Length = 507

 Score =  335 bits (859), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 151/265 (56%), Positives = 196/265 (73%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLD +D YDP+M +EY V+IF YLK++E   MP PDY+  Q EL W+MRGILVDWLIEVH
Sbjct: 213 DLDTEDLYDPLMAAEYVVEIFDYLKEIEPRTMPNPDYIDHQEELEWKMRGILVDWLIEVH 272

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFLAVNIIDRFLS  VV+L +LQLVG+T +FIAAKYEE+L+P + NF ++A
Sbjct: 273 TRFRLLPETLFLAVNIIDRFLSAEVVALDRLQLVGVTAMFIAAKYEEVLSPHVANFSHVA 332

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D  ++++EIL AER+VL T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYL E+SL+D
Sbjct: 333 DETFSDKEILDAERHVLATLNYDISYPNPMNFLRRISKADNYDIQTRTLGKYLTEVSLLD 392

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S +AAAA+YL+R +LN   W A L HY+ YT                +P  H
Sbjct: 393 HRFMAYRQSHVAAAAMYLARLILNSGRWDATLAHYAGYTQEEILPVFRLLIDYLHRPVAH 452

Query: 380 EQLYKKYAAKRFMKASIFVKDWISK 404
           E  +KKYA+K+FMKASI  + W  K
Sbjct: 453 EAFFKKYASKKFMKASIVTRQWAKK 477



>gi|453089144|gb|EMF17184.1| A/B/D/E cyclin [Mycosphaerella populorum SO2202]
          Length = 487

 Score =  335 bits (858), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 201/269 (74%)

Query: 136 QDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWL 195
           ++ EDLD +D  DP+M++EY  +IF Y+++ E   M  PDYM +Q EL W+MRGILVDWL
Sbjct: 210 KEAEDLDTEDLGDPLMVAEYVHEIFDYMREAEISTMANPDYMDNQGELEWKMRGILVDWL 269

Query: 196 IEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNF 255
           +EVH +FRLLPETLFLAVNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P ++NF
Sbjct: 270 LEVHARFRLLPETLFLAVNIIDRFLSCKVVHLDRLQLVGVTAMFIASKYEEVLSPHVQNF 329

Query: 256 IYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEI 315
           +++AD+G+ + EIL AER+VL T+D+ L YPNPMNFLRR SKAD++DIQ RT+ KYL+EI
Sbjct: 330 VHVADDGFKDTEILSAERFVLATLDYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLLEI 389

Query: 316 SLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMK 375
           + +D++FL  PPS +AAAA+YL+R  L+R EW A L  Y+ YT                 
Sbjct: 390 ACLDHRFLKYPPSQVAAAAMYLARLALDRGEWDATLAKYAGYTEGDIRPVFKLMVDYLYA 449

Query: 376 PTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           P  HE  ++KYA+K+F+KASI ++ W  K
Sbjct: 450 PVMHEAFFRKYASKKFLKASIVLRQWAKK 478



>gi|259481818|tpe|CBF75695.1| TPA: G2/mitotic-specific cyclin-B
           [Source:UniProtKB/Swiss-Prot;Acc:P30284] [Aspergillus
           nidulans FGSC A4]
          Length = 490

 Score =  335 bits (858), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 152/273 (55%), Positives = 202/273 (73%), Gaps = 1/273 (0%)

Query: 133 QKTQDW-EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGIL 191
           +K QD+  DLD +D  DP+M +EY V+IF YL++LE E +P PDY+  Q +L W+MRGIL
Sbjct: 197 EKPQDFVADLDTEDLDDPLMAAEYVVEIFDYLRELEMETLPNPDYIDHQPDLEWKMRGIL 256

Query: 192 VDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPS 251
           VDWLIEVH +FRLLPETLFLAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P 
Sbjct: 257 VDWLIEVHTRFRLLPETLFLAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPH 316

Query: 252 IKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKY 311
           + NF ++AD  ++++EIL AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KY
Sbjct: 317 VANFSHVADETFSDKEILDAERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKY 376

Query: 312 LMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXX 371
           LMEISL+D++FL  P S I AAA+YL+R +L+R  W A L HY+ YT             
Sbjct: 377 LMEISLLDHRFLGYPQSQIGAAAMYLARLILDRGPWDATLAHYAGYTEEEIDEVFRLMVD 436

Query: 372 XXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
              +P  HE  +KKYA+K+F+KASI  + W  K
Sbjct: 437 YLHRPVCHEAFFKKYASKKFLKASIMTRQWAKK 469



>gi|326484581|gb|EGE08591.1| G2/mitotic-specific cyclin-B [Trichophyton equinum CBS 127.97]
          Length = 521

 Score =  335 bits (858), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 197/262 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D YDPMM +EY VDIFKYLK+LE   MP PDYM  Q EL W+MRGILVDWLIEVH
Sbjct: 231 DLDAEDLYDPMMATEYVVDIFKYLKELEPITMPNPDYMDHQDELEWKMRGILVDWLIEVH 290

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFL VNIIDRFLSV VV+L +LQLVG+T +FIA+KYEE+L+P + NF ++A
Sbjct: 291 TRFRLLPETLFLTVNIIDRFLSVEVVTLNRLQLVGVTAMFIASKYEEVLSPHVANFSHVA 350

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+ ++++EIL AER++L  +++ L YPNPMNFLRR SK D++D++ RT+AKYLMEISLVD
Sbjct: 351 DDTFSDKEILDAERHILAVLNYDLSYPNPMNFLRRISKPDNYDVRTRTLAKYLMEISLVD 410

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S IAAA+++L+R +  R  W A + +YS YT                +P  H
Sbjct: 411 HRFMKYRQSHIAAASIFLARVIYERGPWDATIAYYSGYTKEEIMPVYDLLIDYLCRPPAH 470

Query: 380 EQLYKKYAAKRFMKASIFVKDW 401
           E  +KKYA+KRF+KASI  + W
Sbjct: 471 EAFFKKYASKRFLKASIMTRQW 492



>gi|67526381|ref|XP_661252.1| CG21_EMENI G2/mitotic-specific cyclin B [Aspergillus nidulans FGSC
           A4]
 gi|232152|sp|P30284.1|CG21_EMENI RecName: Full=G2/mitotic-specific cyclin-B
 gi|2706|emb|CAA45886.1| NIME/CYCLINB [Emericella nidulans]
 gi|40740666|gb|EAA59856.1| CG21_EMENI G2/mitotic-specific cyclin B [Aspergillus nidulans FGSC
           A4]
          Length = 478

 Score =  335 bits (858), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 152/273 (55%), Positives = 202/273 (73%), Gaps = 1/273 (0%)

Query: 133 QKTQDW-EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGIL 191
           +K QD+  DLD +D  DP+M +EY V+IF YL++LE E +P PDY+  Q +L W+MRGIL
Sbjct: 185 EKPQDFVADLDTEDLDDPLMAAEYVVEIFDYLRELEMETLPNPDYIDHQPDLEWKMRGIL 244

Query: 192 VDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPS 251
           VDWLIEVH +FRLLPETLFLAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P 
Sbjct: 245 VDWLIEVHTRFRLLPETLFLAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPH 304

Query: 252 IKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKY 311
           + NF ++AD  ++++EIL AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KY
Sbjct: 305 VANFSHVADETFSDKEILDAERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKY 364

Query: 312 LMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXX 371
           LMEISL+D++FL  P S I AAA+YL+R +L+R  W A L HY+ YT             
Sbjct: 365 LMEISLLDHRFLGYPQSQIGAAAMYLARLILDRGPWDATLAHYAGYTEEEIDEVFRLMVD 424

Query: 372 XXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
              +P  HE  +KKYA+K+F+KASI  + W  K
Sbjct: 425 YLHRPVCHEAFFKKYASKKFLKASIMTRQWAKK 457



>gi|171680297|ref|XP_001905094.1| hypothetical protein [Podospora anserina S mat+]
 gi|170939775|emb|CAP65001.1| unnamed protein product [Podospora anserina S mat+]
          Length = 490

 Score =  334 bits (856), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 198/266 (74%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           EDLD +D+ DP+M++EYA DIF+YL+DLE   +P P YM  Q +L W+ RGIL+DWL+EV
Sbjct: 204 EDLDREDYDDPLMVAEYANDIFEYLRDLECNSVPNPHYMDHQDDLEWKTRGILIDWLVEV 263

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P I NF ++
Sbjct: 264 HTRFHLLPETLFLAVNIIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHIANFRHV 323

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G++E EIL AER+VL T+++ L YPNPMNFLRR SKAD++DI +RT+ KYLMEISL+
Sbjct: 324 ADDGFSEAEILSAERFVLQTLNYDLSYPNPMNFLRRISKADNYDIHSRTLGKYLMEISLL 383

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+   PS IAAAA+Y +R  LNR EW   L +Y+ YT                +P  
Sbjct: 384 DHRFMAYRPSHIAAAAMYCARMCLNRGEWDETLAYYAGYTEAEIDPVYRLMVDYLARPVC 443

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISK 404
           HE  +KKYA+K+F+KASI  + W  K
Sbjct: 444 HEAFFKKYASKKFLKASIVTRAWGKK 469



>gi|46108818|ref|XP_381467.1| hypothetical protein FG01291.1 [Fusarium graminearum PH-1]
          Length = 473

 Score =  334 bits (856), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 149/267 (55%), Positives = 201/267 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +LD +D  DP+M++EYA +IF+YL+DLE + +P P YMS Q +L W+ RGILVDWLIEVH
Sbjct: 191 NLDEEDLEDPLMVAEYANEIFEYLRDLECKSIPNPQYMSHQDDLEWKTRGILVDWLIEVH 250

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLA+N+IDRFLS +VV L + QLVGIT +FIA+KYEE+L+P ++NF  +A
Sbjct: 251 TRFHLLPETLFLAINVIDRFLSEKVVQLDRFQLVGITAMFIASKYEEVLSPHVENFKRIA 310

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G++E EIL AER+VL+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+D
Sbjct: 311 DDGFSEAEILSAERFVLSTLNYDLSYPNPMNFLRRVSKADNYDIQSRTIGKYLMEISLLD 370

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS +AA A+YL+R ML+R EW A L +Y+ YT                +P  H
Sbjct: 371 HRFMAYRPSHVAAGAMYLARLMLDRGEWDATLSYYAGYTEDEVEPVVHLMVDYLARPVVH 430

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKNV 406
           E   KKYAAK+F++AS+  + W  KN 
Sbjct: 431 EAFDKKYAAKKFLRASLLARQWAKKNA 457



>gi|295669528|ref|XP_002795312.1| G2/mitotic-specific cyclin-B [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226285246|gb|EEH40812.1| G2/mitotic-specific cyclin-B [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 505

 Score =  333 bits (855), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 150/265 (56%), Positives = 196/265 (73%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLD +D YDP+M +EY V+IF YLK++E   MP PDY+  Q EL W+MRGILVDWLIEVH
Sbjct: 212 DLDTEDLYDPLMAAEYVVEIFDYLKEIEPRTMPNPDYIDHQEELEWKMRGILVDWLIEVH 271

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFLAVNIIDRFLS  VV+L +LQLVG+T +FIAAKYEE+L+P + NF ++A
Sbjct: 272 TRFRLLPETLFLAVNIIDRFLSAEVVALDRLQLVGVTAMFIAAKYEEVLSPHVANFSHVA 331

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D  ++++EIL AER+VL T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYL E+SL+D
Sbjct: 332 DETFSDKEILDAERHVLATLNYDISYPNPMNFLRRISKADNYDIQTRTLGKYLTEVSLLD 391

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S +AAAA+YL+R +L+   W A L HY+ YT                +P  H
Sbjct: 392 HRFMAYRQSHVAAAAMYLARLILDSGRWDATLAHYAGYTQEEILPVFRLLIDYLHRPVAH 451

Query: 380 EQLYKKYAAKRFMKASIFVKDWISK 404
           E  +KKYA+K+FMKASI  + W  K
Sbjct: 452 EAFFKKYASKKFMKASIVTRQWAKK 476



>gi|494824149|gb|EON61468.1| hypothetical protein W97_00683 [Coniosporium apollinis CBS 100218]
          Length = 496

 Score =  333 bits (855), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 151/265 (56%), Positives = 200/265 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLD +D  DP+M++EY V+IF+YL++LE   M  P+YM SQ EL W+MRGILVDWL+EVH
Sbjct: 214 DLDKEDGDDPLMVAEYVVEIFEYLRELELTTMANPNYMESQGELEWKMRGILVDWLLEVH 273

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFLAVNIIDRFLS++VV L +LQLVG+T +FIA+KYEE+L+P ++NF ++A
Sbjct: 274 TRFRLLPETLFLAVNIIDRFLSMKVVQLDRLQLVGVTAMFIASKYEEVLSPHVQNFRHVA 333

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G+TEEEIL AER+VL  +++ L YPNPMNFLRR SKAD +DIQ RT+ KYL+EIS +D
Sbjct: 334 DDGFTEEEILSAERFVLGALNYDLSYPNPMNFLRRISKADSYDIQTRTLGKYLLEISCLD 393

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS IAAA++YL+R +L R +W A L  Y+ YT                 P  H
Sbjct: 394 HRFIAHEPSRIAAASMYLARLVLERGDWDATLARYAGYTEEEIQPVLLLMIDYLRSPVVH 453

Query: 380 EQLYKKYAAKRFMKASIFVKDWISK 404
           E  +KKYA+K+F+KASI ++ W  K
Sbjct: 454 EAFFKKYASKKFLKASIVLRAWAKK 478



>gi|408388548|gb|EKJ68231.1| hypothetical protein FPSE_11602 [Fusarium pseudograminearum CS3096]
          Length = 474

 Score =  333 bits (855), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 149/267 (55%), Positives = 201/267 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +LD +D  DP+M++EYA +IF+YL+DLE + +P P YMS Q +L W+ RGILVDWLIEVH
Sbjct: 192 NLDEEDLEDPLMVAEYANEIFEYLRDLECKSIPNPQYMSHQDDLEWKTRGILVDWLIEVH 251

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLA+N+IDRFLS +VV L + QLVGIT +FIA+KYEE+L+P ++NF  +A
Sbjct: 252 TRFHLLPETLFLAINVIDRFLSEKVVQLDRFQLVGITAMFIASKYEEVLSPHVENFKRIA 311

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G++E EIL AER+VL+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+D
Sbjct: 312 DDGFSEAEILSAERFVLSTLNYDLSYPNPMNFLRRVSKADNYDIQSRTIGKYLMEISLLD 371

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS +AA A+YL+R ML+R EW A L +Y+ YT                +P  H
Sbjct: 372 HRFMAYRPSHVAAGAMYLARLMLDRGEWDATLSYYAGYTEDEVEPVVHLMVDYLARPVVH 431

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKNV 406
           E   KKYAAK+F++AS+  + W  KN 
Sbjct: 432 EAFDKKYAAKKFLRASLLARQWAKKNA 458



>gi|315042678|ref|XP_003170715.1| G2/mitotic-specific cyclin-B [Arthroderma gypseum CBS 118893]
 gi|311344504|gb|EFR03707.1| G2/mitotic-specific cyclin-B [Arthroderma gypseum CBS 118893]
          Length = 530

 Score =  333 bits (854), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 198/262 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D YDPMM +EY VDIF+YLK+LE   MP PDYM  Q EL W+MRGILVDWLIEVH
Sbjct: 239 DLDAEDLYDPMMATEYVVDIFEYLKELEPVTMPNPDYMDHQDELEWKMRGILVDWLIEVH 298

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFL VNIIDRFLSV +V+L +LQLVG+T +FIA+KYEE+L+P + NF ++A
Sbjct: 299 TRFRLLPETLFLTVNIIDRFLSVEIVTLNRLQLVGVTAMFIASKYEEVLSPHVANFSHVA 358

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+ ++++EIL AER++L  +++ L YPNPMNFLRR SK D++D++ RT+AKYLMEISLVD
Sbjct: 359 DDTFSDKEILDAERHILAVLNYDLSYPNPMNFLRRISKPDNYDVRTRTLAKYLMEISLVD 418

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S IAAA+++L+R + +R  W A + +YS YT                +P  H
Sbjct: 419 HRFMKYRQSHIAAASIFLARVIYDRGPWDATIAYYSGYTKEEIMPVYELLIDYLCRPPAH 478

Query: 380 EQLYKKYAAKRFMKASIFVKDW 401
           E  +KKYA+KRF+KASI  + W
Sbjct: 479 EAFFKKYASKRFLKASIMTRQW 500



>gi|367043426|ref|XP_003652093.1| hypothetical protein THITE_2113137 [Thielavia terrestris NRRL 8126]
 gi|346999355|gb|AEO65757.1| hypothetical protein THITE_2113137 [Thielavia terrestris NRRL 8126]
          Length = 487

 Score =  333 bits (854), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 151/266 (56%), Positives = 200/266 (75%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD++D  DP+M++EYA +IF+YL+DLE   +P P YMS Q +L W+ RGILVDWL+EVH 
Sbjct: 206 LDSEDLDDPLMVAEYANEIFEYLRDLECNSIPNPQYMSHQDDLEWKTRGILVDWLVEVHT 265

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           +F LLPETLFLAVNI+DRFLS +VV L +LQLVGIT +FIA+KYEE+L+P + NF ++AD
Sbjct: 266 RFGLLPETLFLAVNIVDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVANFRHVAD 325

Query: 261 NGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           +G++E EIL AER+VL T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+D+
Sbjct: 326 DGFSEAEILGAERFVLATLNYDLSYPNPMNFLRRISKADNYDIQSRTIGKYLMEISLLDH 385

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           + L   PS IAAAA+YL+R +L+R EW   L +Y+ Y+                +P  HE
Sbjct: 386 RLLGHRPSHIAAAAMYLARLILDRGEWDETLKYYAGYSEEEIQPVVLVMIDYMARPVIHE 445

Query: 381 QLYKKYAAKRFMKASIFVKDWISKNV 406
             +KKYA+KRF+KASI  + W  KN 
Sbjct: 446 AFFKKYASKRFLKASILTRQWAKKNA 471



>gi|116206914|ref|XP_001229266.1| hypothetical protein CHGG_02750 [Chaetomium globosum CBS 148.51]
 gi|88183347|gb|EAQ90815.1| hypothetical protein CHGG_02750 [Chaetomium globosum CBS 148.51]
          Length = 488

 Score =  333 bits (854), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 175/376 (46%), Positives = 241/376 (64%), Gaps = 7/376 (1%)

Query: 31  VVATKQLAIREGVNNVTAIPQKKLG-VVTRKRAVLMDRTNVSLKQNSVNEQTHDITKPII 89
             AT+     + VN  T + +   G +V +KR VL   T  +L    V E T + ++PI 
Sbjct: 102 TTATRSALTTKEVNKKTEVKRSGPGSIVAQKRKVLSTSTTNTL----VKEGTPEDSEPIR 157

Query: 90  KENVNLGFQDIRSKEKHELSFDTTLATTAESEIYEFDRKRSKKQKTQDWEDLDADDFYDP 149
           K+   L  + I++  + E       A ++          R +  +   +  LD +D  DP
Sbjct: 158 KKVHTLEDKKIKTDVRQEEPVRKDAAPSSPPVAASEPEPRVEIPEAALF--LDREDLDDP 215

Query: 150 MMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETL 209
           +M++EYA DIF+YL+DLE   +P P YMS Q +L W+ RGIL+DWL+EVH +F LLPETL
Sbjct: 216 LMVAEYANDIFEYLRDLECNSVPNPQYMSHQDDLEWKTRGILIDWLVEVHTRFHLLPETL 275

Query: 210 FLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEIL 269
           FLAVNI+DRFLS +VV L +LQLVGIT +FIA+KYEE+L+P I NF ++AD+G+TE EIL
Sbjct: 276 FLAVNIVDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHIANFRHIADDGFTEAEIL 335

Query: 270 KAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSM 329
            AER+VL T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+D++ +    S 
Sbjct: 336 SAERFVLATLNYDLSYPNPMNFLRRISKADNYDIQSRTIGKYLMEISLLDHRLMAYRSSH 395

Query: 330 IAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAK 389
           IAAAA+YLSR +L+R EW   L +Y+ Y+                +P  HE  +KKYA K
Sbjct: 396 IAAAAMYLSRLILDRGEWDDTLEYYAGYSEEEIQPVVMLMVDYMARPVIHEAFFKKYAHK 455

Query: 390 RFMKASIFVKDWISKN 405
           +F+KASI  + W  KN
Sbjct: 456 KFLKASILTRQWSKKN 471



>gi|326475660|gb|EGD99669.1| G2/M-specific cyclin NimE [Trichophyton tonsurans CBS 112818]
          Length = 521

 Score =  333 bits (853), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 151/262 (57%), Positives = 197/262 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D YDPMM +EY VDIF+YLK+LE   MP PDYM  Q EL W+MRGILVDWLIEVH
Sbjct: 231 DLDAEDLYDPMMATEYVVDIFEYLKELEPITMPNPDYMDHQDELEWKMRGILVDWLIEVH 290

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFL VNIIDRFLSV VV+L +LQLVG+T +FIA+KYEE+L+P + NF ++A
Sbjct: 291 TRFRLLPETLFLTVNIIDRFLSVEVVTLNRLQLVGVTAMFIASKYEEVLSPHVANFSHVA 350

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+ ++++EIL AER++L  +++ L YPNPMNFLRR SK D++D++ RT+AKYLMEISLVD
Sbjct: 351 DDTFSDKEILDAERHILAVLNYDLSYPNPMNFLRRISKPDNYDVRTRTLAKYLMEISLVD 410

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S IAAA+++L+R +  R  W A + +YS YT                +P  H
Sbjct: 411 HRFMKYRQSHIAAASIFLARVIYERGPWDATIAYYSGYTKEEIMPVYDLLIDYLCRPPAH 470

Query: 380 EQLYKKYAAKRFMKASIFVKDW 401
           E  +KKYA+KRF+KASI  + W
Sbjct: 471 EAFFKKYASKRFLKASIMTRQW 492



>gi|255947596|ref|XP_002564565.1| Pc22g05300 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591582|emb|CAP97818.1| Pc22g05300 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 461

 Score =  333 bits (853), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 151/266 (56%), Positives = 199/266 (74%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD +D  DP+M +EY V+IF+YLKDLE   +P PDY+  Q +L W+MRGILVDWLIEV
Sbjct: 177 QDLDTEDLDDPLMAAEYVVEIFEYLKDLEIMTLPNPDYIDHQPDLEWKMRGILVDWLIEV 236

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +FRLLPETLFLAVNIIDRFLS  VV+L +LQLVG+T +FIA+KYEE+L+P + NF ++
Sbjct: 237 HTRFRLLPETLFLAVNIIDRFLSAEVVALDRLQLVGVTAMFIASKYEEVLSPHVANFSHV 296

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD  ++++EIL AER+VL T+++ + +PNPMNFLRR SKAD++DIQ RT+ KYLMEISL+
Sbjct: 297 ADETFSDKEILDAERHVLATLEYNMSFPNPMNFLRRISKADNYDIQTRTLGKYLMEISLL 356

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+  P S I+AAA+YL+R +L R  W A L HYS YT                +P  
Sbjct: 357 DHRFMSYPQSHISAAAMYLARLILERGPWDATLAHYSGYTEEEIDPVFQLMVDYLHRPVS 416

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISK 404
           HE  +KKYA+K+F+KASI  + W  K
Sbjct: 417 HEAFFKKYASKKFLKASILTRQWAKK 442



>gi|358378739|gb|EHK16420.1| hypothetical protein TRIVIDRAFT_183741 [Trichoderma virens Gv29-8]
          Length = 445

 Score =  332 bits (852), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 201/266 (75%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD +D  DP+M++EYA DIF YL+DLE + +P  DYMS Q +L W+ RGIL+DWLIEVH 
Sbjct: 164 LDEEDLDDPLMVAEYANDIFDYLRDLEVQSIPNSDYMSHQDDLEWKTRGILIDWLIEVHT 223

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P ++NF  +AD
Sbjct: 224 RFHLLPETLFLAVNIIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVENFKKIAD 283

Query: 261 NGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           +G++E EIL AER++L+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYL EISL+D+
Sbjct: 284 DGFSEAEILSAERFILSTLNYDLSYPNPMNFLRRVSKADNYDIQSRTIGKYLTEISLLDH 343

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           +F+   PS +AAA++YL+R ML+R EW A + +Y+ YT                +P  HE
Sbjct: 344 RFMAYRPSHVAAASMYLARLMLDRGEWDATIAYYAGYTEEEVEPVVNLMVDYLARPPIHE 403

Query: 381 QLYKKYAAKRFMKASIFVKDWISKNV 406
             +KKYA+K+F+KASI  + W  KN 
Sbjct: 404 AFFKKYASKKFLKASILSRQWAKKNA 429



>gi|239613461|gb|EEQ90448.1| nime/cyclinb [Ajellomyces dermatitidis ER-3]
          Length = 502

 Score =  332 bits (852), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 148/261 (56%), Positives = 195/261 (74%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           +D YDP+M +EY V+IF YLK++E + MP PDY+  Q EL W+MRGILVDWLIEVH +FR
Sbjct: 218 EDLYDPLMAAEYVVEIFDYLKEIEPQTMPNPDYIDHQEELEWKMRGILVDWLIEVHTRFR 277

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VNIIDRFLS  VV+L +LQLVG+T +FIAAKYEE+L+P + NF ++AD  +
Sbjct: 278 LLPETLFLTVNIIDRFLSAEVVALDRLQLVGVTAMFIAAKYEEVLSPHVANFSHVADETF 337

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           +++EIL AER+VL T+++ + YPNPMNFLRR SKAD++DIQ RT+ KY +E+SL+D++F+
Sbjct: 338 SDKEILDAERHVLATLNYDISYPNPMNFLRRISKADNYDIQTRTLGKYFLEVSLLDHRFM 397

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLY 383
           P   S +AAAA+YL+R +L+R  W A L HYS YT                +P  HE  +
Sbjct: 398 PYRQSHVAAAAMYLARLILHRGPWDATLAHYSGYTKEEILPVFQLLVDYLHRPVSHEAFF 457

Query: 384 KKYAAKRFMKASIFVKDWISK 404
           KKYA+K+FMKASI  + W  K
Sbjct: 458 KKYASKKFMKASIVTRQWAKK 478



>gi|327355038|gb|EGE83895.1| G2/M-specific cyclin NimE [Ajellomyces dermatitidis ATCC 18188]
          Length = 502

 Score =  332 bits (852), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 148/261 (56%), Positives = 195/261 (74%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           +D YDP+M +EY V+IF YLK++E + MP PDY+  Q EL W+MRGILVDWLIEVH +FR
Sbjct: 218 EDLYDPLMAAEYVVEIFDYLKEIEPQTMPNPDYIDHQEELEWKMRGILVDWLIEVHTRFR 277

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VNIIDRFLS  VV+L +LQLVG+T +FIAAKYEE+L+P + NF ++AD  +
Sbjct: 278 LLPETLFLTVNIIDRFLSAEVVALDRLQLVGVTAMFIAAKYEEVLSPHVANFSHVADETF 337

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           +++EIL AER+VL T+++ + YPNPMNFLRR SKAD++DIQ RT+ KY +E+SL+D++F+
Sbjct: 338 SDKEILDAERHVLATLNYDISYPNPMNFLRRISKADNYDIQTRTLGKYFLEVSLLDHRFM 397

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLY 383
           P   S +AAAA+YL+R +L+R  W A L HYS YT                +P  HE  +
Sbjct: 398 PYRQSHVAAAAMYLARLILHRGPWDATLAHYSGYTKEEILPVFQLLVDYLHRPVSHEAFF 457

Query: 384 KKYAAKRFMKASIFVKDWISK 404
           KKYA+K+FMKASI  + W  K
Sbjct: 458 KKYASKKFMKASIVTRQWAKK 478



>gi|471568210|gb|EMR67929.1| putative g2 mitotic-specific cyclin-b protein [Eutypa lata UCREL1]
          Length = 500

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 202/267 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D  DP+M +EYA +IF+YL+DLE   +P P YM+ Q +L W+ RGILVDWL+EVH
Sbjct: 215 DLDAEDHDDPLMAAEYANEIFEYLRDLEVNSIPNPQYMAHQDDLEWKTRGILVDWLVEVH 274

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLA+++IDRFLS +VV L +LQLVGIT +FIAAKYEE+L+P + NF ++A
Sbjct: 275 TRFHLLPETLFLAISVIDRFLSEKVVQLDRLQLVGITAMFIAAKYEEVLSPHVANFKHVA 334

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G++E EIL AER+VL+T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+D
Sbjct: 335 DDGFSEAEILSAERFVLSTLNYDLSYPNPMNFLRRISKADNYDIQSRTIGKYLMEISLLD 394

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS +AAAA+YL+R +L+R EW   L +Y+ YT                +P  H
Sbjct: 395 HRFMAYRPSHVAAAAMYLARLILDRGEWDDTLSYYAGYTEEEIEPVYELMIDYLARPVIH 454

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKNV 406
           E  YKKYA+K+F+KAS+  + W  KN 
Sbjct: 455 EAFYKKYASKKFLKASLLTRQWAKKNA 481



>gi|261194631|ref|XP_002623720.1| G2/M-specific cyclin NimE [Ajellomyces dermatitidis SLH14081]
 gi|239588258|gb|EEQ70901.1| G2/M-specific cyclin NimE [Ajellomyces dermatitidis SLH14081]
          Length = 504

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 148/261 (56%), Positives = 195/261 (74%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           +D YDP+M +EY V+IF YLK++E + MP PDY+  Q EL W+MRGILVDWLIEVH +FR
Sbjct: 220 EDLYDPLMAAEYVVEIFDYLKEIEPQTMPNPDYIDHQEELEWKMRGILVDWLIEVHTRFR 279

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VNIIDRFLS  VV+L +LQLVG+T +FIAAKYEE+L+P + NF ++AD  +
Sbjct: 280 LLPETLFLTVNIIDRFLSAEVVALDRLQLVGVTAMFIAAKYEEVLSPHVANFSHVADETF 339

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           +++EIL AER+VL T+++ + YPNPMNFLRR SKAD++DIQ RT+ KY +E+SL+D++F+
Sbjct: 340 SDKEILDAERHVLATLNYDISYPNPMNFLRRISKADNYDIQTRTLGKYFLEVSLLDHRFM 399

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLY 383
           P   S +AAAA+YL+R +L+R  W A L HYS YT                +P  HE  +
Sbjct: 400 PYRQSHVAAAAMYLARLILHRGPWDATLAHYSGYTKEEILPVFQLLVDYLHRPVSHEAFF 459

Query: 384 KKYAAKRFMKASIFVKDWISK 404
           KKYA+K+FMKASI  + W  K
Sbjct: 460 KKYASKKFMKASIVTRQWAKK 480



>gi|425766179|gb|EKV04804.1| G2/M-specific cyclin NimE [Penicillium digitatum Pd1]
 gi|425774533|gb|EKV12836.1| G2/M-specific cyclin NimE [Penicillium digitatum PHI26]
          Length = 462

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 198/266 (74%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLD +D  DP M +EY V+IF+YLKDLE   +P PDY+  Q +L W+MRGILVDWLIEV
Sbjct: 178 QDLDTEDLDDPSMAAEYVVEIFEYLKDLEIITLPNPDYIDHQPDLEWKMRGILVDWLIEV 237

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +FRLLPETLFLAVNIIDRFLS  VV+L +LQLVG+T +FIA+KYEE+L+P + NF ++
Sbjct: 238 HTRFRLLPETLFLAVNIIDRFLSAEVVALDRLQLVGVTAMFIASKYEEVLSPHVANFSHV 297

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD  ++++EIL AER+VL T+++ + +PNPMNFLRR SKAD++DIQ RT+ KYL+EISL+
Sbjct: 298 ADETFSDKEILDAERHVLATLEYNMSFPNPMNFLRRISKADNYDIQTRTLGKYLVEISLL 357

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+  P S I+AAA+YL+R +L R  W  NL HYS YT                +P  
Sbjct: 358 DHRFMGFPQSHISAAAMYLARLILERGPWDVNLAHYSGYTEEEIHPVFQLMVDYLRRPVS 417

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISK 404
           HE  +KKYA+K+F+KASI  + W  K
Sbjct: 418 HEAFFKKYASKKFLKASILTRQWAKK 443



>gi|156053169|ref|XP_001592511.1| hypothetical protein SS1G_06752 [Sclerotinia sclerotiorum 1980]
 gi|154704530|gb|EDO04269.1| hypothetical protein SS1G_06752 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 482

 Score =  331 bits (849), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 151/267 (56%), Positives = 197/267 (73%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D  DP+M++EY V+IF+YLK LE    P   YM+ Q +L W+MRGILVDWLIEVH
Sbjct: 202 DLDAEDSDDPLMVAEYVVEIFEYLKKLEVATKPNEKYMAHQEDLEWKMRGILVDWLIEVH 261

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLAVNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P + NF ++A
Sbjct: 262 TRFHLLPETLFLAVNIIDRFLSTKVVQLDRLQLVGVTAMFIASKYEEVLSPHVANFRHVA 321

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G+TE EIL AERYVL+ +++ L YPNPMNFLRR SKAD +DIQ RT+ KYLMEISL+D
Sbjct: 322 DDGFTEAEILSAERYVLSALNYDLSYPNPMNFLRRISKADDYDIQTRTLGKYLMEISLLD 381

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS +AAA++YL+R +L + EW   L HYS Y+                +P  H
Sbjct: 382 HRFMKYLPSHVAAASMYLARLILEKGEWDPVLTHYSGYSEDEIEPVFQLMVDYLARPVTH 441

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKNV 406
           E  +KKYA+K+F+KASI  + W  K+ 
Sbjct: 442 EAFFKKYASKKFLKASILTRQWAKKHA 468



>gi|340520334|gb|EGR50570.1| predicted protein [Trichoderma reesei QM6a]
          Length = 460

 Score =  331 bits (849), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 150/280 (53%), Positives = 208/280 (74%)

Query: 127 RKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWR 186
           ++ +K +   + + LD +D  DP+M++EYA DIF YL++LE + +P PDYMS Q +L W+
Sbjct: 165 KEAAKAELLANIKSLDEEDLDDPLMVAEYANDIFDYLRELEVQSIPNPDYMSHQDDLEWK 224

Query: 187 MRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEE 246
            RGIL+DWLIEVH +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +FIA+KYEE
Sbjct: 225 TRGILIDWLIEVHTRFHLLPETLFLAVNIIDRFLSEKVVQLDRLQLVGITAMFIASKYEE 284

Query: 247 LLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQAR 306
           +L+P ++NF  +AD+G++E EIL AER++L+T+++ L YPNPMNFLRR SKAD++DIQ+R
Sbjct: 285 VLSPHVENFKKIADDGFSEAEILSAERFILSTLNYDLSYPNPMNFLRRVSKADNYDIQSR 344

Query: 307 TVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXX 366
           T+ KYL EISL+D++F+   PS +AAA++YL+R ML+R EW   + +Y+ YT        
Sbjct: 345 TIGKYLTEISLLDHRFMVYRPSHVAAASMYLARLMLDRGEWDPTIAYYAGYTEDEVEPVV 404

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
                   +P  HE  +KKYA+K+F+KASI  + W  KN 
Sbjct: 405 NLMVDYLARPPIHEAFFKKYASKKFLKASILSRQWAKKNA 444



>gi|327295590|ref|XP_003232490.1| G2/M-specific cyclin NimE [Trichophyton rubrum CBS 118892]
 gi|326465662|gb|EGD91115.1| G2/M-specific cyclin NimE [Trichophyton rubrum CBS 118892]
          Length = 521

 Score =  331 bits (849), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 196/262 (74%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D YDPMM +EY VDIF+YLK+LE   MP PDYM  Q EL W+MRGILVDWLIEVH
Sbjct: 231 DLDAEDLYDPMMATEYVVDIFEYLKELEPITMPNPDYMDHQDELEWKMRGILVDWLIEVH 290

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFL VNIIDRFLS  VV+L +LQLVG+T +FIA+KYEE+L+P + NF ++A
Sbjct: 291 TRFRLLPETLFLTVNIIDRFLSAEVVTLNRLQLVGVTAMFIASKYEEVLSPHVANFSHVA 350

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+ ++++EIL AER++L  +++ L YPNPMNFLRR SK D++D++ RT+AKYLMEISLVD
Sbjct: 351 DDTFSDKEILDAERHILAVLNYDLSYPNPMNFLRRISKPDNYDVRTRTLAKYLMEISLVD 410

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S IAAA+++L+R +  R  W A + +YS YT                +P  H
Sbjct: 411 HRFMKYRQSHIAAASIFLARVIYERGPWDATIAYYSGYTKEEIMPVYELLIDYLCRPPVH 470

Query: 380 EQLYKKYAAKRFMKASIFVKDW 401
           E  +KKYA+KRF+KASI  + W
Sbjct: 471 EAFFKKYASKRFLKASIMTRQW 492



>gi|340992774|gb|EGS23329.1| G2/M cyclins accumulate steadily during G2 and are abruptly
           destroyed at mitosis-like protein [Chaetomium
           thermophilum var. thermophilum DSM 1495]
          Length = 496

 Score =  331 bits (848), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 211/288 (73%)

Query: 119 ESEIYEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMS 178
           E E+     +++K+   +  + LD++D  DP+M++EYA DIF YL+++E    P P+YM+
Sbjct: 193 EPEVAPVVPQQTKRPIPETAKILDSEDLDDPLMVAEYANDIFDYLREIEPLSAPNPNYMA 252

Query: 179 SQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGL 238
            Q +L W+ RGIL+DWL+EVH +F LLPETLFLAVNI+DRFLS +VV L +LQLVGIT +
Sbjct: 253 HQEDLEWKTRGILIDWLVEVHTRFHLLPETLFLAVNIVDRFLSEKVVQLDRLQLVGITAM 312

Query: 239 FIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKA 298
           FIA+KYEE+L+P I NF ++AD+G++E EIL AER+VL T+++ L YPNPMNFLRR SKA
Sbjct: 313 FIASKYEEVLSPHIANFRHIADDGFSEAEILSAERFVLATLNYDLSYPNPMNFLRRISKA 372

Query: 299 DHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYT 358
           D++DIQ+RT+ KYLMEISL+D++F+   PS++AAAA+YL+R +L+R EW   L +Y+ Y+
Sbjct: 373 DNYDIQSRTIGKYLMEISLLDHRFMCYRPSLVAAAAMYLARLILDRGEWDETLEYYAGYS 432

Query: 359 XXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
                           +P  HE  +KKYA+K+F+KASI  + W  KN 
Sbjct: 433 EAEIEPVVLLMVDYLARPVIHEAFFKKYASKKFLKASILTRQWAKKNA 480



>gi|154318239|ref|XP_001558438.1| hypothetical protein BC1G_03287 [Botryotinia fuckeliana B05.10]
 gi|347837552|emb|CCD52124.1| similar to G2/mitotic-specific cyclin-B [Botryotinia fuckeliana T4]
 gi|472243052|gb|EMR87720.1| putative g2 mitotic-specific cyclin-b protein [Botryotinia
           fuckeliana BcDW1]
          Length = 480

 Score =  331 bits (848), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 151/267 (56%), Positives = 197/267 (73%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D  DP+M++EY V+IF+YLK LE    P   YM+ Q +L W+MRGILVDWLIEVH
Sbjct: 200 DLDAEDTDDPLMVAEYVVEIFEYLKKLEIATKPNEKYMAHQEDLEWKMRGILVDWLIEVH 259

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLAVNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P + NF ++A
Sbjct: 260 TRFHLLPETLFLAVNIIDRFLSTKVVQLDRLQLVGVTAMFIASKYEEVLSPHVANFRHVA 319

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G+TE EIL AERYVL+ +++ L YPNPMNFLRR SKAD +DIQ RT+ KYLMEISL+D
Sbjct: 320 DDGFTEAEILSAERYVLSALNYDLSYPNPMNFLRRISKADDYDIQTRTLGKYLMEISLLD 379

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS +AAA++YL+R +L + EW   L HYS Y+                +P  H
Sbjct: 380 HRFMKYLPSHVAAASMYLARLILEKGEWDPMLTHYSGYSEDEIEPVFQLMVDYLARPVTH 439

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKNV 406
           E  +KKYA+K+F+KASI  + W  K+ 
Sbjct: 440 EAFFKKYASKKFLKASILTRSWAKKHA 466



>gi|296807933|ref|XP_002844305.1| nime/cyclinb [Arthroderma otae CBS 113480]
 gi|238843788|gb|EEQ33450.1| nime/cyclinb [Arthroderma otae CBS 113480]
          Length = 506

