BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10369_c0_seq1-m.144 complete 227-1312(-) 362 (-)
         (361 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511007173|gb|EPB88470.1| NAK protein kinase [Mucor circinello...   396   e-108   Mucor circinelloides f. circinelloides 1006PhL
gi|169859290|ref|XP_001836285.1| other/NAK protein kinase [Copri...   382   e-103   Coprinopsis cinerea okayama7#130
gi|302683791|ref|XP_003031576.1| hypothetical protein SCHCODRAFT...   380   e-103   Schizophyllum commune H4-8
gi|390600491|gb|EIN09886.1| Pkinase-domain-containing protein [P...   376   e-102   Punctularia strigosozonata HHB-11173 SS5
gi|511010600|gb|EPB91820.1| NAK protein kinase [Mucor circinello...   373   e-101   Mucor circinelloides f. circinelloides 1006PhL
gi|449540347|gb|EMD31340.1| hypothetical protein CERSUDRAFT_1199...   359   5e-97   Gelatoporia subvermispora B
gi|170098785|ref|XP_001880611.1| predicted protein [Laccaria bic...   358   1e-96   Laccaria bicolor S238N-H82
gi|395332170|gb|EJF64549.1| Pkinase-domain-containing protein [D...   356   6e-96   Dichomitus squalens LYAD-421 SS1
gi|403417552|emb|CCM04252.1| predicted protein [Fibroporia radic...   356   7e-96   Fibroporia radiculosa
gi|426199049|gb|EKV48974.1| hypothetical protein AGABI2DRAFT_191...   340   5e-91   Agaricus bisporus var. bisporus H97
gi|405118529|gb|AFR93303.1| other/NAK protein kinase [Cryptococc...   337   3e-90   
gi|392576326|gb|EIW69457.1| hypothetical protein TREMEDRAFT_3906...   334   3e-89   Tremella mesenterica DSM 1558
gi|321251918|ref|XP_003192223.1| serine/threonine-protein kinase...   332   1e-88   Cryptococcus gattii WM276
gi|58263206|ref|XP_569013.1| serine/threonine-protein kinase [Cr...   331   2e-88   Cryptococcus neoformans var. neoformans JEC21
gi|494824805|gb|EON62059.1| NAK protein kinase [Coniosporium apo...   325   1e-86   Coniosporium apollinis CBS 100218
gi|134108190|ref|XP_777046.1| hypothetical protein CNBB2780 [Cry...   324   2e-86   Cryptococcus neoformans var. neoformans B-3501A
gi|393239705|gb|EJD47235.1| other/NAK protein kinase [Auriculari...   322   8e-86   Auricularia subglabra TFB-10046 SS5
gi|485926093|gb|EOD50465.1| putative serine threonine protein [N...   322   1e-85   Neofusicoccum parvum UCRNP2
gi|512207232|gb|EPE36050.1| Protein kinase-like (PK-like) [Glare...   315   9e-84   Glarea lozoyensis ATCC 20868
gi|449299431|gb|EMC95445.1| hypothetical protein BAUCODRAFT_5418...   314   2e-83   Baudoinia panamericana UAMH 10762
gi|296417038|ref|XP_002838172.1| hypothetical protein [Tuber mel...   314   2e-83   Tuber melanosporum Mel28
gi|407929432|gb|EKG22262.1| hypothetical protein MPH_00441 [Macr...   313   3e-83   Macrophomina phaseolina MS6
gi|50545942|ref|XP_500508.1| YALI0B04840p [Yarrowia lipolytica] ...   313   4e-83   Yarrowia lipolytica CLIB122
gi|511006741|gb|EPB88047.1| NAK protein kinase [Mucor circinello...   313   4e-83   Mucor circinelloides f. circinelloides 1006PhL
gi|259486792|tpe|CBF84937.1| TPA: serine/threonine protein kinas...   311   2e-82   Aspergillus nidulans FGSC A4
gi|242799422|ref|XP_002483375.1| serine/threonine protein kinase...   310   6e-82   Talaromyces stipitatus ATCC 10500
gi|154324130|ref|XP_001561379.1| hypothetical protein BC1G_00464...   309   6e-82   Botrytis cinerea B05.10
gi|67522038|ref|XP_659080.1| hypothetical protein AN1476.2 [Aspe...   309   1e-81   Aspergillus nidulans FGSC A4
gi|156057459|ref|XP_001594653.1| hypothetical protein SS1G_04461...   308   1e-81   Sclerotinia sclerotiorum 1980 UF-70
gi|358372717|dbj|GAA89319.1| serine/threonine protein kinase [As...   305   1e-80   Aspergillus kawachii IFO 4308
gi|367019848|ref|XP_003659209.1| hypothetical protein MYCTH_2295...   305   1e-80   Myceliophthora thermophila ATCC 42464
gi|396471105|ref|XP_003838791.1| similar to serine/threonine pro...   305   2e-80   Leptosphaeria maculans JN3
gi|258575663|ref|XP_002542013.1| conserved hypothetical protein ...   304   2e-80   Uncinocarpus reesii 1704
gi|302916695|ref|XP_003052158.1| predicted protein [Nectria haem...   304   3e-80   Nectria haematococca mpVI 77-13-4
gi|477536904|gb|ENH88364.1| serine threonine protein [Colletotri...   304   3e-80   Colletotrichum orbiculare MAFF 240422
gi|408388337|gb|EKJ68023.1| hypothetical protein FPSE_11834 [Fus...   304   3e-80   Fusarium pseudograminearum CS3096
gi|115491099|ref|XP_001210177.1| conserved hypothetical protein ...   303   4e-80   Aspergillus terreus NIH2624
gi|46124909|ref|XP_387008.1| hypothetical protein FG06832.1 [Fus...   303   4e-80   
gi|330921804|ref|XP_003299571.1| hypothetical protein PTT_10595 ...   303   4e-80   Pyrenophora teres f. teres 0-1
gi|317036327|ref|XP_001398116.2| serine/threonine protein kinase...   303   6e-80   Aspergillus niger CBS 513.88
gi|500259216|gb|EOO02046.1| putative serine threonine protein [T...   303   6e-80   Phaeoacremonium minimum UCRPA7
gi|169603361|ref|XP_001795102.1| hypothetical protein SNOG_04689...   302   9e-80   Parastagonospora nodorum SN15
gi|482812259|gb|EOA88991.1| hypothetical protein SETTUDRAFT_1763...   302   1e-79   Setosphaeria turcica Et28A
gi|452836488|gb|EME38432.1| hypothetical protein DOTSEDRAFT_1815...   302   1e-79   Dothistroma septosporum NZE10
gi|302667311|ref|XP_003025242.1| hypothetical protein TRV_00558 ...   301   1e-79   Trichophyton verrucosum HKI 0517
gi|134083676|emb|CAK47067.1| unnamed protein product [Aspergillu...   301   2e-79   Aspergillus niger
gi|189203749|ref|XP_001938210.1| serine/threonine kinase 16 [Pyr...   301   2e-79   Pyrenophora tritici-repentis Pt-1C-BFP
gi|406864183|gb|EKD17229.1| serine/threonine kinase 16 [Marssoni...   301   3e-79   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|315046264|ref|XP_003172507.1| NAK protein kinase [Arthroderma...   300   3e-79   Microsporum gypseum CBS 118893
gi|326472058|gb|EGD96067.1| NAK protein kinase [Trichophyton ton...   300   3e-79   Trichophyton tonsurans CBS 112818
gi|70983492|ref|XP_747273.1| serine/threonine protein kinase [As...   300   3e-79   Aspergillus fumigatus Af293
gi|326477077|gb|EGE01087.1| NAK protein kinase [Trichophyton equ...   300   4e-79   Trichophyton equinum CBS 127.97
gi|296806105|ref|XP_002843872.1| serine/threonine-protein kinase...   300   5e-79   Arthroderma otae CBS 113480
gi|121719755|ref|XP_001276576.1| serine/threonine protein kinase...   300   6e-79   Aspergillus clavatus NRRL 1
gi|169772815|ref|XP_001820876.1| serine/threonine protein kinase...   299   6e-79   Aspergillus oryzae RIB40
gi|452001840|gb|EMD94299.1| hypothetical protein COCHEDRAFT_1130...   299   9e-79   Bipolaris maydis C5
gi|212541238|ref|XP_002150774.1| serine/threonine protein kinase...   299   1e-78   Talaromyces marneffei ATCC 18224
gi|119195613|ref|XP_001248410.1| hypothetical protein CIMG_02181...   298   1e-78   Coccidioides immitis RS
gi|119484224|ref|XP_001262015.1| serine/threonine protein kinase...   298   1e-78   Aspergillus fischeri NRRL 181
gi|322706981|gb|EFY98560.1| serine/threonine protein kinase, put...   298   2e-78   Metarhizium robertsii ARSEF 23
gi|429856192|gb|ELA31116.1| serine threonine protein [Colletotri...   298   2e-78   Colletotrichum gloeosporioides Nara gc5
gi|320582714|gb|EFW96931.1| Putative protein kinase [Ogataea par...   298   2e-78   
gi|255945327|ref|XP_002563431.1| Pc20g09350 [Penicillium chrysog...   297   3e-78   Penicillium rubens Wisconsin 54-1255
gi|451850018|gb|EMD63321.1| hypothetical protein COCSADRAFT_1206...   297   3e-78   Bipolaris sorokiniana ND90Pr
gi|406603414|emb|CCH45092.1| SNF1-related protein kinase catalyt...   297   3e-78   Wickerhamomyces ciferrii
gi|453082909|gb|EMF10956.1| serine/threonine protein kinase [Myc...   297   4e-78   Sphaerulina musiva SO2202
gi|378732459|gb|EHY58918.1| serine/threonine kinase 16 [Exophial...   296   4e-78   Exophiala dermatitidis NIH/UT8656
gi|226290970|gb|EEH46398.1| serine/threonine-protein kinase [Par...   296   5e-78   Paracoccidioides brasiliensis Pb18
gi|367044022|ref|XP_003652391.1| hypothetical protein THITE_2113...   296   6e-78   Thielavia terrestris NRRL 8126
gi|320040199|gb|EFW22132.1| serine/threonine protein kinase [Coc...   296   7e-78   Coccidioides posadasii str. Silveira
gi|310790825|gb|EFQ26358.1| hypothetical protein GLRG_01502 [Glo...   296   8e-78   Colletotrichum graminicola M1.001
gi|342890204|gb|EGU89066.1| hypothetical protein FOXB_00415 [Fus...   295   2e-77   Fusarium oxysporum Fo5176
gi|295665350|ref|XP_002793226.1| serine/threonine-protein kinase...   294   2e-77   Paracoccidioides lutzii Pb01
gi|225679259|gb|EEH17543.1| conserved hypothetical protein [Para...   294   2e-77   Paracoccidioides brasiliensis Pb03
gi|358377964|gb|EHK15647.1| hypothetical protein TRIVIDRAFT_3889...   294   3e-77   Trichoderma virens Gv29-8
gi|85090576|ref|XP_958483.1| hypothetical protein NCU07399 [Neur...   293   4e-77   Neurospora crassa OR74A
gi|340923805|gb|EGS18708.1| serine/threonine-protein kinase-like...   293   5e-77   Chaetomium thermophilum var. thermophilum DSM 1495
gi|350296141|gb|EGZ77118.1| kinase-like protein [Neurospora tetr...   293   7e-77   Neurospora tetrasperma FGSC 2509
gi|358391461|gb|EHK40865.1| hypothetical protein TRIATDRAFT_2270...   292   9e-77   Trichoderma atroviride IMI 206040
gi|336274094|ref|XP_003351801.1| hypothetical protein SMAC_00346...   291   2e-76   Sordaria macrospora k-hell
gi|336464058|gb|EGO52298.1| hypothetical protein NEUTE1DRAFT_717...   291   2e-76   Neurospora tetrasperma FGSC 2508
gi|398398297|ref|XP_003852606.1| hypothetical protein MYCGRDRAFT...   291   2e-76   Zymoseptoria tritici IPO323
gi|512190593|gb|EPE06356.1| serine threonine protein [Ophiostoma...   290   3e-76   Ophiostoma piceae UAMH 11346
gi|400602943|gb|EJP70541.1| serine/threonine protein kinase, put...   290   3e-76   Beauveria bassiana ARSEF 2860
gi|302506855|ref|XP_003015384.1| hypothetical protein ARB_06507 ...   290   4e-76   Arthroderma benhamiae CBS 112371
gi|261197992|ref|XP_002625398.1| serine/threonine protein kinase...   290   5e-76   Blastomyces gilchristii SLH14081
gi|171687497|ref|XP_001908689.1| hypothetical protein [Podospora...   290   5e-76   Podospora anserina S mat+
gi|239607789|gb|EEQ84776.1| serine/threonine protein kinase [Aje...   289   7e-76   Blastomyces dermatitidis ER-3
gi|425779381|gb|EKV17445.1| Serine/threonine protein kinase, put...   288   1e-75   Penicillium digitatum PHI26
gi|346322631|gb|EGX92230.1| serine/threonine protein kinase, put...   288   2e-75   Cordyceps militaris CM01
gi|471559833|gb|EMR62113.1| putative serine threonine-protein ki...   286   6e-75   Eutypa lata UCREL1
gi|340520232|gb|EGR50469.1| predicted protein [Trichoderma reese...   283   6e-74   Trichoderma reesei QM6a
gi|452979818|gb|EME79580.1| hypothetical protein MYCFIDRAFT_2088...   282   9e-74   Cercospora fijiensis CIRAD86
gi|345561453|gb|EGX44542.1| hypothetical protein AOL_s00188g210 ...   282   1e-73   Arthrobotrys oligospora ATCC 24927
gi|470288620|ref|XP_004342629.1| serine/threonine protein kinase...   280   4e-73   Capsaspora owczarzaki ATCC 30864
gi|344233875|gb|EGV65745.1| kinase-like protein [Candida tenuis ...   278   2e-72   Candida tenuis ATCC 10573
gi|465797000|emb|CCU97755.1| unnamed protein product [Malassezia...   274   4e-71   Malassezia sympodialis ATCC 42132
gi|459369215|gb|EMG47682.1| hypothetical protein G210_1908, part...   273   4e-71   Candida maltosa Xu316
gi|255729588|ref|XP_002549719.1| hypothetical protein CTRG_04016...   271   2e-70   Candida tropicalis MYA-3404
gi|350633170|gb|EHA21536.1| hypothetical protein ASPNIDRAFT_1293...   269   9e-70   Aspergillus niger ATCC 1015
gi|294656615|ref|XP_458913.2| DEHA2D10296p [Debaryomyces hanseni...   265   1e-68   Debaryomyces hansenii CBS767
gi|344299722|gb|EGW30075.1| hypothetical protein SPAPADRAFT_6369...   265   1e-68   Spathaspora passalidarum NRRL Y-27907
gi|225561907|gb|EEH10187.1| serine/threonine-protein kinase [Aje...   264   2e-68   Histoplasma capsulatum G186AR
gi|240275515|gb|EER39029.1| serine/threonine protein kinase [Aje...   263   7e-68   Histoplasma capsulatum H143
gi|260951069|ref|XP_002619831.1| hypothetical protein CLUG_00990...   261   2e-67   Clavispora lusitaniae ATCC 42720
gi|303321478|ref|XP_003070733.1| kinase domain containing protei...   257   3e-66   Coccidioides posadasii C735 delta SOWgp
gi|190348168|gb|EDK40577.2| hypothetical protein PGUG_04675 [Mey...   256   6e-66   Meyerozyma guilliermondii ATCC 6260
gi|146413499|ref|XP_001482720.1| hypothetical protein PGUG_04675...   256   6e-66   Meyerozyma guilliermondii ATCC 6260
gi|448088885|ref|XP_004196658.1| Piso0_003883 [Millerozyma farin...   256   9e-66   Millerozyma farinosa CBS 7064
gi|241957731|ref|XP_002421585.1| protein kinase, putative [Candi...   255   1e-65   Candida dubliniensis CD36
gi|238883539|gb|EEQ47177.1| conserved hypothetical protein [Cand...   250   4e-64   Candida albicans WO-1
gi|388583622|gb|EIM23923.1| kinase-like protein [Wallemia sebi C...   250   4e-64   Wallemia mellicola CBS 633.66
gi|68481690|ref|XP_715213.1| potential protein kinase [Candida a...   249   1e-63   Candida albicans SC5314
gi|150863878|ref|XP_001382503.2| serine/threonine protein kinase...   244   3e-62   Scheffersomyces stipitis CBS 6054
gi|505756995|gb|EOR01129.1| Serine/threonine-protein kinase ENV7...   240   4e-61   Wallemia ichthyophaga EXF-994
gi|254569012|ref|XP_002491616.1| Putative protein kinase that ex...   238   1e-60   Komagataella phaffii GS115
gi|164662347|ref|XP_001732295.1| hypothetical protein MGL_0070 [...   236   9e-60   Malassezia globosa CBS 7966
gi|19114467|ref|NP_593555.1| serine/threonine protein kinase Ppk...   235   1e-59   Schizosaccharomyces pombe 972h-
gi|196002665|ref|XP_002111200.1| hypothetical protein TRIADDRAFT...   231   3e-58   Trichoplax adhaerens
gi|448536343|ref|XP_003871101.1| hypothetical protein CORT_0G029...   230   5e-58   Candida orthopsilosis Co 90-125
gi|260794050|ref|XP_002592023.1| hypothetical protein BRAFLDRAFT...   229   1e-57   Branchiostoma floridae
gi|354548537|emb|CCE45274.1| hypothetical protein CPAR2_702870 [...   228   3e-57   Candida parapsilosis
gi|326433463|gb|EGD79033.1| NAK/MPSK protein kinase [Salpingoeca...   227   3e-57   Salpingoeca rosetta
gi|307181418|gb|EFN69013.1| Serine/threonine-protein kinase 16 [...   226   1e-56   Camponotus floridanus
gi|330799302|ref|XP_003287685.1| hypothetical protein DICPUDRAFT...   225   1e-56   Dictyostelium purpureum
gi|307205079|gb|EFN83550.1| Serine/threonine-protein kinase 16 [...   224   4e-56   Harpegnathos saltator
gi|470250690|ref|XP_004358442.1| putative protein serine/threoni...   221   2e-55   Dictyostelium fasciculatum
gi|380021181|ref|XP_003694450.1| PREDICTED: serine/threonine-pro...   218   2e-54   Apis florea [dwarf honeybee]
gi|336383935|gb|EGO25084.1| protein kinase [Serpula lacrymans va...   217   4e-54   Serpula lacrymans var. lacrymans S7.9
gi|392594915|gb|EIW84239.1| other/NAK protein kinase [Coniophora...   217   5e-54   Coniophora puteana RWD-64-598 SS2
gi|350398408|ref|XP_003485183.1| PREDICTED: serine/threonine-pro...   216   6e-54   Bombus impatiens
gi|336370516|gb|EGN98856.1| hypothetical protein SERLA73DRAFT_18...   216   7e-54   Serpula lacrymans var. lacrymans S7.3
gi|149235514|ref|XP_001523635.1| conserved hypothetical protein ...   216   8e-54   Lodderomyces elongisporus NRRL YB-4239
gi|332348546|gb|AEE60827.1| serine/threonine kinase [Haemaphysal...   216   8e-54   Haemaphysalis longicornis
gi|393221439|gb|EJD06924.1| other/NAK protein kinase [Fomitipori...   216   1e-53   Fomitiporia mediterranea MF3/22
gi|291392273|ref|XP_002712533.1| PREDICTED: serine/threonine kin...   215   2e-53   
gi|390354882|ref|XP_796127.2| PREDICTED: serine/threonine-protei...   215   2e-53   
gi|444514915|gb|ELV10670.1| Serine/threonine-protein kinase 16 [...   215   2e-53   Tupaia chinensis
gi|401842929|gb|EJT44928.1| ENV7-like protein [Saccharomyces kud...   214   2e-53   Saccharomyces kudriavzevii IFO 1802
gi|365758136|gb|EHM99994.1| YPL236C-like protein [Saccharomyces ...   214   2e-53   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|254583071|ref|XP_002499267.1| ZYRO0E07876p [Zygosaccharomyces...   214   4e-53   Zygosaccharomyces rouxii CBS 732
gi|402224919|gb|EJU04981.1| Pkinase-domain-containing protein, p...   213   5e-53   Dacryopinax primogenitus
gi|409048755|gb|EKM58233.1| hypothetical protein PHACADRAFT_2524...   213   6e-53   Phanerochaete carnosa HHB-10118-sp
gi|504126101|ref|XP_004576867.1| PREDICTED: serine/threonine-pro...   213   6e-53   Ochotona princeps [southern American pika]