 Score =  331 bits (848), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 149/262 (56%), Positives = 194/262 (74%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D YDPMM +EY  +IF YLK+LE   MP PDYM  Q EL W+MRGILVDWLIEVH
Sbjct: 216 DLDAEDLYDPMMATEYVAEIFDYLKELEPLTMPNPDYMDHQDELEWKMRGILVDWLIEVH 275

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFL VNIIDRFLS  VV+L +LQLVG+T +FIAAKYEE+L+P +  F ++A
Sbjct: 276 ARFRLLPETLFLTVNIIDRFLSAEVVALGRLQLVGVTAMFIAAKYEEILSPHVATFTHVA 335

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D  ++++EIL AER++L T+++ L YPNPMNFLRR SK D++D++ RT+AKYLMEISLVD
Sbjct: 336 DGSFSDKEILDAERHILATLNYDLSYPNPMNFLRRISKPDNYDVRTRTLAKYLMEISLVD 395

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S IAAA+++L+R + +R  W A + +YS YT                +P  H
Sbjct: 396 HRFMVYRQSHIAAASIFLARVIFDRGPWDATIAYYSGYTKEEIMPVYQLLIDYLCRPPVH 455

Query: 380 EQLYKKYAAKRFMKASIFVKDW 401
           E  +KKYA+KRF+KASI  + W
Sbjct: 456 EAFFKKYASKRFLKASIMTRQW 477



>gi|320589047|gb|EFX01515.1| g2 mitotic-specific cyclin-b [Grosmannia clavigera kw1407]
          Length = 553

 Score =  330 bits (847), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 200/267 (74%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLD++D +DP M++EYA +IF+YL DLE   +P P YM+ Q EL W+ RG+L+DWL+EVH
Sbjct: 271 DLDSEDLHDPQMVAEYAPEIFEYLCDLECSSLPNPRYMNHQDELDWKTRGVLIDWLVEVH 330

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLAVNI+DRFLS +VV L +LQLVG+T +FIAAKYEE+L+PS+ +F ++A
Sbjct: 331 TRFHLLPETLFLAVNIVDRFLSAKVVQLDRLQLVGVTAMFIAAKYEEVLSPSVSSFRHVA 390

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G++E EIL AER++L T+++ L YPNPMNFLRR SKAD++DIQ RTVAKYL EISL+D
Sbjct: 391 DDGFSEAEILSAERFMLGTLNYDLSYPNPMNFLRRVSKADNYDIQTRTVAKYLTEISLLD 450

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS +AAAA++L+R +L+R EW   L  Y+ Y                 +P+ H
Sbjct: 451 HRFMSYRPSHVAAAAMFLARLILDRGEWDETLSFYAGYNEEEIEPVAILMIDYLARPSTH 510

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKNV 406
           E  +KKYA+K+++KAS+  + W  KN 
Sbjct: 511 EAFFKKYASKKYLKASLITRQWAKKNA 537



>gi|402086426|gb|EJT81324.1| G2/mitotic-specific cyclin-B [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 487

 Score =  330 bits (846), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 197/266 (74%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +L+ DDF DP+M++EYA +IF Y+ DLE+  MP PDYMS Q +L W+ RGILVDWLIEVH
Sbjct: 205 NLENDDFEDPLMVAEYANEIFDYMLDLETRSMPNPDYMSHQDDLEWKTRGILVDWLIEVH 264

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F L+PETLFLAVNI+DRFLS +VV L +LQLVGIT +FIA+KYEE+++P + NF ++ 
Sbjct: 265 TRFHLVPETLFLAVNIVDRFLSEKVVPLDRLQLVGITAMFIASKYEEVMSPHVTNFRHVT 324

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G++E EIL AERY+L T+ + L YPNPMNFLRR SKAD++D+ +RTV KYLMEISL+D
Sbjct: 325 DDGFSESEILSAERYILQTLKYDLSYPNPMNFLRRISKADNYDVNSRTVGKYLMEISLLD 384

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++ +   PS IAAAA+ LSR +L+R EW   L HYS YT                +P  H
Sbjct: 385 HRLMQYRPSHIAAAAMALSRIILDRGEWDETLAHYSGYTDEEVEPVVQLMVDYLSRPIIH 444

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKN 405
           E  +KKYA+KRF+K S+  ++W  +N
Sbjct: 445 EAFFKKYASKRFLKTSLHARNWTERN 470



>gi|399164713|emb|CCE34407.1| probable G2/mitotic-specific cyclin B [Claviceps purpurea 20.1]
          Length = 509

 Score =  330 bits (846), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 198/266 (74%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           ++ DD+ DP+M++EYA +IF+YL+DLE+  M  PDYMS Q +L W+ RGIL+DW++EVH 
Sbjct: 226 IENDDWDDPLMVAEYATEIFEYLRDLETRSMLNPDYMSHQDDLEWKTRGILIDWVVEVHT 285

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           +F L+PETLFLAVNIIDRFLS +VV L +LQLVG+T LFIA+KYEE L+P ++NF  + D
Sbjct: 286 RFNLVPETLFLAVNIIDRFLSEKVVQLDRLQLVGVTALFIASKYEETLSPHLENFRRITD 345

Query: 261 NGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           N ++E EIL AER+VL+T+D+ L YPNPMNFLRR SKAD++DIQ+RT+AKYLMEISL+DY
Sbjct: 346 NAFSEAEILSAERFVLSTLDYDLSYPNPMNFLRRVSKADNYDIQSRTMAKYLMEISLLDY 405

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           +F+P  PS  AAAA++LSR ML+R  W   L +Y+ Y                 +P  HE
Sbjct: 406 RFMPYRPSHCAAAAIFLSRLMLDRGPWDKILAYYAGYDKKELQPVVNLMIDYLARPVIHE 465

Query: 381 QLYKKYAAKRFMKASIFVKDWISKNV 406
             +KKYA KRF+KAS+  + W  +N 
Sbjct: 466 AFFKKYACKRFLKASVLARSWAKRNA 491



>gi|380488482|emb|CCF37342.1| cyclin, partial [Colletotrichum higginsianum]
          Length = 498

 Score =  330 bits (846), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 200/268 (74%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +LD +D  DP+M++EYA +IF+YL+DLE   +P P+YM  Q +L W+ RGILVDWLIEVH
Sbjct: 199 NLDEEDLDDPLMVAEYANEIFEYLRDLECNSIPNPNYMEHQDDLEWKTRGILVDWLIEVH 258

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLA+NIIDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P + NF ++A
Sbjct: 259 TRFHLLPETLFLAINIIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVANFRHVA 318

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G++E EIL AER+VL T+++ L YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D
Sbjct: 319 DDGFSEAEILSAERFVLGTLNYDLSYPNPMNFLRRISKADNYDIQCRTIGKYLMEISLLD 378

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS +AA A+YL+R +L+R +W A +  Y+ YT                +P  H
Sbjct: 379 HRFMAYRPSHVAAGAMYLARLILDRGDWDATIAFYAGYTEDEIEPVIRLMVDYLARPVVH 438

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKNVE 407
           E  +KKYA+K+F+KASI  + W  K+ E
Sbjct: 439 EAFFKKYASKKFLKASILTRQWAKKSAE 466



>gi|310793248|gb|EFQ28709.1| cyclin domain-containing protein [Glomerella graminicola M1.001]
          Length = 500

 Score =  330 bits (846), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 199/268 (74%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +LD +D  DP+M++EYA +IF+YL+DLE   +P P+YM  Q +L W+ RGILVDWLIEVH
Sbjct: 201 NLDEEDLDDPLMVAEYANEIFEYLRDLECNSIPNPNYMEHQDDLEWKTRGILVDWLIEVH 260

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLA+NIIDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P + NF ++A
Sbjct: 261 TRFHLLPETLFLAINIIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVANFRHVA 320

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G+TE EIL AER+VL T+++ L YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D
Sbjct: 321 DDGFTEAEILSAERFVLGTLNYDLSYPNPMNFLRRISKADNYDIQCRTIGKYLMEISLLD 380

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS +AA A+YL+R +L+R +W   +  Y+ YT                +P  H
Sbjct: 381 HRFMSYRPSHVAAGAMYLARLILDRGDWDTTIAFYAGYTEDEIEPVVRLMVDYLARPVVH 440

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKNVE 407
           E  +KKYA+K+F+KASI  + W  K+ E
Sbjct: 441 EAFFKKYASKKFLKASILTRQWAKKSAE 468



>gi|477525207|gb|ENH77122.1| g2 mitotic-specific cyclin-b [Colletotrichum orbiculare MAFF
           240422]
          Length = 499

 Score =  330 bits (846), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 199/267 (74%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +LD +D  DP+M++EYA DIF+YL+DLE   +P P+YM  Q +L W+ RGILVDWLIEVH
Sbjct: 204 NLDEEDLDDPLMVAEYANDIFEYLRDLEVNSIPNPNYMEHQDDLEWKTRGILVDWLIEVH 263

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFLA+N+IDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P + NF ++A
Sbjct: 264 TRFHLLPETLFLAINVIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVANFRHVA 323

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G++E EIL AER+VL T+++ L YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D
Sbjct: 324 DDGFSEAEILSAERFVLGTLNYDLSYPNPMNFLRRISKADNYDIQCRTIGKYLMEISLLD 383

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+   PS IAA A+YL+R +L+R EW+  +  Y+ YT                +P  H
Sbjct: 384 HRFMCYRPSHIAAGAMYLARLILDRGEWNETIAFYAGYTEEEIEPVVRLMVDYLARPVVH 443

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKNV 406
           E  +KKYA+K+F+KASI  + W  K+ 
Sbjct: 444 EAFFKKYASKKFLKASILTRQWAKKSA 470



>gi|512188916|gb|EPE04685.1| g2 mitotic-specific cyclin-b [Ophiostoma piceae UAMH 11346]
          Length = 488

 Score =  328 bits (842), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 149/268 (55%), Positives = 197/268 (73%), Gaps = 6/268 (2%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           +DLDA+DF DP M++EYA DIF+YL+DLE   +P P YMS Q EL W+ RG+L+DWL+EV
Sbjct: 211 KDLDAEDFDDPQMVAEYAADIFEYLRDLECSSLPNPRYMSHQDELDWKTRGVLIDWLVEV 270

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLAVNI+DRFLS +VV L +LQLVG+T +FIAAKYEE+L+PS+ +F ++
Sbjct: 271 HTRFHLLPETLFLAVNIVDRFLSAKVVQLDRLQLVGVTAMFIAAKYEEVLSPSVGSFRHV 330

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G+TE EIL AER++L T+++ L YPNPMNFLRR SKAD++DIQ RTVAKYL EISL+
Sbjct: 331 ADDGFTEAEILSAERFMLGTLNYDLSYPNPMNFLRRVSKADNYDIQTRTVAKYLTEISLL 390

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+   PS +AAAA++L+R +L+R EW A L  Y+ YT                +P+ 
Sbjct: 391 DHRFMSYRPSHVAAAAMFLARLILDRGEWDATLSFYAGYTEEEIEPVAILMVDYLARPST 450

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKYA       S+  + W  KN 
Sbjct: 451 HEAFFKKYA------TSLITRQWAKKNA 472



>gi|449543795|gb|EMD34770.1| hypothetical protein CERSUDRAFT_116962 [Ceriporiopsis subvermispora
           B]
          Length = 625

 Score =  328 bits (841), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 151/265 (56%), Positives = 204/265 (76%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +W+DLD  D  DP+M+SEY V+IF+YLK +E   MP P YM SQ +L+W+MRGIL DWLI
Sbjct: 297 EWDDLDEGDTEDPLMVSEYVVEIFEYLKQVELTTMPNPTYMESQKDLAWKMRGILTDWLI 356

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           +VH +FRLLPETLFL VN+IDRFLS RVVSL KLQLVGIT +F+AAK EE++APS +NF+
Sbjct: 357 QVHSRFRLLPETLFLCVNLIDRFLSSRVVSLAKLQLVGITCMFVAAKVEEIVAPSAQNFL 416

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           Y AD+ Y E EIL AE+Y+L TID+ L YPNP++FLRR+SKAD +D+Q RTVAKY +EI 
Sbjct: 417 YCADSSYNESEILMAEKYILKTIDWNLSYPNPIHFLRRTSKADEYDVQVRTVAKYFLEIQ 476

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP 376
            ++++ +  PPS++AAA+++L+R +LNR++W  NL HYS Y                +KP
Sbjct: 477 CLEWRLIAAPPSLLAAASMWLARLVLNRADWTPNLAHYSSYPESALIPTANLMLNYVLKP 536

Query: 377 TKHEQLYKKYAAKRFMKASIFVKDW 401
            +H+  +KKYA+K+F+KAS+FV++W
Sbjct: 537 IRHQSFFKKYASKKFLKASVFVREW 561



>gi|389740963|gb|EIM82153.1| A/B/D/E cyclin, partial [Stereum hirsutum FP-91666 SS1]
          Length = 404

 Score =  328 bits (840), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 146/261 (55%), Positives = 199/261 (76%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +W+DLDA+D  DP+M+SEY  +IF+YLK++E   MP  +YM +Q +L+W+MRGIL DWLI
Sbjct: 121 EWQDLDAEDAQDPLMVSEYVAEIFEYLKEVERTTMPNANYMDNQKDLAWKMRGILTDWLI 180

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           +VH +FRLLPETLFLAVNIIDRFLS RVVSL KLQLVGIT +F+AAK EE++APS +NF+
Sbjct: 181 QVHMRFRLLPETLFLAVNIIDRFLSSRVVSLAKLQLVGITCMFVAAKVEEIVAPSAQNFL 240

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           Y AD+ YTE EIL+AE+Y+L T+++ + YP+P++FLRR SKAD +++Q RTVAKYLMEI 
Sbjct: 241 YCADSSYTEGEILQAEKYILKTLEWSMNYPSPIHFLRRVSKADDYNVQVRTVAKYLMEIE 300

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP 376
            V+++ +  PPSM+AAA+++L+R +L + EW  NL HYS Y                +KP
Sbjct: 301 CVEWRLIGSPPSMLAAASIWLARLILGKEEWTPNLAHYSSYPESALIPTANIMLNYILKP 360

Query: 377 TKHEQLYKKYAAKRFMKASIF 397
            +H   +KKYA+K++MK   F
Sbjct: 361 IRHSSFFKKYASKKYMKVCCF 381



>gi|71019349|ref|XP_759905.1| hypothetical protein UM03758.1 [Ustilago maydis 521]
 gi|46099560|gb|EAK84793.1| hypothetical protein UM03758.1 [Ustilago maydis 521]
 gi|90887269|gb|AAP94019.2| B-type cyclin 1 [Ustilago maydis]
          Length = 675

 Score =  327 bits (838), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 154/275 (56%), Positives = 208/275 (75%)

Query: 130 SKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRG 189
           +K  K + WEDLDA+D  DP+M++EY  DIF+Y+K+LE   MP  DYM++Q E++W +R 
Sbjct: 277 NKPAKDEGWEDLDAEDADDPLMVAEYVNDIFEYMKELEIINMPNGDYMANQKEINWDVRA 336

Query: 190 ILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLA 249
           IL+DWL++VH KFRLLPETL+LAVNIIDRFLS R +SL KLQLVG+T + IA+KYEE++ 
Sbjct: 337 ILIDWLVDVHAKFRLLPETLYLAVNIIDRFLSRRTISLSKLQLVGVTAMCIASKYEEVMC 396

Query: 250 PSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVA 309
           PSI+NF ++AD GYT+ EIL+AERY+L  +DF + Y NPMNFLRR SKAD++DIQ RTVA
Sbjct: 397 PSIQNFCHLADGGYTDVEILRAERYMLKVLDFSMSYANPMNFLRRISKADNYDIQTRTVA 456

Query: 310 KYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXX 369
           KY MEISL+DY+ +  PPS+IAAA+++L+R++L R EW   L+HYS Y+           
Sbjct: 457 KYFMEISLLDYRLMEHPPSLIAAASVWLAREVLERGEWTPTLVHYSTYSEQELLGTAEIM 516

Query: 370 XXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
               ++P  H+  +KKYA K+FM+AS +V +W  K
Sbjct: 517 LDYCLRPIAHQFFHKKYAHKKFMRASTYVIEWAHK 551



>gi|409047567|gb|EKM57046.1| hypothetical protein PHACADRAFT_254572 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 692

 Score =  327 bits (837), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 152/265 (57%), Positives = 201/265 (75%)

Query: 138 WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIE 197
           W+DLDA+D  DP+M+SEY  DIF YLK +E   MP P+YM  Q +L+W MRGIL DWLI+
Sbjct: 311 WQDLDAEDVDDPLMVSEYVNDIFNYLKGVEQTTMPNPNYMEMQKDLAWTMRGILTDWLIQ 370

Query: 198 VHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIY 257
           VH +FRL PETLFLAVNIIDRFLS RVVSL KLQLVGIT LF+AAK EE++APS  NF+Y
Sbjct: 371 VHSRFRLFPETLFLAVNIIDRFLSQRVVSLAKLQLVGITCLFVAAKVEEIVAPSAHNFLY 430

Query: 258 MADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISL 317
            AD+ YTE EIL+AE+Y+L T+D+ + YPNPM+FLRR+SKAD ++I++RT+AKY +EI  
Sbjct: 431 CADSSYTEAEILQAEKYILKTLDWNMSYPNPMHFLRRASKADDYNIKSRTIAKYFLEIQC 490

Query: 318 VDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT 377
           V+++ +  PPS++AAAAL+L+R ++  +EW  NL HYS Y                +K  
Sbjct: 491 VEWRLIAAPPSLVAAAALWLARLVVGETEWTPNLAHYSSYPESALIPTANLMLNYVLKKP 550

Query: 378 KHEQLYKKYAAKRFMKASIFVKDWI 402
           KH+  ++KYA K+FMK+SI+V+DW+
Sbjct: 551 KHQSFFRKYAGKKFMKSSIYVRDWV 575



>gi|406858966|gb|EKD12044.1| G2/mitotic-specific cyclin-B [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 485

 Score =  327 bits (837), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 192/258 (74%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EY V+IF YLK LE    P  DYM  Q +L W+MRGIL+DWL+EVH +F LLPET
Sbjct: 213 PLMVAEYVVEIFDYLKKLEVASRPNADYMEHQEDLEWKMRGILIDWLVEVHTRFHLLPET 272

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P + NF  +AD+G+TE+EI
Sbjct: 273 LFLAVNIIDRFLSTKVVQLDRLQLVGVTAMFIASKYEEVLSPHVANFRRVADDGFTEDEI 332

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L AERYVLT +++ L YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+   PS
Sbjct: 333 LSAERYVLTALNYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMEYLPS 392

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
            IAAA++YL+RK+L+R EW   L HY+ Y+                +P  HE  +KKYA+
Sbjct: 393 HIAAASMYLARKILDRGEWDPTLAHYAGYSEEEIEPVFKLMVDYLARPVTHEAFFKKYAS 452

Query: 389 KRFMKASIFVKDWISKNV 406
           K+F+KASI  + W  K+ 
Sbjct: 453 KKFLKASILTRQWAKKHA 470



>gi|392578168|gb|EIW71296.1| hypothetical protein TREMEDRAFT_37727 [Tremella mesenterica DSM
           1558]
          Length = 535

 Score =  325 bits (834), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 168/365 (46%), Positives = 230/365 (63%), Gaps = 9/365 (2%)

Query: 46  VTAIPQKKLGVVTRKRAVLMDRTNVSLKQNSVNEQTHDITKPIIKEN-------VNLGFQ 98
            T++P  KL   +R          V LK+  +N Q  D+ +P  K+        +     
Sbjct: 144 TTSVPISKLPARSRSTTASTSTVEVRLKEKKLNVQEEDVVQPARKKRKTSSPALIEAVTP 203

Query: 99  DIRSKEKHELSFDTTLATTAESEIYEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVD 158
           DI  +  ++      + ++          KR  + K   W DLDA+D  DP M+SEY +D
Sbjct: 204 DIDEEALYDHEGRELVLSSGSKGTSMRSPKRVARSKDAGWTDLDAEDEGDPTMVSEYVID 263

Query: 159 IFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDR 218
            FKY+  +E   MP PDYM  QSEL W MR +L+DW+IEVH KFRLLPETLF+AVN++DR
Sbjct: 264 AFKYMMSIERATMPSPDYMDKQSELQWPMRRVLMDWIIEVHTKFRLLPETLFIAVNLVDR 323

Query: 219 FLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTT 278
           FL+ RVVSLVK QLVG+T LF+AAKYEE++ PS+ +F++M D GYT +EILKAERY+L+T
Sbjct: 324 FLTERVVSLVKFQLVGLTALFVAAKYEEVICPSVSHFLHMTDGGYTVDEILKAERYMLST 383

Query: 279 IDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLS 338
           ++F + YPNP++FLRR SKAD +DIQ RTV+KYL+EIS VD + +  PPS++AAAA++L+
Sbjct: 384 LNFDMSYPNPLHFLRRISKADGYDIQTRTVSKYLIEISCVDNRLIKFPPSLLAAAAMFLA 443

Query: 339 RKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP--TKHEQLYKKYAAKRFMKASI 396
           R  L+R +W  NL+HYS Y+               + P        YKKYA+K+ MK+S 
Sbjct: 444 RMCLDRGDWTPNLVHYSTYSVEEILECSQTMLDHLLDPEFNTDTSFYKKYASKKHMKSSF 503

Query: 397 FVKDW 401
           FV  W
Sbjct: 504 FVHQW 508



>gi|225559765|gb|EEH08047.1| G2/mitotic-specific cyclin-B [Ajellomyces capsulatus G186AR]
          Length = 499

 Score =  325 bits (833), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 192/265 (72%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLD +D YDP+M  EYA++IF YLK +E + MP PDY+  Q +L W +RG+LVDWLIEVH
Sbjct: 211 DLDTEDLYDPIMGGEYAIEIFDYLKKIEPQTMPNPDYIYHQEDLEWGLRGVLVDWLIEVH 270

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFL VNIIDRFLS  VV+L +LQLVG+T +FIAAKYEE+ +P + NF ++A
Sbjct: 271 TRFRLLPETLFLTVNIIDRFLSAEVVALDRLQLVGVTAMFIAAKYEEVFSPHVANFSHVA 330

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D  ++++EIL AER+VL T+++ + YPNPMNFLRR SKAD++DI  RT+ KY MEISL+D
Sbjct: 331 DENFSDKEILDAERHVLATLNYDISYPNPMNFLRRISKADNYDIHTRTLGKYFMEISLLD 390

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S +AAA++YL+R +L+R  W A L HYS YT                +P  H
Sbjct: 391 HRFMAYRQSHVAAASMYLARLILHRGRWDATLAHYSGYTKEEILPVFQLLIDYLHRPISH 450

Query: 380 EQLYKKYAAKRFMKASIFVKDWISK 404
           E  +KKYA K+FMKASI  + W  K
Sbjct: 451 EAFFKKYANKKFMKASIVTRQWARK 475



>gi|169867711|ref|XP_001840434.1| g2/mitotic-specific cyclin cdc13 [Coprinopsis cinerea okayama7#130]
 gi|116498595|gb|EAU81490.1| g2/mitotic-specific cyclin cdc13 [Coprinopsis cinerea okayama7#130]
          Length = 618

 Score =  325 bits (833), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 205/283 (72%)

Query: 119 ESEIYEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMS 178
           E+E+  F  +     +T  W+DLDADD  DP+M+SEY  +IF Y+K LE   M  P+YM 
Sbjct: 279 EAEMEAFANEPEHDPETSAWDDLDADDGDDPLMVSEYVGEIFNYMKKLELTTMANPNYME 338

Query: 179 SQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGL 238
           SQ EL+W+MRGIL DWL++VH +FRLLPETLFL VNIIDRFLS RVVSL KLQLVGIT L
Sbjct: 339 SQKELAWKMRGILTDWLVQVHVRFRLLPETLFLCVNIIDRFLSARVVSLAKLQLVGITCL 398

Query: 239 FIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKA 298
           FIA+K+EE+++P + +F+ +AD+ YTE EIL+AERYVL T+D+ L YPNP++FLRR SKA
Sbjct: 399 FIASKFEEIVSPGVSHFLSVADSTYTEAEILQAERYVLKTLDWNLSYPNPVHFLRRVSKA 458

Query: 299 DHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYT 358
           D +D+  RTV KYL+EI  ++++ +  PPS++AAAA++L+R  +   EW  NL HYS Y 
Sbjct: 459 DDYDVAVRTVGKYLLEIGCLEWRLIAAPPSLMAAAAIWLARLAMGHEEWTPNLAHYSSYR 518

Query: 359 XXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDW 401
                          +KP KHE  +KKYA KRF KAS+++++W
Sbjct: 519 ESALVPTANLMLNYILKPIKHEAFFKKYAGKRFSKASVYMREW 561



>gi|426194696|gb|EKV44627.1| hypothetical protein AGABI2DRAFT_194588 [Agaricus bisporus var.
           bisporus H97]
          Length = 578

 Score =  325 bits (833), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 206/268 (76%)

Query: 134 KTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVD 193
           +T  WEDLDADD  DP+M+SEY VDIFKYL+ +E   MP P YM SQ EL+W+MRGIL+D
Sbjct: 268 ETSPWEDLDADDVDDPLMVSEYVVDIFKYLRQVELTTMPNPHYMESQKELAWKMRGILMD 327

Query: 194 WLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIK 253
           WLI+VH +FRLLPETLFL VN+IDRFLS RVVSL KLQLVG+T LFI+AK+EE+++PS+ 
Sbjct: 328 WLIQVHVRFRLLPETLFLCVNLIDRFLSARVVSLAKLQLVGVTCLFISAKFEEVISPSVS 387

Query: 254 NFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLM 313
           +F+  AD+ YTE EIL+AERYVL T+++ L YPNP+++LRR SKAD +D++ RT+AKYL+
Sbjct: 388 HFLLCADSTYTEAEILQAERYVLKTLEWNLSYPNPVHYLRRVSKADGYDVKVRTLAKYLL 447

Query: 314 EISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXX 373
           EIS ++++ +  PPS++AAA+++L+R  L   +W  NL HYS Y+               
Sbjct: 448 EISCLEWRMIAAPPSLMAAASIWLARLALGYEQWTPNLAHYSGYSESALAPTANLMLNYV 507

Query: 374 MKPTKHEQLYKKYAAKRFMKASIFVKDW 401
           +KP +HE  +KKYA KR+ K+SI++++W
Sbjct: 508 LKPIRHESFHKKYAGKRYYKSSIYMREW 535



>gi|358391194|gb|EHK40598.1| hypothetical protein TRIATDRAFT_301423 [Trichoderma atroviride IMI
           206040]
          Length = 493

 Score =  325 bits (833), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 198/266 (74%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD +D  DP+M++EYA +IF YL++LE   +P  DYMS Q +L W+ RGILVDWLIEVH 
Sbjct: 212 LDEEDLDDPLMVAEYANEIFDYLRELEVRSVPNADYMSHQDDLEWKTRGILVDWLIEVHT 271

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P ++NF  +AD
Sbjct: 272 RFHLLPETLFLAVNIIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVENFKKIAD 331

Query: 261 NGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           +G++E EIL AER++L T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYL EISL+D+
Sbjct: 332 DGFSEAEILSAERFILGTLNYDLSYPNPMNFLRRVSKADNYDIQSRTIGKYLTEISLLDH 391

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           +F+   PS +AAA++YL+R ML+  EW + + +Y+ YT                +P  HE
Sbjct: 392 RFMSFRPSHVAAASMYLARLMLDHGEWDSTIAYYAGYTEEEVEPVVNLMVDYLARPPIHE 451

Query: 381 QLYKKYAAKRFMKASIFVKDWISKNV 406
             +KKYA+K+F+KASI  + W  KN 
Sbjct: 452 AFFKKYASKKFLKASILSRQWAKKNA 477



>gi|409075274|gb|EKM75656.1| hypothetical protein AGABI1DRAFT_116256 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 578

 Score =  325 bits (832), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 206/268 (76%)

Query: 134 KTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVD 193
           +T  WEDLDADD  DP+M+SEY VDIFKYL+ +E   MP P YM SQ EL+W+MRGIL+D
Sbjct: 268 ETSPWEDLDADDVDDPLMVSEYVVDIFKYLRQVELTTMPNPHYMESQKELAWKMRGILMD 327

Query: 194 WLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIK 253
           WLI+VH +FRLLPETLFL VN+IDRFLS RVVSL KLQLVG+T LFI+AK+EE+++PS+ 
Sbjct: 328 WLIQVHVRFRLLPETLFLCVNLIDRFLSARVVSLAKLQLVGVTCLFISAKFEEVISPSVS 387

Query: 254 NFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLM 313
           +F+  AD+ YTE EIL+AERYVL T+++ L YPNP+++LRR SKAD +D++ RT+AKYL+
Sbjct: 388 HFLLCADSTYTEAEILQAERYVLKTLEWNLSYPNPVHYLRRVSKADGYDVKVRTLAKYLL 447

Query: 314 EISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXX 373
           EIS ++++ +  PPS++AAA+++L+R  L   +W  NL HYS Y+               
Sbjct: 448 EISCLEWRMIAAPPSLMAAASIWLARLALGYEQWTPNLAHYSGYSESALAPTANLMLNYV 507

Query: 374 MKPTKHEQLYKKYAAKRFMKASIFVKDW 401
           +KP +HE  +KKYA KR+ K+SI++++W
Sbjct: 508 LKPIRHESFHKKYAGKRYYKSSIYMREW 535



>gi|429863631|gb|ELA38054.1| g2 mitotic-specific cyclin-b [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 480

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 198/268 (73%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           ++LD +D  DP+M++EYA +IF+YL+DLE   +P P+YM  Q +L W+ RGILVDWLIEV
Sbjct: 184 KNLDEEDLDDPLMVAEYANEIFEYLRDLECNSIPNPNYMEHQDDLEWKTRGILVDWLIEV 243

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFLA+NIIDRFLS +VV L +LQLVGIT +FIA+KYEE+L+P + NF ++
Sbjct: 244 HTRFHLLPETLFLAINIIDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHVANFRHV 303

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G++E EIL AER+VL T+++ L YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+
Sbjct: 304 ADDGFSEAEILSAERFVLGTLNYDLSYPNPMNFLRRISKADNYDIQCRTIGKYLMEISLL 363

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++F+   PS +AA A+YL+R +L+R +W   +  Y+ Y                 +P  
Sbjct: 364 DHRFMAYRPSHVAAGAMYLARLILDRGDWDDTIAFYAGYNEEEIEPVVRLMVDYLARPVV 423

Query: 379 HEQLYKKYAAKRFMKASIFVKDWISKNV 406
           HE  +KKYA+K+F+KASI  + W  K+ 
Sbjct: 424 HEAFFKKYASKKFLKASILTRQWAKKSA 451



>gi|367020424|ref|XP_003659497.1| hypothetical protein MYCTH_2296618 [Myceliophthora thermophila ATCC
           42464]
 gi|347006764|gb|AEO54252.1| hypothetical protein MYCTH_2296618 [Myceliophthora thermophila ATCC
           42464]
          Length = 472

 Score =  324 bits (831), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 195/255 (76%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD++D  DP+M++EYA DIF+YL+DLE + +P P YM+ Q +L W+ RGIL+DWL+EVH 
Sbjct: 205 LDSEDLDDPLMVAEYANDIFEYLRDLECQSIPNPQYMAHQDDLEWKTRGILIDWLVEVHL 264

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           +F LLPETLFLAVN++DRFLS +VV L +LQLVGIT +FIA+KYEE+L+P I NF ++AD
Sbjct: 265 RFHLLPETLFLAVNVVDRFLSEKVVQLDRLQLVGITAMFIASKYEEVLSPHIANFRHIAD 324

Query: 261 NGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           +G+TE EIL AER+VL T+++ L YPNPMNFLRR SKAD++DIQ+RT+ KYLMEISL+D+
Sbjct: 325 DGFTEAEILSAERFVLATLNYDLSYPNPMNFLRRISKADNYDIQSRTIGKYLMEISLLDH 384

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           + +   PS IAAAA+YLSR +L+R EW   L +YS YT                +P  HE
Sbjct: 385 RLMAYRPSHIAAAAMYLSRLILDRGEWDETLEYYSGYTEEEIQPVVTLMVDYMARPVIHE 444

Query: 381 QLYKKYAAKRFMKAS 395
             +KKYA+K+F+K +
Sbjct: 445 AFFKKYASKKFLKGT 459



>gi|322711525|gb|EFZ03098.1| G2/mitotic-specific cyclin-B [Metarhizium anisopliae ARSEF 23]
          Length = 467

 Score =  323 bits (828), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 149/273 (54%), Positives = 199/273 (72%), Gaps = 10/273 (3%)

Query: 132 KQKTQDWED----------LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQS 181
           KQ+T D ED          ++ DD+ DP+M++EYA +IF+YL+DLE   +P PDYMS Q 
Sbjct: 184 KQETTDDEDKLVPPEGVNVIEEDDWDDPLMVAEYATEIFEYLRDLECRSVPNPDYMSHQD 243

Query: 182 ELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIA 241
           +L W+ RGIL+DWLIEVH +F LLPETLFLAVNIIDRFLS +VV L +LQLVGIT +FIA
Sbjct: 244 DLEWKTRGILIDWLIEVHTRFHLLPETLFLAVNIIDRFLSAKVVQLDRLQLVGITAMFIA 303

Query: 242 AKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHF 301
           +KYEE+L+P ++NF  + DNG++E EIL AER++L+T+++ L YPNPMNFLRR SKAD++
Sbjct: 304 SKYEEVLSPHVENFKRITDNGFSEAEILSAERFLLSTLNYDLSYPNPMNFLRRVSKADNY 363

Query: 302 DIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXX 361
           DIQ+RT+ KYLMEISL+D++F+   PS  AAAA+YL+R ML+R  W   L +Y+ Y    
Sbjct: 364 DIQSRTIGKYLMEISLLDHRFMSFRPSHCAAAAMYLARMMLDRGPWDEILAYYAGYDKQE 423

Query: 362 XXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKA 394
                        +P  HE  +KKYA+K+F+K 
Sbjct: 424 VQPLVDLMVDYLARPVVHEAFFKKYASKKFLKG 456



>gi|400595249|gb|EJP63056.1| cyclin domain-containing protein [Beauveria bassiana ARSEF 2860]
          Length = 447

 Score =  323 bits (827), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 189/258 (73%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EYA +IF+YL+DLE + +P P YM  Q EL W  RGILVDWLIEVH +F LLPET
Sbjct: 173 PLMVAEYATEIFEYLRDLECKSIPNPQYMQHQDELEWSTRGILVDWLIEVHTRFHLLPET 232

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNI+DRFLS +V+ L   QLVGIT +FIA+KYEE+L+P I NF  + ++G+TEEEI
Sbjct: 233 LFLAVNIVDRFLSKKVIQLDNFQLVGITAMFIASKYEEVLSPYIGNFKRITNDGFTEEEI 292

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L AER+VL+T+D+ L YPNPMNFLRR SKAD++DIQ+RT+ KYL EISL+D++F+   PS
Sbjct: 293 LSAERFVLSTLDYDLSYPNPMNFLRRVSKADNYDIQSRTIGKYLTEISLLDHRFMAFRPS 352

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
            +AAAA+YLSR ML+R +W   L HY+ YT                +   HE  +KKYA 
Sbjct: 353 HVAAAAMYLSRLMLDRGKWDDTLAHYAGYTEEELEPVVQLMVDYLARQVVHEAFFKKYAN 412

Query: 389 KRFMKASIFVKDWISKNV 406
           K+F+KASI  + W  KN 
Sbjct: 413 KKFLKASIISRSWAKKNA 430



>gi|346326892|gb|EGX96488.1| G2/mitotic-specific cyclin-B [Cordyceps militaris CM01]
          Length = 696

 Score =  323 bits (827), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 189/258 (73%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EYA +IF YL++LE + +P P YM  Q EL W  RGILVDWLIEVH +F LLPET
Sbjct: 422 PLMVAEYATEIFDYLRELERKAIPNPRYMRHQDELEWSTRGILVDWLIEVHTRFHLLPET 481

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNI+DRFLS +V+ L   QLVGIT +FIA+KYEE+L+P + NF  + ++G+TEEEI
Sbjct: 482 LFLAVNIVDRFLSKKVIQLDNFQLVGITAMFIASKYEEVLSPYLTNFKRITNDGFTEEEI 541

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L AER+VL+T+D+ L YPNPMNFLRR SKAD++DIQ+RT+ KYL EISL+D++F+  PPS
Sbjct: 542 LSAERFVLSTLDYDLSYPNPMNFLRRVSKADNYDIQSRTIGKYLTEISLLDHRFMAYPPS 601

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
            +AAAA+YLSR ML+R  W   L HY+ YT                +P  HE  +KKYA 
Sbjct: 602 HVAAAAMYLSRLMLDRGVWDETLAHYAGYTEEELEPVVQLMVDYLARPVVHEAFFKKYAN 661

Query: 389 KRFMKASIFVKDWISKNV 406
           K+F+KASI  + W  KN 
Sbjct: 662 KKFLKASIISRQWAKKNA 679



>gi|302502557|ref|XP_003013248.1| hypothetical protein ARB_00433 [Arthroderma benhamiae CBS 112371]
 gi|291176811|gb|EFE32608.1| hypothetical protein ARB_00433 [Arthroderma benhamiae CBS 112371]
          Length = 502

 Score =  323 bits (827), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 146/257 (56%), Positives = 193/257 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D YDPMM +EY VDIF+YLK+LE   MP PDYM  Q EL W+MRGILVDWLIEVH
Sbjct: 231 DLDAEDLYDPMMATEYVVDIFEYLKELEPITMPNPDYMDHQDELEWKMRGILVDWLIEVH 290

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFL VNIIDRFLS  VV+L +LQLVG+T +FIA+KYEE+L+P + NF ++A
Sbjct: 291 TRFRLLPETLFLTVNIIDRFLSAEVVTLNRLQLVGVTAMFIASKYEEVLSPHVANFSHVA 350

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+ ++++EIL AER++L  +++ L YPNPMNFLRR SK D++D++ RT+AKYLMEISLVD
Sbjct: 351 DDTFSDKEILDAERHILAVLNYDLSYPNPMNFLRRISKPDNYDVRTRTLAKYLMEISLVD 410

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S IAAA+++L+R +  R  W A + +YS YT                +P  H
Sbjct: 411 HRFMKYRQSHIAAASIFLARVIYERGPWDATIAYYSGYTKEEIMPVYELLIDYLCRPPAH 470

Query: 380 EQLYKKYAAKRFMKASI 396
           E  +KKYA+KRF+K ++
Sbjct: 471 EAFFKKYASKRFLKGTL 487



>gi|378729606|gb|EHY56065.1| G2/mitotic-specific cyclin-B [Exophiala dermatitidis NIH/UT8656]
          Length = 481

 Score =  322 bits (826), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 152/263 (57%), Positives = 189/263 (71%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           E+LDA+D  DP M +EY  +IF Y   LE    P P YM  Q +L W+MRGILVDWLIEV
Sbjct: 197 EELDAEDRDDPSMCAEYVREIFDYYFALEEVTQPNPHYMDHQDDLEWKMRGILVDWLIEV 256

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +FRLLPETLFLAVNI+DRFLS +VV L KLQLVGIT +FIA+KYEE+L+P + NF+++
Sbjct: 257 HTRFRLLPETLFLAVNIVDRFLSQKVVPLDKLQLVGITAMFIASKYEEVLSPHVGNFVHV 316

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
           AD+G+T EE+L AERY L T+ + L YPNPMNFLRR SKAD++DIQ RT+ KYLMEISLV
Sbjct: 317 ADDGFTVEEVLSAERYTLATLKYDLSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLV 376

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D++FL    S IAAAA+YL+R +  R  W+A L  +S YT                 P  
Sbjct: 377 DHRFLEYKQSHIAAAAMYLARMIFERGGWNATLAKFSGYTEEEILPVFDLMVSYLEAPVA 436

Query: 379 HEQLYKKYAAKRFMKASIFVKDW 401
           HE L+KKYA+K+F+KASI  + W
Sbjct: 437 HEALFKKYASKKFLKASIMARKW 459



>gi|302663034|ref|XP_003023165.1| hypothetical protein TRV_02687 [Trichophyton verrucosum HKI 0517]
 gi|291187147|gb|EFE42547.1| hypothetical protein TRV_02687 [Trichophyton verrucosum HKI 0517]
          Length = 502

 Score =  322 bits (826), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 146/257 (56%), Positives = 193/257 (75%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLDA+D YDPMM +EY VDIF+YLK+LE   MP PDYM  Q EL W+MRGILVDWLIEVH
Sbjct: 231 DLDAEDLYDPMMATEYVVDIFEYLKELEPITMPNPDYMDHQDELEWKMRGILVDWLIEVH 290

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFL VNIIDRFLS  VV+L +LQLVG+T +FIA+KYEE+L+P + NF ++A
Sbjct: 291 TRFRLLPETLFLTVNIIDRFLSAEVVTLNRLQLVGVTAMFIASKYEEVLSPHVANFSHVA 350

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+ ++++EIL AER++L  +++ L YPNPMNFLRR SK D++D++ RT+AKYLMEISLVD
Sbjct: 351 DDTFSDKEILDAERHILAVLNYDLSYPNPMNFLRRISKPDNYDVRTRTLAKYLMEISLVD 410

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S IAAA+++L+R +  R  W A + +YS YT                +P  H
Sbjct: 411 HRFMKYRQSHIAAASIFLARVIYERGPWDATIAYYSGYTKEEITPVYELLIDYLCRPPVH 470

Query: 380 EQLYKKYAAKRFMKASI 396
           E  +KKYA+KRF+K ++
Sbjct: 471 EAFFKKYASKRFLKGTL 487



>gi|336375237|gb|EGO03573.1| hypothetical protein SERLA73DRAFT_165237 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 609

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 149/253 (58%), Positives = 196/253 (77%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M+SEY ++IF Y+K++E   MP P+YM SQ EL+W+MRGIL DWL++VH +FRLLPET
Sbjct: 307 PLMVSEYVIEIFNYMKEIELTTMPNPNYMESQKELAWKMRGILTDWLVQVHVRFRLLPET 366

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFL VN+IDRFLS RVVSL KLQLVGIT LF+AAK EE++APS+ +F+Y AD+ YTE EI
Sbjct: 367 LFLCVNLIDRFLSARVVSLAKLQLVGITCLFVAAKVEEIVAPSVAHFLYCADSSYTETEI 426

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L+AERYVL T+D+ L YPNPM+FLRR SKAD +D++ART+AKY +EI  ++++ L  PPS
Sbjct: 427 LQAERYVLKTLDWNLSYPNPMHFLRRISKADEYDVKARTIAKYFLEIQCLEWRLLAAPPS 486

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
           +IAAAA++L+R +L + +W  NL HYS Y                +KP KHE  +KKYA 
Sbjct: 487 LIAAAAIWLARLILGQDKWTPNLAHYSSYAESTIIPTANLMLNYVLKPIKHESFHKKYAG 546

Query: 389 KRFMKASIFVKDW 401
           KRF+K+SI+V+DW
Sbjct: 547 KRFLKSSIWVRDW 559



>gi|212542423|ref|XP_002151366.1| G2/M-specific cyclin NimE [Talaromyces marneffei ATCC 18224]
 gi|210066273|gb|EEA20366.1| G2/M-specific cyclin NimE [Talaromyces marneffei ATCC 18224]
          Length = 485

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 186/251 (74%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M +EY VDIF YLKDLE E +P PDY+  Q EL W+MRGIL+DWLIEVH  FRLLPETLF
Sbjct: 217 MAAEYVVDIFDYLKDLEHETLPSPDYIDHQPELEWKMRGILIDWLIEVHASFRLLPETLF 276

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           L VNIIDRFLS  +VSL +LQLVG+T +FIA+KYEE+L+P + NF  +AD  ++++EIL 
Sbjct: 277 LTVNIIDRFLSAEIVSLDRLQLVGVTAMFIASKYEEVLSPHVANFSQVADETFSDKEILD 336

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AER+VL T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D+KF+P   S +
Sbjct: 337 AERHVLATLNYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHKFMPYKQSHV 396

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AAAA+YL+R +L+R  W A L HYS YT                +   HE  +KKYA+K+
Sbjct: 397 AAAAMYLARLILDRPGWDATLAHYSGYTEEEIQPVFLLMVDYLHRSVAHEAFFKKYASKK 456

Query: 391 FMKASIFVKDW 401
           F+KASI  + W
Sbjct: 457 FLKASIVTRQW 467



>gi|336388249|gb|EGO29393.1| hypothetical protein SERLADRAFT_412909 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 652

 Score =  320 bits (821), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 149/253 (58%), Positives = 196/253 (77%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M+SEY ++IF Y+K++E   MP P+YM SQ EL+W+MRGIL DWL++VH +FRLLPET
Sbjct: 350 PLMVSEYVIEIFNYMKEIELTTMPNPNYMESQKELAWKMRGILTDWLVQVHVRFRLLPET 409

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFL VN+IDRFLS RVVSL KLQLVGIT LF+AAK EE++APS+ +F+Y AD+ YTE EI
Sbjct: 410 LFLCVNLIDRFLSARVVSLAKLQLVGITCLFVAAKVEEIVAPSVAHFLYCADSSYTETEI 469

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L+AERYVL T+D+ L YPNPM+FLRR SKAD +D++ART+AKY +EI  ++++ L  PPS
Sbjct: 470 LQAERYVLKTLDWNLSYPNPMHFLRRISKADEYDVKARTIAKYFLEIQCLEWRLLAAPPS 529

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
           +IAAAA++L+R +L + +W  NL HYS Y                +KP KHE  +KKYA 
Sbjct: 530 LIAAAAIWLARLILGQDKWTPNLAHYSSYAESTIIPTANLMLNYVLKPIKHESFHKKYAG 589

Query: 389 KRFMKASIFVKDW 401
           KRF+K+SI+V+DW
Sbjct: 590 KRFLKSSIWVRDW 602



>gi|212542425|ref|XP_002151367.1| G2/M-specific cyclin NimE [Talaromyces marneffei ATCC 18224]
 gi|210066274|gb|EEA20367.1| G2/M-specific cyclin NimE [Talaromyces marneffei ATCC 18224]
          Length = 480

 Score =  320 bits (821), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 186/251 (74%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M +EY VDIF YLKDLE E +P PDY+  Q EL W+MRGIL+DWLIEVH  FRLLPETLF
Sbjct: 212 MAAEYVVDIFDYLKDLEHETLPSPDYIDHQPELEWKMRGILIDWLIEVHASFRLLPETLF 271

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           L VNIIDRFLS  +VSL +LQLVG+T +FIA+KYEE+L+P + NF  +AD  ++++EIL 
Sbjct: 272 LTVNIIDRFLSAEIVSLDRLQLVGVTAMFIASKYEEVLSPHVANFSQVADETFSDKEILD 331

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AER+VL T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D+KF+P   S +
Sbjct: 332 AERHVLATLNYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHKFMPYKQSHV 391

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AAAA+YL+R +L+R  W A L HYS YT                +   HE  +KKYA+K+
Sbjct: 392 AAAAMYLARLILDRPGWDATLAHYSGYTEEEIQPVFLLMVDYLHRSVAHEAFFKKYASKK 451

Query: 391 FMKASIFVKDW 401
           F+KASI  + W
Sbjct: 452 FLKASIVTRQW 462



>gi|361130671|gb|EHL02421.1| putative G2/mitotic-specific cyclin-B [Glarea lozoyensis 74030]
          Length = 475

 Score =  320 bits (820), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 199/288 (69%), Gaps = 11/288 (3%)

Query: 119 ESEIYEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMS 178
           E+E+   D K +  +  +  EDLD +D  DP+M++EY V+IF YLK+LE   +P  DYM 
Sbjct: 183 ETELAIEDEKSTATKFAEGVEDLDKEDMDDPLMVAEYVVEIFDYLKELELSTLPNADYME 242

Query: 179 SQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGL 238
            Q +L W+MRGILVDWLIEVH +F LLPETLFLAVNIIDRFLS + V L +LQLVG+T +
Sbjct: 243 HQEDLEWKMRGILVDWLIEVHTRFHLLPETLFLAVNIIDRFLSAKAVQLDRLQLVGVTAM 302

Query: 239 FIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKA 298
           FIA+KYEE+L+P + NF ++AD+G++E+EIL AE            YPNPMNFLRR SKA
Sbjct: 303 FIASKYEEVLSPHVANFKHVADDGFSEQEILSAE-----------SYPNPMNFLRRISKA 351

Query: 299 DHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYT 358
           D++DIQ RT+ KYLMEISL+D++F+   PS +AAA++YL+R +L R EW A L HYS Y 
Sbjct: 352 DNYDIQTRTLGKYLMEISLLDHRFMHYLPSHVAAASMYLARMILERGEWDATLTHYSGYN 411

Query: 359 XXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
                           +P  HE  +KKYA+K+F+KASI  + W  ++ 
Sbjct: 412 EEEIEPVFRLMVDYLARPVSHEAFFKKYASKKFLKASILTRSWAKRHA 459



>gi|119194543|ref|XP_001247875.1| hypothetical protein CIMG_01646 [Coccidioides immitis RS]
 gi|392862887|gb|EAS36437.2| G2/M-specific cyclin NimE [Coccidioides immitis RS]
          Length = 493

 Score =  319 bits (818), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 194/265 (73%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +LDA+D +DP+M SEY ++IF YLK++E + MP PDY+  Q EL W +RG+L+DWLIEVH
Sbjct: 211 NLDAEDQFDPLMASEYVIEIFDYLKEIEPQTMPNPDYIEHQEELEWEVRGVLIDWLIEVH 270

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFLAVNIIDRFLS+ +V+L +LQLVG+  +FIA+KYEE+L+P + NF ++A
Sbjct: 271 TRFRLLPETLFLAVNIIDRFLSIDIVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVA 330

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D  +T++EIL AER++L T+++ + YPNPMNFLRR SKAD++D+Q RT  KY MEISL+D
Sbjct: 331 DETFTDKEILDAERHILATLNYDISYPNPMNFLRRISKADNYDVQTRTFGKYFMEISLLD 390

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S +AAAA+Y +R +L+R  W   + HY+ Y+                +P  H
Sbjct: 391 HRFMRYRQSHVAAAAMYFARLILDRGPWDVTIAHYAGYSKEEIIPVFHLMIDYLYRPVAH 450

Query: 380 EQLYKKYAAKRFMKASIFVKDWISK 404
           E  Y+KYA KRF+KAS+  + W  K
Sbjct: 451 EAFYRKYANKRFLKASLHARHWAKK 475



>gi|240276364|gb|EER39876.1| G2/mitotic-specific cyclin-B [Ajellomyces capsulatus H143]
 gi|325089778|gb|EGC43088.1| G2/mitotic-specific cyclin-B [Ajellomyces capsulatus H88]
          Length = 501

 Score =  319 bits (817), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 143/261 (54%), Positives = 189/261 (72%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           +D YDP+M  EYA++IF YLK +E + MP PDY+  Q +L W +RG+LVDWLIEVH +FR
Sbjct: 217 EDLYDPIMGGEYAIEIFDYLKKIEPQTMPNPDYIYHQEDLEWGLRGVLVDWLIEVHTRFR 276

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VNIIDRFLS  VV+L +LQLVG+T +FIAAKYEE+ +P + NF ++AD  +
Sbjct: 277 LLPETLFLTVNIIDRFLSAEVVALDRLQLVGVTAMFIAAKYEEVFSPHVANFSHVADENF 336

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           +++EIL AER+VL T+++ + YPNPMNFLRR SKAD++DI  RT+ KY MEISL+D++F+
Sbjct: 337 SDKEILDAERHVLATLNYDISYPNPMNFLRRISKADNYDIHTRTLGKYFMEISLLDHRFM 396

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLY 383
               S +AAA++YL+R +L+R  W A L HYS YT                +P  HE  +
Sbjct: 397 AYRQSHVAAASMYLARLILHRGRWDATLAHYSGYTKEEILPVFQLLIDYLHRPISHEAFF 456

Query: 384 KKYAAKRFMKASIFVKDWISK 404
           KKYA K+FMKASI  + W  K
Sbjct: 457 KKYANKKFMKASIVTRQWARK 477



>gi|303311187|ref|XP_003065605.1| G2/mitotic-specific cyclin B, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|240105267|gb|EER23460.1| G2/mitotic-specific cyclin B, putative [Coccidioides posadasii C735
           delta SOWgp]
          Length = 493

 Score =  319 bits (817), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 194/265 (73%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +LDA+D +DP+M SEY ++IF YLK++E + MP PDY+  Q EL W +RG+L+DWLIEVH
Sbjct: 211 NLDAEDQFDPLMASEYVIEIFDYLKEIEPQTMPNPDYIEHQEELEWEVRGVLIDWLIEVH 270

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFLAVNIIDRFLS+ +V+L +LQLVG+  +FIA+KYEE+L+P + NF ++A
Sbjct: 271 TRFRLLPETLFLAVNIIDRFLSIDIVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVA 330

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D  +T++EIL AER++L T+++ + YPNPMNFLRR SKAD++D+Q RT  KY MEISL+D
Sbjct: 331 DETFTDKEILDAERHILATLNYDISYPNPMNFLRRISKADNYDVQTRTFGKYFMEISLLD 390

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S +AAAA+Y +R +L+R  W   + HY+ Y+                +P  H
Sbjct: 391 HRFMRYRQSHVAAAAMYFARLILDRGPWDVTIAHYAGYSKEEIIPVFHLMIDYLYRPVAH 450

Query: 380 EQLYKKYAAKRFMKASIFVKDWISK 404
           E  Y+KYA KRF+KAS+  + W  K
Sbjct: 451 EAFYRKYANKRFLKASLHARHWAKK 475



>gi|389625769|ref|XP_003710538.1| G2/mitotic-specific cyclin-B [Magnaporthe oryzae 70-15]
 gi|351650067|gb|EHA57926.1| G2/mitotic-specific cyclin-B [Magnaporthe oryzae 70-15]
 gi|440467743|gb|ELQ36942.1| G2/mitotic-specific cyclin-B [Magnaporthe oryzae Y34]
 gi|440478368|gb|ELQ59208.1| G2/mitotic-specific cyclin-B [Magnaporthe oryzae P131]
          Length = 494

 Score =  317 bits (813), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 140/266 (52%), Positives = 196/266 (73%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DL  DD+ DP+M++EYA +IF Y+ +LE   MP P+YM  Q ++ W+ RGIL+DWLIEVH
Sbjct: 213 DLSMDDYDDPLMVAEYAEEIFSYMLNLELSSMPNPNYMDHQDDVEWKTRGILIDWLIEVH 272

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F L+PETLFLAVNI+DRFLS +VV L +LQLVGIT +FIA+KYEE+++P + NF ++ 
Sbjct: 273 TRFHLVPETLFLAVNIVDRFLSEKVVQLDRLQLVGITAMFIASKYEEVMSPHVTNFRHVT 332

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+G++E EIL AER++L+T+++ L YPNPMNFLRR SKAD++D   RT+ KYLMEISL+D
Sbjct: 333 DDGFSESEILSAERFILSTLNYDLSYPNPMNFLRRVSKADNYDTPCRTIGKYLMEISLLD 392

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++FL   PS++AA+A+ LSR +L+R EW   + +YS Y                 +P  H
Sbjct: 393 HRFLQYRPSLVAASAMALSRIILDRGEWDKTISYYSGYNEDDVEPVVNLMVDYLSRPVIH 452

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKN 405
           E  +KKYA+K+F KASI  ++W+ +N
Sbjct: 453 EAFFKKYASKKFFKASILSRNWVEEN 478



>gi|159125460|gb|EDP50577.1| G2/M-specific cyclin NimE [Aspergillus fumigatus A1163]
          Length = 487

 Score =  317 bits (811), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 188/254 (74%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M +EY V+IF YL+DLE E +P P Y+  Q +L W+MRGILVDWLIEVH +FRLLPETLF
Sbjct: 213 MAAEYVVEIFDYLRDLELETLPNPHYIDHQPDLEWKMRGILVDWLIEVHTRFRLLPETLF 272

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           LAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF ++AD  +T++EIL 
Sbjct: 273 LAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEILD 332

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+  P S +
Sbjct: 333 AERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMCYPQSHV 392

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AAAA+YL+R +L R  W A L HY+ YT                +P  HE  +KKYA+K+
Sbjct: 393 AAAAMYLARLILERGAWDATLAHYAGYTEEEIDPVFRLMIDYLHRPVCHEAFFKKYASKK 452

Query: 391 FMKASIFVKDWISK 404
           F+KASI  + W  K
Sbjct: 453 FLKASILTRQWAKK 466



>gi|146323859|ref|XP_751615.2| G2/M-specific cyclin NimE [Aspergillus fumigatus Af293]
 gi|129557500|gb|EAL89577.2| G2/M-specific cyclin NimE [Aspergillus fumigatus Af293]
          Length = 499

 Score =  317 bits (811), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 188/254 (74%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M +EY V+IF YL+DLE E +P P Y+  Q +L W+MRGILVDWLIEVH +FRLLPETLF
Sbjct: 225 MAAEYVVEIFDYLRDLELETLPNPHYIDHQPDLEWKMRGILVDWLIEVHTRFRLLPETLF 284

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           LAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF ++AD  +T++EIL 
Sbjct: 285 LAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEILD 344

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+  P S +
Sbjct: 345 AERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMCYPQSHV 404

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AAAA+YL+R +L R  W A L HY+ YT                +P  HE  +KKYA+K+
Sbjct: 405 AAAAMYLARLILERGAWDATLAHYAGYTEEEIDPVFRLMIDYLHRPVCHEAFFKKYASKK 464

Query: 391 FMKASIFVKDWISK 404
           F+KASI  + W  K
Sbjct: 465 FLKASILTRQWAKK 478



>gi|395331486|gb|EJF63867.1| hypothetical protein DICSQDRAFT_82352 [Dichomitus squalens LYAD-421
           SS1]
          Length = 594

 Score =  316 bits (809), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 197/253 (77%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M+SEY V+IF+YLKD+E   MP P+YM++Q +L+W+MRGIL DWLI+VH +FRLLPET
Sbjct: 288 PLMVSEYVVEIFEYLKDVEQTTMPNPNYMANQKDLAWKMRGILTDWLIQVHSRFRLLPET 347

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFL VNIIDRFLS RVVSL KLQLVGIT +FIAAK EE++APS  NF+Y AD+ YTE EI
Sbjct: 348 LFLCVNIIDRFLSARVVSLAKLQLVGITCMFIAAKLEEIVAPSASNFLYCADSSYTEAEI 407

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L+AERYVL TID+ L YPNP++FLRR SKAD +++Q RT+ KYL+EI  ++++ +  PPS
Sbjct: 408 LQAERYVLKTIDWNLSYPNPIHFLRRISKADDYNVQVRTIGKYLLEIQCLEWRLIAAPPS 467

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
           ++AAA+++L+R ++   +W ANL HYS Y                +KP +H+  +KKYA+
Sbjct: 468 LLAAASIWLARLIIGTPDWTANLAHYSSYRERDIIPTANLMINYILKPIRHQSFFKKYAS 527

Query: 389 KRFMKASIFVKDW 401
           K+++KASIFV+DW
Sbjct: 528 KKYLKASIFVRDW 540



>gi|121708239|ref|XP_001272070.1| G2/M-specific cyclin NimE [Aspergillus clavatus NRRL 1]
 gi|119400218|gb|EAW10644.1| G2/M-specific cyclin NimE [Aspergillus clavatus NRRL 1]
          Length = 500

 Score =  315 bits (808), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 142/254 (55%), Positives = 188/254 (74%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M +EY V+IF YL+DLE E +P P Y+  Q +L W+MRGILVDWLIEVH +FRLLPETLF
Sbjct: 226 MAAEYVVEIFDYLRDLELETLPNPHYIDHQPDLEWKMRGILVDWLIEVHTRFRLLPETLF 285

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           LAVN+IDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF ++AD  +T++EIL 
Sbjct: 286 LAVNLIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEILD 345

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+  P S +
Sbjct: 346 AERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMCYPQSHV 405

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AAAA+YL+R +L R  W A L HY+ YT                +P  HE  +KKYA+K+
Sbjct: 406 AAAAMYLARLILERGAWDATLAHYAGYTEEEIDPVFRLMIDYLHRPVCHEAFFKKYASKK 465

Query: 391 FMKASIFVKDWISK 404
           F+KASI  + W  K
Sbjct: 466 FLKASILTRQWAKK 479



>gi|465792436|emb|CCU97546.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 519

 Score =  315 bits (808), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 179/384 (46%), Positives = 249/384 (64%), Gaps = 33/384 (8%)

Query: 55  GVV-TRKRAVLMDRTNVSLKQNSV--NEQTHDITKP------IIKENVNLGFQDIRSKEK 105
           GV+ TRKRA L D TN +  +++V   ++  D+ KP                + +R +E 
Sbjct: 67  GVLGTRKRAALGDLTNAARSRSAVLKEDKADDVKKPAALRMRTAAARPAAPRRVVRPREP 126

Query: 106 HELSFDTTLATTAES----EIYEFDRKRSKKQKTQ-------------------DWEDLD 142
             ++ D   A  +      EI++   + +K+ +TQ                    WEDLD
Sbjct: 127 EAMAVDDVPARDSSDKENMEIFDEAAREAKRARTQVAPGVAAAEPAVAARPKDEGWEDLD 186

Query: 143 ADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKF 202
            DD  DP+M++EY  +IF Y++ +E + MP  +YMS Q +L+W +RG+L DWLIE H KF
Sbjct: 187 KDDADDPLMVAEYVEEIFMYMRKIELQCMPNGNYMSLQRDLNWHLRGVLADWLIETHAKF 246

Query: 203 RLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNG 262
           RLLPETLFLA+NI+DRFLS+R +SL KLQLVG+T LFIAAKYEE+L PSI+NF+Y+AD G
Sbjct: 247 RLLPETLFLALNIVDRFLSLRTISLSKLQLVGVTALFIAAKYEEVLCPSIQNFLYVADGG 306

Query: 263 YTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKF 322
           YT+EEIL+AERY+L  ++F L Y +PMNFLRR SKAD++DIQ RTVAKY MEISLVD++ 
Sbjct: 307 YTDEEILRAERYMLKVLNFDLSYASPMNFLRRISKADNYDIQTRTVAKYFMEISLVDHRL 366

Query: 323 LPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQL 382
           L  PPS++AAAA++L+R++L R EW   L+HYS Y                ++P  H   
Sbjct: 367 LDHPPSLVAAAAVWLAREVLERGEWTPTLVHYSTYAEPELLGTAEIMLDYCLRPPAHLYF 426

Query: 383 YKKYAAKRFMKASIFVKDWISKNV 406
           +KKY++K+FM+AS +V +W +KN 
Sbjct: 427 HKKYSSKKFMRASAYVLEW-AKNT 449



>gi|449304900|gb|EMD00907.1| hypothetical protein BAUCODRAFT_118631 [Baudoinia compniacensis
           UAMH 10762]
          Length = 497

 Score =  315 bits (807), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 201/269 (74%)

Query: 136 QDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWL 195
           +D +DLDA+D  DP+M++EY  +IF Y+++LE   MP P YM SQ++L W+MRGILVDWL
Sbjct: 208 KDAKDLDAEDVDDPLMVAEYVHEIFDYMRELEITTMPNPSYMDSQTDLEWKMRGILVDWL 267

Query: 196 IEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNF 255
           +EVH +FRLLPETLFL VNIIDRFLS +VV L +LQLVG+T +FIA+KYEE+L+P ++NF
Sbjct: 268 LEVHTRFRLLPETLFLTVNIIDRFLSSKVVQLDRLQLVGVTAMFIASKYEEVLSPHVQNF 327

Query: 256 IYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEI 315
           +++AD+G++E EIL AER+VL  +D+ L YPNPMNFLRR SKAD +DIQ RT+ KYL+EI
Sbjct: 328 VHVADDGFSETEILSAERFVLAALDYDLSYPNPMNFLRRISKADSYDIQTRTLGKYLLEI 387

Query: 316 SLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMK 375
             +D++FL   PS++AAAA+YL+R  L R EW A L  Y+ YT                 
Sbjct: 388 GCLDHRFLKYRPSLLAAAAMYLARMALGRGEWDATLSKYAGYTEQEIQPVFKLMVDYLHS 447

Query: 376 PTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           P +H+  ++KYA+K+F+KASI ++ W  K
Sbjct: 448 PVQHDAFFRKYASKKFLKASIVLRQWAKK 476



>gi|164658149|ref|XP_001730200.1| hypothetical protein MGL_2582 [Malassezia globosa CBS 7966]
 gi|159104095|gb|EDP42986.1| hypothetical protein MGL_2582 [Malassezia globosa CBS 7966]
          Length = 477

 Score =  315 bits (806), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 156/275 (56%), Positives = 207/275 (75%), Gaps = 1/275 (0%)

Query: 132 KQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGIL 191
           + K + WEDLD DD  DP+M++EY  +IF Y++D+E + MP   YM  Q +L+W +RG+L
Sbjct: 130 RAKDEGWEDLDKDDADDPLMVAEYVEEIFAYMRDIEIQCMPNGSYMDLQRDLNWHLRGVL 189

Query: 192 VDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPS 251
            DWLIE H KFRLLPETLFLA+NI+DRFLS+R +SL KLQLVG+T LFIAAKYEE+L PS
Sbjct: 190 ADWLIETHAKFRLLPETLFLALNIVDRFLSMRTISLSKLQLVGVTALFIAAKYEEVLCPS 249

Query: 252 IKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKY 311
           I+NF+Y+AD GYT+EEIL+AERY+L  ++F L Y +PMNFLRR SKAD++DIQ RTVAKY
Sbjct: 250 IQNFLYVADGGYTDEEILRAERYMLKVLNFDLSYASPMNFLRRISKADNYDIQTRTVAKY 309

Query: 312 LMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXX 371
            MEISLVD++ L  PPS++AAAA++L+R++L R EW   L+HYS Y              
Sbjct: 310 FMEISLVDHRLLDHPPSLVAAAAVWLAREVLERGEWTPTLVHYSTYAEPELLGTAEIMLD 369

Query: 372 XXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
             ++P  H   +KKY++K+FM+AS +V +W +KN 
Sbjct: 370 YCLRPPAHLHFHKKYSSKKFMRASAYVMEW-AKNT 403



>gi|320039428|gb|EFW21362.1| G2/M-specific cyclin NimE [Coccidioides posadasii str. Silveira]
          Length = 366

 Score =  315 bits (806), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 145/293 (49%), Positives = 207/293 (70%), Gaps = 1/293 (0%)

Query: 113 TLATTAESEIYEFDRKRSKKQKTQDWE-DLDADDFYDPMMISEYAVDIFKYLKDLESEIM 171
           T A   E+++ E D   +++ +  D   +LDA+D +DP+M SEY ++IF YLK++E + M
Sbjct: 56  TTAFQEEAKLEETDSVPTEEPQDADKPLNLDAEDQFDPLMASEYVIEIFDYLKEIEPQTM 115

Query: 172 PKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQ 231
           P PDY+  Q EL W +RG+L+DWLIEVH +FRLLPETLFLAVNIIDRFLS+ +V+L +LQ
Sbjct: 116 PNPDYIEHQEELEWEVRGVLIDWLIEVHTRFRLLPETLFLAVNIIDRFLSIDIVALDRLQ 175

Query: 232 LVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNF 291
           LVG+  +FIA+KYEE+L+P + NF ++AD  +T++EIL AER++L T+++ + YPNPMNF
Sbjct: 176 LVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEILDAERHILATLNYDISYPNPMNF 235

Query: 292 LRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANL 351
           LRR SKAD++D+Q RT  KY MEISL+D++F+    S +AAAA+Y +R +L+R  W   +
Sbjct: 236 LRRISKADNYDVQTRTFGKYFMEISLLDHRFMRYRQSHVAAAAMYFARLILDRGPWDVTI 295

Query: 352 IHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
            HY+ Y+                +P  HE  Y+KYA KRF+KAS+  + W  K
Sbjct: 296 AHYAGYSKEEIIPVFHLMIDYLYRPVAHEAFYRKYANKRFLKASLHARHWAKK 348



>gi|190348407|gb|EDK40854.2| hypothetical protein PGUG_04952 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 400

 Score =  314 bits (804), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 205/281 (72%), Gaps = 3/281 (1%)

Query: 128 KRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRM 187
           KRS+K   + W+DLD +D  DP+M+SEY  +IF YL +LE + +P+  Y+  Q+ +  +M
Sbjct: 106 KRSRKIDYE-WQDLDEEDADDPLMVSEYVGEIFAYLGELEYKTLPQ-QYLHKQTHIKPKM 163

Query: 188 RGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEEL 247
           R ILVDWL+E+H +FRLLPETLFLA+N++DRF+S+ VV + KLQL+    LFIAAKYEE+
Sbjct: 164 RSILVDWLVEMHMRFRLLPETLFLAINVMDRFMSMEVVQIDKLQLLATGSLFIAAKYEEV 223

Query: 248 LAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQART 307
            +PS+KN+ Y  D  YTEEEIL+AE+Y+LT +DF+L YPNPMNFLRR SKAD +D+Q+RT
Sbjct: 224 FSPSVKNYAYFTDGSYTEEEILQAEKYILTVLDFELNYPNPMNFLRRISKADDYDVQSRT 283

Query: 308 VAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSE-WHANLIHYSQYTXXXXXXXX 366
           + KYL+EI+++DYKF+ + PS+ +AAA+Y++R +L +S  W  NLIHYS Y         
Sbjct: 284 LGKYLLEITIIDYKFIGMLPSLCSAAAMYIARLILQKSPVWTGNLIHYSGYRAAEMRQCV 343

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNVE 407
                  + P +H++ +KKYA ++FMKAS+  + W  K V+
Sbjct: 344 DLIVQYLVAPVEHDEFFKKYATRKFMKASVVCRSWAKKAVQ 384



>gi|258567878|ref|XP_002584683.1| G2/mitotic-specific cyclin-B [Uncinocarpus reesii 1704]
 gi|237906129|gb|EEP80530.1| G2/mitotic-specific cyclin-B [Uncinocarpus reesii 1704]
          Length = 487

 Score =  314 bits (804), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 139/258 (53%), Positives = 191/258 (74%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           +LDADD YDP+M+SEYAV+IF YL+++E + MP P+Y+  Q EL W+MRGILVDWLIEVH
Sbjct: 215 NLDADDLYDPLMVSEYAVEIFDYLREIEPQTMPSPNYIEHQEELEWKMRGILVDWLIEVH 274

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +FRLLPETLFL VNIIDRFLS+ +V+L +LQLVG+  +FIAAKYEE+L+P +  F ++A
Sbjct: 275 TRFRLLPETLFLTVNIIDRFLSIDMVALDRLQLVGVAAMFIAAKYEEVLSPHVAMFSHVA 334

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D  ++++EIL AER++L T+++ + YPNPMNFLRR SKAD++D+  RT  KYLMEISL+D
Sbjct: 335 DETFSDKEILDAERHILATLNYDISYPNPMNFLRRISKADNYDVHTRTFGKYLMEISLLD 394

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++F+    S IAAAA+Y +R +L R  W   + +Y+ YT                +P  H
Sbjct: 395 HRFMCYRQSHIAAAAMYFARLILERGPWDETIAYYAGYTKSEILPVFHLMIDYLYRPVAH 454

Query: 380 EQLYKKYAAKRFMKASIF 397
           E  Y+KYA+KRF+K  ++
Sbjct: 455 EAFYRKYASKRFLKGRVY 472



>gi|443919123|gb|ELU39381.1| g2/mitotic-specific cyclin cdc13 [Rhizoctonia solani AG-1 IA]
          Length = 570

 Score =  314 bits (804), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 141/273 (51%), Positives = 204/273 (74%)

Query: 129 RSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMR 188
           RS++ + Q W DLDA+D  DP M+SEY  +IF Y+++LE + MP   YM+SQ EL W +R
Sbjct: 250 RSQRIENQPWVDLDAEDENDPAMVSEYVNEIFGYMRELEVQTMPSSIYMNSQPELEWHLR 309

Query: 189 GILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELL 248
           GIL+DWLI+VH +FRLLPETLF+A N+IDRFLS+RVVSLVKLQLVGITGLF+AAKYEE++
Sbjct: 310 GILMDWLIQVHERFRLLPETLFIAANLIDRFLSMRVVSLVKLQLVGITGLFVAAKYEEIM 369

Query: 249 APSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTV 308
            P++++ + +AD+ YT E+IL AE+Y+L T+ + + YPNPM+FLRR +KA+ ++   RT+
Sbjct: 370 VPTLQDLLKVADSDYTVEDILAAEKYLLRTLGWDISYPNPMSFLRRVNKAEDYNANTRTL 429

Query: 309 AKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXX 368
           AK+L+EIS+V+ + L   PSM+AAA L+L+R +L++ EW  +L HYS YT          
Sbjct: 430 AKFLIEISVVEERLLKYTPSMLAAAGLWLARLILDKPEWDVSLEHYSGYTENKLVRCANV 489

Query: 369 XXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDW 401
                ++P KHE L++KY+ K++++ +I  + W
Sbjct: 490 MVNFLLQPIKHESLWRKYSKKKYLRCAIVARKW 522



>gi|134055276|emb|CAK96166.1| unnamed protein product [Aspergillus niger]
 gi|350638268|gb|EHA26624.1| G2/mitotic-specific cyclin B [Aspergillus niger ATCC 1015]
          Length = 480

 Score =  313 bits (803), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 188/254 (74%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M++EY VDIF+YLKDLE E +P  +Y+  Q +L W+MRGILVDWLIEVH +FRLLPETLF
Sbjct: 206 MVAEYVVDIFEYLKDLELETLPNAEYIEHQPDLEWKMRGILVDWLIEVHTRFRLLPETLF 265

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           LAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF  +AD  +T+ EIL 
Sbjct: 266 LAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFTDVADGTFTDREILD 325

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+    S +
Sbjct: 326 AERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMGYRQSHV 385

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AAAA+YL+R +L+R  W A L HY+ YT                +P  HE  +KKYA+K+
Sbjct: 386 AAAAMYLARLILDRGVWDATLAHYAGYTEEEIDPVFRLMIDYLHRPVSHEAFFKKYASKK 445

Query: 391 FMKASIFVKDWISK 404
           F+KASI  + W  K
Sbjct: 446 FLKASILTRQWAKK 459



>gi|317025479|ref|XP_001389166.2| G2/mitotic-specific cyclin-B [Aspergillus niger CBS 513.88]
          Length = 492

 Score =  313 bits (803), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 188/254 (74%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M++EY VDIF+YLKDLE E +P  +Y+  Q +L W+MRGILVDWLIEVH +FRLLPETLF
Sbjct: 218 MVAEYVVDIFEYLKDLELETLPNAEYIEHQPDLEWKMRGILVDWLIEVHTRFRLLPETLF 277

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           LAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF  +AD  +T+ EIL 
Sbjct: 278 LAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFTDVADGTFTDREILD 337

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+    S +
Sbjct: 338 AERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMGYRQSHV 397

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AAAA+YL+R +L+R  W A L HY+ YT                +P  HE  +KKYA+K+
Sbjct: 398 AAAAMYLARLILDRGVWDATLAHYAGYTEEEIDPVFRLMIDYLHRPVSHEAFFKKYASKK 457

Query: 391 FMKASIFVKDWISK 404
           F+KASI  + W  K
Sbjct: 458 FLKASILTRQWAKK 471



>gi|115391051|ref|XP_001213030.1| G2/mitotic-specific cyclin-B [Aspergillus terreus NIH2624]
 gi|114193954|gb|EAU35654.1| G2/mitotic-specific cyclin-B [Aspergillus terreus NIH2624]
          Length = 493

 Score =  313 bits (803), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 188/256 (73%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M +EY V+IF YL DLE E +P P Y+  Q +L W+MRGILVDWLIEVH +FRLLPET
Sbjct: 217 PLMAAEYVVEIFDYLADLELETLPNPHYIDHQPDLEWKMRGILVDWLIEVHTRFRLLPET 276

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF ++AD  +T++EI
Sbjct: 277 LFLAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEI 336

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L AER++L T+++ + +PNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+    S
Sbjct: 337 LDAERHILATLEYNMSFPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMCYRQS 396

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
            +AAAA+YL+R +L R  W A L HY+ YT                +P  HE  +KKYA+
Sbjct: 397 HVAAAAMYLARLILERGPWDATLAHYAGYTEEQIDPVFRLMVDYLHRPVCHEAFFKKYAS 456

Query: 389 KRFMKASIFVKDWISK 404
           K+F+KASI  + W  K
Sbjct: 457 KKFLKASILTRQWAKK 472



>gi|358367025|dbj|GAA83645.1| G2/mitotic-specific cyclin-B [Aspergillus kawachii IFO 4308]
          Length = 492

 Score =  313 bits (802), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 188/254 (74%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M++EY VDIF+YLKDLE E +P  +Y+  Q +L W+MRGILVDWLIEVH +FRLLPETLF
Sbjct: 218 MVAEYVVDIFEYLKDLELETLPNAEYIDHQPDLEWKMRGILVDWLIEVHTRFRLLPETLF 277

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           LAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF  +AD  +T+ EIL 
Sbjct: 278 LAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFTDVADGTFTDREILD 337

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+    S +
Sbjct: 338 AERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMGYRQSHV 397

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AAAA+YL+R +L+R  W A L HY+ YT                +P  HE  +KKYA+K+
Sbjct: 398 AAAAMYLARLILDRGVWDATLAHYAGYTEEEIDPVFRLMIDYLHRPVSHEAFFKKYASKK 457

Query: 391 FMKASIFVKDWISK 404
           F+KASI  + W  K
Sbjct: 458 FLKASILTRQWAKK 471



>gi|392562359|gb|EIW55539.1| A/B/D/E cyclin [Trametes versicolor FP-101664 SS1]
          Length = 407

 Score =  312 bits (800), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 196/253 (77%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M+SEY V+IF+YLK +E   MP P+YM++Q +L+W+MRGIL DWLI+VH +FRLLPET
Sbjct: 106 PLMVSEYVVEIFEYLKKVEQTTMPNPNYMANQKDLAWKMRGILTDWLIQVHSRFRLLPET 165

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFL VNIIDRFLS RVVSL KLQLVGIT +FIAAK EE++APS  NF+Y AD+ YTE EI
Sbjct: 166 LFLCVNIIDRFLSARVVSLAKLQLVGITCMFIAAKVEEIVAPSASNFLYCADSSYTETEI 225

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L+AERYVL TI++ L YPNP++FLRR SKAD +++Q RT+ KYL+EI  ++++ +  PPS
Sbjct: 226 LQAERYVLKTIEWNLSYPNPIHFLRRISKADDYNVQVRTIGKYLLEIQCLEWRLIAAPPS 285

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
           ++AAA+++L+R +L  S+W  NL HYS Y                +KP +H+  +KKYA+
Sbjct: 286 LLAAASVWLARLILGYSDWTPNLAHYSSYRERDIIPTANLMLNYILKPARHQSFFKKYAS 345

Query: 389 KRFMKASIFVKDW 401
           K+F+KASIFV+DW
Sbjct: 346 KKFLKASIFVRDW 358



>gi|391873667|gb|EIT82687.1| cyclin B [Aspergillus oryzae 3.042]
          Length = 495

 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 140/256 (54%), Positives = 190/256 (74%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EY V+IF+Y+KDLE E +P P Y+  Q +L W+MRGILVDWLIEVH +FRLLPET
Sbjct: 219 PLMVAEYVVEIFEYMKDLELETLPNPHYIDHQPDLEWKMRGILVDWLIEVHTRFRLLPET 278

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF ++AD  +T++EI
Sbjct: 279 LFLAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEI 338

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+    S
Sbjct: 339 LDAERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMAYRQS 398

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
            ++AAA+YL+R +L R  W A L +Y+ Y                 +P  HE  +KKYA+
Sbjct: 399 HVSAAAMYLARLILERGPWDATLAYYAGYDEEQIDPVFRLMIDYLHRPVCHEAFFKKYAS 458

Query: 389 KRFMKASIFVKDWISK 404
           K+F+KASI  + W  K
Sbjct: 459 KKFLKASILTRQWAKK 474



>gi|317144414|ref|XP_001820104.2| G2/mitotic-specific cyclin-B [Aspergillus oryzae RIB40]
          Length = 495

 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 140/256 (54%), Positives = 190/256 (74%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EY V+IF+Y+KDLE E +P P Y+  Q +L W+MRGILVDWLIEVH +FRLLPET
Sbjct: 219 PLMVAEYVVEIFEYMKDLELETLPNPHYIDHQPDLEWKMRGILVDWLIEVHTRFRLLPET 278

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF ++AD  +T++EI
Sbjct: 279 LFLAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEI 338