gi|409039036|gb|EKM48782.1| hypothetical protein PHACADRAFT_2661...   213   7e-53   Phanerochaete carnosa HHB-10118-sp
gi|348556480|ref|XP_003464049.1| PREDICTED: serine/threonine-pro...   213   8e-53   
gi|507641572|ref|XP_004701680.1| PREDICTED: LOW QUALITY PROTEIN:...   213   1e-52   Echinops telfairi [lesser hedgehog tenrec]
gi|409077712|gb|EKM78077.1| hypothetical protein AGABI1DRAFT_114...   212   1e-52   Agaricus bisporus var. burnettii JB137-S8
gi|512808907|ref|XP_004876210.1| PREDICTED: serine/threonine-pro...   212   1e-52   
gi|344268508|ref|XP_003406100.1| PREDICTED: serine/threonine-pro...   212   1e-52   Loxodonta africana [African bush elephant]
gi|334347165|ref|XP_003341897.1| PREDICTED: serine/threonine-pro...   212   1e-52   Monodelphis domestica
gi|472366526|ref|XP_004402801.1| PREDICTED: serine/threonine-pro...   212   1e-52   Odobenus rosmarus divergens
gi|410969478|ref|XP_003991222.1| PREDICTED: serine/threonine-pro...   212   2e-52   Felis catus [cat]
gi|471376801|ref|XP_004376394.1| PREDICTED: serine/threonine-pro...   211   2e-52   Trichechus manatus latirostris
gi|367009434|ref|XP_003679218.1| hypothetical protein TDEL_0A067...   211   2e-52   Torulaspora delbrueckii
gi|395823407|ref|XP_003784978.1| PREDICTED: serine/threonine-pro...   211   3e-52   
gi|507672610|ref|XP_004638249.1| PREDICTED: serine/threonine-pro...   211   3e-52   Octodon degus
gi|255719470|ref|XP_002556015.1| KLTH0H03080p [Lachancea thermot...   211   3e-52   Lachancea thermotolerans CBS 6340
gi|385303442|gb|EIF47515.1| serine threonine protein [Dekkera br...   210   5e-52   Brettanomyces bruxellensis AWRI1499
gi|403266827|ref|XP_003925562.1| PREDICTED: serine/threonine-pro...   210   5e-52   Saimiri boliviensis boliviensis
gi|194043857|ref|XP_001928241.1| PREDICTED: serine/threonine-pro...   210   5e-52   
gi|50750866|ref|XP_426593.1| PREDICTED: serine/threonine-protein...   210   6e-52   Gallus gallus [bantam]
gi|511886174|ref|XP_004762884.1| PREDICTED: serine/threonine-pro...   210   6e-52   Mustela putorius furo [black ferret]
gi|465966528|ref|XP_004262741.1| PREDICTED: serine/threonine-pro...   210   6e-52   Orcinus orca [Orca]
gi|301755705|ref|XP_002913702.1| PREDICTED: serine/threonine-pro...   209   7e-52   Ailuropoda melanoleuca
gi|57111227|ref|XP_545656.1| PREDICTED: serine/threonine-protein...   209   7e-52   Canis lupus familiaris [dogs]
gi|432103436|gb|ELK30541.1| Serine/threonine-protein kinase 16 [...   209   8e-52   Myotis davidii
gi|392564252|gb|EIW57430.1| Pkinase-domain-containing protein [T...   209   1e-51   Trametes versicolor FP-101664 SS1
gi|296205653|ref|XP_002749858.1| PREDICTED: serine/threonine-pro...   209   1e-51   Callithrix jacchus [common marmoset]
gi|114053103|ref|NP_001039720.1| serine/threonine-protein kinase...   209   1e-51   Bos taurus [bovine]
gi|388454737|ref|NP_001253902.1| serine/threonine-protein kinase...   209   1e-51   Macaca mulatta [rhesus macaque]
gi|426222609|ref|XP_004005479.1| PREDICTED: serine/threonine-pro...   208   2e-51   Ovis aries [domestic sheep]
gi|488552965|ref|XP_004467828.1| PREDICTED: serine/threonine-pro...   207   3e-51   Dasypus novemcinctus
gi|54696040|gb|AAV38392.1| serine/threonine kinase 16 [Homo sapi...   207   3e-51   Homo sapiens [man]
gi|440911047|gb|ELR60776.1| Serine/threonine-protein kinase 16 [...   207   5e-51   Bos mutus
gi|478506695|ref|XP_004427642.1| PREDICTED: serine/threonine-pro...   207   5e-51   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|57165436|ref|NP_001008910.1| serine/threonine-protein kinase ...   206   6e-51   Homo sapiens [man]
gi|3367705|emb|CAA06700.1| PKL12 protein [Homo sapiens]               206   6e-51   Homo sapiens [man]
gi|195108215|ref|XP_001998688.1| GI23494 [Drosophila mojavensis]...   206   7e-51   Drosophila mojavensis
gi|349581585|dbj|GAA26742.1| K7_Ypl236cp [Saccharomyces cerevisi...   206   8e-51   Saccharomyces cerevisiae Kyokai no. 7
gi|443921288|gb|ELU40987.1| other/NAK protein kinase [Rhizoctoni...   206   8e-51   Rhizoctonia solani AG-1 IA
gi|383865679|ref|XP_003708300.1| PREDICTED: serine/threonine-pro...   206   8e-51   Megachile rotundata
gi|505847450|ref|XP_004617190.1| PREDICTED: serine/threonine-pro...   206   8e-51   Sorex araneus [Eurasian shrew]
gi|158258825|dbj|BAF85383.1| unnamed protein product [Homo sapiens]   206   8e-51   Homo sapiens [man]
gi|149711139|ref|XP_001493234.1| PREDICTED: serine/threonine-pro...   206   8e-51   Equus caballus [domestic horse]
gi|354490994|ref|XP_003507641.1| PREDICTED: serine/threonine-pro...   206   8e-51   
gi|507558456|ref|XP_004662965.1| PREDICTED: serine/threonine-pro...   206   9e-51   Jaculus jaculus
gi|332246609|ref|XP_003272445.1| PREDICTED: LOW QUALITY PROTEIN:...   206   9e-51   Nomascus leucogenys [White-cheeked Gibbon]
gi|151942565|gb|EDN60911.1| conserved protein [Saccharomyces cer...   206   9e-51   Saccharomyces cerevisiae YJM789
gi|431917953|gb|ELK17182.1| Serine/threonine-protein kinase 16 [...   206   9e-51   Pteropus alecto
gi|114583441|ref|XP_001162451.1| PREDICTED: serine/threonine-pro...   206   9e-51   Pan troglodytes
gi|397495728|ref|XP_003818698.1| PREDICTED: serine/threonine-pro...   206   1e-50   Pan paniscus [bonobo]
gi|125777862|ref|XP_001359753.1| GA11523 [Drosophila pseudoobscu...   206   1e-50   Drosophila pseudoobscura pseudoobscura
gi|323302644|gb|EGA56450.1| YPL236C-like protein [Saccharomyces ...   206   1e-50   Saccharomyces cerevisiae FostersB
gi|195445463|ref|XP_002070336.1| GK11088 [Drosophila willistoni]...   206   1e-50   Drosophila willistoni
gi|6325020|ref|NP_015088.1| Env7p [Saccharomyces cerevisiae S288...   206   1e-50   Saccharomyces cerevisiae S288c
gi|225581134|gb|ACN94704.1| GA11523 [Drosophila miranda]              206   1e-50   Drosophila miranda
gi|507926127|ref|XP_004674323.1| PREDICTED: serine/threonine-pro...   206   1e-50   Condylura cristata
gi|432851991|ref|XP_004067141.1| PREDICTED: serine/threonine-pro...   206   1e-50   Oryzias latipes [Japanese rice fish]
gi|358060316|dbj|GAA94070.1| hypothetical protein E5Q_00717 [Mix...   206   1e-50   Mixia osmundae IAM 14324
gi|323335259|gb|EGA76548.1| YPL236C-like protein [Saccharomyces ...   205   1e-50   Saccharomyces cerevisiae Vin13
gi|190407728|gb|EDV10993.1| conserved hypothetical protein [Sacc...   205   1e-50   Saccharomyces cerevisiae RM11-1a
gi|12803571|gb|AAH02618.1| Serine/threonine kinase 16 [Homo sapi...   205   1e-50   Homo sapiens [man]
gi|33303961|gb|AAQ02488.1| serine/threonine kinase 16, partial [...   205   2e-50   synthetic construct
gi|3372666|gb|AAC28337.1| myristilated and palmitylated serine-t...   205   2e-50   Homo sapiens [man]
gi|323306913|gb|EGA60197.1| YPL236C-like protein [Saccharomyces ...   205   2e-50   Saccharomyces cerevisiae FostersO
gi|195037763|ref|XP_001990330.1| GH19283 [Drosophila grimshawi] ...   204   3e-50   Drosophila grimshawi
gi|3646280|emb|CAA09387.1| serine/threonine kinase [Homo sapiens]     204   4e-50   Homo sapiens [man]
gi|389750145|gb|EIM91316.1| Pkinase-domain-containing protein [S...   204   4e-50   Stereum hirsutum FP-91666 SS1
gi|73536291|pdb|2BUJ|A Chain A, Crystal Structure Of The Human S...   203   6e-50   Homo sapiens [man]
gi|443693057|gb|ELT94510.1| hypothetical protein CAPTEDRAFT_1620...   203   8e-50   Capitella teleta
gi|357477799|ref|XP_003609185.1| Serine/threonine protein kinase...   203   8e-50   Medicago truncatula
gi|190691291|gb|ACE87420.1| serine/threonine kinase 16 protein [...   202   8e-50   synthetic construct
gi|148224868|ref|NP_001087851.1| serine/threonine kinase 16 [Xen...   202   9e-50   Xenopus laevis [clawed frog]
gi|156547996|ref|XP_001605375.1| PREDICTED: serine/threonine-pro...   202   9e-50   Nasonia vitripennis
gi|488552962|ref|XP_004467827.1| PREDICTED: serine/threonine-pro...   202   1e-49   Dasypus novemcinctus
gi|242022985|ref|XP_002431917.1| serine/threonine-protein kinase...   202   1e-49   Pediculus humanus corporis [human body lice]
gi|462405045|gb|EMJ10509.1| hypothetical protein PRUPE_ppa008104...   202   1e-49   Prunus persica
gi|225455752|ref|XP_002269355.1| PREDICTED: probable serine/thre...   202   1e-49   Vitis vinifera
gi|340724702|ref|XP_003400720.1| PREDICTED: serine/threonine-pro...   202   1e-49   
gi|71727712|gb|AAZ39949.1| serine/threonine protein kinase [Goss...   202   1e-49   Gossypium hirsutum [American cotton]
gi|195395566|ref|XP_002056407.1| GJ10245 [Drosophila virilis] >g...   202   2e-49   Drosophila virilis
gi|401623380|gb|EJS41482.1| YPL236C [Saccharomyces arboricola H-6]    202   2e-49   Saccharomyces arboricola H-6
gi|443894753|dbj|GAC72100.1| serine/threonine protein kinase [Ps...   202   2e-49   Moesziomyces antarcticus T-34
gi|395527665|ref|XP_003765963.1| PREDICTED: LOW QUALITY PROTEIN:...   201   2e-49   
gi|27465615|ref|NP_775165.1| serine/threonine-protein kinase 16 ...   201   2e-49   Rattus norvegicus [brown rat]
gi|470126586|ref|XP_004299264.1| PREDICTED: probable serine/thre...   201   2e-49   Fragaria vesca subsp. vesca
gi|465957484|gb|EMP27432.1| Serine/threonine-protein kinase 16 [...   201   3e-49   Chelonia mydas [green seaturtle]
gi|147842217|emb|CAN66918.1| hypothetical protein VITISV_043041 ...   201   3e-49   Vitis vinifera
gi|229366470|gb|ACQ58215.1| Serine/threonine-protein kinase 16 [...   201   4e-49   Anoplopoma fimbria
gi|498949238|ref|XP_004543459.1| PREDICTED: serine/threonine-pro...   200   5e-49   Maylandia zebra
gi|26327983|dbj|BAC27732.1| unnamed protein product [Mus musculus]    200   5e-49   Mus musculus [mouse]
gi|118093736|ref|XP_001231623.1| PREDICTED: serine/threonine-pro...   200   5e-49   
gi|194741512|ref|XP_001953233.1| GF17312 [Drosophila ananassae] ...   200   5e-49   Drosophila ananassae
gi|460380689|ref|XP_004236087.1| PREDICTED: probable serine/thre...   200   5e-49   Solanum lycopersicum
gi|52345488|ref|NP_001004792.1| serine/threonine kinase 16 [Xeno...   200   6e-49   Xenopus tropicalis [western clawed frog]
gi|357158203|ref|XP_003578050.1| PREDICTED: probable serine/thre...   200   6e-49   
gi|348516509|ref|XP_003445781.1| PREDICTED: serine/threonine-pro...   199   7e-49   Oreochromis niloticus
gi|195482151|ref|XP_002086757.1| GE11119 [Drosophila yakuba] >gi...   199   8e-49   Drosophila yakuba
gi|194899239|ref|XP_001979168.1| GG25282 [Drosophila erecta] >gi...   199   8e-49   Drosophila erecta
gi|502151836|ref|XP_004508637.1| PREDICTED: serine/threonine-pro...   199   9e-49   Cicer arietinum [garbanzo]
gi|213512603|ref|NP_001133526.1| serine/threonine-protein kinase...   199   9e-49   Salmo salar
gi|224118834|ref|XP_002317918.1| predicted protein [Populus tric...   199   9e-49   
gi|195498791|ref|XP_002096676.1| GE25802 [Drosophila yakuba] >gi...   199   1e-48   Drosophila yakuba
gi|195568928|ref|XP_002102464.1| GD19491 [Drosophila simulans] >...   199   1e-48   Drosophila simulans
gi|460392023|ref|XP_004241617.1| PREDICTED: probable serine/thre...   199   1e-48   Solanum lycopersicum
gi|226958539|ref|NP_035624.3| serine/threonine-protein kinase 16...   199   1e-48   Mus musculus [mouse]
gi|21358347|ref|NP_649712.1| CG1227 [Drosophila melanogaster] >g...   198   2e-48   Drosophila melanogaster
gi|91084617|ref|XP_974511.1| PREDICTED: similar to GA11523-PA [T...   198   2e-48   Tribolium castaneum [rust-red flour beetle]
gi|302819093|ref|XP_002991218.1| hypothetical protein SELMODRAFT...   198   2e-48   Selaginella moellendorffii
gi|302819216|ref|XP_002991279.1| hypothetical protein SELMODRAFT...   198   2e-48   Selaginella moellendorffii
gi|449439365|ref|XP_004137456.1| PREDICTED: serine/threonine-pro...   198   2e-48   
gi|195344187|ref|XP_002038670.1| GM10494 [Drosophila sechellia] ...   197   3e-48   Drosophila sechellia
gi|449440872|ref|XP_004138208.1| PREDICTED: probable serine/thre...   197   3e-48   Cucumis sativus [cucumbers]
gi|168054096|ref|XP_001779469.1| predicted protein [Physcomitrel...   197   3e-48   Physcomitrella patens
gi|328858854|gb|EGG07965.1| hypothetical protein MELLADRAFT_4796...   197   3e-48   Melampsora larici-populina 98AG31
gi|498980156|ref|XP_004529280.1| PREDICTED: serine/threonine-pro...   197   4e-48   Ceratitis capitata
gi|355750858|gb|EHH55185.1| hypothetical protein EGM_04337 [Maca...   197   4e-48   Macaca fascicularis [crab eating macaque]
gi|4106342|gb|AAD02811.1| palmitylated serine/threonine kinase [...   197   4e-48   Mus musculus [mouse]
gi|472582278|gb|EMS19970.1| serine/threonine-protein kinase [Rho...   197   4e-48   Rhodotorula toruloides NP11
gi|26326407|dbj|BAC26947.1| unnamed protein product [Mus musculus]    197   5e-48   Mus musculus [mouse]
gi|355565206|gb|EHH21695.1| hypothetical protein EGK_04819 [Maca...   197   5e-48   Macaca mulatta [rhesus macaque]
gi|224054829|ref|XP_002195709.1| PREDICTED: serine/threonine-pro...   197   5e-48   
gi|353239138|emb|CCA71061.1| related to Prk1p [Piriformospora in...   196   6e-48   Serendipita indica DSM 11827
gi|317106659|dbj|BAJ53163.1| JHL10I11.9 [Jatropha curcas]             196   9e-48   Jatropha curcas
gi|356562660|ref|XP_003549587.1| PREDICTED: probable serine/thre...   196   1e-47   
gi|255541908|ref|XP_002512018.1| serine/threonine protein kinase...   196   1e-47   Ricinus communis
gi|195622442|gb|ACG33051.1| serine/threonine-protein kinase 16 [...   196   1e-47   Zea mays [maize]
gi|508774962|gb|EOY22218.1| Serine/threonine protein kinase 3 is...   196   1e-47   Theobroma cacao [chocolate]
gi|212722828|ref|NP_001132895.1| LOC100194392 [Zea mays] >gi|194...   195   1e-47   Zea mays [maize]
gi|485649108|gb|EOD42014.1| hypothetical protein EMIHUDRAFT_4319...   195   2e-47   Emiliania huxleyi CCMP1516
gi|6729083|dbj|BAA89662.1| F5-2 [Mus musculus]                        195   2e-47   Mus musculus [mouse]
gi|328782822|ref|XP_395536.3| PREDICTED: serine/threonine-protei...   194   2e-47   
gi|194692758|gb|ACF80463.1| unknown [Zea mays] >gi|414885211|tpg...   194   3e-47   Zea mays [maize]
gi|115478867|ref|NP_001063027.1| Os09g0372800 [Oryza sativa Japo...   194   3e-47   
gi|356511575|ref|XP_003524500.1| PREDICTED: probable serine/thre...   194   3e-47   Glycine max [soybeans]
gi|449275357|gb|EMC84229.1| Serine/threonine-protein kinase 16, ...   194   3e-47   Columba livia [carrier pigeon]
gi|213407530|ref|XP_002174536.1| serine/threonine-protein kinase...   194   3e-47   Schizosaccharomyces japonicus yFS275
gi|478257483|gb|ENN77639.1| hypothetical protein YQE_05933, part...   194   3e-47   Dendroctonus ponderosae
gi|410912894|ref|XP_003969924.1| PREDICTED: serine/threonine-pro...   194   4e-47   
gi|118481025|gb|ABK92466.1| unknown [Populus trichocarpa]             193   6e-47   
gi|470126588|ref|XP_004299265.1| PREDICTED: probable serine/thre...   193   7e-47   
gi|6714558|dbj|BAA89499.1| F5-2 [Mus musculus]                        193   7e-47   
gi|474440394|gb|EMS68366.1| Serine/threonine-protein kinase 16 [...   193   7e-47   
gi|224130094|ref|XP_002328652.1| predicted protein [Populus tric...   192   2e-46   
gi|62955237|ref|NP_001017630.1| serine/threonine-protein kinase ...   191   2e-46   
gi|501305275|dbj|GAC94527.1| likely protein kinase [Pseudozyma h...   191   3e-46   
gi|71009810|ref|XP_758315.1| hypothetical protein UM02168.1 [Ust...   190   6e-46   
gi|384490370|gb|EIE81592.1| hypothetical protein RO3G_06297 [Rhi...   190   7e-46   
gi|388854128|emb|CCF52278.1| related to Prk1p [Ustilago hordei]       189   1e-45   
gi|403173673|ref|XP_003332725.2| NAK protein kinase [Puccinia gr...   187   3e-45   
gi|482556795|gb|EOA20987.1| hypothetical protein CARUB_v10001319...   187   6e-45   
gi|198415844|ref|XP_002129344.1| PREDICTED: serine/threonine-pro...   186   7e-45   
gi|297810921|ref|XP_002873344.1| hypothetical protein ARALYDRAFT...   186   8e-45   
gi|15241535|ref|NP_196433.1| serine/threonine protein kinase 3 [...   186   8e-45   
gi|21593866|gb|AAM65833.1| serine/threonine protein kinase [Arab...   186   1e-44   
gi|384491948|gb|EIE83144.1| hypothetical protein RO3G_07849 [Rhi...   186   1e-44   
gi|225710146|gb|ACO10919.1| Serine/threonine-protein kinase 16 [...   186   1e-44   
gi|402889468|ref|XP_003908038.1| PREDICTED: serine/threonine-pro...   185   2e-44   
gi|339244129|ref|XP_003377990.1| serine/threonine-protein kinase...   184   3e-44   
gi|321470799|gb|EFX81774.1| hypothetical protein DAPPUDRAFT_2111...   184   4e-44   
gi|281208865|gb|EFA83040.1| putative protein serine/threonine ki...   182   1e-43   
gi|299473556|emb|CBN77951.1| Serine/threonine protein kinase/TGF...   182   1e-43   
gi|343429149|emb|CBQ72723.1| related to Prk1p [Sporisorium reili...   182   1e-43   
gi|348676992|gb|EGZ16809.1| hypothetical protein PHYSODRAFT_4595...   182   2e-43   