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+    S
Sbjct: 339 LDAERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMAYRQS 398

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
            ++AAA+YL+R +L R  W A L +Y+ Y                 +P  HE  +KKYA+
Sbjct: 399 HVSAAAMYLARLILERGPWDATLAYYAGYDEEQIDPVFRLMIDYLHRPVCHEAFFKKYAS 458

Query: 389 KRFMKASIFVKDWISK 404
           K+F+KASI  + W  K
Sbjct: 459 KKFLKASILTRQWAKK 474



>gi|406605761|emb|CCH42864.1| G2/mitotic-specific cyclin cdc13 [Wickerhamomyces ciferrii]
          Length = 431

 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 148/302 (49%), Positives = 204/302 (67%), Gaps = 11/302 (3%)

Query: 114 LATTAESEIYEFDRKRSKKQKTQ----------DWEDLDADDFYDPMMISEYAVDIFKYL 163
           L  +A   +   D   S K KTQ          +W+DLD++D  DP+M+S+Y  +IF+YL
Sbjct: 117 LKRSATESLSNVDEDESTKLKTQNNNKKAKIEYEWKDLDSEDADDPLMVSDYVDEIFEYL 176

Query: 164 KDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVR 223
             LE E +P   Y+S Q  L  +MR ILVDW++EVH +FRLLPETLFLA+NI+DRF+S  
Sbjct: 177 HQLEIETLPDSTYLSWQKNLKPKMRSILVDWIVEVHLRFRLLPETLFLAINIMDRFMSKE 236

Query: 224 VVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKL 283
            + + KLQL+    LFIAAKYEE+ +PS+KN+ Y+ D GYTE+EIL+AER++L  + F L
Sbjct: 237 SLEVDKLQLLATGSLFIAAKYEEVYSPSVKNYSYVTDGGYTEDEILEAERFILQVLKFNL 296

Query: 284 CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLN 343
            YPNPMNFLRR SKAD +DIQ RT+ KYL+E++++D++F+ + PS+ +AAA+Y+SR+ML 
Sbjct: 297 NYPNPMNFLRRISKADDYDIQTRTIGKYLLEVTIMDHRFIGIKPSLCSAAAMYVSRRMLG 356

Query: 344 RSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWI 402
           R +W   L HYS  YT                KP  HE+ +KKYA+K+FMK+SI  + W 
Sbjct: 357 RPDWDGTLTHYSGGYTKDDMKHVVELILSYLTKPVVHEEFFKKYASKKFMKSSILARQWA 416

Query: 403 SK 404
            K
Sbjct: 417 KK 418



>gi|83767963|dbj|BAE58102.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 482

 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 140/256 (54%), Positives = 190/256 (74%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EY V+IF+Y+KDLE E +P P Y+  Q +L W+MRGILVDWLIEVH +FRLLPET
Sbjct: 206 PLMVAEYVVEIFEYMKDLELETLPNPHYIDHQPDLEWKMRGILVDWLIEVHTRFRLLPET 265

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF ++AD  +T++EI
Sbjct: 266 LFLAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEI 325

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+    S
Sbjct: 326 LDAERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMAYRQS 385

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
            ++AAA+YL+R +L R  W A L +Y+ Y                 +P  HE  +KKYA+
Sbjct: 386 HVSAAAMYLARLILERGPWDATLAYYAGYDEEQIDPVFRLMIDYLHRPVCHEAFFKKYAS 445

Query: 389 KRFMKASIFVKDWISK 404
           K+F+KASI  + W  K
Sbjct: 446 KKFLKASILTRQWAKK 461



>gi|448096908|ref|XP_004198544.1| Piso0_001920 [Millerozyma farinosa CBS 7064]
 gi|359379966|emb|CCE82207.1| Piso0_001920 [Millerozyma farinosa CBS 7064]
          Length = 503

 Score =  310 bits (795), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 142/270 (52%), Positives = 195/270 (72%), Gaps = 2/270 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           DW+DLD +D  DP+M+SEY  DIF YL +LE + +P   Y+  Q +L  +MR ILVDWL+
Sbjct: 215 DWQDLDEEDNDDPLMVSEYVNDIFPYLNELEYKTLPDSQYLFKQKQLKPKMRSILVDWLV 274

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           E+H +FRLLPETLFLA+NI+DRF+S+ VV + KLQL+    LFIAAKYEE+ +PS+KN+ 
Sbjct: 275 EMHTRFRLLPETLFLAINIMDRFMSLEVVQIDKLQLLATGSLFIAAKYEEVFSPSVKNYA 334

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           Y  D  YTEEEIL+AE+++LT ++F L YPNPMNFLRR SKAD +D+Q+RT+ KYL+EI+
Sbjct: 335 YFTDGSYTEEEILQAEKFILTILNFDLNYPNPMNFLRRISKADDYDVQSRTLGKYLLEIT 394

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLN-RSEWHANLIHYS-QYTXXXXXXXXXXXXXXXM 374
           ++DYKF+ + PS+ +A+A+Y+SR +L  R  W+ NLIHYS  Y                 
Sbjct: 395 IIDYKFIGVLPSLCSASAMYISRLILGKRPVWNGNLIHYSGGYKVHEMKPIIELITQYLA 454

Query: 375 KPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
            P +H++ +KKYA ++FMKASI  + W  K
Sbjct: 455 APVEHDEFFKKYATRKFMKASIICRSWAKK 484



>gi|448110926|ref|XP_004201721.1| Piso0_001920 [Millerozyma farinosa CBS 7064]
 gi|359464710|emb|CCE88415.1| Piso0_001920 [Millerozyma farinosa CBS 7064]
          Length = 502

 Score =  310 bits (793), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 142/270 (52%), Positives = 195/270 (72%), Gaps = 2/270 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           DW+DLD +D  DP+M+SEY  DIF YL +LE + +P   Y+  Q +L  +MR ILVDWL+
Sbjct: 214 DWQDLDEEDNDDPLMVSEYVNDIFPYLNELEYKTLPDSQYLFKQKQLKPKMRSILVDWLV 273

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           E+H +FRLLPETLFLA+NI+DRF+S+ VV + KLQL+    LFIAAKYEE+ +PS+KN+ 
Sbjct: 274 EMHTRFRLLPETLFLAINIMDRFMSLEVVQIDKLQLLATGSLFIAAKYEEVFSPSVKNYA 333

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           Y  D  YTEEEIL+AE+++LT ++F L YPNPMNFLRR SKAD +D+Q+RT+ KYL+EI+
Sbjct: 334 YFTDGSYTEEEILQAEKFILTILNFDLNYPNPMNFLRRISKADDYDVQSRTLGKYLLEIT 393

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLN-RSEWHANLIHYS-QYTXXXXXXXXXXXXXXXM 374
           ++DYKF+ + PS+ +A+A+Y+SR +L  R  W+ NLIHYS  Y                 
Sbjct: 394 IIDYKFIGVLPSLCSASAMYISRLILGKRPVWNGNLIHYSGGYKVHEMKPIIELITQYLA 453

Query: 375 KPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
            P +H++ +KKYA ++FMKASI  + W  K
Sbjct: 454 APVEHDEFFKKYATRKFMKASIICRSWAKK 483



>gi|471901968|emb|CCO29823.1| G2/mitotic-specific cyclin cdc13 [Rhizoctonia solani AG-1 IB]
          Length = 562

 Score =  309 bits (792), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 138/273 (50%), Positives = 200/273 (73%)

Query: 129 RSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMR 188
           R++  ++Q W+DLDA+D  DP M+SEY  +IF Y+++LE + MP   YM+SQ EL W +R
Sbjct: 239 RTEMGESQPWDDLDAEDENDPAMVSEYVSEIFGYMRELEFQTMPSSTYMNSQPELEWHLR 298

Query: 189 GILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELL 248
           G+L+DWLI VH +F+LLPETLF+A N+IDRFLS+RVVSLVKLQLVGITGLF+AAKYEE++
Sbjct: 299 GMLMDWLIRVHERFQLLPETLFIAANLIDRFLSLRVVSLVKLQLVGITGLFVAAKYEEIM 358

Query: 249 APSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTV 308
            P++ + + +AD+ +T ++IL AE+Y+L T+ + L YPNPM+FLRR +KA+ +    R +
Sbjct: 359 VPTLHDLLKVADSEHTVDDILAAEKYLLRTLGWDLSYPNPMSFLRRGNKAEDYSADTRML 418

Query: 309 AKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXX 368
           AK+L+EIS+V+ + L   PSM+AAA L+L+R +L+R EW ANL HYS Y           
Sbjct: 419 AKFLIEISVVEERLLKYSPSMLAAAGLWLARLILDRPEWDANLEHYSGYAENKLVRCANT 478

Query: 369 XXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDW 401
                ++P KHE L+ KY+ ++++K +I  + W
Sbjct: 479 MVNFLLQPIKHESLWGKYSKRKYLKCAIVARKW 511



>gi|50405559|ref|XP_456415.1| DEHA2A01760p [Debaryomyces hansenii CBS767]
 gi|49652079|emb|CAG84367.1| DEHA2A01760p [Debaryomyces hansenii CBS767]
          Length = 508

 Score =  309 bits (791), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 197/272 (72%), Gaps = 2/272 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +W+DLD +D  DP+M+SEY  DIF YL +LE + +P   Y+  Q  L  +MR ILVDWL+
Sbjct: 219 EWQDLDEEDIDDPLMVSEYVNDIFPYLSELEHKTLPDSQYLFKQKHLKPKMRSILVDWLV 278

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           E+H +FRLLPETLFLA+NI+DRF+S+ +V + KLQL+    LFIAAKYEE+ +PS+KN+ 
Sbjct: 279 EMHTRFRLLPETLFLAINIMDRFMSLEIVQIDKLQLLATGSLFIAAKYEEVFSPSVKNYA 338

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           Y  D  YTE+EIL+AE+Y+LT ++F L YPNPMNFLRR SKAD +D+Q+RT+ KYL+EI+
Sbjct: 339 YFTDGSYTEDEILQAEKYILTILNFDLNYPNPMNFLRRISKADDYDVQSRTLGKYLLEIT 398

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSE-WHANLIHYS-QYTXXXXXXXXXXXXXXXM 374
           ++DYKF+ + PS+ +A+A+Y++R +L ++  W+ NLIHYS  Y                +
Sbjct: 399 IIDYKFIGMLPSLCSASAMYIARLILGKTPVWNGNLIHYSGGYRVSDMKDCIELLVQYLI 458

Query: 375 KPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
            P +H++ +KKYA ++FMKASI  + W  K V
Sbjct: 459 APVEHDEFFKKYATRKFMKASILCRSWAKKIV 490



>gi|406701613|gb|EKD04729.1| g2/mitotic-specific cyclin cdc13 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 543

 Score =  308 bits (790), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 192/270 (71%), Gaps = 2/270 (0%)

Query: 134 KTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVD 193
           K   W DLDA+D  DP M+SEY +D F Y+ +LE   M  PDYM  Q EL W+MR IL D
Sbjct: 240 KDAGWTDLDAEDEGDPTMVSEYVIDAFNYMMELEKTTMADPDYMDRQDELQWKMRCILND 299

Query: 194 WLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIK 253
           W+IEVH KFRLLPETL +A N+IDRFLS R VSLVK QLVG+T LF+AAKYEE++ PS+ 
Sbjct: 300 WIIEVHSKFRLLPETLLIATNLIDRFLSKRSVSLVKFQLVGLTALFVAAKYEEVICPSVT 359

Query: 254 NFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLM 313
           +F++M D GY   EIL+AERY+LTT+ F L +PNP++FLRR SKAD +D+ ARTVAKY +
Sbjct: 360 HFLHMTDGGYDVGEILRAERYLLTTLGFDLSFPNPLHFLRRVSKADGYDVHARTVAKYFI 419

Query: 314 EISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXX 373
           EIS VD++ +  PPSM+AAAA++L+R  L R  WHAN++HYS Y+               
Sbjct: 420 EISCVDHRLIAYPPSMLAAAAMWLARLCLERGPWHANMVHYSSYSQAELLPCAQVMLDFV 479

Query: 374 MKPTKH--EQLYKKYAAKRFMKASIFVKDW 401
           + P        +KKYA+K+ +KAS++V++W
Sbjct: 480 LDPEVDLTSAFFKKYASKKHLKASVYVREW 509



>gi|328857548|gb|EGG06664.1| hypothetical protein MELLADRAFT_43462 [Melampsora larici-populina
           98AG31]
          Length = 345

 Score =  307 bits (787), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 141/273 (51%), Positives = 189/273 (69%), Gaps = 22/273 (8%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M+ EY  +I+ Y+ +LE E +P  DYMS QSEL+W+MRG+LVDW+IEVH KFRLLPETL+
Sbjct: 1   MVKEYVNEIYHYMCELELETLPDADYMSRQSELTWKMRGVLVDWIIEVHSKFRLLPETLY 60

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           LA+N++DRFL+ R V+L+K QLVG+T LF+A+KYEE++ PS+ NF+YM D GY  EEILK
Sbjct: 61  LAINLMDRFLTKRTVALIKFQLVGVTSLFLASKYEEVICPSVTNFLYMTDGGYENEEILK 120

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AE Y+L  + + L YPNP+NFLRR SKADH+DIQ+RT AKY MEIS+VDY+ +   PS++
Sbjct: 121 AETYMLEMLSWDLRYPNPLNFLRRVSKADHYDIQSRTFAKYFMEISIVDYRLVATAPSLL 180

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMK--------------- 375
           AA +++LSRK+LNR EW ANLIHYS YT               ++               
Sbjct: 181 AATSIWLSRKLLNRGEWDANLIHYSGYTQDEILPTAQIMVDYILRTGCKVLGIGLEPNFV 240

Query: 376 -------PTKHEQLYKKYAAKRFMKASIFVKDW 401
                    +H  L+KKY+ ++F + S  V+DW
Sbjct: 241 GAVGYEGGNEHGNLFKKYSTRKFFRVSELVRDW 273



>gi|403414025|emb|CCM00725.1| predicted protein [Fibroporia radiculosa]
          Length = 610

 Score =  307 bits (786), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 202/265 (76%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +W+DLD +D  DP+M+SEY V+IF YLKD+E   MP P YM +Q +L+W+MRGIL DWLI
Sbjct: 287 EWDDLDVEDGDDPLMVSEYVVEIFDYLKDVEQTTMPNPRYMENQKDLAWKMRGILTDWLI 346

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           +VH +FRLLPETLFL VNIIDRFLS RVVSL KLQLVG+T +FIAAK EE++APS  NF+
Sbjct: 347 QVHSRFRLLPETLFLCVNIIDRFLSARVVSLAKLQLVGVTCMFIAAKVEEMVAPSATNFL 406

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           Y AD+ YTE +IL+AERYVL TID+ L YPNP++FLRR SKAD +++Q RT+AKYL+EI 
Sbjct: 407 YCADSSYTENDILQAERYVLKTIDWNLSYPNPIHFLRRVSKADDYNVQVRTIAKYLLEIQ 466

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP 376
            ++++ +  PPS++AAAA++L+R +L  S+W  NL HYS Y                +KP
Sbjct: 467 CLEWRLIAAPPSLLAAAAIWLARIILGYSDWTPNLAHYSSYPESAIVPTANLMLNYVLKP 526

Query: 377 TKHEQLYKKYAAKRFMKASIFVKDW 401
             HE  YKKYA+K++MKAS+FV+ W
Sbjct: 527 IPHESFYKKYASKKYMKASVFVRQW 551



>gi|119500124|ref|XP_001266819.1| G2/M-specific cyclin NimE [Neosartorya fischeri NRRL 181]
 gi|119414984|gb|EAW24922.1| G2/M-specific cyclin NimE [Neosartorya fischeri NRRL 181]
          Length = 483

 Score =  306 bits (785), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 183/246 (74%)

Query: 151 MISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLF 210
           M +EY V+IF YL+DLE E +P P Y+  Q +L W+MRGILVDWLIEVH +FRLLPETLF
Sbjct: 227 MAAEYVVEIFDYLRDLELETLPNPRYIEHQPDLEWKMRGILVDWLIEVHTRFRLLPETLF 286

Query: 211 LAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILK 270
           LAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF ++AD  +T++EIL 
Sbjct: 287 LAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEILD 346

Query: 271 AERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMI 330
           AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+  P S +
Sbjct: 347 AERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMCYPQSHV 406

Query: 331 AAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKR 390
           AAAA+YL+R +L R  W A L HY+ YT                +P  HE  +KKYA+K+
Sbjct: 407 AAAAMYLARLILERGAWDATLAHYAGYTEEEIDPVFRLMIDYLHRPVCHEAFFKKYASKK 466

Query: 391 FMKASI 396
           F+K  +
Sbjct: 467 FLKGKL 472



>gi|358058255|dbj|GAA95932.1| hypothetical protein E5Q_02590 [Mixia osmundae IAM 14324]
          Length = 632

 Score =  306 bits (785), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 144/263 (54%), Positives = 186/263 (70%), Gaps = 10/263 (3%)

Query: 150 MMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETL 209
           +M+ EY V+I+ YL+DLE   +P P  M  Q EL W MR  LVDW+I+VH +FRLLPETL
Sbjct: 303 LMVKEYVVEIYDYLRDLELTTLPDPYLMDRQVELDWSMRDQLVDWVIDVHTRFRLLPETL 362

Query: 210 FLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEIL 269
           FLA+NI+DRFLS+R VS+ + QLVG   LFIA KYEE+++PSIKNF Y+ D GY EEEIL
Sbjct: 363 FLAINIVDRFLSIREVSVTRFQLVGTAALFIACKYEEVVSPSIKNFCYVTDGGYEEEEIL 422

Query: 270 KAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSM 329
           KAERY+L+ I + L YPNP+NFLRR SKADH+D+Q+RTVAKY +E+SLVD   + L PS+
Sbjct: 423 KAERYILSQIQWNLSYPNPVNFLRRISKADHYDVQSRTVAKYFLELSLVDRDLIGLRPSL 482

Query: 330 IAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK----------H 379
           IAA++++LSRK+L R  W +NL HYS YT                  T+          H
Sbjct: 483 IAASSMWLSRKILARGPWDSNLSHYSGYTEEELAPAALMFFKYVQTNTRRIKHEGKSPLH 542

Query: 380 EQLYKKYAAKRFMKASIFVKDWI 402
             L+KKYA+K+F KAS +VK+W+
Sbjct: 543 TALHKKYASKKFSKASEYVKEWV 565



>gi|459373877|gb|EMG50962.1| G2/mitotic-specific cyclin CYB1, partial [Candida maltosa Xu316]
          Length = 490

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 146/291 (50%), Positives = 204/291 (70%), Gaps = 7/291 (2%)

Query: 121 EIYEFDRKRSKKQKTQ----DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDY 176
           E+ E  R +S  ++++    +W+DLD++D  DP+M SEY  DIF Y  DLES ++P   Y
Sbjct: 170 ELEENTRSQSYHKRSRLIDYEWQDLDSEDHDDPLMASEYVNDIFTYFYDLESRMLPDSQY 229

Query: 177 M-SSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGI 235
           +    S L  RMR ILVDWL+E+H KFRLLPE+LFLA+NI+DRF+S+ +V + KLQL+  
Sbjct: 230 LFKPNSLLKPRMRSILVDWLVEMHLKFRLLPESLFLAINIMDRFMSIEIVQIDKLQLLAT 289

Query: 236 TGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRS 295
             LFIAAKYEE+ +PS+KN+ Y  D  YTEEEIL+AE+Y+LT ++F L YPNPMNFLRR 
Sbjct: 290 GSLFIAAKYEEVFSPSVKNYAYFTDGSYTEEEILQAEKYILTKLNFDLNYPNPMNFLRRI 349

Query: 296 SKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSE-WHANLIHY 354
           SKAD +D+Q+RT+ KYL+EI++VDYKF+ + PS+  A+A+YL+R +L +   W+ NLIHY
Sbjct: 350 SKADDYDVQSRTLGKYLLEITIVDYKFIGMKPSLCCASAMYLARLILEKVPVWNGNLIHY 409

Query: 355 S-QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           S  Y                + P +H++ +KKYA ++FMKAS   ++W  K
Sbjct: 410 SGGYRINDMKECVELMFQYLLAPIEHDEFFKKYAMRKFMKASTLCRNWAKK 460



>gi|393219901|gb|EJD05387.1| hypothetical protein FOMMEDRAFT_138869 [Fomitiporia mediterranea
           MF3/22]
          Length = 555

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 139/253 (54%), Positives = 191/253 (75%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EY  DIF YLK LE   MP P+YM +Q EL+W+MRGIL+DWLI+VH +F+LLPET
Sbjct: 262 PLMVAEYVADIFDYLKALEQTTMPNPNYMENQKELAWKMRGILMDWLIQVHSRFKLLPET 321

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFL VN+IDRFLS RVVSL KLQLVG+T +F+AAK EE +APS+ NF+Y AD+ Y+E+EI
Sbjct: 322 LFLCVNLIDRFLSARVVSLAKLQLVGVTCMFVAAKVEETVAPSVTNFVYCADSSYSEQEI 381

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L+AE+Y+L TID+ + YP P+NFLRR SKAD +++Q RT+ KYL EI  ++++ +  PPS
Sbjct: 382 LQAEKYILKTIDWNMSYPCPLNFLRRISKADDYNVQVRTIGKYLTEIGCLEWRLIAAPPS 441

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
           ++AAA+++L+R +L+  +W  NL HYS Y                +KP  HE  YKKYA+
Sbjct: 442 LLAAASMWLARLVLDCPDWTPNLRHYSSYPEEALIPTANLMLNYILKPIAHESFYKKYAS 501

Query: 389 KRFMKASIFVKDW 401
           KR++K S+FV++W
Sbjct: 502 KRYLKVSVFVREW 514



>gi|401881453|gb|EJT45753.1| g2/mitotic-specific cyclin cdc13 [Trichosporon asahii var. asahii
           CBS 2479]
          Length = 514

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 150/289 (51%), Positives = 198/289 (68%), Gaps = 3/289 (1%)

Query: 115 ATTAESEIYEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKP 174
           A   E ++    R      K   W DLDA+D  DP M+SEY +D F Y+ +LE+  M  P
Sbjct: 193 ADVPELKVERIQRSPRPVAKDAGWTDLDAEDEGDPTMVSEYVIDAFNYMMELET-TMADP 251

Query: 175 DYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVG 234
           DYM  Q EL W+MR IL DW+IEVH KFRLLPETL +A N+IDRFLS R VSLVK QLVG
Sbjct: 252 DYMDRQDELQWKMRCILNDWIIEVHSKFRLLPETLLIATNLIDRFLSKRSVSLVKFQLVG 311

Query: 235 ITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRR 294
           +T LF+AAKYEE++ PS+ +F++M D GY   EIL+AERY+LTT+ F L +PNP++FLRR
Sbjct: 312 LTALFVAAKYEEVICPSVTHFLHMTDGGYDVGEILRAERYLLTTLGFDLSFPNPLHFLRR 371

Query: 295 SSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHY 354
            SKAD +D+ ARTVAKY +EIS VD++ +  PPSM+AAAA++L+R  L R  WHAN++HY
Sbjct: 372 VSKADGYDVHARTVAKYFIEISCVDHRLIAYPPSMLAAAAMWLARLCLERGPWHANMVHY 431

Query: 355 SQYTXXXXXXXXXXXXXXXMKPTKH--EQLYKKYAAKRFMKASIFVKDW 401
           S Y+               + P        +KKYA+K+ +KAS++V++W
Sbjct: 432 SSYSQAELLPCAQVMLDFVLDPEVDLTSAFFKKYASKKHLKASVYVREW 480



>gi|149248462|ref|XP_001528618.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146448572|gb|EDK42960.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 657

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 208/296 (70%), Gaps = 8/296 (2%)

Query: 111 DTTLATTAESEIYEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEI 170
           D T AT+A S IY    KRS+     +W+DLD +D  DP+M SEY  DIF Y  +LE+ +
Sbjct: 343 DGTAATSA-STIY----KRSRLID-YEWQDLDEEDHDDPLMASEYVNDIFTYFYELETRM 396

Query: 171 MPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKL 230
           +P P+Y+ +Q  L  +MR ILVDW++E+H KFRLLPE+L+LA+NI+DRF+S+  V L KL
Sbjct: 397 LPDPNYIQTQKNLKPKMRSILVDWVVEMHLKFRLLPESLYLAINIMDRFMSLENVELDKL 456

Query: 231 QLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMN 290
           QL+    LFIAAKYEE+ +P +KN+ Y  D  YTEEEIL+AE+Y+LTT++F L YPNPMN
Sbjct: 457 QLLATGSLFIAAKYEEVFSPLVKNYAYFTDGSYTEEEILQAEKYILTTLNFDLNYPNPMN 516

Query: 291 FLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNR-SEWHA 349
           FLRR SKAD +D+Q+RT+ KYL+EI++VD++F+ + PS+ +A A+YL+R +L +   W+ 
Sbjct: 517 FLRRISKADDYDVQSRTLGKYLLEITIVDHRFIGMKPSLCSALAMYLARLILKKIPVWNG 576

Query: 350 NLIHYS-QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           NLIHYS  Y                ++P +HE+ +KKYA ++FMKAS   + W  K
Sbjct: 577 NLIHYSGGYRINDMKHCIELLYQYLLQPIEHEEFFKKYAMRKFMKASTLCQSWAKK 632



>gi|255723996|ref|XP_002546927.1| G2/mitotic-specific cyclin CYB1 [Candida tropicalis MYA-3404]
 gi|240134818|gb|EER34372.1| G2/mitotic-specific cyclin CYB1 [Candida tropicalis MYA-3404]
          Length = 468

 Score =  303 bits (777), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 139/271 (51%), Positives = 193/271 (71%), Gaps = 3/271 (1%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSS-QSELSWRMRGILVDWL 195
           +W+DLD +D  DP+M SEY  DIF Y  +LE+ ++P P Y++   + L  RMR ILVDWL
Sbjct: 173 EWQDLDEEDIDDPLMASEYVNDIFSYFYELETRMLPDPQYLTKPNTHLKPRMRSILVDWL 232

Query: 196 IEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNF 255
           +E+H KFRLLPE+LFLA+NI+DRF+S+  V + +LQL+    LFIAAKYEE+ +PS+KN+
Sbjct: 233 VEMHLKFRLLPESLFLAINIMDRFMSIETVQIDRLQLLATGSLFIAAKYEEVFSPSVKNY 292

Query: 256 IYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEI 315
            Y  D  YTEEEIL+AE+Y+LT ++F L YPNPMNFLRR SKAD +D+Q+RT+ KYL+EI
Sbjct: 293 AYFTDGSYTEEEILQAEKYILTILNFDLNYPNPMNFLRRISKADDYDVQSRTLGKYLLEI 352

Query: 316 SLVDYKFLPLPPSMIAAAALYLSRKMLNRSE-WHANLIHYS-QYTXXXXXXXXXXXXXXX 373
           ++VDYKF+ + PS+  A+A+YL+R +L +   W+ NLIHYS  Y                
Sbjct: 353 TIVDYKFIGMRPSLCCASAMYLARLILGKVPIWNGNLIHYSGGYRLNDMKPCVELMFQYL 412

Query: 374 MKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           + P +H++ +KKYA ++FMKAS   + W  K
Sbjct: 413 LAPIEHDEFFKKYAMRKFMKASTLCRSWAKK 443



>gi|146414053|ref|XP_001482997.1| hypothetical protein PGUG_04952 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 400

 Score =  303 bits (776), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 141/281 (50%), Positives = 201/281 (71%), Gaps = 3/281 (1%)

Query: 128 KRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRM 187
           KRS+K   + W+DLD +D  DP+M+SEY  +IF YL +LE + +P+  Y+  Q+ +  +M
Sbjct: 106 KRSRKIDYE-WQDLDEEDADDPLMVSEYVGEIFAYLGELEYKTLPQ-QYLHKQTHIKPKM 163

Query: 188 RGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEEL 247
           R ILVDWL+E+H +FRLLPETLFLA+N++DRF+ + VV + KLQL+    LFIAAKYEE+
Sbjct: 164 RLILVDWLVEMHMRFRLLPETLFLAINVMDRFMLMEVVQIDKLQLLATGSLFIAAKYEEV 223

Query: 248 LAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQART 307
            +P +KN+ Y  D  YTEEEIL+AE+Y+LT +DF+L YPNPMNFLRR SKAD +D+Q RT
Sbjct: 224 FSPLVKNYAYFTDGSYTEEEILQAEKYILTVLDFELNYPNPMNFLRRISKADDYDVQLRT 283

Query: 308 VAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNR-SEWHANLIHYSQYTXXXXXXXX 366
           + KYL+EI+++DYKF+ + PS+ +AAA+Y++R +L +   W  NLIHYS Y         
Sbjct: 284 LGKYLLEITIIDYKFIGMLPSLCSAAAMYIARLILQKLPVWTGNLIHYSGYRAAEMRQCV 343

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNVE 407
                  + P +H++ +KKYA ++FMKAS+  + W  K V+
Sbjct: 344 DLIVQYLVAPVEHDEFFKKYATRKFMKASVVCRSWAKKAVQ 384



>gi|403166750|ref|XP_003326611.2| G2/mitotic-specific cyclin 1/2 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375166700|gb|EFP82192.2| G2/mitotic-specific cyclin 1/2 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 637

 Score =  300 bits (769), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 191/275 (69%), Gaps = 22/275 (8%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EY V+I+ Y+K++E E +P  +YM  Q EL+W+MRG+LVDW+IEVH KFRLLPET
Sbjct: 277 PLMVTEYVVEIYNYMKEVEMETLPDSNYMVRQVELTWKMRGVLVDWIIEVHSKFRLLPET 336

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           L+LA+N++DRFL+ R V+L+K QLVG+T LF+A+KYEE++ PS+ NF+YM D GY  +EI
Sbjct: 337 LYLAINLMDRFLTKRSVALIKFQLVGVTALFLASKYEEVICPSVTNFLYMTDGGYDCDEI 396

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           LKAE Y+L  +++ L YPNP+NFLRR SKAD++DIQ+RT AKY MEIS+VDY+ +   PS
Sbjct: 397 LKAETYMLEMLEWDLRYPNPLNFLRRVSKADNYDIQSRTFAKYFMEISIVDYRLVATAPS 456

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYS-----------QYTXXXXXXXXXXXXXXXMKP- 376
           ++AAA+++L+RK+L R  W ANL HYS           Q+                + P 
Sbjct: 457 LLAAASIWLARKLLGRGGWDANLRHYSGYDQPEILPIAQFMLDYILRSGCKNLGMGLDPG 516

Query: 377 ----------TKHEQLYKKYAAKRFMKASIFVKDW 401
                      +H  L+KKYA ++F + S  V+DW
Sbjct: 517 FVIQASYEGGNEHNNLFKKYATRKFFRVSEIVRDW 551



>gi|448514616|ref|XP_003867157.1| Clb2 B-type mitotic cyclin (cyclin-dependent protein kinase
           regulatory subunit) [Candida orthopsilosis Co 90-125]
 gi|380351495|emb|CCG21719.1| Clb2 B-type mitotic cyclin (cyclin-dependent protein kinase
           regulatory subunit) [Candida orthopsilosis Co 90-125]
          Length = 491

 Score =  300 bits (769), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 135/270 (50%), Positives = 191/270 (70%), Gaps = 2/270 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +W+DLD +D+ DP+M SEY  DIF Y  +LE  ++P P Y+  Q  L  +MR ILVDWL+
Sbjct: 198 EWQDLDEEDYDDPLMASEYVNDIFTYFYELEQRMLPDPQYLYKQKNLKPKMRSILVDWLV 257

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           E+H KF+LLPE+LFLA+NI+DRF+S+  V + KLQL+    LFIAAKYEE+ +PS+KN+ 
Sbjct: 258 EMHLKFKLLPESLFLAINIMDRFMSIEAVEIDKLQLLATGSLFIAAKYEEVFSPSVKNYA 317

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           +  D  Y+ EEIL+AE+Y+LT ++F L YPNPMNFLRR SKAD +D+Q+RT+ KYL+EI+
Sbjct: 318 FFTDGSYSVEEILQAEKYILTVLNFDLNYPNPMNFLRRISKADDYDVQSRTLGKYLLEIT 377

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNR-SEWHANLIHYS-QYTXXXXXXXXXXXXXXXM 374
           ++DYKF+ + PS+  A+A+YLSR +L +   W+ NLIHYS  Y                +
Sbjct: 378 IIDYKFIGMKPSLCCASAMYLSRLILGKIPVWNGNLIHYSGGYRINDMRECVELMFQYII 437

Query: 375 KPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
            P +H++ +KKYA ++FM+AS   + W  K
Sbjct: 438 SPIEHDEFFKKYAMRKFMRASTLCRKWAEK 467



>gi|320580090|gb|EFW94313.1| B-type cyclin [Ogataea parapolymorpha DL-1]
          Length = 423

 Score =  300 bits (768), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 148/294 (50%), Positives = 208/294 (70%), Gaps = 4/294 (1%)

Query: 115 ATTAESEIYEFDRKRSKKQKTQ---DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIM 171
           AT + S+  E   +  KK K +    W+DLDADD  DP+M+SEY  DIF+YL +LE + +
Sbjct: 117 ATDSSSDFLEQGTQEVKKVKVEHDYTWDDLDADDADDPLMVSEYVNDIFEYLHELELKTL 176

Query: 172 PKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQ 231
           P P+Y+  Q  L  +MR ILVDW++EVH KFRLLPETL+LA+NI+DRF+S   V + +LQ
Sbjct: 177 PDPNYLHWQRNLRPKMRSILVDWMVEVHLKFRLLPETLYLAINIMDRFMSRESVQVDRLQ 236

Query: 232 LVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNF 291
           L+    LFIAAKYEE+ +PS+KN+ Y+ D G+TEEEIL AE+++L  + F + YPNPMNF
Sbjct: 237 LLATGSLFIAAKYEEVYSPSVKNYAYVTDGGFTEEEILNAEKFILEILQFNMSYPNPMNF 296

Query: 292 LRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANL 351
           LRR SKAD +D+Q+RT+ KYL+EIS++D+KF+   PS+ +AAA+Y++RKML++++W+ NL
Sbjct: 297 LRRISKADDYDVQSRTIGKYLLEISIIDHKFIGYLPSLCSAAAMYIARKMLSKNDWNGNL 356

Query: 352 IHYS-QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           IHYS  Y                + P  HE+ +KKYA+++FMK SI  + W  K
Sbjct: 357 IHYSGGYKESDLKEVSEMIIDYLISPIVHEEFFKKYASRKFMKVSILARQWAKK 410



>gi|238486190|ref|XP_002374333.1| G2/M-specific cyclin NimE [Aspergillus flavus NRRL3357]
 gi|220699212|gb|EED55551.1| G2/M-specific cyclin NimE [Aspergillus flavus NRRL3357]
          Length = 537

 Score =  299 bits (766), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 184/246 (74%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EY V+IF+Y+KDLE E +P P Y+  Q +L W+MRGILVDWLIEVH +FRLLPET
Sbjct: 206 PLMVAEYVVEIFEYMKDLELETLPNPHYIDHQPDLEWKMRGILVDWLIEVHTRFRLLPET 265

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNIIDRFLS  VV+L +LQLVG+  +FIA+KYEE+L+P + NF ++AD  +T++EI
Sbjct: 266 LFLAVNIIDRFLSAEVVALDRLQLVGVAAMFIASKYEEVLSPHVANFSHVADETFTDKEI 325

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L AER++L T+++ + YPNPMNFLRR SKAD++DIQ RT+ KYLMEISL+D++F+    S
Sbjct: 326 LDAERHILATLEYNMSYPNPMNFLRRISKADNYDIQTRTLGKYLMEISLLDHRFMAYRQS 385

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
            ++AAA+YL+R +L R  W A L +Y+ Y                 +P  HE  +KKYA+
Sbjct: 386 HVSAAAMYLARLILERGPWDATLAYYAGYDEEQIDPVFRLMIDYLHRPVCHEAFFKKYAS 445

Query: 389 KRFMKA 394
           K+F+K 
Sbjct: 446 KKFLKG 451



>gi|50307537|ref|XP_453748.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49642882|emb|CAH00844.1| KLLA0D15543p [Kluyveromyces lactis]
          Length = 539

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 141/278 (50%), Positives = 195/278 (70%), Gaps = 2/278 (0%)

Query: 128 KRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRM 187
           K  +K K  +WEDLD +D  DP M+SEY  DIF+YL  LE   +P    +   + +  + 
Sbjct: 248 KVCEKGKEYEWEDLDEEDINDPFMVSEYVTDIFEYLHRLEMMTLPNRHELFKHANIQ-QN 306

Query: 188 RGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEEL 247
           R ILV+W++++H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG   LFIA+KYEE+
Sbjct: 307 RDILVNWMVKIHNKFGLLPETLYLALNIMDRFLCKELVQLEKLQLVGTACLFIASKYEEV 366

Query: 248 LAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQART 307
            +PS+K+F Y  D    EEEI + E+++L T++F L YPNPMNFLRR SKAD +DIQ+RT
Sbjct: 367 YSPSVKHFAYETDGACDEEEIKEGEKFILKTLEFNLNYPNPMNFLRRISKADDYDIQSRT 426

Query: 308 VAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXX 366
           +AKYL+EIS+VD+KF+ + PS+ AAA+++LSRKML + +W  NLIHYS  YT        
Sbjct: 427 LAKYLLEISIVDFKFIGILPSLCAAASMFLSRKMLGKGQWDGNLIHYSGGYTKDELAPVC 486

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
                  ++P  H++L+KKYA++RFMKAS+  + W  K
Sbjct: 487 NMVMEYLVQPVVHDELFKKYASRRFMKASVISRQWAKK 524



>gi|344303249|gb|EGW33523.1| hypothetical protein SPAPADRAFT_60869 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 475

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 141/270 (52%), Positives = 195/270 (72%), Gaps = 2/270 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +W+DLD +D  DP+M SEY  DIF Y  +LE  ++P P Y+  Q  L  +MR ILVDWL+
Sbjct: 185 EWQDLDEEDLDDPLMASEYVNDIFSYFYELEQRMLPDPQYLFQQKHLKPKMRSILVDWLV 244

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           E+H KFRLLPE+L+LA+NI+DRF+S+ VV + KLQL+    LFIAAKYEE+ +PS+KN+ 
Sbjct: 245 EMHLKFRLLPESLYLAINIMDRFMSIEVVQIDKLQLLATGSLFIAAKYEEVFSPSVKNYA 304

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           Y  D  YTEEEIL+AE+Y+LT ++F L YPNPMNFLRR SKAD +D+Q+RT+ KYL+EI+
Sbjct: 305 YFTDGSYTEEEILQAEKYILTILNFDLNYPNPMNFLRRISKADDYDVQSRTLGKYLLEIT 364

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSE-WHANLIHYS-QYTXXXXXXXXXXXXXXXM 374
           ++DYKF+ + PS+  A+A+YL+R +L +S  W+ NLIHYS  Y                +
Sbjct: 365 VIDYKFIGMRPSLCCASAMYLARLILGKSPVWNGNLIHYSGGYRLSDMKTCVDLIFQYLI 424

Query: 375 KPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
            P +H++ YKKY+A++FMKAS+  + W  K
Sbjct: 425 SPIEHDEFYKKYSARKFMKASLLCRSWAKK 454



>gi|336370345|gb|EGN98685.1| hypothetical protein SERLA73DRAFT_181272 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336383140|gb|EGO24289.1| hypothetical protein SERLADRAFT_467354 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 352

 Score =  298 bits (762), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 137/266 (51%), Positives = 194/266 (72%), Gaps = 3/266 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  DF+D  M++EYA DIFKY+ DLE ++MP PDYMS Q+E+SW MR  LVDWL++VH +
Sbjct: 74  DEVDFFDTTMVTEYAEDIFKYMSDLEEDVMPNPDYMSGQNEISWSMRQTLVDWLLQVHLR 133

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++AVNI+DRFL+ RVVSLVKLQLVG+T +FIAAKYEE+LAPS+  F++M +N
Sbjct: 134 YHMLPETLWIAVNIVDRFLTRRVVSLVKLQLVGVTAMFIAAKYEEILAPSVDEFVFMTEN 193

Query: 262 GYTEEEILKAERYVLTTIDFKLC-YPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GY++EEILK ER VL T+DFK+  Y +P +++RR SKAD +DIQ RT+ K+L E++L+DY
Sbjct: 194 GYSKEEILKGERIVLQTLDFKVSQYCSPYSWMRRISKADDYDIQTRTLGKFLTEVTLLDY 253

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           +FL   PS+IAA  +Y +RKML   +W+   +++S +                ++   H+
Sbjct: 254 RFLRCKPSLIAAVGMYSARKMLG-GDWNEAFVYHSGFVEEQLEPGHQWIADKLLEENFHQ 312

Query: 381 Q-LYKKYAAKRFMKASIFVKDWISKN 405
           Q + +KY  K+F+KAS+F  +W   N
Sbjct: 313 QYVCQKYGHKKFLKASVFAIEWAKAN 338



>gi|50546897|ref|XP_500918.1| YALI0B15180p [Yarrowia lipolytica]
 gi|49646784|emb|CAG83169.1| YALI0B15180p [Yarrowia lipolytica CLIB122]
          Length = 530

 Score =  298 bits (762), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 136/254 (53%), Positives = 177/254 (69%), Gaps = 1/254 (0%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           PM   EY  +IF +L +LE E  P P Y+  Q  LSW  R +L+DWL+EVH KFRLLPET
Sbjct: 256 PMAAGEYVDEIFTHLYNLEEEYQPNPRYIDDQKSLSWNTRAVLIDWLVEVHQKFRLLPET 315

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFLAVNI+DRF+S RVV+L K+QLVGIT L +A KYEE+  P++ NF+Y+ D  Y E+EI
Sbjct: 316 LFLAVNIVDRFMSRRVVALNKVQLVGITSLLLATKYEEVFTPALSNFVYVVDGSYPEDEI 375

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L+AER++L  + F L YPNPMNFLRR SKAD FDI +RT  KYL EI+LVD+ F+    S
Sbjct: 376 LRAERFILQVLQFNLSYPNPMNFLRRISKADDFDIHSRTFGKYLCEIALVDHTFMEFKHS 435

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYA 387
           ++AAAA+++ R ML RS+W  NL++YS  YT               + P +HE  +KKYA
Sbjct: 436 LVAAAAMHVGRMMLARSQWTNNLVYYSGGYTQKDIAPVCRKIFQFLIGPVEHEAFFKKYA 495

Query: 388 AKRFMKASIFVKDW 401
            K+F+KASI  ++W
Sbjct: 496 TKKFLKASIIAREW 509



>gi|45184922|ref|NP_982640.1| AAR099Wp [Ashbya gossypii ATCC 10895]
 gi|44980531|gb|AAS50464.1| AAR099Wp [Ashbya gossypii ATCC 10895]
          Length = 555

 Score =  298 bits (762), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 141/282 (50%), Positives = 196/282 (69%), Gaps = 2/282 (0%)

Query: 128 KRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRM 187
           K S +    +WEDLDA+D  DP M+SEY  DIF+YL  LE   +P    +   + +  + 
Sbjct: 261 KISDQGNQCEWEDLDAEDINDPFMVSEYVNDIFEYLHKLEVMTLPNRHDLFKHANIQ-QN 319

Query: 188 RGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEEL 247
           R ILV+W++++H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG   LFIA+KYEE+
Sbjct: 320 RDILVNWMVKIHNKFGLLPETLYLALNIMDRFLGKELVQLEKLQLVGTACLFIASKYEEV 379

Query: 248 LAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQART 307
            +PS+K+F Y  D    EEEI + E+++L T+ F L YPNPMNFLRR SKAD +DIQ+RT
Sbjct: 380 YSPSVKHFAYETDGACDEEEIKEGEKFILKTLQFNLNYPNPMNFLRRISKADDYDIQSRT 439

Query: 308 VAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXX 366
           +AKYL+EIS+VD+KF+ + PS+ AAA+++LSRKML + +W  NLIHYS  Y+        
Sbjct: 440 LAKYLLEISVVDFKFIGILPSLCAAASMFLSRKMLGKGKWDGNLIHYSGGYSTTELAPIC 499

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNVER 408
                  ++P  H++L+KKYA++RFMKAS+  + W  K + R
Sbjct: 500 NMLMDYLVQPVVHDELFKKYASRRFMKASVISRQWAKKVMTR 541



>gi|374105839|gb|AEY94750.1| FAAR099Wp [Ashbya gossypii FDAG1]
          Length = 555

 Score =  297 bits (761), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 141/282 (50%), Positives = 196/282 (69%), Gaps = 2/282 (0%)

Query: 128 KRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRM 187
           K S +    +WEDLDA+D  DP M+SEY  DIF+YL  LE   +P    +   + +  + 
Sbjct: 261 KISDQGNQCEWEDLDAEDINDPFMVSEYVNDIFEYLHKLEVMTLPNRHDLFKHANIQ-QN 319

Query: 188 RGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEEL 247
           R ILV+W++++H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG   LFIA+KYEE+
Sbjct: 320 RDILVNWMVKIHNKFGLLPETLYLALNIMDRFLGKELVQLEKLQLVGTACLFIASKYEEV 379

Query: 248 LAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQART 307
            +PS+K+F Y  D    EEEI + E+++L T+ F L YPNPMNFLRR SKAD +DIQ+RT
Sbjct: 380 YSPSVKHFAYETDGACDEEEIKEGEKFILKTLQFNLNYPNPMNFLRRISKADDYDIQSRT 439

Query: 308 VAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXX 366
           +AKYL+EIS+VD+KF+ + PS+ AAA+++LSRKML + +W  NLIHYS  Y+        
Sbjct: 440 LAKYLLEISVVDFKFIGILPSLCAAASMFLSRKMLGKGKWDGNLIHYSGGYSTTELAPIC 499

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNVER 408
                  ++P  H++L+KKYA++RFMKAS+  + W  K + R
Sbjct: 500 NMLMDYLVQPVVHDELFKKYASRRFMKASVISRQWAKKVMTR 541



>gi|513030045|gb|AGO10089.1| AaceriAAR099Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 554

 Score =  297 bits (760), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 141/282 (50%), Positives = 196/282 (69%), Gaps = 2/282 (0%)

Query: 128 KRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRM 187
           K S +    +WEDLDA+D  DP M+SEY  DIF+YL  LE   +P    +   + +  + 
Sbjct: 260 KISDQGNQCEWEDLDAEDVNDPFMVSEYVNDIFEYLHKLEVMTLPNRHDLFKHANIQ-QN 318

Query: 188 RGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEEL 247
           R ILV+W++++H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG   LFIA+KYEE+
Sbjct: 319 RDILVNWMVKIHNKFGLLPETLYLALNIMDRFLGKELVQLEKLQLVGTACLFIASKYEEV 378

Query: 248 LAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQART 307
            +PS+K+F Y  D    EEEI + E+++L T+ F L YPNPMNFLRR SKAD +DIQ+RT
Sbjct: 379 YSPSVKHFAYETDGACDEEEIKEGEKFILKTLQFNLNYPNPMNFLRRISKADDYDIQSRT 438

Query: 308 VAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXX 366
           +AKYL+EIS+VD+KF+ + PS+ AAA+++LSRKML + +W  NLIHYS  Y+        
Sbjct: 439 LAKYLLEISVVDFKFIGILPSLCAAASMFLSRKMLGKGKWDGNLIHYSGGYSTTELAPIC 498

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNVER 408
                  ++P  H++L+KKYA++RFMKAS+  + W  K + R
Sbjct: 499 NMLMDYLVQPVVHDELFKKYASRRFMKASVISRQWAKKVMTR 540



>gi|50547241|ref|XP_501090.1| YALI0B19206p [Yarrowia lipolytica]
 gi|49646956|emb|CAG83343.1| YALI0B19206p [Yarrowia lipolytica CLIB122]
          Length = 430

 Score =  296 bits (758), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 137/271 (50%), Positives = 190/271 (70%), Gaps = 3/271 (1%)

Query: 135 TQDWEDLDA--DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           T +  DLD   DD YD  M++EYA +IF Y+K+LE    P P YM SQ+E+ W MR ILV
Sbjct: 153 TNNGVDLDENDDDTYDISMVAEYAEEIFTYMKELEVRFQPNPGYMDSQTEIHWAMRSILV 212

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL +N IDRFL+++ VSL KLQLVG   LF+AAKYEE+  PS+
Sbjct: 213 DWLVQVHHRFSLLPETLFLTINYIDRFLTIKTVSLSKLQLVGAVALFVAAKYEEINCPSV 272

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +   YM DNGY  +EILKAERY++  +DF L +P PM+FLRR+SKAD +D++ RT+AKYL
Sbjct: 273 QEIAYMVDNGYHVDEILKAERYMIDLLDFNLGWPGPMSFLRRTSKADDYDLETRTLAKYL 332

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +E+++++  F+  PPS +AAAA +LSR+MLNR  W     +YS YT              
Sbjct: 333 LEVTIMEKTFVGAPPSWLAAAAHFLSRRMLNRGHWTDGHTYYSGYTEKQLLPAVMRIIQC 392

Query: 373 XMKP-TKHEQLYKKYAAKRFMKASIFVKDWI 402
              P T H+ +++KY  ++F +AS++V++W+
Sbjct: 393 CRDPLTHHKAIFEKYKDRKFKRASVYVQEWM 423



>gi|354547027|emb|CCE43760.1| hypothetical protein CPAR2_214040 [Candida parapsilosis]
          Length = 493

 Score =  296 bits (758), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 134/270 (49%), Positives = 190/270 (70%), Gaps = 2/270 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +W+DLD +D+ DP+M SEY  DIF Y  +LE  ++P   Y+  Q  L  +MR ILVDWL+
Sbjct: 200 EWQDLDEEDYDDPLMASEYVNDIFTYFYELEQRMLPDSQYLYKQKNLKPKMRSILVDWLV 259

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           E+H KF+LLPE+LFLA+NI+DRF+S+  V + KLQL+    LFIAAKYEE+ +PS+KN+ 
Sbjct: 260 EMHLKFKLLPESLFLAINIMDRFMSIEAVEIDKLQLLATGSLFIAAKYEEVFSPSVKNYA 319

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
           +  D  Y+ EEIL+AE+Y+LT ++F L YPNPMNFLRR SKAD +D+Q+RT+ KYL+EI+
Sbjct: 320 FFTDGSYSVEEILQAEKYILTVLNFDLNYPNPMNFLRRISKADDYDVQSRTLGKYLLEIT 379

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNR-SEWHANLIHYS-QYTXXXXXXXXXXXXXXXM 374
           ++DYKF+ + PS+  A+A+YLSR +L +   W+ NLIHYS  Y                +
Sbjct: 380 IIDYKFIGMKPSLCCASAMYLSRLILGKIPVWNGNLIHYSGGYRINDMRECVELMFQYII 439

Query: 375 KPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
            P +H++ +KKYA ++FM+AS   + W  K
Sbjct: 440 SPIEHDEFFKKYAMRKFMRASTLCRKWGEK 469



>gi|363752153|ref|XP_003646293.1| hypothetical protein Ecym_4429 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356889928|gb|AET39476.1| hypothetical protein Ecym_4429 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 604

 Score =  296 bits (757), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 140/282 (49%), Positives = 197/282 (69%), Gaps = 2/282 (0%)

Query: 128 KRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRM 187
           K  +K +  +WEDLDA+D  DP M+SEY  DIF+YL  LE   +P    +   + +  + 
Sbjct: 312 KVCEKGQEYEWEDLDAEDINDPFMVSEYVNDIFEYLHKLEIMTLPNRHDLFKHANIQ-QN 370

Query: 188 RGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEEL 247
           R ILV+W++++H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG   LFIA+KYEE+
Sbjct: 371 RDILVNWMVKIHNKFGLLPETLYLALNIMDRFLGKELVQLEKLQLVGTACLFIASKYEEV 430

Query: 248 LAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQART 307
            +PS+K+F Y  D    E+EI + E+++L T+ F L YPNPMNFLRR SKAD +DIQ+RT
Sbjct: 431 YSPSVKHFAYETDGACDEDEIKEGEKFILKTLKFNLNYPNPMNFLRRISKADDYDIQSRT 490

Query: 308 VAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXX 366
           +AKYL+EIS+VD+KF+ + PS+ AAA+++LSRKML + +W  NLIHYS  Y+        
Sbjct: 491 LAKYLLEISVVDFKFIGILPSLCAAASMFLSRKMLGKGKWDGNLIHYSGGYSPTELSSVC 550

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNVER 408
                  ++P  H++L+KKYA++RFMKAS+  + W  K + R
Sbjct: 551 NMLMDYLVQPVVHDELFKKYASRRFMKASVISRQWAKKVMTR 592



>gi|511007021|gb|EPB88323.1| G2/mitotic-specific cyclin 1/2 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 525

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 142/294 (48%), Positives = 205/294 (69%), Gaps = 3/294 (1%)

Query: 114 LATTAESEIYEFDRK-RSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMP 172
           L  T E+  YE +++ R+K    Q  + L  D + DPM+++EYA +IF YL D E  IM 
Sbjct: 228 LELTQETIKYEHEQEMRAKLAMLQTTQSLREDQWNDPMLVAEYAGEIFGYLFDSEPGIMA 287

Query: 173 KPDYMSSQS-ELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQ 231
            P Y ++Q  E+SW+MR +LVDW+IE+H+ F LLPETLFLAVNIIDRFLS+R V+L KLQ
Sbjct: 288 DPMYANNQQHEISWKMRSVLVDWVIEIHYLFGLLPETLFLAVNIIDRFLSLRTVALGKLQ 347

Query: 232 LVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNF 291
           LVGIT L+IA K+EE + P +++F+YM D G +E+E +KAER+++  +DF+ CYPNP+NF
Sbjct: 348 LVGITSLYIATKFEENMCPIMQDFLYMTDKGVSEDEFIKAERFIMQILDFRFCYPNPLNF 407

Query: 292 LRR-SSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHAN 350
           LRR  ++  + D+  RT+AKY MEIS +D++F+ + PS +AAAAL+LS+KML + +W+++
Sbjct: 408 LRRICTEEMNCDVHTRTLAKYFMEISCIDHRFIGVRPSKVAAAALWLSKKMLVKGKWNSH 467

Query: 351 LIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           L   S Y                 +   H+  +KK++ KRF KASIFV+DWI++
Sbjct: 468 LTKLSGYAPQDFRSTVEAMLDYLSQTVTHDAFFKKWSTKRFSKASIFVRDWINR 521



>gi|393247224|gb|EJD54732.1| A/B/D/E cyclin [Auricularia delicata TFB-10046 SS5]
          Length = 553

 Score =  294 bits (753), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 187/253 (73%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M++EY VDIF YLK +E+  MP  +YM+ Q  ++W +RG LVDW+I VH +FR LPET
Sbjct: 262 PLMVAEYVVDIFNYLKSIETTTMPNANYMNDQDTMTWAIRGTLVDWMISVHARFRFLPET 321

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
           LFL+VNI+DRFL++R+ S+ KLQLVG   +FIAAK EE+  P+    + ++DN ++E E+
Sbjct: 322 LFLSVNILDRFLTMRLASVDKLQLVGAAAVFIAAKCEEMFTPAAIRMVEISDNAFSEAEL 381

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           LKAERY+L TI++ L YP+P+NFLRR SKAD ++ + RT+AK+ +EI +V+++ L +PPS
Sbjct: 382 LKAERYMLKTIEWNLSYPSPLNFLRRVSKADEYNTKVRTLAKFFLEIGVVEWRLLAVPPS 441

Query: 329 MIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAA 388
           ++AAA+++L R +L + EW+ANL+HYS YT               +KP +HE  +KKY+A
Sbjct: 442 LLAAASMWLGRLVLGQGEWNANLVHYSSYTEEAIVPVANIMINFLLKPMRHEHFWKKYSA 501

Query: 389 KRFMKASIFVKDW 401
           K+F +AS ++++W
Sbjct: 502 KKFYRASKYMREW 514



>gi|299749762|ref|XP_001836312.2| cyclin [Coprinopsis cinerea okayama7#130]
 gi|298408589|gb|EAU85496.2| cyclin [Coprinopsis cinerea okayama7#130]
          Length = 505

 Score =  293 bits (751), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 138/272 (50%), Positives = 199/272 (73%), Gaps = 5/272 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D YD  M+SEYA +IFKY++++E EIMP PDYM  Q+E++W MR  LVDWL++VH +
Sbjct: 230 DEVDMYDTTMVSEYADEIFKYMEEMEDEIMPNPDYMDGQNEITWSMRQTLVDWLLQVHLR 289

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++A+NI+DRFL+ RVVSLVKLQLVG+T +F+AAKYEE+LAPS+  F++M ++
Sbjct: 290 YHMLPETLWIAINIVDRFLTKRVVSLVKLQLVGVTAMFVAAKYEEILAPSVDEFVFMTES 349

Query: 262 GYTEEEILKAERYVLTTIDFKLC-YPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GYT+EEILK ER +L T+DF++  Y +P +++R+ SKAD +D+Q RT++K+L EI+L+DY
Sbjct: 350 GYTKEEILKGERIMLQTLDFRISHYCSPYSWMRKISKADDYDVQTRTLSKFLTEITLLDY 409

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           +FL + PSMIAA  +Y SR+ML   +W+   + YS YT               ++     
Sbjct: 410 RFLRVKPSMIAAIGMYCSRRMLG-GDWNEAFVFYSGYTEEQLIPGFDLIISKLVE-ENFS 467

Query: 381 QLY--KKYAAKRFMKASIFVKDWISKNVERQQ 410
           +LY  KKYA K+F+KASIF  +W   ++ER+ 
Sbjct: 468 KLYVCKKYANKKFLKASIFAIEWAHAHLERKH 499



>gi|443894528|dbj|GAC71876.1| hypothetical protein PANT_5d00112 [Pseudozyma antarctica T-34]
          Length = 593

 Score =  292 bits (747), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 133/267 (49%), Positives = 192/267 (71%), Gaps = 3/267 (1%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD D+  D  M++EY+ +IF Y+   E E M  P+YM  Q E+ W MR  LVDWL++VH 
Sbjct: 306 LDPDEVRDTSMVAEYSTEIFNYMARCERETMANPNYMDFQREIHWHMRATLVDWLLQVHM 365

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           ++ +LPETL++A+N++DRFLSVRVVSL KLQLVG+T +FIAAKYEE+LAPS+K F++M +
Sbjct: 366 RYHMLPETLWIAINVVDRFLSVRVVSLAKLQLVGVTAMFIAAKYEEILAPSVKEFVFMTE 425

Query: 261 NGYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           NGY +EEILK ER +L+T+DF +  Y +P +++RR SKAD +DI+ RT++K+LME++L+D
Sbjct: 426 NGYKQEEILKGERIILSTLDFNISSYCSPYSWVRRISKADDYDIRTRTLSKFLMELALLD 485

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++FL   PS+IAA  ++LS+KML   EW    ++YS +T               + P   
Sbjct: 486 HRFLRARPSLIAAVGMFLSKKMLG-GEWDDAFVYYSDFTEEQLVPGANLLLERLLDPGFE 544

Query: 380 EQ-LYKKYAAKRFMKASIFVKDWISKN 405
           EQ +Y+KYA K+F+KAS+F +DW  +N
Sbjct: 545 EQFVYRKYANKKFLKASVFARDWAYQN 571



>gi|58267898|ref|XP_571105.1| cyclin-dependent protein kinase regulator [Cryptococcus neoformans
           var. neoformans JEC21]
 gi|57227339|gb|AAW43798.1| cyclin-dependent protein kinase regulator, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 479

 Score =  292 bits (747), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 194/266 (72%), Gaps = 3/266 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D +D  M++EYA +IF++++ LE  +MP P YM  Q+E+ W MR  L+DWL++VH +
Sbjct: 210 DDVDMFDTTMVAEYADEIFEHMERLEESVMPNPRYMDFQTEIEWTMRTTLIDWLLQVHLR 269

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++AVNI+DRFLS RVVSLVKLQLVG+T +FIAAKYEE+LAPS++ F+YM +N
Sbjct: 270 YHMLPETLWIAVNIVDRFLSTRVVSLVKLQLVGVTAMFIAAKYEEILAPSVEEFVYMTEN 329

Query: 262 GYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GYT++EILK ER +L T+DF +  Y +P +++RR SKAD +D+Q RT++K+LME++L+D+
Sbjct: 330 GYTKDEILKGERIILQTLDFTISSYCSPYSWVRRISKADDYDVQTRTLSKFLMEVTLLDH 389

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT-KH 379
           +FL   PSMIAA  +YL+RKML   +W+   I+YS +T               ++P  + 
Sbjct: 390 RFLRCKPSMIAAIGMYLARKMLG-GDWNDAFIYYSNFTESQLITGASLLCERLIEPDFES 448

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKN 405
             +YKKYA K+F++AS F +DW   N
Sbjct: 449 VYVYKKYANKKFLRASTFARDWALTN 474



>gi|134112383|ref|XP_775167.1| hypothetical protein CNBE4400 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|37706311|gb|AAR01623.1| cyclin [Cryptococcus neoformans var. neoformans]
 gi|50257819|gb|EAL20520.1| hypothetical protein CNBE4400 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 479

 Score =  292 bits (747), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 194/266 (72%), Gaps = 3/266 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D +D  M++EYA +IF++++ LE  +MP P YM  Q+E+ W MR  L+DWL++VH +
Sbjct: 210 DDVDMFDTTMVAEYADEIFEHMERLEESVMPNPRYMDFQTEIEWTMRTTLIDWLLQVHLR 269

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++AVNI+DRFLS RVVSLVKLQLVG+T +FIAAKYEE+LAPS++ F+YM +N
Sbjct: 270 YHMLPETLWIAVNIVDRFLSTRVVSLVKLQLVGVTAMFIAAKYEEILAPSVEEFVYMTEN 329

Query: 262 GYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GYT++EILK ER +L T+DF +  Y +P +++RR SKAD +D+Q RT++K+LME++L+D+
Sbjct: 330 GYTKDEILKGERIILQTLDFTISSYCSPYSWVRRISKADDYDVQTRTLSKFLMEVTLLDH 389

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT-KH 379
           +FL   PSMIAA  +YL+RKML   +W+   I+YS +T               ++P  + 
Sbjct: 390 RFLRCKPSMIAAIGMYLARKMLG-GDWNDAFIYYSNFTESQLITGASLLCERLIEPDFES 448

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKN 405
             +YKKYA K+F++AS F +DW   N
Sbjct: 449 VYVYKKYANKKFLRASTFARDWALTN 474



>gi|392870101|gb|EAS27260.2| G2/mitotic-specific cyclin cdc13 [Coccidioides immitis RS]
          Length = 638

 Score =  292 bits (747), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 191/268 (71%), Gaps = 2/268 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+D +D + ++  DP M++EY  +IF Y++ LE ++MP P YM +Q+E+ W MR +L+
Sbjct: 339 ESTRDVQDYE-EECSDPTMVAEYGDEIFDYMRKLEIKLMPNPHYMDTQAEIQWSMRSVLM 397

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DW+++VH +F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 398 DWIVQVHLRFNLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSV 457

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM DNGYT EEILKAER++L+ + F+L +P PMNFLRR SKAD +D++ RT+AKY 
Sbjct: 458 QEIVYMVDNGYTAEEILKAERFMLSLLQFELGWPGPMNFLRRISKADDYDLETRTLAKYF 517

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI+++D +F+  PPS +AAAA  L+R ML + +W A  +HYS+YT              
Sbjct: 518 LEITIMDERFVGSPPSFVAAAAHCLARMMLRKGDWGAAHVHYSKYTYSQLYPVMKLMFEC 577

Query: 373 XMKPTKHE-QLYKKYAAKRFMKASIFVK 399
              P +H   +Y+KY+ +RF +A+ F +
Sbjct: 578 CDAPQRHHPAIYEKYSDRRFKRAASFAE 605



>gi|385304656|gb|EIF48665.1| putative g2 b-type cyclin [Dekkera bruxellensis AWRI1499]
          Length = 291

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 139/285 (48%), Positives = 194/285 (68%), Gaps = 10/285 (3%)

Query: 127 RKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWR 186
           R R+  QK  D   L         M+SEY  +IF YL +LE + +P P+Y+  Q  L  +
Sbjct: 9   RGRTXMQKMADGXHL---------MVSEYVQEIFDYLHELELKALPDPNYLEWQRNLRPK 59

Query: 187 MRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEE 246
           MR ILVDW++EVH KFRLLPETL+L++NI+DRF+S  +V + +LQL+    LFIAAKYEE
Sbjct: 60  MRSILVDWMVEVHLKFRLLPETLYLSINIMDRFMSREMVQVDRLQLLATGSLFIAAKYEE 119

Query: 247 LLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQAR 306
           + +PS+KN+ Y+ D G+TE+EIL+AER++L  ++F + YPNPMNFLRR SKAD +D+QAR
Sbjct: 120 VYSPSVKNYAYVTDGGFTEDEILQAERFILEILNFDMSYPNPMNFLRRISKADDYDVQAR 179

Query: 307 TVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXX 365
           T+  YL+EI+ +DYKF+   PS+ AA+A+Y+SRKML + +W+ NLIHYS  Y        
Sbjct: 180 TIGXYLLEITAIDYKFIGYLPSLCAASAMYISRKMLGKFDWNGNLIHYSGGYRESDMRET 239

Query: 366 XXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNVERQQ 410
                   + P  HE+ +KKYA++RFMK SI  + W  K V + +
Sbjct: 240 CEMMIDYLVGPIVHEEFFKKYASRRFMKVSILARQWAKKLVRQGK 284



>gi|258566718|ref|XP_002584103.1| G2/mitotic-specific cyclin 3 [Uncinocarpus reesii 1704]
 gi|237905549|gb|EEP79950.1| G2/mitotic-specific cyclin 3 [Uncinocarpus reesii 1704]
          Length = 630

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 142/303 (46%), Positives = 202/303 (66%), Gaps = 15/303 (4%)

Query: 111 DTTLATTA---------ESEIYEFDRKRSKKQKT-QDWEDLDADDFYDPMMISEYAVDIF 160
           +TT+ TTA         E     F +K  +  +T QD+ED    + +DP M++EY  +IF
Sbjct: 301 NTTVGTTAILFPEFTANEKRDLAFAKKFVESTRTAQDYED----ECFDPTMVAEYGDEIF 356

Query: 161 KYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFL 220
            Y++ LE ++MP P YM +Q+E+ W MR +L+DW+++VH +F LLPETLFL VN IDRFL
Sbjct: 357 DYMRKLEVKLMPNPHYMDNQAEIQWSMRSVLMDWIVQVHLRFNLLPETLFLCVNYIDRFL 416

Query: 221 SVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTID 280
           S ++VSL KLQLVG T +FIAAKYEE+  PS++  +YM DN YT EEILKAER++L+ + 
Sbjct: 417 SSKIVSLGKLQLVGATAIFIAAKYEEINCPSVQEIVYMVDNTYTAEEILKAERFMLSLLQ 476

Query: 281 FKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRK 340
           F+L +P PMNFLRR SKAD +D++ RT+AKY +EI+++D +F+  PPS +AA A  L+R 
Sbjct: 477 FELGWPGPMNFLRRISKADDYDLETRTLAKYFLEITIMDERFIGCPPSFLAAGAHCLARL 536

Query: 341 MLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE-QLYKKYAAKRFMKASIFVK 399
           ML + +W A  ++YS YT                 P +H   +Y+KY+ +RF +AS FV+
Sbjct: 537 MLRKGDWGATHVYYSNYTPSQLYPLVSLMLECCDIPQRHHPAIYEKYSDRRFKRASCFVE 596

Query: 400 DWI 402
             I
Sbjct: 597 SEI 599



>gi|405120953|gb|AFR95723.1| cyclin [Cryptococcus neoformans var. grubii H99]
          Length = 479

 Score =  291 bits (745), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 194/266 (72%), Gaps = 3/266 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D +D  M++EYA +IF++++ LE  +MP P YM  Q+E+ W MR  L+DWL++VH +
Sbjct: 210 DDVDMFDTTMVAEYADEIFEHMERLEETVMPNPRYMDFQTEIEWTMRTTLIDWLLQVHLR 269

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++AVNI+DRFLS RVVSLVKLQLVG+T +FIAAKYEE+LAPS++ F+YM +N
Sbjct: 270 YHMLPETLWIAVNIVDRFLSTRVVSLVKLQLVGVTAMFIAAKYEEILAPSVEEFVYMTEN 329

Query: 262 GYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GYT++EILK ER +L T+DF +  Y +P +++RR SKAD +D+Q RT++K+LME++L+D+
Sbjct: 330 GYTKDEILKGERIILQTLDFTISSYCSPYSWVRRISKADDYDVQTRTLSKFLMEVTLLDH 389

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT-KH 379
           +FL   PSMIAA  +YL+RKML   +W+   I+YS +T               ++P  + 
Sbjct: 390 RFLRCKPSMIAAIGMYLARKMLG-GDWNDAFIYYSNFTESQLITGASLLCERLIEPDFES 448

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKN 405
             +YKKYA K+F++AS F +DW   N
Sbjct: 449 VYVYKKYANKKFLRASTFARDWALTN 474



>gi|321259415|ref|XP_003194428.1| cyclin-dependent protein kinase regulator [Cryptococcus gattii
           WM276]
 gi|317460899|gb|ADV22641.1| cyclin-dependent protein kinase regulator, putative [Cryptococcus
           gattii WM276]
          Length = 479

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 194/266 (72%), Gaps = 3/266 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D +D  M++EYA +IF++++ LE  +MP P YM  Q+E+ W MR  L+DWL++VH +
Sbjct: 210 DDVDMFDTTMVAEYADEIFEHMERLEETVMPNPRYMDFQTEIEWTMRTTLIDWLLQVHLR 269

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++AVNI+DRFLS RVVSLVKLQLVG+T +FIAAKYEE+LAPS++ F+YM +N
Sbjct: 270 YHMLPETLWIAVNIVDRFLSTRVVSLVKLQLVGVTAMFIAAKYEEILAPSVEEFVYMTEN 329

Query: 262 GYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GYT++EILK ER +L T+DF +  Y +P +++RR SKAD +D+Q RT++K+LME++L+D+
Sbjct: 330 GYTKDEILKGERIILQTLDFAISSYCSPYSWVRRISKADDYDVQTRTLSKFLMEVTLLDH 389

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT-KH 379
           +FL   PSMIAA  +YL+RKML   +W+   I+YS +T               ++P  + 
Sbjct: 390 RFLRCKPSMIAAIGMYLARKMLG-GDWNDAFIYYSNFTESQLITGASLLCERLVEPDFES 448

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKN 405
             +YKKYA K+F++AS F +DW   N
Sbjct: 449 VYVYKKYANKKFLRASTFARDWALTN 474



>gi|320037767|gb|EFW19704.1| G2/mitotic-specific cyclin-B1 [Coccidioides posadasii str.
           Silveira]
          Length = 645

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 188/265 (70%), Gaps = 5/265 (1%)

Query: 136 QDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWL 195
           QD+E+    +  DP M++EY  +IF Y++ LE ++MP P YM +Q+E+ W MR +L+DW+
Sbjct: 352 QDYEE----ECSDPTMVAEYGDEIFDYMRKLEIKLMPNPHYMDTQAEIQWSMRSVLMDWI 407

Query: 196 IEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNF 255
           ++VH +F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS++  
Sbjct: 408 VQVHLRFNLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSVQEI 467

Query: 256 IYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEI 315
           +YM DNGYT EEILKAER++L+ + F+L +P PMNFLRR SKAD +D++ RT+AKY +EI
Sbjct: 468 VYMVDNGYTAEEILKAERFMLSLLQFELGWPGPMNFLRRISKADDYDLETRTLAKYFLEI 527

Query: 316 SLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMK 375
           +++D +F+  PPS +AAAA  L+R ML + +W A  +HYS+YT                 
Sbjct: 528 TIMDERFVGSPPSFVAAAAHCLARMMLRKGDWGAAHVHYSKYTYSQLYPVMKLMFECCDA 587

Query: 376 PTKHE-QLYKKYAAKRFMKASIFVK 399
           P +H   +Y+KY+ +RF +A+ F +
Sbjct: 588 PQRHHPAIYEKYSDRRFKRAASFAE 612



>gi|303314823|ref|XP_003067420.1| cyclin domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240107088|gb|EER25275.1| cyclin domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 645

 Score =  290 bits (743), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 132/265 (49%), Positives = 188/265 (70%), Gaps = 5/265 (1%)

Query: 136 QDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWL 195
           QD+E+    +  DP M++EY  +IF Y++ LE ++MP P YM +Q+E+ W MR +L+DW+
Sbjct: 352 QDYEE----ECSDPTMVAEYGDEIFDYMRKLEIKLMPNPHYMDTQAEIQWSMRSVLMDWI 407

Query: 196 IEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNF 255
           ++VH +F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS++  
Sbjct: 408 VQVHLRFNLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSVQEI 467

Query: 256 IYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEI 315
           +YM DNGYT EEILKAER++L+ + F+L +P PMNFLRR SKAD +D++ RT+AKY +EI
Sbjct: 468 VYMVDNGYTAEEILKAERFMLSLLQFELGWPGPMNFLRRISKADDYDLETRTLAKYFLEI 527

Query: 316 SLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMK 375
           +++D +F+  PPS +AAAA  L+R ML + +W A  +HYS+YT                 
Sbjct: 528 TIMDERFVGSPPSFVAAAAHCLARMMLRKGDWGAAHVHYSKYTYSQLYPVMKLMFECCDA 587

Query: 376 PTKHE-QLYKKYAAKRFMKASIFVK 399
           P +H   +Y+KY+ +RF +A+ F +
Sbjct: 588 PQRHHPAIYEKYSDRRFKRAASFAE 612



>gi|388853627|emb|CCF52799.1| probable b-type cyclin 2 [Ustilago hordei]
          Length = 606

 Score =  290 bits (743), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 193/267 (72%), Gaps = 3/267 (1%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD D+  D  M++EY+ +IF Y+   E E M  P+YM  QSE+ W MR  LVDWL++VH 
Sbjct: 320 LDPDEVRDTSMVAEYSNEIFTYMARCERETMANPNYMDFQSEIHWHMRATLVDWLLQVHM 379

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           ++ +LPETL++A+N++DRFLSVRVVSL KLQLVG+T +FIAAKYEE+LAPS+K F+YM +
Sbjct: 380 RYHMLPETLWIAINVVDRFLSVRVVSLAKLQLVGVTAMFIAAKYEEILAPSVKEFVYMTE 439

Query: 261 NGYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
            GY++EEILK ER +L+T+DF +  Y +P +++RR SKAD +DI+ RT++K+LME++L+D
Sbjct: 440 GGYSQEEILKGERIILSTLDFNVSSYCSPYSWVRRISKADDYDIRTRTLSKFLMELALLD 499

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++FL   PS+IAA  ++L++KML   +W    ++YS +T               + P   
Sbjct: 500 HRFLRARPSLIAAVGMFLAKKMLG-GDWDDAFVYYSDFTEEQLVPGANLLLERLLDPGFE 558

Query: 380 EQ-LYKKYAAKRFMKASIFVKDWISKN 405
           EQ +Y+KYA K+F+KAS+F +DW  +N
Sbjct: 559 EQFVYRKYANKKFLKASVFARDWAYQN 585



>gi|366988667|ref|XP_003674101.1| hypothetical protein NCAS_0A11620 [Naumovozyma castellii CBS 4309]
 gi|342299964|emb|CCC67720.1| hypothetical protein NCAS_0A11620 [Naumovozyma castellii CBS 4309]
          Length = 479

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 137/266 (51%), Positives = 187/266 (70%), Gaps = 2/266 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +WEDLDA+D  DP M+SEY  DIF YL  LE   +P  + +     ++ + R ILV+WL+
Sbjct: 198 EWEDLDAEDVNDPFMVSEYVNDIFDYLYHLEVVTLPNKEDLKKHKNIN-QNRDILVNWLV 256

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           ++H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG + LFIA+KYEE+ +PSIK++ 
Sbjct: 257 KIHNKFGLLPETLYLAINIMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHYA 316

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
              D   TEEEI + E+++L T++F L YPNPMNFLRR SKAD +DIQ+RT+AK+L+EIS
Sbjct: 317 SETDGACTEEEIKEGEKFILKTLEFTLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEIS 376

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMK 375
           LVD++F+ + PS+ AAAA++LSRKML +  W  NLIHYS  YT               + 
Sbjct: 377 LVDFRFIGILPSLCAAAAMFLSRKMLGKGGWDGNLIHYSGGYTKEQLDPVCNMIMDYLVS 436

Query: 376 PTKHEQLYKKYAAKRFMKASIFVKDW 401
           P  H++ ++KY ++RFMKASI    W
Sbjct: 437 PIVHDEFHRKYQSRRFMKASIISVQW 462



>gi|6325376|ref|NP_015444.1| Clb2p [Saccharomyces cerevisiae S288c]
 gi|116164|sp|P24869.1|CG22_YEAST RecName: Full=G2/mitotic-specific cyclin-2
 gi|5500|emb|CAA44195.1| CLB2 [Saccharomyces cerevisiae]
 gi|171237|gb|AAA34502.1| G2-specific B-type cyclin-like protein [Saccharomyces cerevisiae]
 gi|1066473|gb|AAB68060.1| Clb2p: G2/Mitotic-specific cyclin 2 (Swiss Prot. accession number
           P24869) [Saccharomyces cerevisiae]
 gi|151942896|gb|EDN61242.1| B-type cyclin [Saccharomyces cerevisiae YJM789]
 gi|190408046|gb|EDV11311.1| G2/mitotic-specific cyclin-2 [Saccharomyces cerevisiae RM11-1a]
 gi|256273401|gb|EEU08338.1| Clb2p [Saccharomyces cerevisiae JAY291]
 gi|259150269|emb|CAY87072.1| Clb2p [Saccharomyces cerevisiae EC1118]
 gi|285815642|tpg|DAA11534.1| TPA: Clb2p [Saccharomyces cerevisiae S288c]
 gi|323331351|gb|EGA72769.1| Clb2p [Saccharomyces cerevisiae AWRI796]
 gi|323335184|gb|EGA76474.1| Clb2p [Saccharomyces cerevisiae Vin13]
 gi|323350244|gb|EGA84391.1| Clb2p [Saccharomyces cerevisiae VL3]
 gi|349581922|dbj|GAA27079.1| K7_Clb2p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|365762586|gb|EHN04120.1| Clb2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392296123|gb|EIW07226.1| Clb2p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 491

 Score =  290 bits (741), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 137/266 (51%), Positives = 188/266 (70%), Gaps = 2/266 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +WEDLDA+D  DP M+SEY  DIF+YL  LE   +PK + +     +  + R ILV+WL+
Sbjct: 211 EWEDLDAEDVNDPFMVSEYVNDIFEYLHQLEVITLPKKEDLYQHRNIH-QNRDILVNWLV 269

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           ++H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG + LFIA+KYEE+ +PSIK+F 
Sbjct: 270 KIHNKFGLLPETLYLAINIMDRFLGKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFA 329

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
              D   TE+EI + E+++L T+ F L YPNPMNFLRR SKAD +DIQ+RT+AK+L+EIS
Sbjct: 330 SETDGACTEDEIKEGEKFILKTLKFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEIS 389

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMK 375
           LVD++F+ + PS+ AAAA+++SRKML + +W  NLIHYS  YT               + 
Sbjct: 390 LVDFRFIGILPSLCAAAAMFMSRKMLGKGKWDGNLIHYSGGYTKEELAPVCHMIMDYLVS 449

Query: 376 PTKHEQLYKKYAAKRFMKASIFVKDW 401
           P  H++ ++KY ++RFMKASI    W
Sbjct: 450 PIVHDEFHRKYQSRRFMKASIISVQW 475



>gi|393242173|gb|EJD49692.1| hypothetical protein AURDEDRAFT_59334 [Auricularia delicata
           TFB-10046 SS5]
          Length = 317

 Score =  289 bits (740), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 193/263 (73%), Gaps = 3/263 (1%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           +D  D  DP M+SEYA +IFKY++++E   MP PDY+  QSE++W MR  LVDWL++VH 
Sbjct: 49  VDHVDAEDPAMVSEYADEIFKYMEEIEIGTMPNPDYIQGQSEITWDMRQTLVDWLLQVHM 108

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           ++ +LPETL++AVNI+DRFL+ RVVSL+KLQLVG+T +FIAAKYEE+LAPS++ F+YM D
Sbjct: 109 RYHMLPETLWIAVNIVDRFLTKRVVSLIKLQLVGVTAMFIAAKYEEVLAPSVEEFVYMTD 168

Query: 261 NGYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
            GY+ EEILK ER +L T++F++  Y +P +++R+ SKAD +DIQ RT++K++ME++L+D
Sbjct: 169 KGYSREEILKGERIILQTLEFRVSSYCSPYSWVRKISKADDYDIQTRTLSKFIMEVTLLD 228