gi|327260428|ref|XP_003215036.1| PREDICTED: serine/threonine-pro...   181   2e-43   
gi|470506214|ref|XP_004348721.1| serine/threonine protein kinase...   181   2e-43   
gi|403162524|ref|XP_003322720.2| serine/threonine protein kinase...   181   4e-43   
gi|225719218|gb|ACO15455.1| Serine/threonine-protein kinase 16 [...   181   4e-43   
gi|444313771|ref|XP_004177543.1| hypothetical protein TBLA_0A022...   179   8e-43   
gi|332028434|gb|EGI68477.1| Serine/threonine-protein kinase 16 [...   179   8e-43   
gi|328769759|gb|EGF79802.1| hypothetical protein BATDEDRAFT_3334...   179   1e-42   
gi|401886387|gb|EJT50425.1| serine/threonine-protein kinase [Tri...   177   3e-42   
gi|365987730|ref|XP_003670696.1| hypothetical protein NDAI_0F013...   177   3e-42   
gi|402588071|gb|EJW82005.1| other/NAK/MPSK protein kinase [Wuche...   177   4e-42   
gi|406698334|gb|EKD01572.1| serine/threonine-protein kinase [Tri...   176   9e-42   
gi|460413793|ref|XP_004252263.1| PREDICTED: serine/threonine-pro...   176   1e-41   
gi|393911062|gb|EJD76146.1| NAK/MPSK protein kinase [Loa loa]         173   6e-41   
gi|30682270|ref|NP_850792.1| serine/threonine protein kinase 3 [...   171   3e-40   
gi|301117892|ref|XP_002906674.1| protein kinase [Phytophthora in...   171   4e-40   
gi|440640591|gb|ELR10510.1| hypothetical protein GMDG_04788 [Geo...   171   4e-40   
gi|170576928|ref|XP_001893816.1| Protein kinase domain containin...   171   4e-40   
gi|301090153|ref|XP_002895305.1| serine/threonine protein kinase...   169   8e-40   
gi|50288825|ref|XP_446842.1| hypothetical protein [Candida glabr...   169   1e-39   
gi|322701045|gb|EFY92796.1| serine/threonine protein kinase, put...   169   2e-39   
gi|363749009|ref|XP_003644722.1| hypothetical protein Ecym_2153 ...   168   2e-39   
gi|399168077|emb|CCE31009.1| related to serine/threonine kinase ...   166   1e-38   
gi|414588963|tpg|DAA39534.1| TPA: putative protein kinase superf...   166   1e-38   
gi|115478094|ref|NP_001062642.1| Os09g0237600 [Oryza sativa Japo...   166   1e-38   
gi|82400199|gb|ABB72838.1| serine/threonine kinase [Elaeis guine...   166   1e-38   
gi|389626689|ref|XP_003710998.1| NAK protein kinase [Magnaporthe...   165   2e-38   
gi|410080532|ref|XP_003957846.1| hypothetical protein KAFR_0F011...   165   2e-38   
gi|125562875|gb|EAZ08255.1| hypothetical protein OsI_30510 [Oryz...   164   5e-38   
gi|226503333|ref|NP_001149977.1| serine/threonine-protein kinase...   163   7e-38   
gi|313212081|emb|CBY16120.1| unnamed protein product [Oikopleura...   163   9e-38   
gi|402083568|gb|EJT78586.1| NAK protein kinase [Gaeumannomyces g...   162   1e-37   
gi|474392120|gb|EMS65453.1| Serine/threonine-protein kinase 16 [...   162   1e-37   
gi|66814138|ref|XP_641248.1| hypothetical protein DDB_G0280111 [...   162   1e-37   
gi|475566144|gb|EMT14968.1| Serine/threonine-protein kinase 16 [...   162   1e-37   
gi|320586822|gb|EFW99485.1| serine/threonine-protein kinase [Gro...   162   2e-37   
gi|156393932|ref|XP_001636581.1| predicted protein [Nematostella...   161   2e-37   
gi|326502538|dbj|BAJ95332.1| predicted protein [Hordeum vulgare ...   161   3e-37   
gi|380481204|emb|CCF41980.1| serine/threonine-protein kinase [Co...   160   4e-37   
gi|326510495|dbj|BAJ87464.1| predicted protein [Hordeum vulgare ...   160   4e-37   
gi|357154962|ref|XP_003576962.1| PREDICTED: probable serine/thre...   160   4e-37   
gi|154283573|ref|XP_001542582.1| conserved hypothetical protein ...   159   9e-37   
gi|294460033|gb|ADE75600.1| unknown [Picea sitchensis]                159   9e-37   
gi|290987503|ref|XP_002676462.1| predicted protein [Naegleria gr...   159   9e-37   
gi|366995195|ref|XP_003677361.1| hypothetical protein NCAS_0G012...   158   2e-36   
gi|513194607|ref|XP_004942901.1| PREDICTED: serine/threonine-pro...   158   2e-36   
gi|380487668|emb|CCF37894.1| kinase [Colletotrichum higginsianum]     157   4e-36   
gi|340381524|ref|XP_003389271.1| PREDICTED: serine/threonine-pro...   157   4e-36   
gi|403215336|emb|CCK69835.1| hypothetical protein KNAG_0D00830 [...   157   4e-36   
gi|488552968|ref|XP_004467829.1| PREDICTED: serine/threonine-pro...   157   5e-36   
gi|390354884|ref|XP_782009.2| PREDICTED: serine/threonine-protei...   156   9e-36   
gi|346979409|gb|EGY22861.1| serine/threonine-protein kinase [Ver...   155   2e-35   
gi|330841970|ref|XP_003292960.1| hypothetical protein DICPUDRAFT...   155   2e-35   
gi|116180710|ref|XP_001220204.1| hypothetical protein CHGG_00983...   153   6e-35   
gi|453088721|gb|EMF16761.1| hypothetical protein SEPMUDRAFT_1459...   153   7e-35   
gi|350398411|ref|XP_003485184.1| PREDICTED: serine/threonine-pro...   152   1e-34   
gi|256071906|ref|XP_002572279.1| serine/threonine protein kinase...   152   1e-34   
gi|340724704|ref|XP_003400721.1| PREDICTED: serine/threonine-pro...   152   2e-34   
gi|513194612|ref|XP_004942902.1| PREDICTED: serine/threonine-pro...   151   2e-34   
gi|513194604|ref|XP_004942900.1| PREDICTED: serine/threonine-pro...   150   8e-34   
gi|470244102|ref|XP_004355783.1| putative protein serine/threoni...   148   2e-33   
gi|56754037|gb|AAW25209.1| SJCHGC01087 protein [Schistosoma japo...   148   3e-33   
gi|345485394|ref|XP_003425260.1| PREDICTED: serine/threonine-pro...   147   4e-33   
gi|508774964|gb|EOY22220.1| Serine/threonine protein kinase 3 is...   147   4e-33   
gi|297826731|ref|XP_002881248.1| hypothetical protein ARALYDRAFT...   147   6e-33   
gi|253735782|ref|NP_001156676.1| serine/threonine kinase 16 [Acy...   147   6e-33   
gi|219110639|ref|XP_002177071.1| predicted protein [Phaeodactylu...   147   6e-33   
gi|356557118|ref|XP_003546865.1| PREDICTED: uncharacterized prot...   147   7e-33   
gi|299472655|emb|CBN78307.2| conserved unknown protein (Partial)...   146   1e-32   
gi|300122212|emb|CBK22785.2| unnamed protein product [Blastocyst...   145   1e-32   
gi|303281780|ref|XP_003060182.1| predicted protein [Micromonas p...   145   1e-32   
gi|508774963|gb|EOY22219.1| Serine/threonine protein kinase 3 is...   145   2e-32   
gi|117616800|gb|ABK42418.1| MPSK1 [synthetic construct]               145   2e-32   
gi|482562511|gb|EOA26701.1| hypothetical protein CARUB_v10022785...   144   3e-32   
gi|30685467|ref|NP_850199.1| protein kinase superfamily protein ...   144   5e-32   
gi|508704866|gb|EOX96762.1| Serine/threonine-protein kinase DDB_...   144   5e-32   
gi|508704867|gb|EOX96763.1| Serine/threonine-protein kinase DDB_...   144   5e-32   
gi|508704865|gb|EOX96761.1| Serine/threonine-protein kinase DDB_...   144   5e-32   
gi|18403106|ref|NP_565756.1| protein kinase superfamily protein ...   144   6e-32   
gi|470141562|ref|XP_004306499.1| PREDICTED: uncharacterized prot...   143   7e-32   
gi|18176324|gb|AAL60023.1| putative serine/threonine protein kin...   143   8e-32   
gi|168033698|ref|XP_001769351.1| predicted protein [Physcomitrel...   142   1e-31   
gi|356525620|ref|XP_003531422.1| PREDICTED: uncharacterized prot...   142   2e-31   
gi|353232103|emb|CCD79458.1| serine/threonine kinase [Schistosom...   141   2e-31   
gi|440640590|gb|ELR10509.1| hypothetical protein GMDG_04787 [Geo...   141   3e-31   
gi|462417090|gb|EMJ21827.1| hypothetical protein PRUPE_ppa002321...   141   4e-31   
gi|196003414|ref|XP_002111574.1| hypothetical protein TRIADDRAFT...   140   4e-31   
gi|307211953|gb|EFN87865.1| AP2-associated protein kinase 1 [Har...   140   5e-31   
gi|302781923|ref|XP_002972735.1| hypothetical protein SELMODRAFT...   140   6e-31   
gi|449463803|ref|XP_004149621.1| PREDICTED: uncharacterized prot...   140   6e-31   
gi|330929815|ref|XP_003302784.1| hypothetical protein PTT_14734 ...   140   6e-31   
gi|332028241|gb|EGI68289.1| AP2-associated protein kinase 1 [Acr...   140   7e-31   
gi|255542175|ref|XP_002512151.1| serine/threonine protein kinase...   140   8e-31   
gi|475666044|gb|EMT63835.1| hypothetical protein FOC4_g10010307 ...   139   9e-31   
gi|302823395|ref|XP_002993350.1| hypothetical protein SELMODRAFT...   139   1e-30   
gi|482813452|gb|EOA90143.1| hypothetical protein SETTUDRAFT_1457...   139   1e-30   
gi|452990042|gb|EME89797.1| ARK kinase [Pseudocercospora fijiens...   139   1e-30   
gi|302414640|ref|XP_003005152.1| serine/threonine-protein kinase...   139   2e-30   
gi|189188160|ref|XP_001930419.1| Ark1/Prk1 family protein kinase...   139   2e-30   
gi|348685367|gb|EGZ25182.1| hypothetical protein PHYSODRAFT_4818...   138   2e-30   
gi|156380586|ref|XP_001631849.1| predicted protein [Nematostella...   138   2e-30   
gi|321459364|gb|EFX70418.1| hypothetical protein DAPPUDRAFT_3283...   138   2e-30   
gi|465792823|emb|CCU98065.1| unnamed protein product [Malassezia...   138   2e-30   
gi|326473841|gb|EGD97850.1| nak/nak-unclassified protein kinase ...   138   3e-30   
gi|413937541|gb|AFW72092.1| putative protein kinase superfamily ...   138   3e-30   
gi|378726032|gb|EHY52491.1| AP2-associated kinase [Exophiala der...   138   3e-30   
gi|225450356|ref|XP_002274890.1| PREDICTED: uncharacterized prot...   138   3e-30   
gi|393905920|gb|EFO23257.2| NAK/BIKE protein kinase [Loa loa]         137   4e-30   
gi|340377003|ref|XP_003387020.1| PREDICTED: cyclin-G-associated ...   137   4e-30   
gi|322778707|gb|EFZ09123.1| hypothetical protein SINV_00054 [Sol...   137   4e-30   
gi|312076329|ref|XP_003140812.1| NAK/BIKE protein kinase [Loa loa]    137   4e-30   
gi|413937540|gb|AFW72091.1| putative protein kinase superfamily ...   137   4e-30   
gi|307184044|gb|EFN70594.1| AP2-associated protein kinase 1 [Cam...   137   4e-30   
gi|398409546|ref|XP_003856238.1| hypothetical protein MYCGRDRAFT...   137   4e-30   
gi|330801936|ref|XP_003288978.1| hypothetical protein DICPUDRAFT...   137   5e-30   
gi|170588197|ref|XP_001898860.1| Protein kinase domain containin...   137   5e-30   
gi|241857997|ref|XP_002416130.1| numb-associated kinase, putativ...   137   5e-30   
gi|62867355|dbj|BAD95980.1| Ser/Thr protein kinase [Lotus japoni...   137   5e-30   
gi|502164558|ref|XP_004513162.1| PREDICTED: probable serine/thre...   137   6e-30   
gi|315055117|ref|XP_003176933.1| nak/nak-unclassified protein ki...   136   9e-30   
gi|350399874|ref|XP_003485667.1| PREDICTED: hypothetical protein...   136   1e-29   
gi|451847226|gb|EMD60534.1| hypothetical protein COCSADRAFT_4017...   136   1e-29   
gi|327307686|ref|XP_003238534.1| nak/nak-unclassified protein ki...   135   1e-29   
gi|340712533|ref|XP_003394812.1| PREDICTED: hypothetical protein...   135   2e-29   
gi|402595005|gb|EJW88931.1| other/NAK/BIKE protein kinase [Wuche...   135   2e-29   
gi|396460970|ref|XP_003835097.1| hypothetical protein LEMA_P0724...   135   2e-29   
gi|407924061|gb|EKG17121.1| hypothetical protein MPH_05693 [Macr...   135   2e-29   
gi|451997842|gb|EMD90307.1| hypothetical protein COCHEDRAFT_1178...   135   2e-29   
gi|345568370|gb|EGX51264.1| hypothetical protein AOL_s00054g334 ...   135   2e-29   
gi|357157790|ref|XP_003577915.1| PREDICTED: actin-regulating kin...   135   2e-29   
gi|297741242|emb|CBI32193.3| unnamed protein product [Vitis vini...   135   2e-29   
gi|281200400|gb|EFA74620.1| putative protein serine/threonine ki...   134   3e-29   
gi|470390848|ref|XP_004334610.1| protein kinase [Acanthamoeba ca...   134   3e-29   
gi|328721584|ref|XP_001947823.2| PREDICTED: AP2-associated prote...   134   3e-29   
gi|147778998|emb|CAN60313.1| hypothetical protein VITISV_036304 ...   134   3e-29   
gi|383850446|ref|XP_003700806.1| PREDICTED: uncharacterized prot...   134   4e-29   
gi|475612040|gb|EMT28285.1| Putative serine/threonine-protein ki...   134   4e-29   
gi|460366988|ref|XP_004229357.1| PREDICTED: uncharacterized prot...   134   5e-29   
gi|413922858|gb|AFW62790.1| putative protein kinase superfamily ...   134   5e-29   
gi|291243146|ref|XP_002741465.1| PREDICTED: numb-associated kina...   134   5e-29   
gi|494826375|gb|EON63457.1| NAK/BIKE protein kinase [Coniosporiu...   134   5e-29   
gi|505858362|ref|XP_004622575.1| PREDICTED: serine/threonine-pro...   134   6e-29   
gi|357149854|ref|XP_003575255.1| PREDICTED: uncharacterized prot...   133   6e-29   
gi|154312948|ref|XP_001555801.1| hypothetical protein BC1G_05175...   133   7e-29   
gi|470406259|ref|XP_004335935.1| protein kinase domain containin...   133   9e-29   
gi|45198378|ref|NP_985407.1| AFL143Cp [Ashbya gossypii ATCC 1089...   132   1e-28   
gi|328790038|ref|XP_625109.3| PREDICTED: LOW QUALITY PROTEIN: hy...   132   1e-28   
gi|357158206|ref|XP_003578051.1| PREDICTED: probable serine/thre...   132   1e-28   
gi|452848309|gb|EME50241.1| hypothetical protein DOTSEDRAFT_6894...   132   1e-28   
gi|374108635|gb|AEY97541.1| FAFL143Cp [Ashbya gossypii FDAG1]         132   1e-28   
gi|169617157|ref|XP_001801993.1| hypothetical protein SNOG_11755...   132   1e-28   
gi|119591121|gb|EAW70715.1| serine/threonine kinase 16, isoform ...   132   1e-28   
gi|145535740|ref|XP_001453603.1| hypothetical protein [Parameciu...   132   1e-28   
gi|66802570|ref|XP_635157.1| hypothetical protein DDB_G0291350 [...   132   2e-28   
gi|512206274|gb|EPE35094.1| Protein kinase-like (PK-like) [Glare...   132   2e-28   
gi|242024449|ref|XP_002432640.1| Actin-regulating kinase, putati...   132   2e-28   
gi|428176480|gb|EKX45364.1| hypothetical protein GUITHDRAFT_6202...   132   2e-28   
gi|21428728|gb|AAM50024.1| SD07306p [Drosophila melanogaster]         131   2e-28   
gi|45552405|ref|NP_995725.1| Numb-associated kinase, isoform C [...   131   2e-28   
gi|472244259|gb|EMR88882.1| putative serine threonine protein [B...   131   3e-28   
gi|347834940|emb|CCD49512.1| similar to serine/threonine protein...   131   3e-28   
gi|392597624|gb|EIW86946.1| hypothetical protein CONPUDRAFT_1342...   131   3e-28   
gi|194879906|ref|XP_001974326.1| GG21669 [Drosophila erecta] >gi...   131   3e-28   
gi|255935307|ref|XP_002558680.1| Pc13g02390 [Penicillium chrysog...   131   3e-28   
gi|296825746|ref|XP_002850863.1| serine/threonine-protein kinase...   131   4e-28   
gi|195580014|ref|XP_002079851.1| GD21795 [Drosophila simulans] >...   130   4e-28   
gi|513033048|gb|AGO13020.1| AaceriAFL143Cp [Saccharomycetaceae s...   130   5e-28   
gi|6537312|gb|AAF15596.1|AF197910_1 Numb-associated kinase [Dros...   130   5e-28   
gi|17137206|ref|NP_477165.1| Numb-associated kinase, isoform A [...   130   5e-28   
gi|171685850|ref|XP_001907866.1| hypothetical protein [Podospora...   130   5e-28   
gi|391336933|ref|XP_003742829.1| PREDICTED: AP2-associated prote...   130   6e-28   
gi|477518424|gb|ENH70649.1| Serine/threonine-protein kinase ppk3...   130   6e-28   
gi|475673001|gb|EMT70124.1| Serine/threonine-protein kinase ppk3...   130   6e-28   
gi|255082384|ref|XP_002504178.1| serine/threonine-protein kinase...   130   6e-28   
gi|321465608|gb|EFX76608.1| hypothetical protein DAPPUDRAFT_2138...   130   6e-28   
gi|340959473|gb|EGS20654.1| hypothetical protein CTHT_0024900 [C...   130   7e-28   
gi|195344950|ref|XP_002039039.1| GM17048 [Drosophila sechellia] ...   130   7e-28   
gi|326523989|dbj|BAJ97005.1| predicted protein [Hordeum vulgare ...   130   7e-28   
gi|50726472|dbj|BAD34081.1| putative AAK1 protein [Oryza sativa ...   130   7e-28   
gi|312066990|ref|XP_003136532.1| NAK/MPSK protein kinase [Loa loa]    130   8e-28   
gi|342873558|gb|EGU75722.1| hypothetical protein FOXB_13741 [Fus...   130   8e-28   
gi|194391130|dbj|BAG60683.1| unnamed protein product [Homo sapiens]   130   8e-28   
gi|50726471|dbj|BAD34080.1| cyclin G-associated kinase-like prot...   130   8e-28   
gi|449304773|gb|EMD00780.1| hypothetical protein BAUCODRAFT_6111...   129   9e-28   
gi|449551288|gb|EMD42252.1| hypothetical protein CERSUDRAFT_1107...   129   9e-28   
gi|195484292|ref|XP_002090632.1| GE12690 [Drosophila yakuba] >gi...   129   1e-27   
gi|367050334|ref|XP_003655546.1| hypothetical protein THITE_2119...   129   1e-27   
gi|405951797|gb|EKC19678.1| AP2-associated protein kinase 1 [Cra...   129   1e-27   
gi|425769781|gb|EKV08264.1| Serine/threonine protein kinase, put...   129   1e-27   
gi|399172392|emb|CCE26539.1| related to serine/threonine kinase ...   129   1e-27   
gi|328766204|gb|EGF76260.1| hypothetical protein BATDEDRAFT_9285...   129   2e-27   
gi|195114990|ref|XP_002002050.1| GI17169 [Drosophila mojavensis]...   129   2e-27   
gi|261197563|ref|XP_002625184.1| serine/threonine protein kinase...   129   2e-27   
gi|327351280|gb|EGE80137.1| serine/threonine protein kinase [Aje...   129   2e-27   
gi|170035699|ref|XP_001845705.1| numb-associated kinase [Culex q...   128   2e-27   
gi|296414555|ref|XP_002836964.1| hypothetical protein [Tuber mel...   128   2e-27   


>gi|511007173|gb|EPB88470.1| NAK protein kinase [Mucor circinelloides f. circinelloides 1006PhL]
          Length = 337

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/360 (52%), Positives = 264/360 (73%), Gaps = 26/360 (7%)

Query: 1   MSLVLSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYAL 60
           MS  L ++RDT+YA+TSCCFPNP+++IN++ +KVI LLGEGG+S+V+LV++ S+ + +AL
Sbjct: 1   MSSYLVTIRDTVYALTSCCFPNPSIYINKKNYKVINLLGEGGYSFVYLVKEESSHQLFAL 60

Query: 61  KKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-L 119
           KKIRC  G  ++ DAM E+DMY+LF  + II+V+DT V+ D +G K VYIFLPYYK G L
Sbjct: 61  KKIRCPMGDRALSDAMHEIDMYQLFQSQYIIRVLDTSVLTDPDGTKTVYIFLPYYKRGNL 120

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENE 179
           QD IN N  N  +FSEK++L+ F  +C+A++ LH +    +P RSE      N       
Sbjct: 121 QDNINANNINKSFFSEKDLLEFFLKVCFALKVLHNHH--ELPPRSETTTEQDN------- 171

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
                         +D +VP+AHRD+KP NIL++DD  + PILMDFGS+++ARI I++R 
Sbjct: 172 -------------DDDHLVPYAHRDLKPSNILISDDGKT-PILMDFGSVMKARIPIRSRQ 217

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           + L+QQD+A+++ST+PYRAPEL+DV+T   L+EKVDIWSLGCTLYA AYG +PF+ ++NE
Sbjct: 218 DGLLQQDIAAENSTIPYRAPELYDVQTGTTLDEKVDIWSLGCTLYAAAYGQNPFEASVNE 277

Query: 300 QGGSIALAVLNAQFRFP--PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLE 357
            GGSIALA+LN  ++FP    + D YS EFK+LI F+L +DPK+RP IHQVI K+++ L+
Sbjct: 278 MGGSIALAILNGHYKFPLDKEQDDPYSDEFKELIQFLLVIDPKERPTIHQVIEKLESILQ 337



>gi|169859290|ref|XP_001836285.1| other/NAK protein kinase [Coprinopsis cinerea okayama7#130]
 gi|116502574|gb|EAU85469.1| other/NAK protein kinase [Coprinopsis cinerea okayama7#130]
          Length = 413

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 199/400 (49%), Positives = 265/400 (66%), Gaps = 51/400 (12%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D L+AV+SC C   P L IN RTF++IK+LGEGGFS+V+L QD  +GR +ALKKIRC 
Sbjct: 18  AKDALWAVSSCLCQQQPKLKINGRTFQIIKVLGEGGFSFVYLAQDEHSGRQFALKKIRCP 77

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            GS+ VK+AM+EV+ YR F H NII+++D+ VVQD  G G+IVY+FLP YK G LQD IN
Sbjct: 78  TGSEGVKEAMREVEAYRRFKHPNIIRILDSAVVQDPEGEGQIVYLFLPLYKRGNLQDAIN 137

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV--PLRSENGITNSNLNG------- 175
            NL NN++FSE++ML++FRG C AVRA+H YR  S    +R++   +NS  +G       
Sbjct: 138 ANLVNNRHFSEQDMLRLFRGTCLAVRAMHEYRPTSARSAIRTDPQRSNSTNSGPADDDDD 197

Query: 176 ------------------------------IENEMXXXXXXXXXXXXXEDG----VVPFA 201
                                         ++N++             ++G    VVP+A
Sbjct: 198 TRFPRPEGDAEGGYSYDTPSVPLMGKQRELVQNDVVFDGDEESELPQPQEGTPLDVVPYA 257

Query: 202 HRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPEL 261
           HRD+KPGNI++ DD  + PILMDFGS ++A+I I+ R +AL+QQD+A++ STM YRAPEL
Sbjct: 258 HRDLKPGNIMIADDGKT-PILMDFGSTMKAKIPIENRQQALLQQDIAAEQSTMAYRAPEL 316

Query: 262 FDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRFPPTEQ 320
           FDVKT + L+EKVDIWSLGCTLYA+AY  SPF+N    EQGGSIA+AVLNAQ++ P   Q
Sbjct: 317 FDVKTGITLDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP---Q 373

Query: 321 DKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
             YS   + LI  MLK +P++RPDI+QVI   D  L+ L+
Sbjct: 374 SAYSQGLRSLIDAMLKPNPQERPDINQVIELTDRVLQSLA 413



>gi|302683791|ref|XP_003031576.1| hypothetical protein SCHCODRAFT_76377 [Schizophyllum commune H4-8]
 gi|300105269|gb|EFI96673.1| hypothetical protein SCHCODRAFT_76377, partial [Schizophyllum
           commune H4-8]
          Length = 408

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/395 (50%), Positives = 257/395 (65%), Gaps = 46/395 (11%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D ++A++SC C  +  + IN RTF +IK+LGEGGFS+V+L QD  +GR +ALKKIRC 
Sbjct: 18  AKDAIWALSSCLCQQSAKIKINGRTFNIIKVLGEGGFSFVYLAQDEHSGRQFALKKIRCP 77

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            GSD+VK+AM+EV+ YR F H NII+++D+ VVQD +G GKIVY+FLP YK G LQD IN
Sbjct: 78  TGSDAVKEAMREVEAYRRFKHPNIIRILDSAVVQDPDGEGKIVYLFLPLYKRGNLQDAIN 137

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYR---------------------------- 156
           +N+ N  +F E EML++FRG C A+RA+H YR                            
Sbjct: 138 SNVVNGNHFPEGEMLRLFRGTCEAIRAMHDYRAPVASSSSAQQQQRQQRRDEQQRHSDDD 197

Query: 157 --FPSVPLRSENGITNSNLN---------GIENEMXXXXXXXXXXXXXEDGVVPFAHRDI 205
             FP     +E G +    +           E ++                +VP+AHRDI
Sbjct: 198 ERFPHPEGDAEGGYSYDGADVPLVTKHRVEEEGDVIFEGDQDLSSNGGNTELVPYAHRDI 257

Query: 206 KPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVK 265
           KPGN+++ DD  + PILMDFGS V+ARI IQ RN+AL+QQD+A++ STM YRAPELFDVK
Sbjct: 258 KPGNVMIADDGVT-PILMDFGSTVKARIPIQNRNQALVQQDIAAEQSTMTYRAPELFDVK 316

Query: 266 TNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSP 325
           T V L+EKVDIWSLGC LYA+AY  SPF++   EQGGSIA+AVLNAQ++ PP+    YS 
Sbjct: 317 TGVTLDEKVDIWSLGCMLYALAYNHSPFESTQGEQGGSIAMAVLNAQYKHPPS---AYSQ 373

Query: 326 EFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
             KDLI  MLKV+P DRPDIH+VI   D  L+ L+
Sbjct: 374 GLKDLIDSMLKVNPADRPDIHRVIQMTDRVLQSLA 408



>gi|390600491|gb|EIN09886.1| Pkinase-domain-containing protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 404

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/399 (49%), Positives = 256/399 (64%), Gaps = 67/399 (16%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D L+ ++SC C P+ ++ IN RTFK+IK+LGEGGFS+V+L QD ++GR +ALKKIRC 
Sbjct: 21  AKDALWGLSSCICKPDSSIKINGRTFKIIKVLGEGGFSFVYLAQDEASGREFALKKIRCP 80

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            GSD VK+AM+EV+ YR F H+NII+++D+ VVQD  G GKIVY+FLP YK G  QD IN
Sbjct: 81  TGSDGVKEAMQEVEAYRRFKHKNIIRILDSAVVQDPEGEGKIVYLFLPLYKRGNFQDAIN 140

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYR---------------------------- 156
            +     +FSEKEML++F+G C AVRA+H YR                            
Sbjct: 141 AHSAAGTHFSEKEMLRLFKGACEAVRAMHQYRPSARGATQARPAARSADPGGEILDHPDH 200

Query: 157 ----FPSVPLRS-------------ENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVP 199
                 SVPL +             ++    S LNG  N               E G+VP
Sbjct: 201 ADDDGASVPLVAAQTREEGEPIFDEDDDTQTSALNGDGN--------------TEAGIVP 246

Query: 200 FAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAP 259
           +AHRD+KPGN+++ DD  +  ILMDFGS+++AR+ I+ RN+AL+QQD+A++ STM YRAP
Sbjct: 247 YAHRDLKPGNVMIADDGVTS-ILMDFGSVMKARVAIENRNQALLQQDIAAEKSTMAYRAP 305

Query: 260 ELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRFPPT 318
           ELFDVKT V ++EKVDIWSLGCTLYAMAY  SPF+N    EQGGSIA+AV+NAQ++ P  
Sbjct: 306 ELFDVKTGVTIDEKVDIWSLGCTLYAMAYLHSPFENLQTTEQGGSIAMAVMNAQYKHP-- 363

Query: 319 EQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLE 357
            Q  YS   K LI  ML VDP  RPDI QVI  VD  L+
Sbjct: 364 -QSSYSDGLKKLIDSMLTVDPSKRPDIDQVIGMVDRCLQ 401



>gi|511010600|gb|EPB91820.1| NAK protein kinase [Mucor circinelloides f. circinelloides 1006PhL]
          Length = 364

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/365 (51%), Positives = 247/365 (67%), Gaps = 13/365 (3%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
            +S+ D   +   CC P+  L IN R +++IKLLGEGGFS+V+L QD S G  YA+KKIR
Sbjct: 4   FNSILDAFSSFMGCCIPSSNLSINGRAYRIIKLLGEGGFSFVYLAQDGS-GNQYAMKKIR 62

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVI 123
           C  G++    A +EVD+Y+LFSH+NIIK++D+  + + +G K +YIFLPYY+ G LQD I
Sbjct: 63  CTLGTEEADLAQREVDIYQLFSHKNIIKMVDSSTITEPDGSKTIYIFLPYYRRGNLQDAI 122

Query: 124 NNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS---VPLRSENGITNSNLNGIENEM 180
           N N  N  +F E +ML++FR +C AV ALHTY+      V       I+  + N  +  +
Sbjct: 123 NKNNMNKTHFPETDMLRMFREVCVAVEALHTYKAQGGARVLYAPSQVISPEDENRQDEAL 182

Query: 181 XXXXXXXXXXXXXEDG----VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQ 236
                        E G    +VP+AHRDIKPGN+L++DD ++ PILMDFGS   ARI++ 
Sbjct: 183 LSHSQDQPSGGQLETGKRGEMVPWAHRDIKPGNVLISDDGET-PILMDFGSACAARIQVN 241