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++FL   PS+IAA  +Y SR+ML   +W    ++YS YT                +P   
Sbjct: 229 HRFLRAKPSLIAAVGMYSSRRMLG-GDWGDAFVYYSGYTAEQLEQGHQYIVEKLAEPAFE 287

Query: 380 EQ-LYKKYAAKRFMKASIFVKDW 401
            Q +YKKYA KRF+KAS+F +DW
Sbjct: 288 TQYVYKKYANKRFLKASLFARDW 310



>gi|388579640|gb|EIM19962.1| hypothetical protein WALSEDRAFT_30034 [Wallemia sebi CBS 633.66]
          Length = 449

 Score =  289 bits (740), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 158/370 (42%), Positives = 232/370 (62%), Gaps = 24/370 (6%)

Query: 46  VTAIPQKKLGVVTRKRAVLMDRTNVSLKQNSVNEQTHDI---------TKPIIKENVNLG 96
           V++IPQ KL +V     + +   +  +  + V++   DI           P   E V LG
Sbjct: 85  VSSIPQTKLRIVQPTSKLQVYNEDDQMSDDEVDDGPPDIDLTDEEDEVVSPEEAEEV-LG 143

Query: 97  ---FQDIRSKEKHELSFDTTLATTAESEIYEFDRKRSKKQKTQDWEDLDADDFYDPMMIS 153
               QDI  +++ E     T      S I E +R +S  +     ED D   F+D  M++
Sbjct: 144 DDDEQDIMEEDQIEDEDWVTKHVEVPSLIEEVNRVQSNYK-----EDFD---FWDTTMVA 195

Query: 154 EYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAV 213
           EYA +IF Y+ + E E M  P+YM  QSE+ W MR  L+DWL++VH ++ +LPETL++A+
Sbjct: 196 EYAPEIFSYMCEQEIETMANPNYMEFQSEIEWSMRSTLIDWLLQVHLRYHMLPETLWIAI 255

Query: 214 NIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAER 273
           NIIDRFLSVRVVSLVKLQLVG+T +FIAAKYEE+LAPS+  F+YM +NGYT EEILK ER
Sbjct: 256 NIIDRFLSVRVVSLVKLQLVGVTAMFIAAKYEEILAPSVDEFVYMTENGYTREEILKGER 315

Query: 274 YVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAA 332
            +L T++F +  Y +P  ++RR SKAD++DIQ RT++K++ME++L+D +F+   PS+IAA
Sbjct: 316 IILQTLNFSISSYSSPYTWVRRISKADNYDIQTRTLSKFIMEVALLDNRFIRARPSLIAA 375

Query: 333 AALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQL-YKKYAAKRF 391
             +Y SR ML   +W+ + ++YS ++               ++P   +Q  YKKY+ ++F
Sbjct: 376 VGMYASRVMLG-GDWNEDFVYYSGFSESQLETPMDFIIEKLIQPDFDQQFCYKKYSNRKF 434

Query: 392 MKASIFVKDW 401
           +KASIF +DW
Sbjct: 435 LKASIFARDW 444



>gi|343429395|emb|CBQ72968.1| b-type cyclin 2 [Sporisorium reilianum SRZ2]
          Length = 600

 Score =  289 bits (740), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 130/267 (48%), Positives = 193/267 (72%), Gaps = 3/267 (1%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD ++  D  M++EY+ +IF Y+   E E M  P+YM  QSE+ W MR  LVDWL++VH 
Sbjct: 314 LDPEEVRDTSMVAEYSQEIFSYMARCERETMANPNYMDFQSEIHWHMRATLVDWLLQVHM 373

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           ++ +LPETL++A+N++DRFLSVRVVSL KLQLVG+T +FIAAKYEE+LAPS+K F+YM +
Sbjct: 374 RYHMLPETLWIAINVVDRFLSVRVVSLAKLQLVGVTAMFIAAKYEEILAPSVKEFVYMTE 433

Query: 261 NGYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
            GY++EEILK ER +L+T+DF +  Y +P +++R+ SKAD +DI+ RT++K+LME++L+D
Sbjct: 434 GGYSQEEILKGERIILSTLDFNISSYCSPYSWVRKISKADDYDIRTRTLSKFLMELALLD 493

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++FL   PS++AA  ++L++KML   EW    ++YS +T               + P   
Sbjct: 494 HRFLRARPSLVAAVGMFLAKKMLG-GEWDDAFVYYSDFTEEQLVPGANLLLERLLDPGFE 552

Query: 380 EQ-LYKKYAAKRFMKASIFVKDWISKN 405
           EQ +Y+KYA K+F+KAS+F +DW  +N
Sbjct: 553 EQFVYRKYANKKFLKASVFARDWAYQN 579



>gi|296419994|ref|XP_002839571.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295635743|emb|CAZ83762.1| unnamed protein product [Tuber melanosporum]
          Length = 236

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 133/219 (60%), Positives = 169/219 (77%)

Query: 187 MRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEE 246
           MRGILVDWLIEVH +FRLLPETLFLAVNI+DRFLS ++V L KLQLVG+T +FIAAKYEE
Sbjct: 1   MRGILVDWLIEVHTRFRLLPETLFLAVNIVDRFLSAKIVELDKLQLVGVTAMFIAAKYEE 60

Query: 247 LLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQAR 306
           + +P ++ F  +AD+G+TEEEIL+AERY+LTT+++ L YPNPMNFLRR SKAD +D + R
Sbjct: 61  VFSPGVQYFRSVADDGFTEEEILQAERYILTTLNYNLSYPNPMNFLRRISKADQYDYETR 120

Query: 307 TVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXX 366
           TVAKYL+EISL+D++F+   PS ++AAA+YLSR ML R  W A+L+HYS YT        
Sbjct: 121 TVAKYLLEISLLDHRFMGYAPSHVSAAAMYLSRMMLERGPWDADLVHYSDYTEEEVLPVF 180

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKN 405
                   +P KHE  +KKYA+K+FMKASI  + W  +N
Sbjct: 181 RLMIDYLARPVKHEAFFKKYASKKFMKASIHARQWAKRN 219



>gi|426199341|gb|EKV49266.1| hypothetical protein AGABI2DRAFT_134807 [Agaricus bisporus var.
           bisporus H97]
          Length = 449

 Score =  288 bits (738), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 135/267 (50%), Positives = 194/267 (72%), Gaps = 3/267 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D YD  M+SEYA DIF+Y+ DLE E MP+PDYM +QSE++W MR  LVDWL++VH +
Sbjct: 171 DEVDTYDTTMVSEYAEDIFEYMCDLEEESMPQPDYMINQSEITWEMRQTLVDWLLQVHFR 230

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++A+NI+DRFLS RVVSL KLQLVG+T +FIAAKYEE+LAPS+  F++M +N
Sbjct: 231 YHMLPETLWIAINIVDRFLSRRVVSLGKLQLVGVTAMFIAAKYEEILAPSVDEFVFMTEN 290

Query: 262 GYTEEEILKAERYVLTTIDFKLC-YPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GYT++EILK ER VL T++F++  Y +P +++R+ SKAD +DIQ RT++K+L E++L+D+
Sbjct: 291 GYTKDEILKGERIVLQTLEFQISHYCSPYSWMRKISKADDYDIQTRTLSKFLTEVTLLDH 350

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           +FL + PS++AA  +Y +RKML   +W+   + YS +T                +     
Sbjct: 351 RFLRVKPSLVAAIGMYCARKMLG-GDWNEAFVFYSGFTEEQLQPGHQLLVEKLAETGFSR 409

Query: 381 Q-LYKKYAAKRFMKASIFVKDWISKNV 406
           Q + KKYA K+F+KAS+F  DW  ++V
Sbjct: 410 QYVCKKYANKKFLKASVFAVDWAKQHV 436



>gi|401623164|gb|EJS41271.1| clb2p [Saccharomyces arboricola H-6]
          Length = 492

 Score =  288 bits (738), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 137/266 (51%), Positives = 187/266 (70%), Gaps = 2/266 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +WEDLDA+D  DP M+SEY  DIF+YL  LE   +PK + +     +  + R ILV+WL+
Sbjct: 212 EWEDLDAEDVNDPFMVSEYVNDIFEYLHQLEVITLPKKEDLYQHRNIH-QNRDILVNWLV 270

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           ++H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG + LFIA+KYEE+ +PSIK+F 
Sbjct: 271 KIHNKFGLLPETLYLAINIMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFA 330

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
              D   TEEEI + E+++L T+ F L YPNPMNFLRR SKAD +DIQ+RT+AK+L+EIS
Sbjct: 331 SETDGACTEEEIKEGEKFILKTLKFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEIS 390

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMK 375
           LVD++F+ + PS+ AAAA+++SRKML + +W  NLIHYS  YT               + 
Sbjct: 391 LVDFRFIGILPSLCAAAAMFMSRKMLGKGKWDGNLIHYSGGYTKEELAPVCHMIMDYLVS 450

Query: 376 PTKHEQLYKKYAAKRFMKASIFVKDW 401
              H++ ++KY ++RFMKASI    W
Sbjct: 451 SIVHDEFHRKYQSRRFMKASIISVQW 476



>gi|255714853|ref|XP_002553708.1| KLTH0E05192p [Lachancea thermotolerans]
 gi|238935090|emb|CAR23271.1| KLTH0E05192p [Lachancea thermotolerans CBS 6340]
          Length = 487

 Score =  288 bits (738), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 138/280 (49%), Positives = 193/280 (68%), Gaps = 2/280 (0%)

Query: 128 KRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRM 187
           K   K    +WEDLDA+D  DP M+SEY  DIF+YL  LE   +P    +   S +  + 
Sbjct: 196 KVCAKGTEYEWEDLDAEDINDPFMVSEYVNDIFEYLHKLEIMTLPNRHDLYKHSNIR-QN 254

Query: 188 RGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEEL 247
           R ILV+W++++H+KF LLPETL+L++NI+DRFL   +V L KLQLVG   LFIA+KYEE+
Sbjct: 255 RDILVNWMVKIHNKFGLLPETLYLSLNIMDRFLCRELVQLEKLQLVGTACLFIASKYEEV 314

Query: 248 LAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQART 307
            +PS+K+F Y  D    E+EI + E+++L T++F L YPNPMNFLRR SKAD +DIQ+RT
Sbjct: 315 YSPSVKHFAYETDGACDEDEIREGEKFILKTLEFNLNYPNPMNFLRRISKADDYDIQSRT 374

Query: 308 VAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXX 366
           +AKYL+EIS+VD++F+ + PS+ AA A++LSRKML + +W  NLIHYS  YT        
Sbjct: 375 LAKYLLEISVVDFRFIGVLPSLCAATAMFLSRKMLGKGKWDGNLIHYSGGYTREELAPVC 434

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISKNV 406
                  ++P  H++ +KKYA+++FMKAS+  + W  K V
Sbjct: 435 NMVMDYLVQPVVHDEFFKKYASRKFMKASVISRQWAKKVV 474



>gi|409078350|gb|EKM78713.1| hypothetical protein AGABI1DRAFT_85626 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 449

 Score =  288 bits (738), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 135/267 (50%), Positives = 193/267 (72%), Gaps = 3/267 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D YD  M+SEYA DIF+Y+ DLE E MP+PDYM +QSE++W MR  LVDWL++VH +
Sbjct: 171 DEVDTYDTTMVSEYAEDIFEYMCDLEEESMPQPDYMINQSEITWEMRQTLVDWLLQVHFR 230

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++A+NI+DRFLS RVVSL KLQLVG+T +FIAAKYEE+LAPS+  F++M +N
Sbjct: 231 YHMLPETLWIAINIVDRFLSRRVVSLGKLQLVGVTAMFIAAKYEEILAPSVDEFVFMTEN 290

Query: 262 GYTEEEILKAERYVLTTIDFKLC-YPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GYT++EILK ER VL T++F++  Y +P +++R+ SKAD +DIQ RT++K+L E++L+D+
Sbjct: 291 GYTKDEILKGERIVLQTLEFQISHYCSPYSWMRKISKADDYDIQTRTLSKFLTEVTLLDH 350

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           +FL + PS++AA  +Y +RKML   +W+   + YS +T                      
Sbjct: 351 RFLRVKPSLVAAIGMYCARKMLG-GDWNEAFVFYSGFTEEQLQPGHQLLVEKLAGTGFSR 409

Query: 381 Q-LYKKYAAKRFMKASIFVKDWISKNV 406
           Q + KKYA K+F+KAS+F  DW  ++V
Sbjct: 410 QYVCKKYANKKFLKASVFAVDWAKQHV 436



>gi|403213919|emb|CCK68421.1| hypothetical protein KNAG_0A07680 [Kazachstania naganishii CBS
           8797]
          Length = 448

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 137/265 (51%), Positives = 185/265 (69%), Gaps = 2/265 (0%)

Query: 138 WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIE 197
           WEDLDA+D  DP M+SEY  DIF+YL  LE   +PK D +     +  + R ILV+WL++
Sbjct: 167 WEDLDAEDVNDPFMVSEYVNDIFEYLHRLEIITLPKKDDLYKHRNIR-QNRDILVNWLVK 225

Query: 198 VHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIY 257
           +H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG + LFIA+KYEE+ +PSIK+F  
Sbjct: 226 IHNKFGLLPETLYLAINIMDRFLCRELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFAS 285

Query: 258 MADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISL 317
             D   TEEEI + E+++L T++  L YPNPMNFLRR SKAD +DIQ+RT+AK+L+EISL
Sbjct: 286 ETDGACTEEEIKEGEKFILKTLEMNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEISL 345

Query: 318 VDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHY-SQYTXXXXXXXXXXXXXXXMKP 376
           VD++F+ + PS+ AAAA++LSRKML + +W  NLIHY   YT                 P
Sbjct: 346 VDFRFIGMLPSLCAAAAMFLSRKMLGKGKWDGNLIHYCGGYTKTQLAPVCDMIMDYLTSP 405

Query: 377 TKHEQLYKKYAAKRFMKASIFVKDW 401
             H++ ++KY ++RFMKAS+    W
Sbjct: 406 IVHDEFHRKYQSRRFMKASVISVQW 430



>gi|344233975|gb|EGV65845.1| hypothetical protein CANTEDRAFT_118639 [Candida tenuis ATCC 10573]
          Length = 446

 Score =  288 bits (736), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 184/258 (71%), Gaps = 2/258 (0%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M+SEY  +I+ YL +LE + +P P Y+  Q  L  +MR ILVDWL+E+H +FRLLPET
Sbjct: 175 PLMVSEYVNEIYPYLHELECKTLPDPQYIFKQRHLKPKMRSILVDWLVEMHSRFRLLPET 234

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
            +LA+NI+DRF+S+ +V + KLQL+    LFIAAKYEE+ +PS+KN+ Y  D  + EEEI
Sbjct: 235 FYLAINIMDRFMSLEIVQIDKLQLLATGSLFIAAKYEEVFSPSVKNYSYFTDGSFAEEEI 294

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L+AE+Y+LT ++F+L YPNPMNFLRR SKAD +D+Q RT+ KYL+E+++VDYKF+ + PS
Sbjct: 295 LQAEKYILTILEFELNYPNPMNFLRRISKADDYDVQTRTLGKYLLEVTVVDYKFIGMLPS 354

Query: 329 MIAAAALYLSRKMLNRSE-WHANLIHYS-QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKY 386
           + AA+A+Y+ R ++ +   W+ NLIHYS  Y                + P +H++ +KKY
Sbjct: 355 LCAASAMYIGRSIMGKFPLWNGNLIHYSGGYKVEDMKDCINMIIQYLISPVEHDEFFKKY 414

Query: 387 AAKRFMKASIFVKDWISK 404
           + K+FMKASI  + W  K
Sbjct: 415 STKKFMKASILCRSWAKK 432



>gi|150864121|ref|XP_001382825.2| G2/mitotic-specific cyclin [Scheffersomyces stipitis CBS 6054]
 gi|149385377|gb|ABN64796.2| G2/mitotic-specific cyclin [Scheffersomyces stipitis CBS 6054]
          Length = 464

 Score =  287 bits (735), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 141/278 (50%), Positives = 194/278 (69%), Gaps = 4/278 (1%)

Query: 131 KKQKTQD--WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMR 188
           KK K  D  W+DLD +D  DP+M SEY  DI  Y  +LE  ++P P Y+  Q  L  +MR
Sbjct: 165 KKSKLIDYEWQDLDEEDLDDPLMASEYVNDIMHYFYELERRMLPDPQYLFRQRHLKPKMR 224

Query: 189 GILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELL 248
            ILVDWL+E+H KFRLLPE+LFLA+N++DRF+S+ VV + KLQL+    LFIAAKYEE+ 
Sbjct: 225 SILVDWLVEMHLKFRLLPESLFLAINLMDRFMSLEVVQIDKLQLLATGSLFIAAKYEEVF 284

Query: 249 APSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTV 308
           +PS+KN+ Y  D  Y+E+EIL+AE+Y+LT ++F L YPNPMNFLRR SKAD +D+Q+RT+
Sbjct: 285 SPSVKNYAYFTDGSYSEDEILQAEKYILTVLNFDLNYPNPMNFLRRISKADDYDVQSRTL 344

Query: 309 AKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSE-WHANLIHYS-QYTXXXXXXXX 366
            KYL+EI+ +DYKF+   PS+  A+A+YL+R +L +S  W+ NLIHYS  Y         
Sbjct: 345 GKYLLEITAIDYKFIGYKPSLCCASAMYLARLILGKSPVWNGNLIHYSGGYRVNNMKVCV 404

Query: 367 XXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
                  + P +H++ +KKYA ++FMKAS+  + W  K
Sbjct: 405 EMIFQYLISPVEHDEFFKKYATRKFMKASMLCRSWAKK 442



>gi|344233976|gb|EGV65846.1| A/B/D/E cyclin [Candida tenuis ATCC 10573]
          Length = 442

 Score =  287 bits (735), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 184/258 (71%), Gaps = 2/258 (0%)

Query: 149 PMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPET 208
           P+M+SEY  +I+ YL +LE + +P P Y+  Q  L  +MR ILVDWL+E+H +FRLLPET
Sbjct: 171 PLMVSEYVNEIYPYLHELECKTLPDPQYIFKQRHLKPKMRSILVDWLVEMHSRFRLLPET 230

Query: 209 LFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEI 268
            +LA+NI+DRF+S+ +V + KLQL+    LFIAAKYEE+ +PS+KN+ Y  D  + EEEI
Sbjct: 231 FYLAINIMDRFMSLEIVQIDKLQLLATGSLFIAAKYEEVFSPSVKNYSYFTDGSFAEEEI 290

Query: 269 LKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPS 328
           L+AE+Y+LT ++F+L YPNPMNFLRR SKAD +D+Q RT+ KYL+E+++VDYKF+ + PS
Sbjct: 291 LQAEKYILTILEFELNYPNPMNFLRRISKADDYDVQTRTLGKYLLEVTVVDYKFIGMLPS 350

Query: 329 MIAAAALYLSRKMLNRSE-WHANLIHYS-QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKY 386
           + AA+A+Y+ R ++ +   W+ NLIHYS  Y                + P +H++ +KKY
Sbjct: 351 LCAASAMYIGRSIMGKFPLWNGNLIHYSGGYKVEDMKDCINMIIQYLISPVEHDEFFKKY 410

Query: 387 AAKRFMKASIFVKDWISK 404
           + K+FMKASI  + W  K
Sbjct: 411 STKKFMKASILCRSWAKK 428



>gi|238488495|ref|XP_002375485.1| G2/mitotic-specific cyclin (Clb3), putative [Aspergillus flavus
           NRRL3357]
 gi|220697873|gb|EED54213.1| G2/mitotic-specific cyclin (Clb3), putative [Aspergillus flavus
           NRRL3357]
          Length = 604

 Score =  287 bits (735), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 131/274 (47%), Positives = 190/274 (69%), Gaps = 2/274 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+++D  M++EY+ DIF Y+++ E +++P   YM +Q+E+ W MR +L+
Sbjct: 305 EATRTVEDIE-DEYWDTSMVAEYSEDIFDYMREQEIKMLPNAHYMDNQAEIQWSMRSVLM 363

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 364 DWLVQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSV 423

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM D GYT +EILKAER++LT + F+L +P PM+FLR+ SKAD +D++ RT+AKY 
Sbjct: 424 QEIVYMVDGGYTADEILKAERFMLTMLQFELGWPGPMSFLRKISKADDYDLETRTLAKYF 483

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI+++D +F+  PPS  AA A  L+R ML +  W    +HY+ YT              
Sbjct: 484 LEITIMDERFVGCPPSFTAAGAHCLARMMLRKGNWTPAHVHYAGYTYSQLYPLISLMVEC 543

Query: 373 XMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKN 405
              P KH   +Y+KY  KRF +AS+FV+  + K 
Sbjct: 544 CEIPRKHHAAIYEKYTDKRFKRASLFVEAEMRKG 577



>gi|317136730|ref|XP_001727241.2| G2/mitotic-specific cyclin [Aspergillus oryzae RIB40]
          Length = 621

 Score =  287 bits (735), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 131/274 (47%), Positives = 190/274 (69%), Gaps = 2/274 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+++D  M++EY+ DIF Y+++ E +++P   YM +Q+E+ W MR +L+
Sbjct: 322 EATRTVEDIE-DEYWDTSMVAEYSEDIFDYMREQEIKMLPNAHYMDNQAEIQWSMRSVLM 380

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 381 DWLVQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSV 440

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM D GYT +EILKAER++LT + F+L +P PM+FLR+ SKAD +D++ RT+AKY 
Sbjct: 441 QEIVYMVDGGYTADEILKAERFMLTMLQFELGWPGPMSFLRKISKADDYDLETRTLAKYF 500

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI+++D +F+  PPS  AA A  L+R ML +  W    +HY+ YT              
Sbjct: 501 LEITIMDERFVGCPPSFTAAGAHCLARMMLRKGNWTPAHVHYAGYTYSQLYPLISLMVEC 560

Query: 373 XMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKN 405
              P KH   +Y+KY  KRF +AS+FV+  + K 
Sbjct: 561 CEIPRKHHAAIYEKYTDKRFKRASLFVEAEMRKG 594



>gi|83770269|dbj|BAE60402.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391866857|gb|EIT76125.1| cyclin B [Aspergillus oryzae 3.042]
          Length = 641

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 131/274 (47%), Positives = 190/274 (69%), Gaps = 2/274 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+++D  M++EY+ DIF Y+++ E +++P   YM +Q+E+ W MR +L+
Sbjct: 342 EATRTVEDIE-DEYWDTSMVAEYSEDIFDYMREQEIKMLPNAHYMDNQAEIQWSMRSVLM 400

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 401 DWLVQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSV 460

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM D GYT +EILKAER++LT + F+L +P PM+FLR+ SKAD +D++ RT+AKY 
Sbjct: 461 QEIVYMVDGGYTADEILKAERFMLTMLQFELGWPGPMSFLRKISKADDYDLETRTLAKYF 520

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI+++D +F+  PPS  AA A  L+R ML +  W    +HY+ YT              
Sbjct: 521 LEITIMDERFVGCPPSFTAAGAHCLARMMLRKGNWTPAHVHYAGYTYSQLYPLISLMVEC 580

Query: 373 XMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKN 405
              P KH   +Y+KY  KRF +AS+FV+  + K 
Sbjct: 581 CEIPRKHHAAIYEKYTDKRFKRASLFVEAEMRKG 614



>gi|392574233|gb|EIW67370.1| hypothetical protein TREMEDRAFT_40507 [Tremella mesenterica DSM
           1558]
          Length = 470

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 130/266 (48%), Positives = 198/266 (74%), Gaps = 3/266 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D +D  M++EYA +IF+++++LE  +MP P YM  Q+E+ W MR  L+DWL++VH +
Sbjct: 201 DDVDMFDTTMVAEYADEIFQHMENLEQSVMPNPRYMDFQTEIEWTMRSTLIDWLLQVHLR 260

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++AVN++DRFLSVRVVSLVKLQLVG+T +FIAAKYEE+LAPS++ F++M ++
Sbjct: 261 YHMLPETLWIAVNLVDRFLSVRVVSLVKLQLVGVTAMFIAAKYEEILAPSVEEFVFMTES 320

Query: 262 GYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GYT++EILK ER +L T+DF +  Y +P +++RR SKAD +DIQ RT++K+LME++L+D+
Sbjct: 321 GYTKDEILKGERIILQTLDFTISSYCSPYSWVRRISKADDYDIQTRTLSKFLMEVTLLDH 380

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT-KH 379
           +FL   PSMIAA  +YL+R+MLN  +W+   ++YS +T               ++P+ + 
Sbjct: 381 RFLRCRPSMIAAVGMYLARRMLN-GDWNDAFVYYSGFTEVQLVPGAMLLCERLVEPSFEG 439

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKN 405
              YKKY+ K+F++AS F ++W  K+
Sbjct: 440 VYAYKKYSNKKFLRASTFAREWAMKH 465



>gi|367015716|ref|XP_003682357.1| hypothetical protein TDEL_0F03350 [Torulaspora delbrueckii]
 gi|359750019|emb|CCE93146.1| hypothetical protein TDEL_0F03350 [Torulaspora delbrueckii]
          Length = 476

 Score =  287 bits (734), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 187/266 (70%), Gaps = 2/266 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +WEDLDA+D  DP M+SEY  +IF+YL  LE   +P+ + +     +  + R ILV+WL+
Sbjct: 196 EWEDLDAEDSNDPFMVSEYVNEIFEYLSHLEVVTLPREEDLYKHRNIR-QNRDILVNWLV 254

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           ++H+KF LLPETL+LA+N +DRFL   +V L KLQLVG + LFIA+KYEE+ +PSIK+F 
Sbjct: 255 KIHNKFGLLPETLYLAINTMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFA 314

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
              D   TEEEI + E+++L T+ F L YPNPMNFLRR SKAD +DIQ+RT+AK+L+EIS
Sbjct: 315 SETDGACTEEEIKEGEKFILKTLSFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEIS 374

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMK 375
           LVD++F+ + PS+ AAAA++LSRKML + +W  NLIHYS  YT               + 
Sbjct: 375 LVDFRFIGILPSLCAAAAMFLSRKMLGKGKWDGNLIHYSGGYTKAQLAPVCHMLMDYLVS 434

Query: 376 PTKHEQLYKKYAAKRFMKASIFVKDW 401
           P  H++ ++KY ++RFMKASI    W
Sbjct: 435 PIVHDEFHRKYQSRRFMKASIISVQW 460



>gi|505760579|gb|EOR04644.1| G2/mitotic-specific cyclin cdc13 [Wallemia ichthyophaga EXF-994]
          Length = 461

 Score =  286 bits (733), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 136/269 (50%), Positives = 191/269 (71%), Gaps = 6/269 (2%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           EDLD   F+D  M++EYA +IF Y+ + E E M  P YM  QSE+ W MR  L+DWL++V
Sbjct: 196 EDLD---FWDTTMVAEYAPEIFSYMCEQEIETMANPHYMDFQSEIEWSMRSTLIDWLLQV 252

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H ++ +LPETL++A+NIIDRFLSVRVVSLVKLQLVG+T +FIAAKYEE+LAPS+  F+YM
Sbjct: 253 HLRYHMLPETLWIAINIIDRFLSVRVVSLVKLQLVGVTAMFIAAKYEEILAPSVDEFVYM 312

Query: 259 ADNGYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISL 317
            +NGYT EEILK ER +L T++F +  Y +P  ++RR SKAD +DIQ RT++K++ME++L
Sbjct: 313 TENGYTREEILKGERIILQTLNFSVSSYSSPYTWVRRISKADDYDIQTRTLSKFIMEVAL 372

Query: 318 VDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT 377
           +D++FL   PS+ AA  +Y+SR ML   +W+ + ++YS ++                +P 
Sbjct: 373 LDHRFLRARPSLTAAVGMYVSRLMLG-GDWNEDFVYYSGFSEKQLEKPTEYILETLCQPR 431

Query: 378 KHEQL-YKKYAAKRFMKASIFVKDWISKN 405
              Q  YKKY+ K+F+KASIF +DW  K+
Sbjct: 432 FDSQFCYKKYSNKKFLKASIFARDWALKS 460



>gi|485923574|gb|EOD48693.1| putative g2 mitotic-specific cyclin protein [Neofusicoccum parvum
           UCRNP2]
          Length = 660

 Score =  286 bits (732), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 135/288 (46%), Positives = 195/288 (67%), Gaps = 2/288 (0%)

Query: 124 EFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSEL 183
           E D      + T+  ED++ D+ +D  M++EY  +IF+Y++ LE  + P P YM +Q+E+
Sbjct: 359 ELDEAAIYVEATKTPEDVE-DEAWDTSMVAEYGDEIFEYMRSLEDRMRPNPFYMDNQAEI 417

Query: 184 SWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAK 243
            W MR +L+DWL++VHH+F LLPETLFLAVN +DRFLS +VVSL KLQLVG T +F+AAK
Sbjct: 418 QWSMRSVLMDWLVQVHHRFTLLPETLFLAVNYVDRFLSCKVVSLGKLQLVGATAIFVAAK 477

Query: 244 YEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDI 303
           YEE+  PS+   +YM D GYT +EILKAER++L+ + F+L +P PM+FLRR SKAD +D+
Sbjct: 478 YEEINCPSVSEIVYMVDGGYTVDEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDL 537

Query: 304 QARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXX 363
           + RT+AKY +EI+++D +F+   PS +AA A  L+R ML + +W    +HYS YT     
Sbjct: 538 ETRTLAKYFLEITIMDERFVGCVPSFLAAGAHCLARFMLKKGDWSKAHVHYSGYTWSQLR 597

Query: 364 XXXXXXXXXXMKPTKHEQ-LYKKYAAKRFMKASIFVKDWISKNVERQQ 410
                      +P KH   +++KYA KR+ +AS+FV+  I K  +  Q
Sbjct: 598 SLVLVILECSEQPQKHHSAVFEKYADKRYKRASLFVESEIHKGFQLPQ 645



>gi|327352501|gb|EGE81358.1| G2/mitotic-specific cyclin cdc13 [Ajellomyces dermatitidis ATCC
           18188]
          Length = 674

 Score =  286 bits (732), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 133/273 (48%), Positives = 190/273 (69%), Gaps = 2/273 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+ +D  M++EY  +IF+Y+++LE  ++P   YM +Q+E+ W MR +L+
Sbjct: 374 EATRTPEDIE-DEAWDTSMVAEYGDEIFQYMRELEMRLLPNAHYMDNQAEIQWSMRSVLM 432

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 433 DWLVQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSL 492

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  IYM DNGYT +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY 
Sbjct: 493 QEIIYMVDNGYTADEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYF 552

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI+++D +F+  PPS  AA A  L+R ML +  W    ++YS YT              
Sbjct: 553 LEITIMDERFVGTPPSFTAAGAHCLARLMLRKGTWTPAHVYYSNYTYSQLYPLVSLILEC 612

Query: 373 XMKPTKHEQ-LYKKYAAKRFMKASIFVKDWISK 404
              P KH   +Y+KY+ +RF +AS FVK  + K
Sbjct: 613 CEDPMKHHSAVYEKYSDRRFKRASTFVKGEMMK 645



>gi|296416356|ref|XP_002837846.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633730|emb|CAZ82037.1| unnamed protein product [Tuber melanosporum]
          Length = 587

 Score =  286 bits (731), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 187/270 (69%), Gaps = 2/270 (0%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           E  D +D  D  M++EY  +IF+Y+++LE++++P   YM  QSE+ W MR IL+DWL++V
Sbjct: 314 EFFDDEDEGDISMVAEYGDEIFEYMRELEAKMLPNAHYMDHQSEIQWSMRAILMDWLVQV 373

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFL  N +DRFLS +VVSL KLQLVG T LF+AAKYEE+  PS+   +YM
Sbjct: 374 HTRFNLLPETLFLTSNYVDRFLSAKVVSLGKLQLVGATALFVAAKYEEINCPSVHEIVYM 433

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
            DNGYT EEILKAER++L+ + ++L +P PM+FLRR SKAD +D++ RT+AKY +EI+++
Sbjct: 434 VDNGYTAEEILKAERFMLSMLHYELGWPGPMSFLRRISKADDYDLETRTLAKYFLEITVM 493

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKP-T 377
           D +F+  PPS +AA A  L+R ML + EW      YS YT                KP T
Sbjct: 494 DERFVGSPPSFLAAGAHCLARHMLRKGEWTPAHTFYSGYTASQLEPLIHTLVECCEKPKT 553

Query: 378 KHEQLYKKYAAKRFMKASIFVKDWISKNVE 407
            H  +Y K+A +R+ +AS++V++W+ KN E
Sbjct: 554 HHGAVYDKFADRRYKRASLYVQNWM-KNEE 582



>gi|240278503|gb|EER42009.1| G2/mitotic-specific cyclin cdc13 [Ajellomyces capsulatus H143]
          Length = 660

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 188/268 (70%), Gaps = 2/268 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+ +D  M++EY+ +IF+Y+++LE  ++P   YM +Q+E+ W MR +L+
Sbjct: 360 EATRTPEDIE-DEAWDTSMVAEYSDEIFQYMRELEMRLLPNAHYMDNQAEIQWSMRSVLM 418

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 419 DWLVQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSL 478

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  IYM DNGYT +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY 
Sbjct: 479 QEIIYMVDNGYTADEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYF 538

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI++ D +F+  PPS  AA A  L+R ML +  W    ++YS YT              
Sbjct: 539 LEITITDERFVGTPPSFTAAGAHCLARLMLRKGTWTPAHVYYSNYTYSQLYPLVSLILEC 598

Query: 373 XMKPTKHEQ-LYKKYAAKRFMKASIFVK 399
              P KH   +Y+KY+ +RF +AS FVK
Sbjct: 599 CENPEKHHSAVYEKYSDRRFKRASTFVK 626



>gi|115388003|ref|XP_001211507.1| G2/mitotic-specific cyclin cdc13 [Aspergillus terreus NIH2624]
 gi|114195591|gb|EAU37291.1| G2/mitotic-specific cyclin cdc13 [Aspergillus terreus NIH2624]
          Length = 604

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 191/274 (69%), Gaps = 2/274 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+F+D  M+++Y+ DIF+Y+K+ E ++MP   YM +Q+E+ W MR +L+
Sbjct: 312 EATRTVEDIE-DEFWDTSMVADYSDDIFEYMKEQEIKMMPNAHYMDNQAEIQWSMRSVLM 370

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 371 DWLVQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSV 430

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM D GYT +EILKAER++L+ + F+L +P PM+FLR+ SKAD +D++ RT+AKY 
Sbjct: 431 QEIVYMVDGGYTVDEILKAERFMLSMLQFELGWPGPMSFLRKISKADDYDLETRTLAKYF 490

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI+++D +F+  PPS  AA A  L+R ML +  W    +HY+ YT              
Sbjct: 491 LEITIMDERFVGCPPSFTAAGAHCLARLMLRKGTWCHAHVHYAGYTYSQLLPLISLMMEC 550

Query: 373 XMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKN 405
              P KH   +Y+KY  KRF +AS+FV+  + K 
Sbjct: 551 CELPRKHHAAIYEKYTDKRFKRASLFVEAEMRKG 584



>gi|50286369|ref|XP_445613.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524918|emb|CAG58524.1| unnamed protein product [Candida glabrata]
          Length = 476

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 137/269 (50%), Positives = 189/269 (70%), Gaps = 2/269 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +WEDLDA+D  DP M+SE   DIF+YL  LE   +P+ + +     +  + R ILV+WL+
Sbjct: 196 EWEDLDAEDANDPFMVSEDVNDIFEYLHQLEIVTLPRKEDLYKHRNIC-QNRDILVNWLV 254

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           ++H+KF LLPETL+LAVN++DRFL   +V L KLQLVG + LFIA+KYEE+ +PSIK+F 
Sbjct: 255 KIHNKFGLLPETLYLAVNLMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFA 314

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
              D   TE+EI + E+++L T++F L YPNPMNFLRR SKAD +DIQ+RT+AK+L+EIS
Sbjct: 315 SETDGACTEDEIKEGEKFILKTLEFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEIS 374

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMK 375
           LVD++F+ + PS+ AAAA++LSRKML + +W  NLIHYS  YT               + 
Sbjct: 375 LVDFRFIGVLPSLCAAAAMFLSRKMLGKGQWDGNLIHYSGGYTKNQLAPVCEMIMDYLVS 434

Query: 376 PTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           P  H++ ++KY ++RFMKASI    W  K
Sbjct: 435 PVVHDEFHRKYQSRRFMKASIISVQWALK 463



>gi|410075059|ref|XP_003955112.1| hypothetical protein KAFR_0A05420 [Kazachstania africana CBS 2517]
 gi|372461694|emb|CCF55977.1| hypothetical protein KAFR_0A05420 [Kazachstania africana CBS 2517]
          Length = 461

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 137/269 (50%), Positives = 188/269 (69%), Gaps = 2/269 (0%)

Query: 137 DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLI 196
           +WEDLDA+D  DP M+SEY  DIF+YL  LE   +P  + +     +  + R ILV+WL+
Sbjct: 181 EWEDLDAEDVNDPFMVSEYVNDIFEYLYRLEVITLPNKEDLYKHRNIR-QNRDILVNWLV 239

Query: 197 EVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFI 256
           ++H+KF LLPETL+LA+NI+DRFL   +V L KLQLVG + LFIA+KYEE+ +PSIK+F 
Sbjct: 240 KIHNKFGLLPETLYLAINIMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFA 299

Query: 257 YMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEIS 316
              D   TEEEI + E+++L T++F L YPNPMNFLRR SKAD +DIQ+RT+AK+L+EIS
Sbjct: 300 SETDGACTEEEIKEGEKFILKTLNFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEIS 359

Query: 317 LVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMK 375
           LVD++F+ + PS+ AAAA++LSRKML + +W  NLIHYS  Y+                 
Sbjct: 360 LVDFRFIGILPSLCAAAAMFLSRKMLGKGKWDGNLIHYSGGYSKDQLAPACRMIMDYLTG 419

Query: 376 PTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           P  H++ ++KY ++RFMKAS+    W  K
Sbjct: 420 PIVHDEFHRKYQSRRFMKASVISVQWALK 448



>gi|472585584|gb|EMS23135.1| G2/mitotic-specific cyclin 3/4 [Rhodosporidium toruloides NP11]
          Length = 606

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 131/264 (49%), Positives = 190/264 (71%), Gaps = 3/264 (1%)

Query: 145 DFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRL 204
           D++D  M++EY+ +IF+Y+ +LE   MP P YM  QSE+ W MR  L+DWL++VH ++ +
Sbjct: 339 DYFDISMVAEYSDEIFEYMAELEEASMPNPRYMDHQSEIEWPMRATLIDWLLQVHMRYHM 398

Query: 205 LPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYT 264
           LPETL++AVNIIDRFLS RVVSLVK QLVG+T +FIA+KYEE++APS++ F+ M +NGY+
Sbjct: 399 LPETLWIAVNIIDRFLSNRVVSLVKFQLVGVTAMFIASKYEEIMAPSVEEFVLMTENGYS 458

Query: 265 EEEILKAERYVLTTIDFKLC-YPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
            EEILK ER +L +++F +  Y +P +++RR SKAD +DIQ RT++K+LME++L+D++FL
Sbjct: 459 REEILKGERIILQSLEFNISTYCSPYSWVRRISKADDYDIQTRTLSKFLMEVTLLDHRFL 518

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQL- 382
              PSMIAA  +YL+R+ML   +W+   I YS YT                 P   E+  
Sbjct: 519 RARPSMIAAIGMYLARRMLG-GDWNEAFIFYSGYTEAQLLVPAGFLLESIAAPGFEEKFC 577

Query: 383 YKKYAAKRFMKASIFVKDWISKNV 406
           YKKY++K+F+KASIF ++W  +N 
Sbjct: 578 YKKYSSKKFLKASIFARNWAKQNA 601



>gi|336266658|ref|XP_003348096.1| hypothetical protein SMAC_03942 [Sordaria macrospora k-hell]
 gi|380091031|emb|CCC11237.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 652

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 133/268 (49%), Positives = 187/268 (69%), Gaps = 1/268 (0%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           ED   ++ +D  M++EY  +IF+YL++LE  ++P P YM  Q+E+ W MR +L+DWL++V
Sbjct: 368 EDEVEEENWDVSMVAEYGDEIFEYLRELEGRMLPNPHYMDIQTEIRWSMRSVLMDWLVQV 427