Query: 237 TRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNN 296
           TR EAL QQDLA++  TMPYRAPELFDVKT   L+EKVDIWSLGCTLYAMAYG SPF+ N
Sbjct: 242 TRQEALQQQDLAAEQCTMPYRAPELFDVKTGTTLDEKVDIWSLGCTLYAMAYGQSPFEVN 301

Query: 297 INEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL 356
           + +QGGS+ALAVLN Q++FP  E  +YS E  + I +ML  +P  RP I QVIAK+D  L
Sbjct: 302 M-DQGGSVALAVLNNQYKFP--EDSQYSKELNETIRWMLTANPATRPSIQQVIAKLDDLL 358

Query: 357 EQLSS 361
           ++ SS
Sbjct: 359 KKSSS 363



>gi|449540347|gb|EMD31340.1| hypothetical protein CERSUDRAFT_119907 [Ceriporiopsis subvermispora
           B]
          Length = 424

 Score =  359 bits (922), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 187/409 (45%), Positives = 256/409 (62%), Gaps = 62/409 (15%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           ++D  +A++SC C  +  + IN RTFK++K+LGEGGFS+V+L QD  +GR +ALKKIRC 
Sbjct: 20  LKDAFWALSSCICQQSAKIKINGRTFKIVKVLGEGGFSFVYLAQDEHSGRQFALKKIRCP 79

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G + V  AM+EV+ YR F H NII+++D+ VVQD +G G+IVY+FLP YK G LQD IN
Sbjct: 80  GGREDVLQAMREVEAYRRFKHPNIIRILDSAVVQDPDGEGQIVYLFLPLYKRGNLQDAIN 139

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYR---------------------------- 156
            N  N  +F+E EM+++F+G C A+RA+H YR                            
Sbjct: 140 ANTINGTHFAEAEMVRLFKGTCEAIRAMHDYRAPLGTTSRENQSSSARRLSGEQPARHSE 199

Query: 157 ----FP-------------------SVPLRSENGITNSN--LNGIENEMXXXXXXXXXXX 191
               FP                   SVPL +++ +       +G E              
Sbjct: 200 DDEMFPHPDGDADGGFSYDGAAGGSSVPLMTKSRLEEEETIFDGDEELKQIQQNGKARAD 259

Query: 192 XXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQH 251
             +  +VP+AHRD+KPGN+++ D+    PILMDFGS ++ARIK++ R++AL+QQD+A++ 
Sbjct: 260 DGQSELVPYAHRDLKPGNVMIADNGS--PILMDFGSTMKARIKVENRSQALLQQDIAAEQ 317

Query: 252 STMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLN 310
           STM YRAPELFDVKT + L+EKVDIWSLGCTLYA+AY  SPF+N    EQGGSIA+AV+N
Sbjct: 318 STMAYRAPELFDVKTGITLDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVMN 377

Query: 311 AQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           AQ++ P +    YS   K+LI  MLKV+P +RPDIH+VI   D  L+ L
Sbjct: 378 AQYKHPNS---AYSQGLKNLIDSMLKVNPAERPDIHKVIEMTDQVLQSL 423



>gi|170098785|ref|XP_001880611.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164644136|gb|EDR08386.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 328

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 180/338 (53%), Positives = 240/338 (71%), Gaps = 26/338 (7%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D  +A++SC C   P + IN RTF++ K+LGEGGFS+V+L QD  +GR +ALKKIRC 
Sbjct: 9   AKDAFWALSSCLCQQTPKVKINGRTFQITKVLGEGGFSFVYLAQDEHSGRQFALKKIRCP 68

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G + VK+ M+EV+ YR F H NII+++D+ VVQD  G G+IVY+FLP YK G LQD+IN
Sbjct: 69  TGQEGVKEVMREVEAYRRFKHPNIIRILDSAVVQDPEGEGQIVYLFLPLYKRGNLQDMIN 128

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXX 184
           +N+ N ++F E+EM+++F+G C AVRA+H YR P+ P   + G  +   +G E +     
Sbjct: 129 SNVVNGQHFPEQEMVRLFKGTCLAVRAMHEYR-PTTPRVEDEGDVDVVFDGDEEQQ---- 183

Query: 185 XXXXXXXXXEDG----VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNE 240
                    +DG    VVP+AHRD+KPGN+++ DD  + PILMDFGS ++ARI I+ R++
Sbjct: 184 ---------QDGPPLAVVPYAHRDLKPGNVMIADDGVT-PILMDFGSTMKARIFIENRSQ 233

Query: 241 ALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINE 299
           AL QQD+A++ STM YRAPELFDVKT   L+EKVDIWSLGCTLYA+AY  SPF+N    E
Sbjct: 234 ALYQQDIAAEQSTMSYRAPELFDVKTGQTLDEKVDIWSLGCTLYALAYSHSPFENTQTTE 293

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKV 337
           QGGSIA+AVLNAQ++ P   Q  YS   +DLI  MLKV
Sbjct: 294 QGGSIAMAVLNAQYKHP---QSAYSRGLRDLIDSMLKV 328



>gi|395332170|gb|EJF64549.1| Pkinase-domain-containing protein [Dichomitus squalens LYAD-421
           SS1]
          Length = 434

 Score =  356 bits (913), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 188/421 (44%), Positives = 258/421 (61%), Gaps = 74/421 (17%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           V+D  +A++SC C  +  + IN RTFK+I++LGEGGFS+V+L QD  +GR +ALKKIRC 
Sbjct: 18  VKDAFWALSSCICQQSAKVKINGRTFKIIRVLGEGGFSFVYLAQDEHSGRQFALKKIRCP 77

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G + V+ AM+EV+ YR F H NII+++D+ VVQD NG G++VY+FLP YK G LQD IN
Sbjct: 78  NGQEDVRQAMREVEAYRRFKHPNIIRILDSAVVQDPNGDGQVVYLFLPLYKRGNLQDAIN 137

Query: 125 NNLENNKYFSEKEMLKIFRGICYAV-------------------RALHTYRFPSVPLRSE 165
            N  NN +FSE EML+ F+G C A+                   RA  +   PS P    
Sbjct: 138 ANSINNTHFSETEMLRYFKGTCEAIRAMHDYRAPVGSKNDAFVSRANQSRHAPSAPSSPR 197

Query: 166 NGIT-NSNLNGI---------------------------------------------ENE 179
           N ++ + + NG+                                             + E
Sbjct: 198 NSLSGDEDDNGMFPQPEGDAEGGYSYHGAGGSSSRAPLMAKDRPQGSGEEHEPIFDGDEE 257

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
           +             E  +VP+AHRD+KPGNI+++D+   QPILMDFGS ++AR+KI+ R+
Sbjct: 258 LDRIQHQGGNGHAGETELVPYAHRDLKPGNIMISDEG--QPILMDFGSTMKARVKIENRS 315

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NIN 298
           +AL+QQD+A++ STM YRAPELFDVKT V ++EKVDIWSLGCTL+A+AY  SPF+N    
Sbjct: 316 QALLQQDIAAEQSTMAYRAPELFDVKTGVTIDEKVDIWSLGCTLFALAYSHSPFENTQTT 375

Query: 299 EQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQ 358
           EQGGSIA+AV+ AQ++ PP+    YS   +DLI  MLKV P++RP+IH+VI + D  L+ 
Sbjct: 376 EQGGSIAMAVMGAQYKHPPS---AYSQGLRDLIDSMLKVKPEERPNIHEVIRRTDQVLQS 432

Query: 359 L 359
           L
Sbjct: 433 L 433



>gi|403417552|emb|CCM04252.1| predicted protein [Fibroporia radiculosa]
          Length = 417

 Score =  356 bits (913), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 194/403 (48%), Positives = 259/403 (64%), Gaps = 56/403 (13%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           ++D  +A++SC C  +  + IN RTFK++++LGEGGFS+V+L +D  +GR +ALKKIRC 
Sbjct: 19  LKDAFWALSSCICQQSAKVKINGRTFKIVRVLGEGGFSFVYLAEDEHSGRQFALKKIRCP 78

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G + V+ AM+EV+ YR F H NII+++D+ VVQD NG G++VY+FLP YK G LQD IN
Sbjct: 79  SGHEDVRQAMREVEAYRRFKHPNIIRILDSAVVQDPNGDGQVVYLFLPLYKRGNLQDAIN 138

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYR---------FPS---------------V 160
            N  NN +FSE+EML++F+G C AVRA+H Y          FPS                
Sbjct: 139 ANSINNNHFSEQEMLRLFKGTCEAVRAMHDYHTPLASSSDPFPSRENQSSAAHDDISRRP 198

Query: 161 PLRSENGI-TNSNLNGIE-------------------NEMXXXXXXXXXXXXXEDG---V 197
            L  E G   N++ NG                     +E              + G   +
Sbjct: 199 SLDEEGGYHDNASTNGSSVPLMSAHRPVDEREPIFGGDEDLARIQQNGASENAQGGQAEL 258

Query: 198 VPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYR 257
           VP+AHRD+KPGN+++ DD    PILMDFGS ++ARIKI+ R++AL+QQD+A++ STM YR
Sbjct: 259 VPYAHRDLKPGNVMIADDGS--PILMDFGSTMKARIKIENRSQALLQQDIAAEQSTMAYR 316

Query: 258 APELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRFP 316
           APELFDVKT V L+EKVDIWSLGCTL+A+AY  SPF+N    EQGGSIA+AV+NAQ++ P
Sbjct: 317 APELFDVKTGVTLDEKVDIWSLGCTLFALAYSHSPFENMQTTEQGGSIAMAVMNAQYKHP 376

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            +    YS   K+LI  MLK +P+DRPDIHQVI   D  L+ L
Sbjct: 377 SS---AYSQGLKNLIDSMLKSNPQDRPDIHQVIEMTDRALQSL 416



>gi|426199049|gb|EKV48974.1| hypothetical protein AGABI2DRAFT_191128 [Agaricus bisporus var.
           bisporus H97]
          Length = 430

 Score =  340 bits (871), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 246/417 (58%), Gaps = 68/417 (16%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D  +A++SC C   P++ IN RTFK+IK+LGEGGFS+V+L QD  +GR++ALKKIRC 
Sbjct: 18  AKDAFWALSSCLCQQTPSVKINGRTFKIIKVLGEGGFSFVYLAQDEYSGRHFALKKIRCP 77

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G++ VK+AM+EV+ YR F H NII++ D+ VVQD  G G+IVY+FLP+YK G LQD IN
Sbjct: 78  TGAEGVKEAMREVEAYRRFKHPNIIRIFDSAVVQDPEGEGQIVYLFLPHYKRGNLQDAIN 137

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLR----SENGI-----TNSNLNG 175
            N+ N ++F E+EM+  F+G C AVRA+H+Y  PS        + NG+     +N+  NG
Sbjct: 138 ANVVNGQHFREQEMVHFFKGTCEAVRAMHSYH-PSAGSAGLPPTSNGVAGASSSNARGNG 196

Query: 176 IENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQ---------------- 219
             N               ED   P    D   G     +DA S                 
Sbjct: 197 NANPQRKGSGRRLSNEDDEDERFPQLEGDADGGYSYEANDASSSVPLVTRNEVVFDGDEE 256

Query: 220 -----------------------------------PILMDFGSLVRARIKIQTRNEALMQ 244
                                              PILMDFGS ++AR+ I+ R+ AL+Q
Sbjct: 257 VAEEVADPGTEVGIVPYAHRDIKPGNVMIADDNVTPILMDFGSTMKARVHIENRSLALLQ 316

Query: 245 QDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGS 303
           QD+A++ STM YRAPELFDVKT   ++EKVDIWSLGCTLYA+AY  SPF+N    EQGGS
Sbjct: 317 QDIAAEQSTMAYRAPELFDVKTGNTIDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGS 376

Query: 304 IALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
           IA+AVLNAQ++ P +    YS   K LI  MLKV+PKDRPDIHQVI   +  L+ L+
Sbjct: 377 IAMAVLNAQYKHPAS---AYSQGLKSLIDSMLKVNPKDRPDIHQVIEMTNRVLQSLA 430



>gi|405118529|gb|AFR93303.1| other/NAK protein kinase [Cryptococcus neoformans var. grubii H99]
          Length = 357

 Score =  337 bits (864), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 172/359 (47%), Positives = 240/359 (66%), Gaps = 27/359 (7%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            RD L  +T C C P+ TL IN R++K+ KLLGEGGFS+V+L++D S+ R YALKKI   
Sbjct: 17  ARDALLTITQCICKPDATLKINGRSYKIEKLLGEGGFSFVYLIRDLSSDRLYALKKILVT 76

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G + VK+AM+EV+ YR F H NII+++D+ VVQD++G GKI+Y+FLPYY  G LQD + 
Sbjct: 77  SGQEGVKEAMREVEAYRRFRHPNIIRILDSAVVQDESGDGKIIYLFLPYYSKGNLQDAMA 136

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV-----PLRSENGITNSNLNGIENE 179
           N     +   E+++L++F G C AVRA+H Y  P++     P R +  +    +   + E
Sbjct: 137 NASVTGQRIPERKLLELFHGTCLAVRAMHQYHLPNISASYPPTREDEPLVGETVFDHDEE 196

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
           +             +  +VP+AHRDIKP NI+++D+   +PILMDFGS ++ARI I+TR 
Sbjct: 197 LTEED---------QGELVPYAHRDIKPANIMISDE--DEPILMDFGSTIKARIAIETRQ 245

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           +AL++QD+A +HS+MPYRAPELFDVKT   L+EK DIWSLGCTLYA+AYG SPF+ +   
Sbjct: 246 QALLEQDIAGEHSSMPYRAPELFDVKTGKTLDEKCDIWSLGCTLYAVAYGHSPFEVD--- 302

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQ 358
            G SIA+AV + ++R        YS +F  LI  ML VDP++RPDI +VI   +  L +
Sbjct: 303 -GQSIAMAVGSGRYR----HLTGYSQDFVQLIDSMLIVDPENRPDIQKVIEMTENILRK 356



>gi|392576326|gb|EIW69457.1| hypothetical protein TREMEDRAFT_39060 [Tremella mesenterica DSM
           1558]
          Length = 361

 Score =  334 bits (856), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 176/353 (49%), Positives = 229/353 (64%), Gaps = 16/353 (4%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D   +++ C C P+ TL IN R++ V KLLGEGGFS+V+L+ D  +GR YALKKI   
Sbjct: 20  AKDAFVSISQCICKPDTTLKINGRSYHVDKLLGEGGFSFVYLIHDVESGRAYALKKILVT 79

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G + VK AMKEV+ YR F H NIIK++D+ +VQD++G GKI+Y+FLPYY  G LQD + 
Sbjct: 80  SGQEGVKAAMKEVEAYRRFRHPNIIKILDSSIVQDESGHGKIIYLFLPYYPRGNLQDSMT 139

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXX 184
             +       EK +L++F G C AVRA+H Y     P+ S         + +  E     
Sbjct: 140 VAVNTGDRIPEKRLLELFHGTCLAVRAMHRYH---SPVDSSTYPPTQGADPLSGENDPLF 196

Query: 185 XXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQ 244
                    E   VP+AHRDIKPGNI++ DD    PILMDFGS V+ARI I+TR +AL++
Sbjct: 197 DRDESDPTVEGESVPYAHRDIKPGNIMIADDG--SPILMDFGSTVKARIDIRTRQQALLE 254

Query: 245 QDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSI 304
           QD AS+ STMPYRAPELFDVKT   L+EKVDIWSLGCTL+A+AYG SPF+     +G SI
Sbjct: 255 QDAASEQSTMPYRAPELFDVKTGKRLDEKVDIWSLGCTLFAVAYGHSPFEV----EGQSI 310

Query: 305 ALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLE 357
           A+AV + ++R P      YSP+   LI  ML VDP+ RPDI +VIA  +  L+
Sbjct: 311 AMAVGSGRYRHP----GGYSPKLIALIDSMLIVDPEKRPDIEKVIALTEETLK 359



>gi|321251918|ref|XP_003192223.1| serine/threonine-protein kinase [Cryptococcus gattii WM276]
 gi|317458691|gb|ADV20436.1| Serine/threonine-protein kinase, putative [Cryptococcus gattii
           WM276]
          Length = 361

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 171/351 (48%), Positives = 236/351 (67%), Gaps = 29/351 (8%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            RD L  +T C C P+ TL IN R++K+ KLLGEGGFS+V+L++D S+ R YALKKI   
Sbjct: 17  ARDALLTITQCICKPDATLKINGRSYKIEKLLGEGGFSFVYLIRDLSSDRLYALKKILIT 76

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G + VK+AM+EV+ YR F H NII+++D+ VVQD++G GKI+Y+FLPYY  G LQD + 
Sbjct: 77  SGQEGVKEAMREVEAYRRFRHPNIIRILDSAVVQDESGDGKIIYLFLPYYSKGNLQDAMA 136

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV-----PLRSENGITNSNLNGIENE 179
           N         E+++L++F G C A  A+H YR P++     P R +  +    +   + E
Sbjct: 137 NASVTGHRMPERKLLELFHGTCLA--AMHQYRLPNISASYPPTREDEPLVGETVFDHDEE 194

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
           +                +VP+AHRDIKP NI+++D+   +PILMDFGS ++ARIK++TR 
Sbjct: 195 LTEEDRGE---------LVPYAHRDIKPANIMISDE--DEPILMDFGSTIKARIKVETRQ 243

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           +AL++QD+AS+HS+MPYRAPELFDVKTN  L+EK DIWSLGCTLYA+AYG SPF+ +   
Sbjct: 244 QALLEQDIASEHSSMPYRAPELFDVKTNKTLDEKCDIWSLGCTLYAVAYGHSPFEVD--- 300

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIA 350
            G SIA+AV + ++R        YS +F  LI  ML VDP+ RPDI +V +
Sbjct: 301 -GQSIAMAVGSGRYR----HGTGYSQDFVQLIDSMLVVDPEQRPDIQKVCS 346



>gi|58263206|ref|XP_569013.1| serine/threonine-protein kinase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57223663|gb|AAW41706.1| serine/threonine-protein kinase, putative [Cryptococcus neoformans
           var. neoformans JEC21]
          Length = 354

 Score =  331 bits (849), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 235/351 (66%), Gaps = 29/351 (8%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            RD L  +T C C P+ TL IN R++K+ KLLGEGGFS+V+L++D S+ R YALKKI   
Sbjct: 17  ARDALLTITQCICKPDATLKINGRSYKIEKLLGEGGFSFVYLIRDLSSDRLYALKKILVT 76

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G + VK+AM+EV+ YR F H NII+++D+ VVQD++G GKI+Y+FLPYY  G LQD + 
Sbjct: 77  SGQEGVKEAMREVEAYRRFRHPNIIRILDSAVVQDESGDGKIIYLFLPYYSKGNLQDAMA 136

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV-----PLRSENGITNSNLNGIENE 179
           N     +   E+++L+IF G C A  A+H YR P++     P R +  +    +   + E
Sbjct: 137 NASVTGQRIPERKLLEIFHGTCLA--AMHQYRLPNISASYPPTREDEPLVGETVFDHDEE 194

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
           +                +VP+AHRDIKP NI+++D+   +PILMDFGS ++ARI ++TR 
Sbjct: 195 LTQEDRGE---------LVPYAHRDIKPANIMISDE--DEPILMDFGSTIKARITVETRQ 243

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           +AL++QD+A +HS+MPYRAPELFDVKT   L+EK DIWSLGCTLYA+AYG SPF+ +   
Sbjct: 244 QALLEQDIAGEHSSMPYRAPELFDVKTGRTLDEKCDIWSLGCTLYAVAYGHSPFEVD--- 300

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIA 350
            G SIA+AV + ++R P      YS +F  LI  ML VDP+ RPDI +V +
Sbjct: 301 -GQSIAMAVGSGRYRHP----SGYSQDFVQLIDSMLVVDPEHRPDIQKVCS 346



>gi|494824805|gb|EON62059.1| NAK protein kinase [Coniosporium apollinis CBS 100218]
          Length = 418

 Score =  325 bits (833), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 180/412 (43%), Positives = 242/412 (58%), Gaps = 54/412 (13%)

Query: 1   MSLVLSSVRDTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRY 57
           MS   S   D +Y++T+C  CFP +P L IN ++FK+++LLGEGGFSYV+LVQDTST   
Sbjct: 1   MSAAASYFLDLVYSLTNCMSCFPGSPQLRINNKSFKILRLLGEGGFSYVYLVQDTSTSTL 60

Query: 58  YALKKIRCQFGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPY 114
           YALKKIRC FG +SV  A+KEV+ Y LF+ H NII+ ID  V  DK+  G K VYI LPY
Sbjct: 61  YALKKIRCPFGQESVSQALKEVEAYSLFAPHPNIIRAIDHSVESDKSDPGAKTVYILLPY 120

Query: 115 YKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP-----LRSENGI 168
           Y+ G LQD+IN NL N+  F E+ ++ +F G+C A++A+H YR    P      R   G+
Sbjct: 121 YRRGNLQDMINANLVNHTTFPERRLMVLFLGVCRALKAMHHYRVKKGPGGEASERKARGV 180

Query: 169 --------------------------TNSNLNGIENEMXXXXXXXXXXXXXEDGVV---- 198
                                           G + E+             ++GV     
Sbjct: 181 RREAARADREAGEEVEMNMGKRRQRSPRGEAAGDDLELEQEPLMEGEVTRSQEGVKAGEE 240

Query: 199 -PFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYR 257
             +AHRDIKPGNI+++DD  + PILMD GSL  A   I +R+ AL  QD A++HSTMPYR
Sbjct: 241 RAYAHRDIKPGNIMISDDGQT-PILMDLGSLAPAPTSITSRSLALQVQDQAAEHSTMPYR 299

Query: 258 APELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP- 316
           APELFDVKT   ++ KVDIWSLGCTLYA   G SPF+    E GGS++L VL   +RFP 
Sbjct: 300 APELFDVKTGSTIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSLCVLGGDWRFPD 359

Query: 317 ---------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                       ++  +P  KD++   L+V+P +RPD+ ++I+ V+  +E L
Sbjct: 360 EAPARGKQKAKSEEGITPAVKDVVRRCLRVEPAERPDVDELISLVEEVIEGL 411



>gi|134108190|ref|XP_777046.1| hypothetical protein CNBB2780 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259731|gb|EAL22399.1| hypothetical protein CNBB2780 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 366

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 165/338 (48%), Positives = 227/338 (67%), Gaps = 27/338 (7%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            RD L  +T C C P+ TL IN R++K+ KLLGEGGFS+V+L++D S+ R YALKKI   
Sbjct: 17  ARDALLTITQCICKPDATLKINGRSYKIEKLLGEGGFSFVYLIRDLSSDRLYALKKILVT 76

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G + VK+AM+EV+ YR F H NII+++D+ VVQD++G GKI+Y+FLPYY  G LQD + 
Sbjct: 77  SGQEGVKEAMREVEAYRRFRHPNIIRILDSAVVQDESGDGKIIYLFLPYYSKGNLQDAMA 136

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV-----PLRSENGITNSNLNGIENE 179
           N     +   E+++L+IF G C AVRA+H YR P++     P R +  +    +   + E
Sbjct: 137 NASVTGQRIPERKLLEIFHGTCLAVRAMHQYRLPNISASYPPTREDEPLVGETVFDHDEE 196

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
           +                +VP+AHRDIKP NI+++D+   +PILMDFGS ++ARI ++TR 
Sbjct: 197 LTQEDRGE---------LVPYAHRDIKPANIMISDE--DEPILMDFGSTIKARITVETRQ 245

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           +AL++QD+A +HS+MPYRAPELFDVKT   L+EK DIWSLGCTLYA+AYG SPF+ +   
Sbjct: 246 QALLEQDIAGEHSSMPYRAPELFDVKTGRTLDEKCDIWSLGCTLYAVAYGHSPFEVD--- 302

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKV 337
            G SIA+AV + ++R P      YS +F  LI  ML V
Sbjct: 303 -GQSIAMAVGSGRYRHP----SGYSQDFVQLIDSMLVV 335



>gi|393239705|gb|EJD47235.1| other/NAK protein kinase [Auricularia delicata TFB-10046 SS5]
          Length = 389

 Score =  322 bits (826), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 234/390 (60%), Gaps = 39/390 (10%)

Query: 4   VLSSVRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKK 62
           +L + RD L A+TSC C P   L IN RT+K++KLLGEGGFS+V+L +D  +GR +ALK 
Sbjct: 6   LLDTARDALTAITSCVCRPQAKLKINGRTYKLVKLLGEGGFSFVYLAEDEHSGRQFALKV 65

Query: 63  IRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQ 120
           IRC  G   V++A++E   +R F H N+++++D+ VVQD  G GKIVY+FLP+++ G L 
Sbjct: 66  IRCPSGGADVREALREAAAHRRFKHPNVMRILDSAVVQDPAGDGKIVYLFLPFFRRGNLH 125

Query: 121 DVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS-------VPLRSEN------G 167
           D ++ +     +F E +ML IFRG C AVRA+H +R  +        P  + N      G
Sbjct: 126 DALSTHAVRGTHFPEHDMLTIFRGTCLAVRAIHQHRAKAGAASGAQRPPETHNDDDDRGG 185

Query: 168 ITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPF-----------------AHRDIKPGNI 210
           +     +                   ++  V F                 AHRDIKP N+
Sbjct: 186 LPEPEGDAEGGFSYHAAAPAPSRRRQQEAEVVFNAEEPAEEGEEGVLQPWAHRDIKPANV 245

Query: 211 LLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVEL 270
           +L D  D  P+LMD GS + ARI+IQTR EALMQQ++A++ S+MPYRAPELFDVKT+  L
Sbjct: 246 MLAD--DGTPVLMDLGSAIPARIRIQTRQEALMQQEMAAERSSMPYRAPELFDVKTDTTL 303

Query: 271 NEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDL 330
           +EKVDIWSLG TLY +AY  SPF+     QG S+ +AVLNAQ++ PP+E   YS   + L
Sbjct: 304 DEKVDIWSLGATLYTLAYLYSPFEAQA-AQGASVQMAVLNAQYKHPPSE---YSRAVRAL 359

Query: 331 ISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
           I   L VDP+ RP I  VI   D  L+ L+
Sbjct: 360 IDMCLVVDPEQRPGIDAVIEATDRALQNLN 389



>gi|485926093|gb|EOD50465.1| putative serine threonine protein [Neofusicoccum parvum UCRNP2]
          Length = 397

 Score =  322 bits (825), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 180/391 (46%), Positives = 239/391 (61%), Gaps = 34/391 (8%)

Query: 1   MSLVLSSVRDTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRY 57
           MS + S V D +Y++T+C  CFP  P L IN R+FK+++LLGEGGFSYV+LVQD S    
Sbjct: 1   MSSLSSYVLDLVYSLTNCMSCFPGTPQLKINGRSFKILRLLGEGGFSYVYLVQDNSGQNL 60

Query: 58  YALKKIRCQFGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPY 114
           YALKKIRC FG +SV  A+KEV+ Y LFS H NII  ID  +  DK+  G K VYI LPY
Sbjct: 61  YALKKIRCPFGQESVSQALKEVEAYSLFSPHPNIIHCIDHSIASDKSDPGAKTVYILLPY 120

Query: 115 YKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNL 173
           Y+ G LQD+IN NL N+  F E+ ++ +F G+C A++A+H Y+  +    S      S +
Sbjct: 121 YRRGNLQDMINANLVNHTNFPERRLMILFLGVCRALKAMHQYKVKAEEAGSRRQ-QKSRM 179

Query: 174 NGIENEMXXXXXXXXXXXXXEDGVVP-----FAHRDIKPGNILLTDDADSQPILMDFGSL 228
              + +              +DGV P     +AHRDIKPGNI++ DD  + PILMD GSL
Sbjct: 180 ADDDEDEAAEPLMDDEVTASQDGVAPGEQRAYAHRDIKPGNIMIADDGKT-PILMDLGSL 238

Query: 229 VRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAY 288
             + I I +R+ AL  QD A++HSTMPYRAPELFDVKT+  ++ KVDIWSLGCTLYA   
Sbjct: 239 APSPIPITSRSLALQVQDTAAEHSTMPYRAPELFDVKTDTSIDTKVDIWSLGCTLYACLV 298

Query: 289 GSSPFDNNINEQGGSIALAVLNAQFRFP-------------------PTEQD-KYSPEFK 328
           G SPF+    E GGS++L VL   +RFP                    T QD   S   K
Sbjct: 299 GKSPFEARSEETGGSLSLCVLGGDWRFPDEGTAQQAHGKQKQAASALSTPQDGGISEPVK 358

Query: 329 DLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +++   LKV+P +RPD+ ++I  V+  + +L
Sbjct: 359 EVVRKCLKVEPAERPDVDELIRIVEDVITEL 389



>gi|512207232|gb|EPE36050.1| Protein kinase-like (PK-like) [Glarea lozoyensis ATCC 20868]
          Length = 413

 Score =  315 bits (808), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 177/403 (43%), Positives = 237/403 (58%), Gaps = 55/403 (13%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y +T+C  CFP +P L IN R+FK+++LLGEGGFSYV+LVQDTS    YALKKIRC 
Sbjct: 7   DLFYTLTNCMSCFPGSPQLKINSRSFKILRLLGEGGFSYVYLVQDTSNESLYALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKNG--GKIVYIFLPYYKSG-LQDV 122
           FG +SV  AMKEV+ Y LFS H NII  ID  V  D++    K VYI LPYY+ G LQD+
Sbjct: 67  FGQESVALAMKEVEAYALFSPHPNIIHSIDYSVASDRSDPTAKTVYILLPYYRRGNLQDI 126

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP-----------LRSENGITNS 171
           IN NL N   F E+ ++ +F G+C A++A+H Y+    P           +R +    + 
Sbjct: 127 INANLVNGTRFPERNLMVLFLGVCKALKAMHNYKVGGPPGGANSQKKAKRVRGQAASADQ 186

Query: 172 NLNGIENEMXXXXXXXXXX---------------XXXEDGVVP-----FAHRDIKPGNIL 211
            L   E E+                            ++G+ P     +AHRDIKPGNI+
Sbjct: 187 EL-AEEAELRRGRQAARQVDSDSEQQEALLEPEILTAQEGIAPGGIRAYAHRDIKPGNIM 245

Query: 212 LTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELN 271
           + DD + QPILMD GSL  A   I +R++AL  QD A++HSTMPYRAPELFDVKT   ++
Sbjct: 246 IDDDGE-QPILMDLGSLAPAPTPITSRSQALAVQDQAAEHSTMPYRAPELFDVKTGSVID 304

Query: 272 EKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP--------------- 316
            KVDIWSLGCTLYA   G SPF+   +E GGS++L VL   +RFP               
Sbjct: 305 TKVDIWSLGCTLYACLVGKSPFEMRSDETGGSLSLCVLGGDWRFPDEGAGGKKKATNQTG 364

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            ++  + S   ++++   LKV+P +RPD+ ++I  V+  +EQL
Sbjct: 365 QSDDSEISEGIREVVRKCLKVEPAERPDVDELIEIVEGVIEQL 407



>gi|449299431|gb|EMC95445.1| hypothetical protein BAUCODRAFT_541809 [Baudoinia compniacensis
           UAMH 10762]
          Length = 430

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 178/412 (43%), Positives = 233/412 (56%), Gaps = 70/412 (16%)

Query: 10  DTLYAVTSCC--FP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           DTL+ ++ CC  FP NP+L +N R+FK+++LLGEGGFSYV+LVQ       YALKKIRC 
Sbjct: 16  DTLWQLSQCCNCFPANPSLRLNGRSFKILRLLGEGGFSYVYLVQSPGDPTLYALKKIRCP 75

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  A+KEV+ Y LFS H NII  +D CV  DK   G K VYI LPYY+ G LQD 
Sbjct: 76  FGQESVSQALKEVEAYSLFSPHPNIIHAVDHCVEDDKGGEGNKTVYILLPYYRRGNLQDA 135

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP--------------------- 161
           IN NL N+  F E+ ++ +F G+C A++A+H YR    P                     
Sbjct: 136 INANLVNHARFPERRLMVLFLGVCRALKAMHQYRVKGAPGGETSRKKAKKVRVQAAEADR 195

Query: 162 -------------LRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVV-PFAHRDIKP 207
                         R +NG T       E E              E+G +  +AHRDIKP
Sbjct: 196 EAEAAAVQANTSRRRRDNGDT-------EQEPLMEGEVMAAQEGMEEGQMRSYAHRDIKP 248

Query: 208 GNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTN 267
           GNI+++D+  +QP+LMDFGSL  +   + +R  AL  QD A++HSTMPYRAPELFDVKT 
Sbjct: 249 GNIMISDNG-TQPVLMDFGSLAPSPTPVTSRALALQIQDQAAEHSTMPYRAPELFDVKTG 307

Query: 268 VELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP---PTE----- 319
             ++ KVDIWSLGCTLYA   G SPF+    E GGS++L VL   +RFP   P E     
Sbjct: 308 TVIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSLCVLGGDWRFPDEGPAEAKRGK 367

Query: 320 ------------QDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                       +D  S   K+++   L+V+P +RPDI Q+ A V+  +  L
Sbjct: 368 QRVTDAEAPKKKEDVVSEPVKEVVRACLRVEPAERPDIDQLTAMVEEVVASL 419



>gi|296417038|ref|XP_002838172.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634086|emb|CAZ82363.1| unnamed protein product [Tuber melanosporum]
          Length = 387

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 228/376 (60%), Gaps = 30/376 (7%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y++T+C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD + G  YALKKIRC 
Sbjct: 7   DLVYSLTTCMSCFPSSPNLTINHRSFKILRLLGEGGFSYVYLVQDNA-GALYALKKIRCP 65

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGG--------------KIVYIFL 112
           FG +SV+ AMKEV+ Y+LF+HEN+IK +D  +  D++                K VYI L
Sbjct: 66  FGQESVQRAMKEVEAYKLFNHENVIKSVDYTITSDRSASTTLGRSDDGDDGSQKTVYILL 125

Query: 113 PYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRF--PSVPLRSENGIT 169
           PY++ G LQD IN NL N+  F E  ++++F G+C  ++ALH +R   P           
Sbjct: 126 PYFRRGNLQDAINANLINHTIFPEGRLMRLFLGVCRGLQALHEHRLKRPGEVRAGAGATA 185

Query: 170 NSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLV 229
               +     +             E  +  +AHRDIKPGN+++ DD   +PILMDFGS+ 
Sbjct: 186 GGGSDETTEPLMTPDVLSTQEGGQEGDIRAYAHRDIKPGNVMIDDDG-LRPILMDFGSMT 244

Query: 230 RARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYG 289
            A   I +R  AL  QD A++HSTMPYRAPELFDVKT   ++EKVDIWS+GCTLY   YG
Sbjct: 245 PAPTPITSRTLALSVQDNAAEHSTMPYRAPELFDVKTGSVIDEKVDIWSMGCTLYCALYG 304

Query: 290 SSPFDNNINEQGGSIALAVLNAQFRFPPT--------EQDKYSPEFKDLISFMLKVDPKD 341
            SPF+    E GGS+ALAV +  + FP           Q   S   K+++   LKV+P D
Sbjct: 305 DSPFELATEESGGSLALAVCSGSYTFPEEGRLGGRKPGQRPVSEGVKEIVRMCLKVEPAD 364

Query: 342 RPDIHQVIAKVDTQLE 357
           RP+I ++I +V+  +E
Sbjct: 365 RPNIRELIREVERVIE 380



>gi|407929432|gb|EKG22262.1| hypothetical protein MPH_00441 [Macrophomina phaseolina MS6]
          Length = 421

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 176/415 (42%), Positives = 240/415 (57%), Gaps = 57/415 (13%)

Query: 1   MSLVLSSVRDTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRY 57
           MS + S V D +Y++T+C  CFP  P L IN R+FK+++LLGEGGFSYV+LVQD S    
Sbjct: 1   MSSLSSYVLDLVYSLTNCMSCFPGTPQLKINGRSFKILRLLGEGGFSYVYLVQDNSGQNL 60

Query: 58  YALKKIRCQFGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPY 114
           YALKKIRC FG +SV  A+KEV+ Y LFS H NII  ID  +  DK+  G K VYI LPY
Sbjct: 61  YALKKIRCPFGQESVSLALKEVEAYSLFSPHPNIIHCIDHSIASDKSDPGAKTVYILLPY 120

Query: 115 YKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGI----- 168
           Y+ G LQD+IN NL N+  F E+ ++ +F G+C A++A+H Y+    P  + +       
Sbjct: 121 YRRGNLQDMINANLVNHTNFPERRLMILFLGVCRALKAMHQYKVKGAPGGAASQSKAKRV 180