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           HH+F LLPETLFL VN IDRFLSV+VVSL KLQLVG T +F+AAKYEE+  PS++  +YM
Sbjct: 428 HHRFSLLPETLFLTVNYIDRFLSVKVVSLGKLQLVGATAIFVAAKYEEINCPSVQELVYM 487

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
            D GY+ EEILKAE+++LT ++F+L +P PM+FLRR SKAD +D++ RT+AKYL+E++++
Sbjct: 488 VDQGYSVEEILKAEKFMLTMLNFELGWPGPMSFLRRISKADDYDLETRTLAKYLLEVTIM 547

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D +F+  PPS +AA A  LSR  L R  W    +H+S YT                +P K
Sbjct: 548 DERFVGCPPSYLAAGAHCLSRFFLARGPWTLAHVHFSGYTLAQLRPLITTILECCQEPRK 607

Query: 379 HEQ-LYKKYAAKRFMKASIFVKDWISKN 405
           H   +Y KY+ +RF  AS FV+  I+K 
Sbjct: 608 HHGAVYDKYSHQRFKSASTFVETKIAKG 635



>gi|407927499|gb|EKG20391.1| Cyclin [Macrophomina phaseolina MS6]
          Length = 632

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 191/279 (68%), Gaps = 2/279 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+ +D  M++EY  +IF Y++ LE  + P P YM +Q+E+ W MR +L+
Sbjct: 342 EATKTPEDIE-DEAWDTSMVAEYGDEIFDYMRQLEDRMRPNPFYMENQAEIQWSMRSVLM 400

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFLAVN +DRFLS +VVSL KLQLVG T +F+AAKYEE+  PS+
Sbjct: 401 DWLVQVHHRFTLLPETLFLAVNYVDRFLSCKVVSLGKLQLVGATAIFVAAKYEEINCPSV 460

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
              +YM D GYT +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY 
Sbjct: 461 SEIVYMVDGGYTVDEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYF 520

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI+++D +F+   PS +AA A  L+R ML + +W    +HYS YT              
Sbjct: 521 LEITIMDERFVGCVPSFLAAGAHCLARFMLKKGDWSKAHVHYSGYTWSQLRSLVSVILEC 580

Query: 373 XMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKNVERQQ 410
              P KH   +++KYA KR+ +AS+FV+  I K  +  Q
Sbjct: 581 SEHPQKHHIAVFEKYADKRYKRASLFVEAEIRKGFQLAQ 619



>gi|512192134|gb|EPE07894.1| g2 mitotic-specific cyclin [Ophiostoma piceae UAMH 11346]
          Length = 687

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 130/283 (45%), Positives = 193/283 (68%), Gaps = 2/283 (0%)

Query: 124 EFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSEL 183
           E +  RS  + +   ED+D D+ +D  M++EY  DI+ Y+K+LE +++P P YM  Q+E+
Sbjct: 374 ELEIARSIVEASLSLEDMD-DEIWDISMVAEYGDDIYNYMKELEVKMLPSPHYMDMQTEI 432

Query: 184 SWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAK 243
            W MR +L++WLI+VH +F LLPETLFL VN IDRFLS ++VS+ KLQLVG T +FIA+K
Sbjct: 433 QWSMRSVLMEWLIQVHARFNLLPETLFLTVNYIDRFLSAKIVSVAKLQLVGATAIFIASK 492

Query: 244 YEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDI 303
           YEE++ PSI+  +YM D GYT +EILKAER++L+ ++F+L +P PM+FLRR SKAD +D+
Sbjct: 493 YEEIICPSIQEIVYMVDGGYTTDEILKAERFMLSMLNFELGWPGPMSFLRRISKADDYDL 552

Query: 304 QARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXX 363
             RT+AKY +E++++D +F+  PPS +AA +  L+R ML + +W     HYS YT     
Sbjct: 553 DTRTLAKYFLEVTIMDERFVACPPSFLAAGSHCLARLMLRKGDWSTAHTHYSGYTWSQVR 612

Query: 364 XXXXXXXXXXMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKN 405
                       PT H   ++ KYA+ +F KAS +V++ + + 
Sbjct: 613 PLVCTILQCCRDPTTHHAAVFDKYASNKFKKASSYVEEEVQRG 655



>gi|154275998|ref|XP_001538844.1| hypothetical protein HCAG_06449 [Ajellomyces capsulatus NAm1]
 gi|150413917|gb|EDN09282.1| hypothetical protein HCAG_06449 [Ajellomyces capsulatus NAm1]
          Length = 658

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 188/268 (70%), Gaps = 2/268 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+ +D  M++EY+ +IF+Y++ LE  ++P   YM +Q+E+ W MR +L+
Sbjct: 358 EATRTPEDIE-DEAWDTSMVAEYSDEIFQYMRQLEMRLLPNAHYMDNQAEIQWSMRSVLM 416

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 417 DWLVQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSL 476

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  IYM DNGYT +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY 
Sbjct: 477 QEIIYMVDNGYTADEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYF 536

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI+++D +F+  PPS  AA A  L+R ML +  W    ++YS YT              
Sbjct: 537 LEITIMDERFVGTPPSFTAAGAHCLARLMLRKGTWTPAHVYYSNYTYSQLYPLVSLILEC 596

Query: 373 XMKPTKHEQ-LYKKYAAKRFMKASIFVK 399
              P KH   +Y+KY+ +RF +AS FVK
Sbjct: 597 CENPEKHHSAVYEKYSDRRFKRASTFVK 624



>gi|444319955|ref|XP_004180634.1| hypothetical protein TBLA_0E00540 [Tetrapisispora blattae CBS 6284]
 gi|387513677|emb|CCH61115.1| hypothetical protein TBLA_0E00540 [Tetrapisispora blattae CBS 6284]
          Length = 550

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 135/265 (50%), Positives = 186/265 (70%), Gaps = 2/265 (0%)

Query: 138 WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIE 197
           WEDLDA+D  DP M+SEY  DIF+YL  LE   +P  + +     +  + R ILV+WL++
Sbjct: 271 WEDLDAEDGNDPFMVSEYVHDIFEYLSRLEVLTLPHKEDLYKHKNIR-QNRDILVNWLVK 329

Query: 198 VHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIY 257
           +H+KF LLPETL+L +N++DRFL+  +V L +LQLVG + LFIA+KYEE+ +PSIK+F  
Sbjct: 330 IHNKFGLLPETLYLTINLLDRFLAKELVQLDRLQLVGTSCLFIASKYEEVYSPSIKHFAS 389

Query: 258 MADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISL 317
             D   TEEEI + E+++L T++F L YPNPMNFLRR SKAD +DIQ+RT+AK+L+EISL
Sbjct: 390 ETDGACTEEEIKEGEKFILKTLEFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEISL 449

Query: 318 VDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMKP 376
           VD++F+ + PS+ AAA+++LSRKML +  W  NLIHYS  YT               + P
Sbjct: 450 VDFRFIGILPSLCAAASMFLSRKMLGKGTWDGNLIHYSGGYTKEQLEPVCNMIMDYLVSP 509

Query: 377 TKHEQLYKKYAAKRFMKASIFVKDW 401
             H++ +KKY ++RFMKASI    W
Sbjct: 510 IVHDEFHKKYQSRRFMKASIISVQW 534



>gi|367001472|ref|XP_003685471.1| hypothetical protein TPHA_0D04040 [Tetrapisispora phaffii CBS 4417]
 gi|357523769|emb|CCE63037.1| hypothetical protein TPHA_0D04040 [Tetrapisispora phaffii CBS 4417]
          Length = 512

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 149/343 (43%), Positives = 216/343 (62%), Gaps = 8/343 (2%)

Query: 64  LMDRTNVSLKQNSVNEQTHDITKPIIKENVNLGFQDIRSKEKHELSFDTTLATTAESEI- 122
           LMD TN    Q  +  + ++    +  +N+N  +  I   E+ +++    ++  AE  I 
Sbjct: 163 LMDETNFQPTQEDIFTRENET---VAGQNINSNYNII--TEEDDINKKRPISQIAEYNIP 217

Query: 123 YEFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSE 182
            +F       ++   WEDLDA+D+ DP M++EY  DIF YL  LE   +PK +       
Sbjct: 218 KKFKVCNENGEEEYVWEDLDAEDYNDPFMVNEYVNDIFDYLYHLEVITLPKKEDFYQHKN 277

Query: 183 LSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAA 242
           +  + R ILV+WL+++H+KF LLPE+LFLA+N++DRFL   +V L KLQLVG + LFIA+
Sbjct: 278 IH-QNRDILVNWLVKIHNKFGLLPESLFLAINLMDRFLCKELVQLDKLQLVGTSCLFIAS 336

Query: 243 KYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFD 302
           KYEE+ +PSIKNF    D   TEEEI + E+++L T+ F L YPNPMNFLRR SKA  +D
Sbjct: 337 KYEEVYSPSIKNFASETDGACTEEEIKEGEKFILKTLSFNLNYPNPMNFLRRISKAADYD 396

Query: 303 IQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXX 361
           IQ+RT+AK+L+EIS+VD++F+ + PS+ +AAA++L+RKML + EW  NLIHYS  Y    
Sbjct: 397 IQSRTLAKFLLEISIVDFRFIGILPSLCSAAAMFLARKMLGKGEWDGNLIHYSGGYVKSQ 456

Query: 362 XXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
                       + P  H++ ++KY ++RFMKASI    W  K
Sbjct: 457 IAPVCKMMMDYLVSPIVHDEFHRKYQSRRFMKASIISVQWALK 499



>gi|212530754|ref|XP_002145534.1| G2/mitotic-specific cyclin (Clb3), putative [Talaromyces marneffei
           ATCC 18224]
 gi|210074932|gb|EEA29019.1| G2/mitotic-specific cyclin (Clb3), putative [Talaromyces marneffei
           ATCC 18224]
          Length = 630

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 186/263 (70%), Gaps = 1/263 (0%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           D+ +D  M++EY  +IF+Y++++E +++P   YM +Q+E+ W MR +L+DWL++VHH+F 
Sbjct: 354 DEMWDTSMVAEYGDEIFEYMREMEIKMLPNAHYMDNQAEIQWSMRSVLIDWLVQVHHRFS 413

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFLAVN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PSI   +YM D GY
Sbjct: 414 LLPETLFLAVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSIHEIVYMVDRGY 473

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           T +EILKAER++L+ + F+L +P PM+FLRR SKAD +D+  RT+AKY +E++++D +F+
Sbjct: 474 TADEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLDTRTLAKYFLEVTIMDERFV 533

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQ-L 382
             PPS  AA A  L+R ML++ +W    ++YS YT                 P+KH   +
Sbjct: 534 GSPPSFTAAGAHCLARMMLHKGDWSHAHVYYSNYTYAQLFQLLLTILECCENPSKHHNAI 593

Query: 383 YKKYAAKRFMKASIFVKDWISKN 405
           Y KY+ +RF ++S+FV+  I+K 
Sbjct: 594 YDKYSERRFKRSSLFVEAEIAKG 616



>gi|378726127|gb|EHY52586.1| G2/mitotic-specific cyclin 3/4 [Exophiala dermatitidis NIH/UT8656]
          Length = 689

 Score =  285 bits (728), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 133/274 (48%), Positives = 189/274 (68%), Gaps = 2/274 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  E+++ D+ YD  M++EY  +IFKY+K LE +++P P YM +Q E+ W MR +L+
Sbjct: 388 EATRSPEEVE-DECYDTSMVAEYGDEIFKYMKQLELKMLPNPHYMENQHEIQWSMRSVLM 446

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VH +F LLPETLFL VN IDRFLS +VVSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 447 DWLVQVHLRFNLLPETLFLCVNYIDRFLSCKVVSLGKLQLVGATAIFIAAKYEEINCPSV 506

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM D GY+ +EILKAER++LT + F+L +P PM+FLRR SKAD +D++ RT+AKY 
Sbjct: 507 QEIVYMVDGGYSMDEILKAERFMLTMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYF 566

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +E++L+D +F+  PPS  AAA+  L+R ML +  W  + +HYS YT              
Sbjct: 567 LEVTLMDERFIGSPPSFTAAASHCLARLMLRKGTWTPHHVHYSGYTYSQLKPLVSLLLEC 626

Query: 373 XMKPTKHEQ-LYKKYAAKRFMKASIFVKDWISKN 405
              P KH   ++ KY+ KR+ +AS FV+  I + 
Sbjct: 627 CDDPRKHHNAVFNKYSDKRYKRASAFVETEIHRG 660



>gi|302497055|ref|XP_003010528.1| hypothetical protein ARB_03229 [Arthroderma benhamiae CBS 112371]
 gi|291174071|gb|EFE29888.1| hypothetical protein ARB_03229 [Arthroderma benhamiae CBS 112371]
          Length = 654

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 184/258 (71%), Gaps = 1/258 (0%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           D++ D  M++EY  +IF+YL++LE +++P   YM +Q+E+ W MR +L+DWL++VHH+F 
Sbjct: 367 DEWRDTTMVAEYGEEIFQYLRELELKLLPNAHYMDNQAEIQWSMRSVLMDWLVQVHHRFS 426

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS++  +YM DNGY
Sbjct: 427 LLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSVQEIVYMVDNGY 486

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           T +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY +E++++D +F+
Sbjct: 487 TVDEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYFLELTIMDERFV 546

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE-QL 382
             PPS  AA A  L+R ML + +W    + YS YT                 P +H   +
Sbjct: 547 GTPPSFTAAGAHCLARLMLRKGDWTPAHVFYSGYTFGQLYQLIGLILECCEAPQQHHLAI 606

Query: 383 YKKYAAKRFMKASIFVKD 400
           Y+KYA +RF +ASIFV++
Sbjct: 607 YEKYADRRFKRASIFVEN 624



>gi|367024095|ref|XP_003661332.1| hypothetical protein MYCTH_2300590 [Myceliophthora thermophila ATCC
           42464]
 gi|347008600|gb|AEO56087.1| hypothetical protein MYCTH_2300590 [Myceliophthora thermophila ATCC
           42464]
          Length = 671

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 186/265 (70%), Gaps = 1/265 (0%)

Query: 147 YDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLP 206
           +D  M++EY  +IF+Y+++LE++++P P YM  Q+E+ W MR +L+DWL++VHH+F LLP
Sbjct: 374 WDVSMVAEYGDEIFEYMRELEAQMLPNPHYMDDQTEIQWSMRSVLMDWLVQVHHRFCLLP 433

Query: 207 ETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEE 266
           ETLFL VN IDRFLSV+VVSL KLQLVG T LF+AAKYEE+  PS++  +YM D+GY+ +
Sbjct: 434 ETLFLTVNYIDRFLSVKVVSLGKLQLVGATALFVAAKYEEINCPSVQEIVYMVDSGYSVD 493

Query: 267 EILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLP 326
           EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY +EI+++D +F+  P
Sbjct: 494 EILKAERFMLSMLHFELGWPGPMSFLRRISKADDYDLETRTLAKYFLEITIMDERFVSCP 553

Query: 327 PSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQ-LYKK 385
           PS +AA A  +SR  L + +W    +HYS YT                 PTKH   +Y+K
Sbjct: 554 PSFLAAGAHCISRFFLEKGDWTLAHVHYSGYTLSQLKPLIKLLFECCQYPTKHHSAVYEK 613

Query: 386 YAAKRFMKASIFVKDWISKNVERQQ 410
           YA  ++  +S FV+  I+  +   Q
Sbjct: 614 YATPKYKHSSTFVESKIASGLTLSQ 638



>gi|302663426|ref|XP_003023355.1| hypothetical protein TRV_02457 [Trichophyton verrucosum HKI 0517]
 gi|291187349|gb|EFE42737.1| hypothetical protein TRV_02457 [Trichophyton verrucosum HKI 0517]
          Length = 653

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 184/258 (71%), Gaps = 1/258 (0%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           D++ D  M++EY  +IF+YL++LE +++P   YM +Q+E+ W MR +L+DWL++VHH+F 
Sbjct: 366 DEWRDTTMVAEYGEEIFQYLRELELKLLPNAHYMDNQAEIQWSMRSVLMDWLVQVHHRFS 425

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS++  +YM DNGY
Sbjct: 426 LLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSVQEIVYMVDNGY 485

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           T +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY +E++++D +F+
Sbjct: 486 TVDEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYFLELTIMDERFV 545

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE-QL 382
             PPS  AA A  L+R ML + +W    + YS YT                 P +H   +
Sbjct: 546 GTPPSFTAAGAHCLARLMLRKGDWTPAHVFYSGYTFGQLYQLIGLILECCEAPQQHHLAI 605

Query: 383 YKKYAAKRFMKASIFVKD 400
           Y+KYA +RF +ASIFV++
Sbjct: 606 YEKYADRRFKRASIFVEN 623



>gi|156839549|ref|XP_001643464.1| hypothetical protein Kpol_1006p2 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114076|gb|EDO15606.1| hypothetical protein Kpol_1006p2 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 490

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 135/270 (50%), Positives = 188/270 (69%), Gaps = 2/270 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           Q+  +WEDLDA+D  DP M+SEY  +IF YL  LE   +P+   +     +  + R ILV
Sbjct: 206 QEEYEWEDLDAEDANDPFMVSEYVTNIFDYLHHLEVITLPQKQDLFKHRNIH-QNRDILV 264

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           +W+I++H+KF LLPETL+LA+N++DRFL   +V L KLQLVG + LFIA+KYEE+ +PSI
Sbjct: 265 NWMIKIHNKFGLLPETLYLAINLMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSI 324

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           K+F    D   +E+EI + E+++L T++F L YPNPMNFLRR SKAD +DIQ RT+AK+L
Sbjct: 325 KHFASETDGACSEDEIKEGEKFILKTLEFNLNYPNPMNFLRRISKADDYDIQLRTLAKFL 384

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXX 371
           +EISLVD++F+ + PS+ AAAA++LSRKML + +W  NLIHYS  YT             
Sbjct: 385 LEISLVDFRFIGILPSLCAAAAMFLSRKMLGKGKWDGNLIHYSGGYTTEQLAPVCQMMMD 444

Query: 372 XXMKPTKHEQLYKKYAAKRFMKASIFVKDW 401
             + P  H++ ++KY ++RFMKASI    W
Sbjct: 445 YLVSPIVHDEFHRKYQSRRFMKASIISVQW 474



>gi|443921549|gb|ELU41141.1| g2/mitotic-specific cyclin cdc13 [Rhizoctonia solani AG-1 IA]
          Length = 1569

 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 140/271 (51%), Positives = 200/271 (73%), Gaps = 24/271 (8%)

Query: 136 QDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWL 195
           Q W+DLDA+D  DP M++EY  +IF+Y+K+LE                   MRGIL+DW+
Sbjct: 291 QRWDDLDAEDADDPTMVAEYVAEIFEYMKELE-------------------MRGILMDWI 331

Query: 196 IEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNF 255
           I+VH +FRLLPETLFLA NIIDRFLS+R+VSLVKLQLVGITGLF+AAKYEE++APS++NF
Sbjct: 332 IQVHSRFRLLPETLFLACNIIDRFLSMRIVSLVKLQLVGITGLFVAAKYEEIMAPSVQNF 391

Query: 256 IYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEI 315
           + ++D+GY+E+EIL+AE+Y+L T+ + L YPNPM++LRR+SKAD +D+Q RT+AK+L+EI
Sbjct: 392 LKVSDSGYSEQEILQAEKYILRTLGWDLSYPNPMSWLRRASKADAYDVQTRTMAKFLVEI 451

Query: 316 SLVDYKFLPLPPSMIAAAALYLSRKMLNRSEW----HANLIHYSQYTXXXXXXXXXXXXX 371
           S+V+ K L   PS+++AA+L+L+R +L+R EW    +ANL HYS Y+             
Sbjct: 452 SVVEEKLLKCTPSLLSAASLWLARLVLDREEWLFVQNANLEHYSGYSEEALLPCANIMLN 511

Query: 372 XXMK-PTKHEQLYKKYAAKRFMKASIFVKDW 401
             ++ P+ HE L+KKY+ K++ K + + + W
Sbjct: 512 YIVQPPSAHESLWKKYSGKKYFKCAAYARKW 542



>gi|327300008|ref|XP_003234697.1| G2/mitotic-specific cyclin cdc13 [Trichophyton rubrum CBS 118892]
 gi|326463591|gb|EGD89044.1| G2/mitotic-specific cyclin cdc13 [Trichophyton rubrum CBS 118892]
          Length = 651

 Score =  284 bits (726), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 184/258 (71%), Gaps = 1/258 (0%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           D++ D  M++EY  +IF+YL++LE +++P   YM +Q+E+ W MR +L+DWL++VHH+F 
Sbjct: 364 DEWRDTTMVAEYGEEIFQYLRELELKLLPNAHYMDNQAEIQWSMRSVLMDWLVQVHHRFS 423

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS++  +YM DNGY
Sbjct: 424 LLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSVQEIVYMVDNGY 483

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           T +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY +E++++D +F+
Sbjct: 484 TVDEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYFLELTIMDERFV 543

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE-QL 382
             PPS  AA A  L+R ML + +W    + YS YT                 P +H   +
Sbjct: 544 GTPPSFTAAGAHCLARLMLRKGDWTPAHVFYSGYTFGQLYQLIGLILECCEAPQQHHLAI 603

Query: 383 YKKYAAKRFMKASIFVKD 400
           Y+KYA +RF +ASIFV++
Sbjct: 604 YEKYADRRFKRASIFVEN 621



>gi|121716748|ref|XP_001275899.1| G2/mitotic-specific cyclin, putative [Aspergillus clavatus NRRL 1]
 gi|119404056|gb|EAW14473.1| G2/mitotic-specific cyclin, putative [Aspergillus clavatus NRRL 1]
          Length = 637

 Score =  284 bits (726), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 191/274 (69%), Gaps = 2/274 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+F+D  M++EY+ +IF+Y+K+ E  ++P   YM +Q+E+ W MR +L+
Sbjct: 337 EATRSTEDIE-DEFWDTSMVAEYSDEIFEYMKEQEIRMLPNAHYMDNQAEIQWSMRSVLM 395

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 396 DWLVQVHHRFSLLPETLFLCVNYIDRFLSSKIVSLGKLQLVGATAIFIAAKYEEINCPSV 455

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM D GYT +EILKAER++L+ + F+L +P PM+FLR+ SKAD +D++ RT+AKY 
Sbjct: 456 QEIVYMVDGGYTVDEILKAERFMLSMLQFELGWPGPMSFLRKISKADDYDLETRTLAKYF 515

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +E++++D +F+  PPS IAA A  L+R +L +  W    +HY++YT              
Sbjct: 516 LEVTIMDERFVGSPPSFIAAGAHCLARLLLRKGNWTPAHVHYAEYTYSQLFPLVSLMLEC 575

Query: 373 XMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKN 405
              P KH   +Y+KY  KRF +AS+F +  I K 
Sbjct: 576 CEIPRKHHCAIYEKYTDKRFKRASLFAEAEIKKG 609



>gi|254567748|ref|XP_002490984.1| B-type cyclin involved in cell cycle progression [Komagataella
           pastoris GS115]
 gi|238030781|emb|CAY68704.1| B-type cyclin involved in cell cycle progression [Komagataella
           pastoris GS115]
 gi|328352484|emb|CCA38883.1| G2/mitotic-specific cyclin-2 [Komagataella pastoris CBS 7435]
          Length = 402

 Score =  284 bits (726), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 152/318 (47%), Positives = 211/318 (66%), Gaps = 10/318 (3%)

Query: 88  IIKENVNLGFQDIRSKEKHELSFDTTLATTAESEIYEFDRKRSKKQKTQDWEDLDADDFY 147
           I KEN+  G  D     K  L    T+     +++ +   K++K   +  W+DLDADD  
Sbjct: 81  IQKENILSGPADRNRNTKSSLKRSATI-----TDVPQVTNKKAKVDYS--WDDLDADDSD 133

Query: 148 DPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPE 207
           DP+M+SEY  +IF+YL  LE E +P P+Y+  Q     +MR ILVDWL+EV  KFRLLPE
Sbjct: 134 DPLMVSEYVGEIFEYLHRLEKETLPDPNYLQWQKSFKPKMRSILVDWLVEVQLKFRLLPE 193

Query: 208 TLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEE 267
           TL+L++NI+DRFLS   V + KLQL+    +FI+AKYEE+ +PSIK   Y  D+G++EEE
Sbjct: 194 TLYLSINIMDRFLSKEPVQINKLQLLATGCIFISAKYEEVYSPSIK--YYAQDSGFSEEE 251

Query: 268 ILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPP 327
           IL AE+++L  +DF + YP  MNFLRR SKAD +D+Q+RT+ KYL+EI+++D+KFL + P
Sbjct: 252 ILDAEKFILEILDFNINYPGAMNFLRRISKADDYDVQSRTIGKYLLEITIIDHKFLGVLP 311

Query: 328 SMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKY 386
           S+ AAA++Y++RKML R EW+ NLIHYS  YT               + P  HE+ +KKY
Sbjct: 312 SLCAAASMYVARKMLGRYEWNGNLIHYSGGYTEAHLKETCEMLIDYLVSPIIHEEFFKKY 371

Query: 387 AAKRFMKASIFVKDWISK 404
           A+K+FMK SI  + W  K
Sbjct: 372 ASKKFMKVSILARQWAKK 389



>gi|310792596|gb|EFQ28123.1| cyclin domain-containing protein [Glomerella graminicola M1.001]
          Length = 651

 Score =  283 bits (725), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 130/283 (45%), Positives = 196/283 (69%), Gaps = 2/283 (0%)

Query: 124 EFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSEL 183
           E +  R+  + T+  E++D D+ +D  M++EY  DIF+Y+++LE  ++P P YM  Q+E+
Sbjct: 332 ELETARAIVESTRTQEEVD-DEVWDVCMVAEYGEDIFEYMRELEMRMLPDPHYMDHQAEI 390

Query: 184 SWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAK 243
            W MR +L+DWL++VHH+F LLPETLFL VN IDRFLS +VVS+ KLQLVG T L +A+K
Sbjct: 391 QWSMRSVLMDWLVQVHHRFGLLPETLFLTVNYIDRFLSYKVVSIGKLQLVGATALLVASK 450

Query: 244 YEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDI 303
           YEE+  PS++  ++M DNGY  +E+LKAER++L+ + F+L +P PM+FLRR SKAD +D+
Sbjct: 451 YEEINCPSLQEIVFMVDNGYKVDELLKAERFMLSMLSFELGFPGPMSFLRRVSKADDYDL 510

Query: 304 QARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXX 363
           + RT+AKY +E++++D +F+  PPS +AAAA  LSR +L + +W    +HYS YT     
Sbjct: 511 ETRTLAKYFLEVTIMDERFVASPPSFLAAAAHCLSRLILKKGDWTPAHVHYSGYTWGQLR 570

Query: 364 XXXXXXXXXXMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKN 405
                       P KH   +++KY+ KR+ +A+ +V+  ISK 
Sbjct: 571 NLVTMILECCHSPRKHHLAVFEKYSDKRYKRAAEYVQTEISKG 613



>gi|326480210|gb|EGE04220.1| G2/mitotic-specific cyclin cdc13 [Trichophyton equinum CBS 127.97]
          Length = 654

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 184/258 (71%), Gaps = 1/258 (0%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           D++ D  M++EY  +IF+YL++LE +++P   YM +Q+E+ W MR +L+DWL++VHH+F 
Sbjct: 367 DEWRDTTMVAEYGEEIFQYLRELELKLLPNAHYMDNQAEIQWSMRSVLMDWLVQVHHRFS 426

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS++  +YM DNGY
Sbjct: 427 LLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSVQEIVYMVDNGY 486

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           T +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY +E++++D +F+
Sbjct: 487 TVDEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYFLELTIMDERFV 546

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE-QL 382
             PPS  AA A  L+R ML + +W    + YS YT                 P +H   +
Sbjct: 547 GTPPSFTAAGAHCLARLMLRKGDWTPAHVFYSGYTFGQLYQLIGLILECCEAPQQHHLAI 606

Query: 383 YKKYAAKRFMKASIFVKD 400
           Y+KYA +RF +ASIFV++
Sbjct: 607 YEKYADRRFKRASIFVEN 624



>gi|296815994|ref|XP_002848334.1| G2/mitotic-specific cyclin-3 [Arthroderma otae CBS 113480]
 gi|238841359|gb|EEQ31021.1| G2/mitotic-specific cyclin-3 [Arthroderma otae CBS 113480]
          Length = 650

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 185/258 (71%), Gaps = 1/258 (0%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           +++ D  M+SEY  +IF+YL++LE +++P   YM +Q+E+ W MR +L+DWL++VHH+F 
Sbjct: 363 EEWRDTTMVSEYGEEIFQYLRELEIKLLPNAHYMDNQAEIQWSMRSVLMDWLVQVHHRFS 422

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS++  +YM +NGY
Sbjct: 423 LLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSVQEIVYMVENGY 482

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           T EEILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY +E++++D +F+
Sbjct: 483 TVEEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYFLELTIMDERFV 542

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE-QL 382
             PPS  AA A  L+R ML + EW    ++YS YT                 P +H   +
Sbjct: 543 GTPPSFTAAGAHCLARLMLRKGEWTPAHVYYSGYTFGQLYQLIGLILECCEFPQQHHLAI 602

Query: 383 YKKYAAKRFMKASIFVKD 400
           Y+KYA ++F +ASIFV++
Sbjct: 603 YEKYADRKFKRASIFVEN 620



>gi|315042381|ref|XP_003170567.1| G2/mitotic-specific cyclin-3 [Arthroderma gypseum CBS 118893]
 gi|311345601|gb|EFR04804.1| G2/mitotic-specific cyclin-3 [Arthroderma gypseum CBS 118893]
          Length = 658

 Score =  283 bits (725), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 189/269 (70%), Gaps = 2/269 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T   E+ D +++ D  M++EY  +IF+YL++LE +++P   YM +Q+E+ W MR +L+
Sbjct: 361 ESTTSVEEYD-EEWRDTTMVAEYGEEIFQYLRELEIKLLPNAHYMDNQAEIQWSMRSVLM 419

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 420 DWLVQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSV 479

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM DNGYT +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY 
Sbjct: 480 QEIVYMVDNGYTVDEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYF 539

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +E++++D +F+  PPS  AA A  L+R ML + +W    + YS YT              
Sbjct: 540 LELTIMDERFVGTPPSFTAAGAHCLARLMLRKGDWTPAHVFYSGYTFGQLYQLIGLILEC 599

Query: 373 XMKPTKHE-QLYKKYAAKRFMKASIFVKD 400
              P +H   +Y+KYA +RF +ASIFV++
Sbjct: 600 CEAPQQHHLAIYEKYADRRFKRASIFVEN 628



>gi|71014611|ref|XP_758735.1| hypothetical protein UM02588.1 [Ustilago maydis 521]
 gi|46098525|gb|EAK83758.1| hypothetical protein UM02588.1 [Ustilago maydis 521]
          Length = 740

 Score =  283 bits (725), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 127/267 (47%), Positives = 192/267 (71%), Gaps = 3/267 (1%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD ++  D  M++EY+ +IF Y+   E E M  P+YM  QSE+ W MR  LVDWL++VH 
Sbjct: 297 LDPEEVRDTSMVAEYSNEIFSYMARCERETMANPNYMEFQSEIHWHMRATLVDWLLQVHM 356

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           ++ +LPETL++A+N++DRFLSVRVVSL KLQLVG+T +FIAAKYEE+LAPS+K F+YM +
Sbjct: 357 RYHMLPETLWIAINVVDRFLSVRVVSLAKLQLVGVTAMFIAAKYEEILAPSVKEFVYMTE 416

Query: 261 NGYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
            GY++EEILK ER +L+T+DF +  Y +P +++R+ SKAD +DI+ RT++K+LME++L+D
Sbjct: 417 GGYSQEEILKGERIILSTLDFNISSYCSPYSWVRKISKADDYDIRTRTLSKFLMELALLD 476

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++FL   PS++AA  ++L++KML   EW    ++YS +T               +     
Sbjct: 477 HRFLRARPSLVAAVGMFLAKKMLG-GEWDDAFVYYSDFTEEQLVPGANLLLERLLDQGFE 535

Query: 380 EQ-LYKKYAAKRFMKASIFVKDWISKN 405
           EQ +Y+KY+ K+F++AS+F +DW  +N
Sbjct: 536 EQFVYRKYSNKKFLRASVFARDWAFQN 562



>gi|401888094|gb|EJT52061.1| hypothetical protein A1Q1_06691 [Trichosporon asahii var. asahii
           CBS 2479]
 gi|406699287|gb|EKD02494.1| hypothetical protein A1Q2_03254 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 435

 Score =  283 bits (724), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 190/266 (71%), Gaps = 3/266 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D +D  M++EYA +IF +++++E   MP P YM  QSE+ W MR  LVDWL++VH +
Sbjct: 166 DDIDMFDTTMVAEYADEIFAHMEEMELATMPNPRYMDFQSEVEWTMRTTLVDWLLQVHLR 225

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + LLPETL++AVNI+DRFLSVRVVS  KLQLVG+T LFIAAKYEE+LAPS+  F+YMADN
Sbjct: 226 YHLLPETLWIAVNILDRFLSVRVVSTQKLQLVGLTALFIAAKYEEILAPSVDEFVYMADN 285

Query: 262 GYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GYT++EILK ER +L T+DF +  Y  P +++RR SKAD +DIQ RT++K+LME++L+D+
Sbjct: 286 GYTKDEILKGERIILQTLDFNISAYCTPYSWVRRISKADDYDIQTRTLSKFLMEVTLLDH 345

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT-KH 379
           +FL   PSMIAA  +YLSRKML  S+W+   + YS++T               ++   + 
Sbjct: 346 RFLRCKPSMIAAVGMYLSRKMLG-SDWNDAFVFYSEFTESQLRTAADMICERLVEDGFER 404

Query: 380 EQLYKKYAAKRFMKASIFVKDWISKN 405
             +Y KY++K+F++AS +  DW   N
Sbjct: 405 VFVYVKYSSKKFLRASAYACDWAMTN 430



>gi|242817649|ref|XP_002486999.1| G2/mitotic-specific cyclin (Clb3), putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218713464|gb|EED12888.1| G2/mitotic-specific cyclin (Clb3), putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 631

 Score =  283 bits (724), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 186/263 (70%), Gaps = 1/263 (0%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           D+ +D  M++EY  +IF+Y++++E  ++P   YM +Q+E+ W MR +L+DWL++VHH+F 
Sbjct: 355 DEMWDTSMVAEYGDEIFEYMREMEIRMLPNAHYMDNQAEIQWSMRSVLIDWLVQVHHRFS 414

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL+VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+   +YM D GY
Sbjct: 415 LLPETLFLSVNYIDRFLSCKIVSLGKLQLVGATAIFIAAKYEEINCPSVHEIVYMVDKGY 474

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           + +EILKAER++L+ + F+L +P PM+FLRR SKAD +D+  RT+AKY +E++++D +F+
Sbjct: 475 SADEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLDTRTLAKYFLEVTIMDERFV 534

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQ-L 382
             PPS  AA A  L+R ML++ +W    ++YS YT                 P+KH   +
Sbjct: 535 GSPPSYTAAGAHCLARLMLHKGDWSHAHVYYSNYTYAQLYPLLLIILECCENPSKHHNAI 594

Query: 383 YKKYAAKRFMKASIFVKDWISKN 405
           Y+KYA +RF ++S+FV+  I+K 
Sbjct: 595 YEKYADRRFKRSSVFVEAEIAKG 617



>gi|440632419|gb|ELR02338.1| hypothetical protein GMDG_05405 [Geomyces destructans 20631-21]
          Length = 673

 Score =  283 bits (724), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 183/263 (69%), Gaps = 1/263 (0%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           DD +D  M++EY  +IF Y+++LE ++ P P YM +Q+E+ W MR +L+DWLI+VHH+F 
Sbjct: 364 DDMWDTSMVAEYGDEIFGYMRELEIKLAPNPHYMDNQAEIQWSMRSVLMDWLIQVHHRFS 423

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFL VN IDRFLS ++VSL KLQLVG T +F+AAKYEE+  PS+   +YM D+GY
Sbjct: 424 LLPETLFLCVNYIDRFLSHKIVSLGKLQLVGATAIFVAAKYEEINCPSVSEIVYMVDDGY 483

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           + +EILKAER++L  +DF+L +P PM+FLRR SKAD +D++ RT+AKY +E++++D +F+
Sbjct: 484 SVDEILKAERFMLGMLDFELGWPGPMSFLRRISKADDYDLETRTLAKYFLEVAIMDERFV 543

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE-QL 382
             PPS +AA A  +SR ML + +W    +HYS YT                 P KH   +
Sbjct: 544 GTPPSFVAAGAQCISRMMLKKGDWTPAHVHYSGYTWTQLRPLVSLMLECCRNPEKHHAAV 603

Query: 383 YKKYAAKRFMKASIFVKDWISKN 405
           + KY+ +R+ +AS +VK  I+  
Sbjct: 604 FDKYSDRRYKRASEYVKTTIASG 626



>gi|365982063|ref|XP_003667865.1| hypothetical protein NDAI_0A04660 [Naumovozyma dairenensis CBS 421]
 gi|343766631|emb|CCD22622.1| hypothetical protein NDAI_0A04660 [Naumovozyma dairenensis CBS 421]
          Length = 483

 Score =  283 bits (724), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 134/263 (50%), Positives = 184/263 (69%), Gaps = 2/263 (0%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           DLD +D  DP M+SEY  DIF YL  LE   +P  + +     ++ + R ILV+WL+++H
Sbjct: 206 DLDEEDSNDPFMVSEYVNDIFGYLHQLEISTLPAKENLKKHKNIN-QNRDILVNWLVKIH 264

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
           +KF LLPETL+LA+NI+DRFL   +V L KLQLVG + LFIA+KYEE+ +PSIK+F    
Sbjct: 265 NKFGLLPETLYLAINIMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFASET 324

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D   TE+EI + E+++L T++F L YPNPMNFLRR SKAD +DIQ+RT+AK+L+EISLVD
Sbjct: 325 DGACTEDEIKEGEKFILKTLEFSLKYPNPMNFLRRISKADDYDIQSRTLAKFLLEISLVD 384

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXXXXMKPTK 378
           ++F+ + PS+ AAAA++LSRKML + +W  NLIHYS  YT               + P  
Sbjct: 385 FRFIGILPSLCAAAAMFLSRKMLGKGKWDGNLIHYSGGYTKSQLAPVCDMIMDYLVSPIV 444

Query: 379 HEQLYKKYAAKRFMKASIFVKDW 401
           H++ ++KY ++RFMKASI    W
Sbjct: 445 HDEFHRKYQSRRFMKASIISVQW 467



>gi|512204782|gb|EPE33604.1| Cyclin-like protein [Glarea lozoyensis ATCC 20868]
          Length = 665

 Score =  283 bits (723), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 126/274 (45%), Positives = 191/274 (69%), Gaps = 2/274 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + ++  ED++ D+ +D  M++EY  +IF Y+++LE +++P P+YM +QSE+ W MR +L+
Sbjct: 349 EGSRTQEDIE-DEAWDTSMVAEYGDEIFAYMRELEIKMLPNPNYMDNQSEIQWSMRSVLM 407

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWLI+VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +F+AAKYEE+  P++
Sbjct: 408 DWLIQVHHRFSLLPETLFLCVNYIDRFLSCKIVSLGKLQLVGATAIFVAAKYEEINCPAV 467

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
              +YM D GYT +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY 
Sbjct: 468 SEIVYMVDGGYTVDEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYF 527

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +E++++D +F+  PPS +AA A   +R  L + +W  + IHYS YT              
Sbjct: 528 LEVTIMDERFVGCPPSYVAAGAHCFARMALKKGDWSPSHIHYSGYTWQQLRPLVSAMLEC 587

Query: 373 XMKPTKHEQ-LYKKYAAKRFMKASIFVKDWISKN 405
              P KH   +++KY+ +R+ +AS FV+  + + 
Sbjct: 588 CENPEKHHSAVFEKYSDRRYKRASHFVQGEMKRG 621



>gi|302678331|ref|XP_003028848.1| hypothetical protein SCHCODRAFT_83073 [Schizophyllum commune H4-8]
 gi|300102537|gb|EFI93945.1| hypothetical protein SCHCODRAFT_83073 [Schizophyllum commune H4-8]
          Length = 380

 Score =  283 bits (723), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 147/260 (56%), Positives = 190/260 (73%)