Query: 169 --------------------TNSNLNGIENEMXXXXXXXXXXXXXEDGVVP-----FAHR 203
                                N  +   + +              +DGV P     +AHR
Sbjct: 181 RQEAARADAEAAEEAGARKQKNRRMEDEDEDEAAEPLIDDEVTAAQDGVAPGEQRAYAHR 240

Query: 204 DIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFD 263
           DIKPGNI++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFD
Sbjct: 241 DIKPGNIMIADDGKT-PILMDLGSLAPSPIHITSRSLALQVQDTAAEHSTMPYRAPELFD 299

Query: 264 VKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------- 316
           VKT+  ++ KVDIWSLGCTLYA   G SPF+    E GGS++L VL   +RFP       
Sbjct: 300 VKTDTSIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSLCVLGGDWRFPDESSAQD 359

Query: 317 ------------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                        +++   S   K+++   L+V+P +RPD+ ++I  V+  + +L
Sbjct: 360 HGRQKQAVSSLSASQEGSISEPVKEVVRKCLRVEPSERPDVDELIRIVEDVITEL 414



>gi|50545942|ref|XP_500508.1| YALI0B04840p [Yarrowia lipolytica]
 gi|49646374|emb|CAG82736.1| YALI0B04840p [Yarrowia lipolytica CLIB122]
          Length = 357

 Score =  313 bits (803), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/372 (43%), Positives = 236/372 (63%), Gaps = 35/372 (9%)

Query: 6   SSVRDTLYAVTSC--CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKI 63
           S ++D  Y++++C  CFP+P L IN R+FK+ KLLGEGGF++V+LV+ T     +ALKKI
Sbjct: 3   SYIKDCFYSLSTCISCFPSPQLRINNRSFKIRKLLGEGGFAFVYLVE-TRGQELFALKKI 61

Query: 64  RCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDV 122
           RC FG +SV+ AM+EVD Y+ F    IIK +D+ V Q+ +G K VYI LPY K+G LQD 
Sbjct: 62  RCPFGPESVQTAMREVDAYKTFDSPYIIKYVDSSVEQEADGSKSVYILLPYLKNGNLQDA 121

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRF-------PSVPLRS-------ENGI 168
           IN+++ N  +FSE+E++ +   IC+A++ LH +R         +VP  S       E G+
Sbjct: 122 INDHVMNGTHFSEEELMALVVEICHAIKTLHQHRIGGDVSTTTTVPQSSYRLGDDEEQGL 181

Query: 169 TNSN-LNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGS 227
             ++ LN   N                  +VP+AHRDIKP NI+L+D+   +PILMD GS
Sbjct: 182 VAADELNNSANATPLSE------------LVPYAHRDIKPANIMLSDNG--RPILMDLGS 227

Query: 228 LVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMA 287
             RARI + +R +AL  QD+A++  +MPYRAPELFDVKT   ++E+VD+WSLGCT+Y + 
Sbjct: 228 CSRARIDVSSRQKALELQDMAAEQCSMPYRAPELFDVKTGANIDERVDVWSLGCTIYTLM 287

Query: 288 YGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQ 347
           Y +SPF++  NE G S+ LA++N  F  P + +  YS + K L+   L VDP++RP I  
Sbjct: 288 YFTSPFEHQTNETGASLNLAIMNGHFTMPASPE--YSDQLKGLVKKCLIVDPQERPFIDD 345

Query: 348 VIAKVDTQLEQL 359
           V+     +  ++
Sbjct: 346 VLKAASEEYREV 357



>gi|511006741|gb|EPB88047.1| NAK protein kinase [Mucor circinelloides f. circinelloides 1006PhL]
          Length = 329

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 156/352 (44%), Positives = 228/352 (64%), Gaps = 40/352 (11%)

Query: 5   LSSVRDTLYAV--TSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKK 62
           ++SV DT+      +  FPN  + +N R+F++ KLLGEGGFS+V+L QD +  + +A+K 
Sbjct: 11  INSVVDTVVDTYNNAHTFPNTVIKVNGRSFRITKLLGEGGFSFVYLAQDDNK-QLFAIKT 69

Query: 63  IRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQD 121
           IRC+ G +  ++A+KE  +   F H+NIIK+ D C++++++G K +YI +P+YK G +QD
Sbjct: 70  IRCKMGKEVAQNAIKEAIITNRFQHKNIIKIEDMCMIKEEDGSKTIYIIMPFYKRGNIQD 129

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMX 181
           +I+   +  K   E+++L +FR IC +V+ L +Y+               N  G+     
Sbjct: 130 LIDKCNQQGKTIPERQILTLFRDICISVQVLASYK---------------NRAGVS---- 170

Query: 182 XXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEA 241
                           +P+AHRDIKP N+LL+DD  + P+LMDFGS   AR+ I  R  A
Sbjct: 171 ----------------IPWAHRDIKPANVLLSDDGKT-PVLMDFGSARPARVDIVDRQTA 213

Query: 242 LMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQG 301
           + QQD A+++ +MPYRAPELFDVKT   L EKVD+WSLGCTL+AMAYG SPF+  +N+QG
Sbjct: 214 MKQQDDAAENCSMPYRAPELFDVKTGTTLTEKVDVWSLGCTLFAMAYGESPFEMTVNQQG 273

Query: 302 GSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVD 353
           G++ALAVLN QF FP  ++D YS   +DLIS+ML  DP  RP+I +VI+ V+
Sbjct: 274 GTMALAVLNRQFYFPHAKKDMYSRTLQDLISWMLNTDPNTRPNIDKVISAVN 325



>gi|259486792|tpe|CBF84937.1| TPA: serine/threonine protein kinase, putative (AFU_orthologue;
           AFUA_8G04670) [Aspergillus nidulans FGSC A4]
          Length = 419

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 228/407 (56%), Gaps = 58/407 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ E NII  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYSLFTSEKNIIHSIDHCVSTESGSKFRSDGGEAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV--PLRSENGITNSN 172
           + G LQD IN NL N   F EK ++ +  G+  A+RA+H YR  S   P R    +    
Sbjct: 127 QRGNLQDAINANLVNQTRFPEKRLMVLMLGVAQALRAMHQYRVKSGSGPTRKAKAVRKEG 186

Query: 173 LNG---------------------IENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGNI 210
                                    ENE              EDG + P+AHRDIKPGNI
Sbjct: 187 AEADVEMRKGKGKRRGSQPAGEEDSENEPLMDDEVTQSQEGYEDGNLRPYAHRDIKPGNI 246

Query: 211 LLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVEL 270
           ++ DD  S PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   +
Sbjct: 247 MIDDDGQS-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSII 305

Query: 271 NEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------PT 318
           + KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP             +
Sbjct: 306 DTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKSGATKGKGKAS 365

Query: 319 EQDKY------SPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           EQ K       S   K+++   L+V+P DRPDI ++I  +   + +L
Sbjct: 366 EQQKQDSAASISSPVKEVVRRCLQVEPADRPDIDELIQMLKEVIREL 412



>gi|242799422|ref|XP_002483375.1| serine/threonine protein kinase, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|242799427|ref|XP_002483376.1| serine/threonine protein kinase, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218716720|gb|EED16141.1| serine/threonine protein kinase, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218716721|gb|EED16142.1| serine/threonine protein kinase, putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 421

 Score =  310 bits (793), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 172/412 (41%), Positives = 235/412 (57%), Gaps = 63/412 (15%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKNTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQ---------DKNGGKIVYIFLPYYK 116
           FG +SV  A+KEV+ Y LF+ H NII+  D CVV          D +  K VYI LPYY+
Sbjct: 67  FGQESVSQALKEVEAYSLFTPHPNIIRSFDHCVVNESASKFRGGDDSSSKTVYILLPYYQ 126

Query: 117 SG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGIT------ 169
            G LQD IN NL N+  F EKE++ +  G+  A++A+H Y+  S P  +    +      
Sbjct: 127 RGNLQDAINANLVNHTKFPEKELMALMLGVAKALKAMHQYKVKSGPASTRQAKSVRREGE 186

Query: 170 --------------NSNLNGIENEMXXXXXXXXXXXXXEDGV-----VPFAHRDIKPGNI 210
                           N +G+++++             ++GV      P+AHRDIKPGNI
Sbjct: 187 QADEELSRKLGKPKRRNTHGVDDDVEQEPLMDDEVTQSQEGVGEGEFRPYAHRDIKPGNI 246

Query: 211 LLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVEL 270
           ++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   +
Sbjct: 247 MIDDDGIT-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSII 305

Query: 271 NEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP-------------- 316
           + KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP              
Sbjct: 306 DTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDENTSSAKGKAKSN 365

Query: 317 ---------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                     + ++  S   K+++   L+V+P DRPDI ++I  +   ++ L
Sbjct: 366 TPAASGSSQASNENGISEPVKEIVRKCLQVEPADRPDIDELIQLISKAIKSL 417



>gi|154324130|ref|XP_001561379.1| hypothetical protein BC1G_00464 [Botryotinia fuckeliana B05.10]
 gi|347829817|emb|CCD45514.1| similar to serine/threonine protein kinase [Botryotinia fuckeliana
           T4]
 gi|472241307|gb|EMR86035.1| putative serine threonine protein [Botryotinia fuckeliana BcDW1]
          Length = 413

 Score =  309 bits (792), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 175/403 (43%), Positives = 234/403 (58%), Gaps = 55/403 (13%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY +T+C  CFP +P L IN R+FK+++LLGEGGFSYV+LVQDTS+   YA+KKIRC 
Sbjct: 7   DLLYTLTNCMSCFPGSPQLKINNRSFKILRLLGEGGFSYVYLVQDTSSDNTYAVKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  AMKEV+ Y LFS H NII  +D CV  D++  G K VYI LPYY+ G LQD+
Sbjct: 67  FGQESVALAMKEVEAYALFSPHPNIIHSVDYCVSADRSDPGAKTVYILLPYYRRGNLQDI 126

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP--------------------- 161
           IN NL N+  F EK ++ +F G+  A++A+H Y+    P                     
Sbjct: 127 INANLVNHTKFPEKRLMVLFLGVLNALKAMHQYKVRGGPGGANSVNKAKKVRADAARADQ 186

Query: 162 -----LRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVP-----FAHRDIKPGNIL 211
                + S  G         ++E              E G+ P     +AHRDIKPGNI+
Sbjct: 187 EAEEEVESRRGRQRGRETDDDSEQQEPLMDGEVTMSQE-GIAPGGARAYAHRDIKPGNIM 245

Query: 212 LTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELN 271
           + DD   QPILMD GSL  +   I +R+ AL  QD A++HSTMPYRAPELFDVKT   ++
Sbjct: 246 IDDDG-VQPILMDLGSLAPSPTPITSRSLALAVQDQAAEHSTMPYRAPELFDVKTGSTID 304

Query: 272 EKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP--------------- 316
            KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP               
Sbjct: 305 TKVDIWSLGCTLYACLVGKSPFEMRSDETGGSLSICVLGGDWRFPDEGAGGKKKTTNQTG 364

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            +E    S   ++++   LKV+P +RPD+ +++  V   +E+L
Sbjct: 365 QSEDSGISESIREVVRKCLKVEPSERPDVDELMEIVRGVIEEL 407



>gi|67522038|ref|XP_659080.1| hypothetical protein AN1476.2 [Aspergillus nidulans FGSC A4]
 gi|40745450|gb|EAA64606.1| hypothetical protein AN1476.2 [Aspergillus nidulans FGSC A4]
          Length = 979

 Score =  309 bits (791), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 228/407 (56%), Gaps = 58/407 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ E NII  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYSLFTSEKNIIHSIDHCVSTESGSKFRSDGGEAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV--PLRSENGITNSN 172
           + G LQD IN NL N   F EK ++ +  G+  A+RA+H YR  S   P R    +    
Sbjct: 127 QRGNLQDAINANLVNQTRFPEKRLMVLMLGVAQALRAMHQYRVKSGSGPTRKAKAVRKEG 186

Query: 173 LNG---------------------IENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGNI 210
                                    ENE              EDG + P+AHRDIKPGNI
Sbjct: 187 AEADVEMRKGKGKRRGSQPAGEEDSENEPLMDDEVTQSQEGYEDGNLRPYAHRDIKPGNI 246

Query: 211 LLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVEL 270
           ++ DD  S PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   +
Sbjct: 247 MIDDDGQS-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSII 305

Query: 271 NEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------PT 318
           + KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP             +
Sbjct: 306 DTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKSGATKGKGKAS 365

Query: 319 EQDK------YSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           EQ K       S   K+++   L+V+P DRPDI ++I  +   + +L
Sbjct: 366 EQQKQDSAASISSPVKEVVRRCLQVEPADRPDIDELIQMLKEVIREL 412



>gi|156057459|ref|XP_001594653.1| hypothetical protein SS1G_04461 [Sclerotinia sclerotiorum 1980]
 gi|154702246|gb|EDO01985.1| hypothetical protein SS1G_04461 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 413

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 172/402 (42%), Positives = 232/402 (57%), Gaps = 53/402 (13%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY +T+C  CFP +P L IN R+FK+++LLGEGGFSYV+LVQDTS    YA+KKIRC 
Sbjct: 7   DLLYTLTNCMSCFPGSPQLKINNRSFKILRLLGEGGFSYVYLVQDTSDDNTYAVKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  AMKEV+ Y LFS H NII  +D CV  D++  G K VYI LPYY+ G LQD+
Sbjct: 67  FGQESVAQAMKEVEAYALFSPHPNIIHSVDYCVSADRSDPGAKTVYILLPYYRRGNLQDI 126

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP--------------------- 161
           IN NL N+  F EK ++ +F G+  A++A+H Y+    P                     
Sbjct: 127 INANLVNHTKFPEKRLMVLFLGVLNALKAMHQYKVKGGPGGASSVNKAKKVRADAARADE 186

Query: 162 --------LRSENGITNSNLNGIENE-MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILL 212
                    R   G   ++ +  + E +               G   +AHRDIKPGNI++
Sbjct: 187 DAEEEVESRRGRQGGRETDPDSEQQEPLMDGEVTMSQEGIAPGGARAYAHRDIKPGNIMI 246

Query: 213 TDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNE 272
            DD   QPILMD GSL  +   I +R+ AL  QD A++HSTMPYRAPELFDVKT   ++ 
Sbjct: 247 DDDG-VQPILMDLGSLAPSPTPITSRSLALAVQDQAAEHSTMPYRAPELFDVKTGSTIDT 305

Query: 273 KVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP---------------P 317
           KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP                
Sbjct: 306 KVDIWSLGCTLYACLVGKSPFEMRSDETGGSLSICVLGGDWRFPDEGAGGKKKTTNQTGQ 365

Query: 318 TEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           TE    S   ++++   L+V+P +RPD+ +++  V   +++L
Sbjct: 366 TEDSGISESIREVVRKCLRVEPSERPDVDELMEIVRGVIDEL 407



>gi|358372717|dbj|GAA89319.1| serine/threonine protein kinase [Aspergillus kawachii IFO 4308]
          Length = 425

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 177/399 (44%), Positives = 229/399 (57%), Gaps = 60/399 (15%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSTPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHEN-IIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ +N II+ ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYNLFTTQNNIIQSIDHCVSTESGSKFRADGGDAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV--PLRSENGI---- 168
           + G LQD IN NL N+  F EK ++ +  G+  A+RA+H YR  S   P R    +    
Sbjct: 127 QRGNLQDAINANLVNHSRFPEKRLMVLMLGVANALRAMHLYRVKSGTGPTRKAKAVRREG 186

Query: 169 -----------------TNSNLNGIE-NEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGN 209
                            T+ N++  E NE              +DG + P+AHRDIKPGN
Sbjct: 187 AEADADTAMRMPKPKRRTSQNVDEEEENEPLMDDEVTISQEGVQDGDLRPYAHRDIKPGN 246

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 247 IMIADDGRT-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSI 305

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQD-------- 321
           ++ KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP  +          
Sbjct: 306 IDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKSSATKGKGKA 365

Query: 322 -----------KYSPEFKDLISFMLKVDPKDRPDIHQVI 349
                      + S   KD++   L+V+P DRPDI ++I
Sbjct: 366 GGDDSRKDNTMQISAPVKDVVRKCLQVEPADRPDIDELI 404



>gi|367019848|ref|XP_003659209.1| hypothetical protein MYCTH_2295931 [Myceliophthora thermophila ATCC
           42464]
 gi|347006476|gb|AEO53964.1| hypothetical protein MYCTH_2295931 [Myceliophthora thermophila ATCC
           42464]
          Length = 414

 Score =  305 bits (781), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 167/403 (41%), Positives = 239/403 (59%), Gaps = 54/403 (13%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D L ++ SC  CFP +PTL IN R+ K+++LLGEGGFSYV+LVQDTST   +ALKKIRC 
Sbjct: 7   DLLSSLGSCLNCFPGSPTLKINNRSLKILRLLGEGGFSYVYLVQDTSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKNGG---KIVYIFLPYYKSG-LQD 121
           FG++SV  AMKEVD Y+LF+H   II  +D  +  ++ GG   K VY+ LPYY+ G LQD
Sbjct: 67  FGAESVAQAMKEVDAYKLFAHSPGIIHSVDYAIATERGGGEQTKTVYVLLPYYRRGNLQD 126

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS-----------VPLRSENGITN 170
           +IN NL N+  F EK+++ +F G+C A+R +H YR P            + +R++    +
Sbjct: 127 MINANLVNHTRFPEKKLMLLFLGVCRALRDMHLYRGPGEAGGGGAGGERMEMRADGVDEH 186

Query: 171 SNLNGIENEMXXXXXXXXXXXXXEDGVVP----------FAHRDIKPGNILLTDDADSQP 220
           +   G                  ED  +P          +AHRDIKP NI+++D   ++P
Sbjct: 187 ARAKGTRAADDEDETEQQRPLMTEDERMPAATTAGATRSYAHRDIKPANIMISDSG-TEP 245

Query: 221 ILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLG 280
           ++MD GS+  + + I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++ KVDIWSLG
Sbjct: 246 VIMDLGSIAVSPLPITSRSLAIATQDTAAEHSTMPYRAPELFDVKTGSVIDTKVDIWSLG 305

Query: 281 CTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------------PT---- 318
           CTLYA   G SPF+   +E GGS+++ VL+  +RFP                  P+    
Sbjct: 306 CTLYACLVGKSPFEMRSDETGGSLSICVLSGDWRFPDEGPGGKGKGKGKGTAAGPSNGTS 365