Query: 134 KTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVD 193
           +T  W+DLDA+D  DP M+SEY V+IFKY+++LE   +P P YM SQ EL+W+MRGIL D
Sbjct: 113 ETSPWDDLDAEDGDDPAMVSEYVVEIFKYMRELELATLPNPRYMDSQKELAWKMRGILTD 172

Query: 194 WLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIK 253
           WLI+VH +FRLLPETLFL VNIIDRFLS RVVSL KLQLVGIT + IAAK EE++APS+ 
Sbjct: 173 WLIQVHVRFRLLPETLFLCVNIIDRFLSARVVSLAKLQLVGITCMLIAAKVEEIVAPSVH 232

Query: 254 NFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLM 313
           +F+  AD  Y E EIL AE+YVL T+D+ L +PNP++FLRR SKAD ++++ RT+ KYL+
Sbjct: 233 HFLMCADATYAENEILLAEKYVLKTLDWNLSFPNPVHFLRRVSKADDYNVKVRTLGKYLL 292

Query: 314 EISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXX 373
           EI  ++++ L  PPS++AAAA++L+R  L   +W ANL HYS Y                
Sbjct: 293 EIGCLEWRLLATPPSLLAAAAIWLARLALGLEKWTANLAHYSSYPESALVPTACLMINYI 352

Query: 374 MKPTKHEQLYKKYAAKRFMK 393
           +KP +HE  YKKYA KRF K
Sbjct: 353 IKPIRHESFYKKYAGKRFFK 372



>gi|358389795|gb|EHK27387.1| hypothetical protein TRIVIDRAFT_34612, partial [Trichoderma virens
           Gv29-8]
          Length = 642

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 133/290 (45%), Positives = 196/290 (67%), Gaps = 3/290 (1%)

Query: 112 TTLATTAESEIY-EFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEI 170
           T LA    S +  E D  R + ++T   E++D ++ +D  M++EY  +IF+YL+++E ++
Sbjct: 313 TILAPRVTSRVQRELDEARIEVEQTITPEEID-EEMWDVSMVAEYGEEIFEYLREMEIKM 371

Query: 171 MPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKL 230
           +P P YM  Q+E+ W MR +L+DWL++VHH+F LLPETLFL VN IDRFLS ++VS+ KL
Sbjct: 372 LPNPHYMEMQTEIQWSMRTVLMDWLVQVHHRFNLLPETLFLTVNYIDRFLSCKIVSIGKL 431

Query: 231 QLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMN 290
           QLVG T + +A+KYEE+  PS+   +YM D GYT E+ILKAER++L+ + F+L +P PM+
Sbjct: 432 QLVGATAILVASKYEEINCPSLDEIVYMVDGGYTTEDILKAERFMLSMLGFELGWPGPMS 491

Query: 291 FLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHAN 350
           FLRR SKAD +D+  RT+AKY +E++++D +F+  PPS +AA A  LSR +LN+ EW   
Sbjct: 492 FLRRVSKADDYDLDTRTLAKYFLELTIMDERFVASPPSFLAAGAHCLSRLILNKGEWTKR 551

Query: 351 LIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQ-LYKKYAAKRFMKASIFVK 399
            +HYS YT                 P KH   +++KY  KRF +AS+ V+
Sbjct: 552 HVHYSGYTWSQLKSLVTMMIECCENPAKHHGAVFEKYREKRFKEASVQVQ 601



>gi|254579869|ref|XP_002495920.1| ZYRO0C06138p [Zygosaccharomyces rouxii]
 gi|238938811|emb|CAR26987.1| ZYRO0C06138p [Zygosaccharomyces rouxii]
          Length = 479

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 136/273 (49%), Positives = 188/273 (68%), Gaps = 2/273 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           Q   +WEDLDA+D  DP M+SEY  +IF YL  LE   +P+ + +     +  + R ILV
Sbjct: 195 QAEYEWEDLDAEDANDPFMVSEYVDEIFDYLHHLEVMTLPREENLYKHRNIR-QNRDILV 253

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           +WL+++H+KF LLPETL+LA+N +DRFL   +V L KLQLVG + LFIA+KYEE+ +PSI
Sbjct: 254 NWLVKIHNKFGLLPETLYLAINTMDRFLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSI 313

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           K+F    D   TE+EI + E+++L T+ F L YPNPMNFLRR SKAD +DIQ+RT+AK+L
Sbjct: 314 KHFASETDGACTEDEIKEGEKFILKTLGFNLNYPNPMNFLRRISKADDYDIQSRTLAKFL 373

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYS-QYTXXXXXXXXXXXXX 371
           +EISL+D++F+ + PS+ AAAA++LSRKML + +W  NLIHYS  YT             
Sbjct: 374 LEISLMDFRFIGILPSLCAAAAMFLSRKMLGKGKWDGNLIHYSGGYTKEQLAPVCHMIMD 433

Query: 372 XXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
             + P  H++ ++KY ++RFMKASI    W  K
Sbjct: 434 YLVSPMVHDEFHRKYQSRRFMKASIISVQWALK 466



>gi|380489622|emb|CCF36585.1| cyclin [Colletotrichum higginsianum]
          Length = 650

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 130/283 (45%), Positives = 195/283 (68%), Gaps = 2/283 (0%)

Query: 124 EFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSEL 183
           E +  R   + T+  E++D D+ +D  M++EY  DIF+Y+++LE  ++P P YM  Q+E+
Sbjct: 331 ELETARVIVESTRTQEEVD-DEVWDVCMVAEYGDDIFEYMRELEMRMLPDPHYMDHQAEI 389

Query: 184 SWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAK 243
            W MR +L+DWL++VHH+F LLPETLFL VN IDRFLS +VVS+ KLQLVG T L +A+K
Sbjct: 390 QWSMRSVLMDWLVQVHHRFSLLPETLFLTVNYIDRFLSYKVVSIGKLQLVGATALLVASK 449

Query: 244 YEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDI 303
           YEE+  PS++  ++M DNGY  +EILKAER++L+ + F+L +P PM+FLRR SKAD +D+
Sbjct: 450 YEEINCPSLQEIVFMVDNGYKVDEILKAERFMLSMLSFELGFPGPMSFLRRVSKADDYDL 509

Query: 304 QARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXX 363
           + RT+AKY +E++++D +F+  PPS +AAAA  LSR +L + +W    +HYS YT     
Sbjct: 510 ETRTLAKYFLEVTIMDERFVASPPSFLAAAAHCLSRLILKKGDWTPAHVHYSGYTWGQLR 569

Query: 364 XXXXXXXXXXMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKN 405
                       P KH   +++KY+ KR+ +A+ +V+  I+K 
Sbjct: 570 NLVTMILECCHAPRKHHLAVFEKYSDKRYKRAAEYVQTEITKG 612



>gi|406608177|emb|CCH40611.1| G2/mitotic-specific cyclin-B1 [Wickerhamomyces ciferrii]
          Length = 433

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 186/264 (70%), Gaps = 1/264 (0%)

Query: 140 DLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVH 199
           D + +D +D  M++EY+ +IF YL  LE ++ P P YM +Q+EL W MR ILVDWL++VH
Sbjct: 163 DEEDEDTFDVSMVAEYSPEIFNYLHGLEIKMRPNPGYMKNQTELKWNMRSILVDWLVQVH 222

Query: 200 HKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMA 259
            +F LLPETLFL VN IDRFLS R VSL + QLVG   LFIAAKYEE+  PS++   YM 
Sbjct: 223 SRFNLLPETLFLTVNYIDRFLSRRRVSLSRFQLVGAVALFIAAKYEEINCPSVQEIAYMV 282

Query: 260 DNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
           D+ YT E+IL+AER+++  ++F++ +P PM+FLRR+SKAD +D + RT+AKY +EI+++D
Sbjct: 283 DHAYTVEDILRAERFMIDVLEFEMGWPGPMSFLRRTSKADDYDFETRTLAKYFLEITVMD 342

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           Y+F+  PPS +AA+A +LSR +LNR EW    ++YS YT                 P +H
Sbjct: 343 YRFVASPPSWLAASAHFLSRLLLNRGEWTPAHVYYSGYTAEQLRPAASVLLEACRNPEEH 402

Query: 380 EQ-LYKKYAAKRFMKASIFVKDWI 402
            + +++KY  +R+ ++S+FV++WI
Sbjct: 403 HKSIFEKYQERRYRRSSLFVQEWI 426



>gi|68466601|ref|XP_722496.1| likely G2 B-type cyclin [Candida albicans SC5314]
 gi|68466884|ref|XP_722357.1| likely G2 B-type cyclin [Candida albicans SC5314]
 gi|46444327|gb|EAL03602.1| likely G2 B-type cyclin [Candida albicans SC5314]
 gi|46444475|gb|EAL03749.1| likely G2 B-type cyclin [Candida albicans SC5314]
          Length = 492

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 201/290 (69%), Gaps = 4/290 (1%)

Query: 119 ESEIYEFDRKRSKKQKTQD--WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDY 176
           + E+ E  +   KK +  D  W+DLD +D  D +M+SEY  +IF Y  +LE+ ++P P Y
Sbjct: 167 QPEVGERSQSYHKKSRLIDYEWQDLDEEDSDDQLMVSEYVNEIFSYYYELETRMLPDPQY 226

Query: 177 MSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGIT 236
           +  Q+ L  RMR ILVDWL+E+H KF+LLPE+LFLAVN++DRF+SV VV + KLQL+   
Sbjct: 227 LFKQTLLKPRMRSILVDWLVEMHLKFKLLPESLFLAVNVMDRFMSVEVVQIDKLQLLATA 286

Query: 237 GLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSS 296
            LF AAKYEE+ +PS+KN+ Y  D  YT EE+++AE+Y+LT ++F L YPNPMNFLRR S
Sbjct: 287 ALFTAAKYEEVFSPSVKNYAYFTDGSYTPEEVVQAEKYMLTILNFDLNYPNPMNFLRRIS 346

Query: 297 KADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNR-SEWHANLIHYS 355
           KAD +D+Q+RT+ KYL+EI++VDYKF+ + PS+  A+A+YL+R +L +   W+ NLIHYS
Sbjct: 347 KADDYDVQSRTLGKYLLEITIVDYKFIGMRPSLCCASAMYLARLILGKLPVWNGNLIHYS 406

Query: 356 -QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
             Y                + P +H++ +KKYA ++FM+AS   ++W  K
Sbjct: 407 GGYRISDMRECIELMFQYLIAPIEHDEFFKKYAMRKFMRASTLCRNWAKK 456



>gi|241950769|ref|XP_002418107.1| G2/mitotic-specific cyclin, putative [Candida dubliniensis CD36]
 gi|223641446|emb|CAX43407.1| G2/mitotic-specific cyclin, putative [Candida dubliniensis CD36]
          Length = 486

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 141/291 (48%), Positives = 201/291 (69%), Gaps = 4/291 (1%)

Query: 118 AESEIYEFDRKRSKKQKTQD--WEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPD 175
           ++ EI E  +   KK +  D  W+DLD +D  D +M+SEY  +IF Y  +LE+ ++P   
Sbjct: 166 SQPEIGERSQSYHKKSRLIDYEWQDLDEEDSDDQLMVSEYVNEIFSYYYELETRMLPDSQ 225

Query: 176 YMSSQSELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGI 235
           Y+  Q+ L  RMR ILVDWL+E+H KF+LLPE+LFLAVN++DRF+SV VV + KLQL+  
Sbjct: 226 YLFKQTLLKPRMRSILVDWLVEMHLKFKLLPESLFLAVNVMDRFMSVEVVQIDKLQLLAT 285

Query: 236 TGLFIAAKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRS 295
             LF AAKYEE+ +PS+KN+ Y  D  YT EE+++AE+Y+LT +DF L YPNPMNFLRR 
Sbjct: 286 AALFTAAKYEEVFSPSVKNYAYFTDGSYTPEEVVQAEKYMLTILDFDLNYPNPMNFLRRI 345

Query: 296 SKADHFDIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNR-SEWHANLIHY 354
           SKAD +D+Q+RT+ KYL+EI++VDYKF+ + PS+  A+A+YL+R +L +   W+ NLIHY
Sbjct: 346 SKADDYDVQSRTLGKYLLEITIVDYKFIGMRPSLCCASAMYLARLILGKLPVWNGNLIHY 405

Query: 355 S-QYTXXXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
           S  Y                + P +H++ +KKYA ++FM+AS   ++W  K
Sbjct: 406 SGGYRISDMRECIELMFQYLIAPIEHDEFFKKYAMRKFMRASTLCRNWAKK 456



>gi|429852555|gb|ELA27687.1| g2 mitotic-specific cyclin cdc13 [Colletotrichum gloeosporioides
           Nara gc5]
          Length = 632

 Score =  282 bits (721), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 130/283 (45%), Positives = 197/283 (69%), Gaps = 2/283 (0%)

Query: 124 EFDRKRSKKQKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSEL 183
           E +  R+  + T+  E++D D+ +D  M++EY  DIF+Y+++LE +++P P YM  Q+E+
Sbjct: 317 ELETARAIVESTRTQEEVD-DEIWDVCMVAEYGDDIFEYMRELEMKMLPDPHYMDHQAEI 375

Query: 184 SWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAK 243
            W MR +L+DWLI+VHH+F LLPETLFL VN IDRFLS +VVS+ KLQLVG T L +A+K
Sbjct: 376 QWSMRSVLMDWLIQVHHRFSLLPETLFLTVNYIDRFLSYKVVSIGKLQLVGATALLVASK 435

Query: 244 YEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDI 303
           YEE+  PS++  ++M DNGY  +EILKAER++L+ + F+L +P PM+FLRR SKAD +D+
Sbjct: 436 YEEINCPSLQEIVFMVDNGYKIDEILKAERFMLSMLSFELGFPGPMSFLRRVSKADDYDL 495

Query: 304 QARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXX 363
           + RT+AKY +E++++D +F+  PPS +AAAA  LSR +L + +W    +HYS YT     
Sbjct: 496 ETRTLAKYFLEVTIMDERFVASPPSFLAAAAHCLSRLILKKGDWTPAHVHYSGYTWAQLK 555

Query: 364 XXXXXXXXXXMKPTKHE-QLYKKYAAKRFMKASIFVKDWISKN 405
                       P KH   +++KY+ KR+ +A+ +V+  ++K 
Sbjct: 556 NLVSMVLECCYNPRKHHLAVFEKYSDKRYKRAAEYVQAELAKG 598



>gi|238881947|gb|EEQ45585.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 492

 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 201/285 (70%), Gaps = 6/285 (2%)

Query: 126 DRKRSKKQKTQ----DWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQS 181
           +R +S  +K++    +W+DLD +D  D +M+SEY  +IF Y  +LE+ ++P P Y+  Q+
Sbjct: 172 ERSQSYHKKSRLIDYEWQDLDEEDSDDQLMVSEYVNEIFSYYYELETRMLPDPQYLFKQT 231

Query: 182 ELSWRMRGILVDWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIA 241
            L  RMR ILVDWL+E+H KF+LLPE+LFLAVN++DRF+SV VV + KLQL+    LF A
Sbjct: 232 LLKPRMRSILVDWLVEMHLKFKLLPESLFLAVNVMDRFMSVEVVQIDKLQLLATAALFTA 291

Query: 242 AKYEELLAPSIKNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHF 301
           AKYEE+ +PS+KN+ Y  D  YT EE+++AE+Y+LT ++F L YPNPMNFLRR SKAD +
Sbjct: 292 AKYEEVFSPSVKNYAYFTDGSYTPEEVVQAEKYMLTILNFDLNYPNPMNFLRRISKADDY 351

Query: 302 DIQARTVAKYLMEISLVDYKFLPLPPSMIAAAALYLSRKMLNR-SEWHANLIHYS-QYTX 359
           D+Q+RT+ KYL+EI++VDYKF+ + PS+  A+A+YL+R +L +   W+ NLIHYS  Y  
Sbjct: 352 DVQSRTLGKYLLEITIVDYKFIGMRPSLCCASAMYLARLILGKLPVWNGNLIHYSGGYRI 411

Query: 360 XXXXXXXXXXXXXXMKPTKHEQLYKKYAAKRFMKASIFVKDWISK 404
                         + P +H++ +KKYA ++FM+AS   ++W  K
Sbjct: 412 SDMRECIELMFQYLIAPIEHDEFFKKYAMRKFMRASTLCRNWAKK 456



>gi|501304845|dbj|GAC94124.1| hypothetical protein PHSY_001693 [Pseudozyma hubeiensis SY62]
          Length = 543

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 128/269 (47%), Positives = 193/269 (71%), Gaps = 3/269 (1%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD ++  D  M++EY+ +IF Y+   E E M  P+YM  QSE+ W MR  LVDWL++VH 
Sbjct: 255 LDPEEVRDTSMMAEYSNEIFSYMARCERETMANPNYMEFQSEIHWHMRATLVDWLLQVHM 314

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           ++ +LPETL++A+N++DRFLSVRVVSL KLQLVG+T +FIAAKYEE+LAPS+K F+YM +
Sbjct: 315 RYHMLPETLWIAINVVDRFLSVRVVSLAKLQLVGVTAMFIAAKYEEILAPSVKEFVYMTE 374

Query: 261 NGYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
            GY++EEILK ER +L+T+DF +  Y +P +++R+ SKAD +DI+ RT++K+LME++L+D
Sbjct: 375 GGYSQEEILKGERIILSTLDFNISSYCSPYSWVRKISKADDYDIRTRTLSKFLMELALLD 434

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++FL   PS++AA  ++L++KML   EW    ++YS +T               +     
Sbjct: 435 HRFLRARPSLVAAVGMFLAKKMLG-GEWDDAFVYYSDFTEEQLVPGANLLLERLLDQGFE 493

Query: 380 EQ-LYKKYAAKRFMKASIFVKDWISKNVE 407
           +Q +Y+KY+ K+F+KAS+F +DW  +N E
Sbjct: 494 DQFVYRKYSNKKFLKASVFARDWAFQNHE 522



>gi|336472682|gb|EGO60842.1| hypothetical protein NEUTE1DRAFT_119955 [Neurospora tetrasperma
           FGSC 2508]
 gi|350294082|gb|EGZ75167.1| hypothetical protein NEUTE2DRAFT_155668 [Neurospora tetrasperma
           FGSC 2509]
          Length = 652

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 182/260 (70%), Gaps = 1/260 (0%)

Query: 147 YDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLP 206
           +D  M++EY  +IF+YL++LE  ++P P YM  Q+E+ W MR +L+DWL++VHH+F LLP
Sbjct: 376 WDVSMVAEYGDEIFEYLRELEERMLPNPHYMDIQTEIRWSMRSVLMDWLVQVHHRFSLLP 435

Query: 207 ETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEE 266
           ETLFL VN IDRFLSV+VVSL KLQLVG T +F+AAKYEE+  PSI+  +YM D GY+ E
Sbjct: 436 ETLFLTVNYIDRFLSVKVVSLGKLQLVGATAIFVAAKYEEINCPSIQELVYMVDQGYSVE 495

Query: 267 EILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLP 326
           EILKAE+++LT ++F+L +P PM+FLRR SKAD +D++ RT+AKYL+E++++D +F+  P
Sbjct: 496 EILKAEKFMLTMLNFELGWPGPMSFLRRISKADDYDLETRTLAKYLLEVTIMDERFVGCP 555

Query: 327 PSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQ-LYKK 385
            S +AA A  LSR  L R  W    +H+S YT                +P KH   +Y K
Sbjct: 556 ASYLAAGAHCLSRFFLQRGPWTHAHVHFSGYTLAQLRPLIISILDCCQEPRKHHGAVYDK 615

Query: 386 YAAKRFMKASIFVKDWISKN 405
           Y+ +RF  AS FV+  I+K 
Sbjct: 616 YSHQRFKSASTFVEGKIAKG 635



>gi|392564147|gb|EIW57325.1| hypothetical protein TRAVEDRAFT_126038 [Trametes versicolor
           FP-101664 SS1]
          Length = 355

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/262 (48%), Positives = 194/262 (74%), Gaps = 3/262 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D +D  M+SEYA DIF+Y+++LE ++MP  DYM+ Q+E++W+MR  LVDWL++VH +
Sbjct: 79  DEVDEFDMTMVSEYAEDIFEYMQELEEDVMPSADYMTGQTEINWQMRQTLVDWLLQVHLR 138

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + +LPETL++A+NI+DRFL+ RVVSL+KLQLVG+T +FIAAKYEE+LAPS++ F++M + 
Sbjct: 139 YHMLPETLWIAINIVDRFLTKRVVSLMKLQLVGVTAMFIAAKYEEILAPSVEEFVFMTER 198

Query: 262 GYTEEEILKAERYVLTTIDFKLC-YPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GY++EEILK ER +L T+DFK+  Y +P +++R+ SKAD +DIQ RT++K+L E++L+DY
Sbjct: 199 GYSKEEILKGERIMLQTLDFKVSQYCSPYSWMRKISKADDYDIQTRTLSKFLTEVTLLDY 258

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT-KH 379
           +FL + PSM+AA  +Y +RKML   +W+   ++YS +T                +     
Sbjct: 259 RFLRVKPSMVAAVGMYTARKMLG-GDWNEAFVYYSGFTEEHLLPGHKLLVDKLAEDDFAS 317

Query: 380 EQLYKKYAAKRFMKASIFVKDW 401
           + + KKYA K+F+KAS++  DW
Sbjct: 318 QHVCKKYATKKFLKASLYAVDW 339



>gi|451997873|gb|EMD90338.1| hypothetical protein COCHEDRAFT_1157353 [Bipolaris maydis C5]
 gi|477592378|gb|ENI09449.1| hypothetical protein COCC4DRAFT_56975 [Bipolaris maydis ATCC 48331]
          Length = 602

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/268 (47%), Positives = 185/268 (69%), Gaps = 2/268 (0%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           ED++ D+ +D  M++EY  +IF+Y+  LE  + P   YM  Q+E+ W MR +L+DWL++V
Sbjct: 317 EDVE-DEQWDTSMVAEYGEEIFEYMHSLEERMKPNASYMDHQAEIQWSMRSVLMDWLVQV 375

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H++F LLPETLFLAVN +DRFLS +VVSL KLQLVG T LF+AAKYEE+  PS++  +YM
Sbjct: 376 HNRFTLLPETLFLAVNYVDRFLSCKVVSLGKLQLVGATALFVAAKYEEINCPSVQEIVYM 435

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
            D  YT +E+LKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT++KY +EI+++
Sbjct: 436 VDGAYTADEVLKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLSKYFLEITIM 495

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D +F+   PS ++A A  L+R ML + +W  + +HYS YT                 P K
Sbjct: 496 DERFVGCAPSFLSAGAHCLARFMLKKGDWSQSHVHYSGYTLTQLRQLITVILECCDNPQK 555

Query: 379 HE-QLYKKYAAKRFMKASIFVKDWISKN 405
           H   +Y+KY  KR+ +ASIFV+  ISK 
Sbjct: 556 HHAAVYEKYTDKRYKRASIFVEAEISKG 583



>gi|367036907|ref|XP_003648834.1| hypothetical protein THITE_2106718 [Thielavia terrestris NRRL 8126]
 gi|346996095|gb|AEO62498.1| hypothetical protein THITE_2106718 [Thielavia terrestris NRRL 8126]
          Length = 678

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/268 (47%), Positives = 185/268 (69%), Gaps = 1/268 (0%)

Query: 144 DDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFR 203
           +D +D  M++EY+ +IF Y+++LE++++P P YM  Q+E+ W MR +L+DWL++VHH+F 
Sbjct: 376 EDAWDVSMVTEYSDEIFAYMRELEAQMLPNPHYMDIQTEIQWSMRSVLMDWLVQVHHRFC 435

Query: 204 LLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGY 263
           LLPETLFLAVN IDRFLSV+VVSL KLQLVG T L +AAKYEE+  PS++  +YM D+GY
Sbjct: 436 LLPETLFLAVNYIDRFLSVKVVSLGKLQLVGATALLVAAKYEEINCPSVQEIVYMVDSGY 495

Query: 264 TEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
           T +EI KAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY +EI+++D +F+
Sbjct: 496 TVDEIQKAERFMLSMLQFELGWPGPMSFLRRISKADEYDLETRTLAKYFLEITIMDERFV 555

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQ-L 382
             PPS +AA A  +SR  L +  W  + +HYS YT                 P KH   +
Sbjct: 556 SSPPSFLAAGAHCISRLFLGKGGWTPSHVHYSGYTFSQLKPLINMLFECCQYPGKHHSAV 615

Query: 383 YKKYAAKRFMKASIFVKDWISKNVERQQ 410
           Y KYA  ++  +S F++  I+  V   Q
Sbjct: 616 YDKYATPKYKHSSTFIESKIASGVTLAQ 643



>gi|494827097|gb|EON64113.1| hypothetical protein W97_03343 [Coniosporium apollinis CBS 100218]
          Length = 667

 Score =  281 bits (718), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 130/276 (47%), Positives = 190/276 (68%), Gaps = 2/276 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+ +D  M++EY  +IF Y++ LE  + P P YM +Q+E+ W MR +L+
Sbjct: 374 ESTKTAEDIE-DEAWDTSMVAEYGDEIFDYMRQLEERMRPNPYYMDNQAEIQWSMRSVLM 432

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL+VN +DRFLS +VVSL KLQLVG T +F+AAKYEE+  PS+
Sbjct: 433 DWLVQVHHRFNLLPETLFLSVNYVDRFLSCKVVSLNKLQLVGATAIFVAAKYEEINCPSV 492

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM D+GY+ +EILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY 
Sbjct: 493 QEIVYMVDSGYSVDEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYF 552

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +EI+++D +F+   PS  AAAA  L+R ML + +W    ++YS YT              
Sbjct: 553 LEITIMDERFVGCAPSFTAAAAHCLARFMLRKGDWSPAHVYYSNYTLSQLRHLLSVMLEC 612

Query: 373 XMKPTKHEQ-LYKKYAAKRFMKASIFVKDWISKNVE 407
              P KH   +Y KYA KR+ KAS FV+  ++   +
Sbjct: 613 CEHPQKHHSAVYDKYADKRYKKASRFVEGELANGFQ 648



>gi|90888880|gb|AAP94020.2| B-type cyclin 2 [Ustilago maydis]
          Length = 604

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 191/267 (71%), Gaps = 3/267 (1%)

Query: 141 LDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHH 200
           LD ++  D  M++EY+ +IF Y+   E E M  P+YM  QSE+ W MR  LVDWL++VH 
Sbjct: 319 LDPEEVRDTSMVAEYSNEIFSYMARCERETMANPNYMEFQSEIHWHMRATLVDWLLQVHM 378

Query: 201 KFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMAD 260
           ++ +LPETL++A+N++DRFLSVRVVSL KLQLVG+T +FIAAKYEE+LAPS+K F+YM +
Sbjct: 379 RYHMLPETLWIAINVVDRFLSVRVVSLAKLQLVGVTAMFIAAKYEEILAPSVKEFVYMTE 438

Query: 261 NGYTEEEILKAERYVLTTIDFKL-CYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVD 319
            GY++EEILK ER +L+T+ F +  Y +P +++R+ SKAD +DI+ RT++K+LME++L+D
Sbjct: 439 GGYSQEEILKGERIILSTLGFNISSYCSPYSWVRKISKADDYDIRTRTLSKFLMELALLD 498

Query: 320 YKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKH 379
           ++FL   PS++AA  ++L++KML   EW    ++YS +T               +     
Sbjct: 499 HRFLRARPSLVAAVGMFLAKKMLG-GEWDDAFVYYSDFTEEQLVPGANLLLERLLDQGFE 557

Query: 380 EQ-LYKKYAAKRFMKASIFVKDWISKN 405
           EQ +Y+KY+ K+F++AS+F +DW  +N
Sbjct: 558 EQFVYRKYSNKKFLRASVFARDWAFQN 584



>gi|392594698|gb|EIW84022.1| hypothetical protein CONPUDRAFT_49528 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 352

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 191/259 (73%), Gaps = 3/259 (1%)

Query: 145 DFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRL 204
           DF+D  M+SEYA +IF+Y+++LE +IMP PDYM  Q+E++W MR  LVDWL++VH ++ +
Sbjct: 79  DFFDTTMVSEYAEEIFEYMENLEEDIMPNPDYMDGQNEINWSMRQTLVDWLLQVHLRWHM 138

Query: 205 LPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYT 264
           LPETL++A+NI+DRFL+ RVVSLVKLQLVG+T +FIAAKYEE+LAPS+  F++M +NG+ 
Sbjct: 139 LPETLWIAINIVDRFLTRRVVSLVKLQLVGVTAMFIAAKYEEILAPSVDEFVFMTENGFK 198

Query: 265 EEEILKAERYVLTTIDFKLC-YPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFL 323
            EEILK ER VL T+DFK+  Y +P +++RR SKAD +D+  RT+ K+L E++L+D++FL
Sbjct: 199 REEILKGERIVLQTLDFKISQYCSPYSWMRRISKADDYDLHTRTLGKFLAEVTLLDHRFL 258

Query: 324 PLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPT-KHEQL 382
              PS+IAA ++Y +RKML   +W+   +++S +                ++ + K + +
Sbjct: 259 RCKPSLIAAVSMYSARKMLG-GKWNDAFVYHSGFVAEHLEQGHQWICEKLLEESFKEQHV 317

Query: 383 YKKYAAKRFMKASIFVKDW 401
            +KYA K+F+KASI+  DW
Sbjct: 318 CQKYAHKKFLKASIYAIDW 336



>gi|451847193|gb|EMD60501.1| hypothetical protein COCSADRAFT_174783 [Bipolaris sorokiniana
           ND90Pr]
          Length = 608

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 128/268 (47%), Positives = 185/268 (69%), Gaps = 2/268 (0%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           ED++ D+ +D  M++EY  +IF+Y+  LE  + P   YM  Q+E+ W MR +L+DWL++V
Sbjct: 323 EDVE-DEQWDTSMVAEYGEEIFEYMHSLEERMKPNASYMDHQAEIQWSMRSVLMDWLVQV 381

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H++F LLPETLFLAVN +DRFLS +VVSL KLQLVG T LF+AAKYEE+  PS++  +YM
Sbjct: 382 HNRFTLLPETLFLAVNYVDRFLSCKVVSLGKLQLVGATALFVAAKYEEINCPSVQEIVYM 441

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
            D  YT +E+LKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT++KY +EI+++
Sbjct: 442 VDGAYTADEVLKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLSKYFLEITIM 501

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D +F+   PS ++A A  L+R ML + +W  + +HYS YT                 P K
Sbjct: 502 DERFVGCAPSFLSAGAHCLARFMLKKGDWSQSHVHYSGYTLTQLRQLITVILECCDNPQK 561

Query: 379 HE-QLYKKYAAKRFMKASIFVKDWISKN 405
           H   +Y+KY  KR+ +ASIFV+  ISK 
Sbjct: 562 HHAAVYEKYTDKRYKRASIFVEAEISKG 589



>gi|156041186|ref|XP_001587579.1| hypothetical protein SS1G_11572 [Sclerotinia sclerotiorum 1980]
 gi|154695955|gb|EDN95693.1| hypothetical protein SS1G_11572 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 635

 Score =  280 bits (716), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 130/279 (46%), Positives = 193/279 (69%), Gaps = 8/279 (2%)

Query: 139 EDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEV 198
           ED++ D+ +D  M++EY  +IF Y+++LE++++P P YM +Q+E+ W MR +L+DWLI+V
Sbjct: 323 EDIE-DEMWDTSMVAEYGEEIFSYMRELENKLLPDPHYMDTQAEIQWSMRSVLMDWLIQV 381

Query: 199 HHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYM 258
           H +F LLPETLFL VN IDRFLS +VVSL KLQLVG T +F+AAKYEE+  PSI   +YM
Sbjct: 382 HQRFSLLPETLFLCVNYIDRFLSKKVVSLGKLQLVGATAIFVAAKYEEINCPSIGEIVYM 441

Query: 259 ADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLV 318
            D GY+ EEILKAER++L+ + F+L +P PM+FLRR SKAD +D++ RT+AKY +E++++
Sbjct: 442 VDGGYSSEEILKAERFMLSMLQFELGWPGPMSFLRRISKADDYDLETRTLAKYFLEVTIM 501

Query: 319 DYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTK 378
           D +F+  PPS +AAA+  ++R ML + +W    ++YS YT                   K
Sbjct: 502 DERFVGSPPSFVAAASHAVARFMLGKGDWSPAHVYYSGYTWNQLKPLVSLVMECCENARK 561

Query: 379 HE-QLYKKYAAKRFMKASIFVKDWISKN------VERQQ 410
           H   +++KY+ +R+ +AS +V+D + K       V RQQ
Sbjct: 562 HHAAVFEKYSDRRYKRASTYVEDQMIKGFQIPGIVRRQQ 600



>gi|71002538|ref|XP_755950.1| G2/mitotic-specific cyclin (Clb3) [Aspergillus fumigatus Af293]
 gi|66853588|gb|EAL93912.1| G2/mitotic-specific cyclin (Clb3), putative [Aspergillus fumigatus
           Af293]
 gi|159130007|gb|EDP55121.1| G2/mitotic-specific cyclin, putative [Aspergillus fumigatus A1163]
          Length = 636

 Score =  280 bits (716), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 191/274 (69%), Gaps = 2/274 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+++D  M++EY+ +IF+Y+++ E  ++P   YM +Q+E+ W MR +L+
Sbjct: 336 EATRTAEDIE-DEYWDTSMVAEYSDEIFEYMREQEIRMLPNAHYMDNQAEIQWSMRSVLM 394

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 395 DWLVQVHHRFSLLPETLFLCVNYIDRFLSSKIVSLGKLQLVGATAIFIAAKYEEINCPSV 454

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM D GYT +EILKAER++L+ + F+L +P PM+FLR+ SKAD +D++ RT+AKY 
Sbjct: 455 QEIVYMVDGGYTVDEILKAERFMLSMLQFELGWPGPMSFLRKISKADDYDLETRTLAKYF 514

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +E++++D +F+  PPS +AA A  L+R ML +  W  + +HY+ YT              
Sbjct: 515 LEVTIMDERFVGSPPSFLAAGAHCLARLMLRKGTWTPSHVHYAGYTYSQLYPLVSLILEC 574

Query: 373 XMKPTKHEQ-LYKKYAAKRFMKASIFVKDWISKN 405
              P KH   +++KY  KRF +AS+F +  I K 
Sbjct: 575 CEIPRKHHSAIFEKYTDKRFKRASLFAEAEIKKG 608



>gi|119482101|ref|XP_001261079.1| G2/mitotic-specific cyclin, putative [Neosartorya fischeri NRRL
           181]
 gi|119409233|gb|EAW19182.1| G2/mitotic-specific cyclin, putative [Neosartorya fischeri NRRL
           181]
          Length = 636

 Score =  280 bits (715), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 191/274 (69%), Gaps = 2/274 (0%)

Query: 133 QKTQDWEDLDADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILV 192
           + T+  ED++ D+++D  M++EY+ +IF+Y+++ E  ++P   YM +Q+E+ W MR +L+
Sbjct: 336 EATRTAEDIE-DEYWDTSMVAEYSDEIFEYMREQEIRMLPNAHYMDNQAEIQWSMRSVLM 394

Query: 193 DWLIEVHHKFRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSI 252
           DWL++VHH+F LLPETLFL VN IDRFLS ++VSL KLQLVG T +FIAAKYEE+  PS+
Sbjct: 395 DWLVQVHHRFSLLPETLFLCVNYIDRFLSSKIVSLGKLQLVGATAIFIAAKYEEINCPSV 454

Query: 253 KNFIYMADNGYTEEEILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYL 312
           +  +YM D GYT +EILKAER++L+ + F+L +P PM+FLR+ SKAD +D++ RT+AKY 
Sbjct: 455 QEIVYMVDGGYTVDEILKAERFMLSMLQFELGWPGPMSFLRKISKADDYDLETRTLAKYF 514

Query: 313 MEISLVDYKFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXX 372
           +E++++D +F+  PPS +AA A  L+R ML +  W  + +HY+ YT              
Sbjct: 515 LEVTIMDERFVGSPPSFLAAGAHCLARLMLRKGAWTPSHVHYAGYTYSQLYPLVSLILEC 574

Query: 373 XMKPTKHEQ-LYKKYAAKRFMKASIFVKDWISKN 405
              P KH   +++KY  KRF +AS+F +  I K 
Sbjct: 575 CEIPRKHHSAIFEKYTDKRFKRASLFAEAEIKKG 608



>gi|164426098|ref|XP_961608.2| hypothetical protein NCU01242 [Neurospora crassa OR74A]
 gi|16944477|emb|CAC28649.2| related to cyclin B3 [Neurospora crassa]
 gi|157071198|gb|EAA32372.2| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 653

 Score =  280 bits (715), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 181/260 (69%), Gaps = 1/260 (0%)

Query: 147 YDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHKFRLLP 206
           +D  M++EY  +IF+YL++LE  ++P P YM  Q+E+ W MR +L+DWL++VHH+F LLP
Sbjct: 377 WDVSMVAEYGDEIFEYLRELEERMLPNPHYMDIQTEIRWSMRSVLMDWLVQVHHRFSLLP 436

Query: 207 ETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADNGYTEE 266
           ETLFL VN IDRFLSV+VVSL KLQLVG T +F+AAKYEE+  PSI+  +YM D GY+ E
Sbjct: 437 ETLFLTVNYIDRFLSVKVVSLGKLQLVGATAIFVAAKYEEINCPSIQELVYMVDQGYSVE 496

Query: 267 EILKAERYVLTTIDFKLCYPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDYKFLPLP 326
           EILKAE+++LT ++F+L +P PM+FLRR SKAD +D++ RT+AKYL+E++++D +F+  P
Sbjct: 497 EILKAEKFMLTMLNFELGWPGPMSFLRRISKADDYDLETRTLAKYLLEVTIMDERFVGCP 556

Query: 327 PSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHEQ-LYKK 385
            S +AA A  LSR  L R  W    +H+S YT                +P KH   +Y K
Sbjct: 557 ASYLAAGAHCLSRFFLQRGPWTHAHVHFSGYTLAQLRPLIISILDCCQEPRKHHGAVYDK 616

Query: 386 YAAKRFMKASIFVKDWISKN 405
           Y+ +RF  AS FV+  I+  
Sbjct: 617 YSHQRFKSASTFVEGKIANG 636



>gi|395332283|gb|EJF64662.1| hypothetical protein DICSQDRAFT_52549 [Dichomitus squalens LYAD-421
           SS1]
          Length = 356

 Score =  279 bits (714), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 195/262 (74%), Gaps = 3/262 (1%)

Query: 142 DADDFYDPMMISEYAVDIFKYLKDLESEIMPKPDYMSSQSELSWRMRGILVDWLIEVHHK 201
           D  D +D  M+SEYA DIF+Y+++LE ++MP PDYM+ Q+EL+W+MR  LVDWL++VH +
Sbjct: 80  DEVDEFDTTMVSEYAEDIFEYMQELEEDVMPGPDYMNGQTELNWQMRQTLVDWLLQVHLR 139

Query: 202 FRLLPETLFLAVNIIDRFLSVRVVSLVKLQLVGITGLFIAAKYEELLAPSIKNFIYMADN 261
           + LLPETL++AVNI+DRFL+ R+VS++KLQLVG+T +FIAAKYEE+LAPS+  F++M + 
Sbjct: 140 YHLLPETLWIAVNIVDRFLTKRIVSMLKLQLVGVTAMFIAAKYEEILAPSVDEFVFMTEG 199

Query: 262 GYTEEEILKAERYVLTTIDFKLC-YPNPMNFLRRSSKADHFDIQARTVAKYLMEISLVDY 320
           GY++EEILK ER +L T+DFK+  Y +P +++R+ SKAD +D+Q RT++K+L E++L+D+
Sbjct: 200 GYSKEEILKGERIMLQTLDFKVSQYCSPYSWMRKISKADDYDLQTRTLSKFLTEVTLLDH 259

Query: 321 KFLPLPPSMIAAAALYLSRKMLNRSEWHANLIHYSQYTXXXXXXXXXXXXXXXMKPTKHE 380
           +FL + PS++AA  +Y +R+ML   +W+   ++YS +T                +    +
Sbjct: 260 RFLRVKPSLVAAIGMYTARRMLG-GDWNEAFVYYSSFTEEHLLPGHKLLIEKLTEDGFCD 318

Query: 381 Q-LYKKYAAKRFMKASIFVKDW 401
           Q + KKYA K+F+KAS++  +W
Sbjct: 319 QHVCKKYATKKFLKASLYAVEW 340