Query: 319 --EQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                  S   ++++   LKV+P +RPDI ++I  V+  +E+L
Sbjct: 366 GGNDTPTSEPIREVVRRCLKVEPSERPDIDELIEMVERVVEEL 408



>gi|396471105|ref|XP_003838791.1| similar to serine/threonine protein kinase [Leptosphaeria maculans
           JN3]
 gi|312215360|emb|CBX95312.1| similar to serine/threonine protein kinase [Leptosphaeria maculans
           JN3]
          Length = 413

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 172/398 (43%), Positives = 237/398 (59%), Gaps = 49/398 (12%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y+ T+C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD S  +  ALKKIRC 
Sbjct: 10  DVVYSFTNCMVCFPSSPQLKINSRSFKILRLLGEGGFSYVYLVQDNSNQQLLALKKIRCP 69

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  A+KEV+ Y LF+ H NII  ID  V  DK+    K VYI LPYY+ G LQD+
Sbjct: 70  FGQESVSLALKEVEAYSLFAPHPNIIHSIDYSVENDKSDASAKTVYILLPYYRRGNLQDM 129

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSEN---------GITNSNL 173
           IN NL N+  F E+ ++ +F G+C A++A+H Y+    P  +++             ++ 
Sbjct: 130 INANLVNHTKFPERRLMVLFLGVCKALKAMHQYKVKDGPGGAQSEGKAKKVRRDAKRADA 189

Query: 174 NGIEN-EMXXXXXXXXXXXXXE----------------DGVVP-----FAHRDIKPGNIL 211
              E+ EM             E                +G+ P     +AHRDIKPGNI+
Sbjct: 190 EAAESMEMRPSRRHHAQDDDDEQEAEGLLEDSAVTAAHEGIAPGGSRAYAHRDIKPGNIM 249

Query: 212 LTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELN 271
           + DD  S PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   ++
Sbjct: 250 IDDDGKS-PILMDLGSLAPSPIAITSRSLALQVQDTAAEHSTMPYRAPELFDVKTGSVID 308

Query: 272 EKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------PTEQD 321
            KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP             +D
Sbjct: 309 TKVDIWSLGCTLYACLVGKSPFEARSDETGGSLSICVLGGDWRFPDEGVQRGKQKQNAED 368

Query: 322 KYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
             +   K+++   L+++P +RPD+ ++IA V+  L+ L
Sbjct: 369 AITESVKEVVRKCLRLEPSERPDVDELIAIVEEVLQTL 406



>gi|258575663|ref|XP_002542013.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237902279|gb|EEP76680.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 423

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 173/406 (42%), Positives = 235/406 (57%), Gaps = 57/406 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ + +II  ID CV  +            G K VYI LP+Y
Sbjct: 67  FGQESVSQALKEVEAYTLFTGNRHIIHSIDHCVATESGSKFRSDGGDAGSKTVYILLPFY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS--VPLRSENGI---- 168
           + G LQD IN NL N+  F EKE++ +  G+  A++A+H YR  S   P++    +    
Sbjct: 127 QHGNLQDAINANLVNHTQFPEKELMVMMLGVAKALKAMHQYRINSGATPVKKAKMVRREG 186

Query: 169 ------------TNSNLNGIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGNILLTDD 215
                       T+ + +  E E              E+G   P+AHRDIKPGNI+L +D
Sbjct: 187 QEADASRRKMRTTSESDDDTEQEPLMDGEVTRSQEGMEEGDYRPYAHRDIKPGNIMLDND 246

Query: 216 ADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVD 275
             + PILMD GS+  + I I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++ KVD
Sbjct: 247 GKT-PILMDLGSMAPSPIAITSRSLAIAVQDTAAEHSTMPYRAPELFDVKTGSIIDTKVD 305

Query: 276 IWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRF-------------PPT---- 318
           IWSLGCT+YA   G SPF+    E GGS+++ VL   +RF             PP+    
Sbjct: 306 IWSLGCTMYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKTGTVKGKGKPPSGEES 365

Query: 319 -----EQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                E    SPE KD++   L+V+P +RPDI ++I  ++  ++ L
Sbjct: 366 DMLSREGGAISPEVKDVVRRCLRVEPSERPDIDELIQILNQTVQSL 411



>gi|302916695|ref|XP_003052158.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256733097|gb|EEU46445.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 402

 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 172/392 (43%), Positives = 234/392 (59%), Gaps = 43/392 (10%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y+  +C  CFP NP L IN R+FK+++LLGEGGFSYV+LV+DTST   +ALKKIRC 
Sbjct: 7   DLFYSFGNCLNCFPGNPNLKINNRSFKILRLLGEGGFSYVYLVEDTSTHELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKNGG---KIVYIFLPYYKSG-LQD 121
           FG++SV+ AM+EVD YRLFSH   II  +D  V  ++      K VY+ LPYYK G LQD
Sbjct: 67  FGAESVQQAMREVDAYRLFSHVPTIISAVDHSVATERGADETTKTVYVLLPYYKRGNLQD 126

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPL----------RSENGITNS 171
           +IN NL N+  F E+ ++ +F G+C A+RA+H YR P   +          R E   T  
Sbjct: 127 MINANLVNHDRFPERRLMLLFLGVCKALRAMHDYRPPVERMDMGHEEDQLHRDERNNTRG 186

Query: 172 NLNGIENEMXXXXXXXXXXXXXEDG--VVPFAHRDIKPGNILLTDDADSQPILMDFGSLV 229
                E E                G  +  +AHRDIKPGNI++ DDA S PILMD GS+ 
Sbjct: 187 KRTEEEEEGEQERGLLEDENQVSGGRSIQHYAHRDIKPGNIMI-DDAGSTPILMDLGSVA 245

Query: 230 RARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYG 289
            + I + +++ AL  QD A++HSTMPYRAPELFDV+T   ++ KVDIWS+GCTLYA   G
Sbjct: 246 PSPIPVTSQSLALQIQDTAAEHSTMPYRAPELFDVQTGTVIDTKVDIWSMGCTLYACLVG 305

Query: 290 SSPFDNNINEQGGSIALAVLNAQFRFP---PTEQDK-------------------YSPEF 327
            SPF+   +E GG+++L VL   +RFP   P    +                    S   
Sbjct: 306 KSPFEMRSDETGGTLSLCVLGGDWRFPDEGPAGVKRNNSMRPQQQQQQPQAPAIEISEPI 365

Query: 328 KDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           ++++   L+V+P +RPDI+++I  V T +E+L
Sbjct: 366 REVVRKCLRVEPAERPDINELIDMVQTVIEEL 397



>gi|477536904|gb|ENH88364.1| serine threonine protein [Colletotrichum orbiculare MAFF 240422]
          Length = 415

 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 170/405 (41%), Positives = 231/405 (57%), Gaps = 57/405 (14%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y+  +C  CFP +PTL IN R+FK+++LLGEGGFSYV+LVQDTST    ALKKIRC 
Sbjct: 7   DVFYSFGNCLNCFPGSPTLKINSRSFKILRLLGEGGFSYVYLVQDTSTSEELALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKN---GGKIVYIFLPYYKSG-LQD 121
           FG++SV  AMKEV+ YRLF+    II  +D  +  ++    G K VY+ LPYY+ G LQD
Sbjct: 67  FGAESVAQAMKEVEAYRLFARTPGIIHAVDHAIATERGGEPGSKTVYVLLPYYRRGNLQD 126

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENG-------------- 167
           +IN NL N+  F E+ ++ +F G+C A+RA+H YR   +  R E G              
Sbjct: 127 LINANLVNHTAFPERRLMLLFLGVCKALRAMHKYRGAGME-RMEMGNGDEEDQQGKGKRN 185

Query: 168 --------ITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQ 219
                   +  S     E+E                 V  +AHRDIKPGNI++ DD+ S 
Sbjct: 186 KGGKRVGNVAASAGADDEDEGEQQRPLMEGETPGSGDVKSYAHRDIKPGNIMI-DDSGSN 244

Query: 220 PILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSL 279
           PILMD GS+  + I I + + A+  QD A++HSTMPYRAPELFDV+T   ++ KVDIWSL
Sbjct: 245 PILMDLGSIAPSPIAITSHSLAIATQDTAAEHSTMPYRAPELFDVRTGTVIDTKVDIWSL 304

Query: 280 GCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDK----------------- 322
           GCTLYA   G SPF+   +E GGS++L VL   +RFP     +                 
Sbjct: 305 GCTLYACLVGKSPFEARSDETGGSLSLCVLGGDWRFPDEGIKRTGTSGGMKGKAVDSGAN 364

Query: 323 --------YSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                    S   ++++   LKV+P +RPDI ++I  V+  +E+L
Sbjct: 365 GGSAGDVTISDPIREVVRICLKVEPAERPDIDELIDIVEGVIEEL 409



>gi|408388337|gb|EKJ68023.1| hypothetical protein FPSE_11834 [Fusarium pseudograminearum CS3096]
          Length = 404

 Score =  304 bits (778), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 171/395 (43%), Positives = 237/395 (60%), Gaps = 47/395 (11%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y+  +C  CFP NP L IN R+FK+++LLGEGGFSYV+LV+DTST   +ALKKIRC 
Sbjct: 7   DLFYSFGNCLNCFPGNPNLKINNRSFKILRLLGEGGFSYVYLVEDTSTHELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKNGG---KIVYIFLPYYKSG-LQD 121
           FG++SV+ AM+EVD YRLFSH   II  ID  V  ++      K VY+ LPYYK G LQD
Sbjct: 67  FGAESVQQAMREVDAYRLFSHVPTIISAIDHSVATERGADEATKTVYVLLPYYKRGNLQD 126

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPL----RSENGITNSNLNGIE 177
           +IN NL N+  F E+ ++ +F G+C A+RA+H Y+ P+V      R E+ + N   N   
Sbjct: 127 MINANLVNHDRFPERRLMLLFLGVCKALRAMHDYK-PAVERMNMGREEDELNNGERNNTR 185

Query: 178 NEMXXXXXXXXXXXXXEDG---------VVPFAHRDIKPGNILLTDDADSQPILMDFGSL 228
            +               +G         +  ++HRDIKPGNI++ DD  S PILMD GS+
Sbjct: 186 GKRTEEEEEGEQERGLLEGESQVNGGRSIQHYSHRDIKPGNIMI-DDTGSTPILMDLGSV 244

Query: 229 VRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAY 288
             + I + +++ AL  QD A++HSTMPYRAPELFDV+T + ++ KVDIWSLGCTLYA   
Sbjct: 245 APSPIPVTSQSLALQIQDTAAEHSTMPYRAPELFDVQTGMVIDTKVDIWSLGCTLYACLV 304

Query: 289 GSSPFDNNINEQGGSIALAVLNAQFRFP---PTEQDK---------------------YS 324
           G SPF+   +E GG+++L VL   +RFP   P    +                      S
Sbjct: 305 GKSPFEMRSDETGGTLSLCVLGGDWRFPDEGPAGVKRNNSMRPQQGQPQQQQQAPAVEIS 364

Query: 325 PEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
              ++++   L V+P +RPDI+++I  V T +E+L
Sbjct: 365 EPIREVVRKCLCVEPAERPDINELIQMVQTVIEEL 399



>gi|115491099|ref|XP_001210177.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114197037|gb|EAU38737.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 425

 Score =  303 bits (777), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 178/415 (42%), Positives = 231/415 (55%), Gaps = 72/415 (17%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSTPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ E NII  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYTLFTSESNIIHSIDHCVSTESGSKFRSDGGDAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP--LRSENGITNSN 172
           + G LQD IN NL N+  F EK+++ +  G+  A+RA+H YR  S     R   G+    
Sbjct: 127 QRGNLQDAINANLVNHTRFPEKQLMVLMLGVAKALRAMHQYRVKSGAGATRKAKGVRREG 186

Query: 173 LNG------------------------------IENEMXXXXXXXXXXXXXEDG-VVPFA 201
                                            ++NE+             +DG V P+A
Sbjct: 187 EEADAEVGMRMPKPKRRASHKVDDDDEEENEPLMDNEVTRSQEGV------QDGDVRPYA 240

Query: 202 HRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPEL 261
           HRDIKPGNI++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPEL
Sbjct: 241 HRDIKPGNIMIADDGQT-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPEL 299

Query: 262 FDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----- 316
           FDVKT   ++ KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP     
Sbjct: 300 FDVKTGSIIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKPN 359

Query: 317 ------------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                        T+    S   KD++   L+V+P DRPDI ++I  +   +++L
Sbjct: 360 AGKGKGKAGETAQTDNATISAPVKDVVRKCLQVEPADRPDIDELIQIITDVIKEL 414



>gi|46124909|ref|XP_387008.1| hypothetical protein FG06832.1 [Fusarium graminearum PH-1]
          Length = 405

 Score =  303 bits (777), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 170/396 (42%), Positives = 236/396 (59%), Gaps = 48/396 (12%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y+  +C  CFP NP L IN R+FK+++LLGEGGFSYV+LV+DTST   +ALKKIRC 
Sbjct: 7   DLFYSFGNCLNCFPGNPNLKINNRSFKILRLLGEGGFSYVYLVEDTSTHELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKNGG---KIVYIFLPYYKSG-LQD 121
           FG++SV+ AM+EVD YRLFSH   II  ID  V  ++      K VY+ LPYYK G LQD
Sbjct: 67  FGAESVQQAMREVDAYRLFSHVPTIISAIDHSVATERGADEATKTVYVLLPYYKRGNLQD 126

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPL----RSENGITNSNLNGIE 177
           +IN NL N+  F E+ ++ +F G+C A+RA+H Y+ P+V      R E+ + N   N   
Sbjct: 127 MINANLVNHDRFPERRLMLLFLGVCKALRAMHDYK-PAVERMNMGREEDELNNGERNNTR 185

Query: 178 NEMXXXXXXXXXXXXXEDG---------VVPFAHRDIKPGNILLTDDADSQPILMDFGSL 228
            +               +G         +  ++HRDIKPGNI++ DD  S PILMD GS+
Sbjct: 186 GKRTEEEEEGEQERGLLEGESQVNGGRSIQHYSHRDIKPGNIMI-DDTGSTPILMDLGSV 244

Query: 229 VRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAY 288
             + I + +++ AL  QD A++HSTMPYRAPELFDV+T + ++ KVDIWSLGCTLYA   
Sbjct: 245 APSPIPVTSQSLALQIQDTAAEHSTMPYRAPELFDVQTGMVIDTKVDIWSLGCTLYACLV 304

Query: 289 GSSPFDNNINEQGGSIALAVLNAQFRFP-------------------------PTEQDKY 323
           G SPF+   +E GG+++L VL   +RFP                              + 
Sbjct: 305 GKSPFEMRSDETGGTLSLCVLGGDWRFPDEGPAGVKRNNSMRPQQGQSQQQQQQAPAVEI 364

Query: 324 SPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           S   ++++   L V+P +RPDI+++I  V T +E+L
Sbjct: 365 SEPIREVVRKCLCVEPAERPDINELIQMVQTVIEEL 400



>gi|330921804|ref|XP_003299571.1| hypothetical protein PTT_10595 [Pyrenophora teres f. teres 0-1]
 gi|311326706|gb|EFQ92347.1| hypothetical protein PTT_10595 [Pyrenophora teres f. teres 0-1]
          Length = 414

 Score =  303 bits (777), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 172/399 (43%), Positives = 231/399 (57%), Gaps = 50/399 (12%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y+ T+C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD S  +  ALKKIRC 
Sbjct: 10  DAVYSFTNCMVCFPSSPHLKINSRSFKILRLLGEGGFSYVYLVQDNSNQQLLALKKIRCP 69

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  A+KEV+ Y LFS H NII  ID  V  DK+    K VYI LPYY+ G LQD+
Sbjct: 70  FGQESVSLALKEVEAYALFSPHPNIIHSIDYSVETDKSDASAKTVYILLPYYRRGNLQDM 129

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNG------- 175
           IN NL N+  F E+ ++ +F G+C A++A+H Y+    P  + +      + G       
Sbjct: 130 INANLVNHTKFPERRLMVLFLGVCKALKAMHQYKAKGGPGGTRSQQKAKKVRGEAKRADA 189

Query: 176 ---IENEM-----------------XXXXXXXXXXXXXEDGVVP-----FAHRDIKPGNI 210
                 EM                              +DG+ P     +AHRDIKPGNI
Sbjct: 190 EAAASMEMRPSRRNRDQEEDDDEQEAEGLLEESEVTAAQDGIAPGGERAYAHRDIKPGNI 249

Query: 211 LLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVEL 270
           ++ DD  + PILMD GSL  +   I +R+ AL  QD A++HSTMPYRAPELFDVKT   +
Sbjct: 250 MIDDDGQT-PILMDLGSLAPSPTPITSRSLALQVQDTAAEHSTMPYRAPELFDVKTGSVI 308

Query: 271 NEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------PTEQ 320
           + KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP              
Sbjct: 309 DTKVDIWSLGCTLYACLVGKSPFEARSDETGGSLSICVLGGDWRFPDEGIQRGKQKANPD 368

Query: 321 DKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           D  +   K+++   LK++P +RPD+ Q+I  V+  L +L
Sbjct: 369 DAITDSVKEVVRQCLKLEPSERPDVDQLIGIVEDVLREL 407



>gi|317036327|ref|XP_001398116.2| serine/threonine protein kinase [Aspergillus niger CBS 513.88]
          Length = 425

 Score =  303 bits (775), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 176/399 (44%), Positives = 228/399 (57%), Gaps = 60/399 (15%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSTPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHEN-IIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ +N II  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYNLFTTQNNIIHSIDHCVSTESGSKFRADGGDAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV--PLRSENGI---- 168
           + G LQD IN NL N+  F EK ++ +  G+  A+RA+H YR  S   P R    +    
Sbjct: 127 QRGNLQDAINANLVNHSRFPEKRLMVLMLGVANALRAMHLYRVKSGTGPTRKAKAVRREG 186

Query: 169 -----------------TNSNLNGIE-NEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGN 209
                            T+ N++  E NE              +DG + P+AHRDIKPGN
Sbjct: 187 AEADADTAMRMPKPKRRTSQNVDEEEENEPLMDDEVTISQEGVQDGDLRPYAHRDIKPGN 246

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 247 IMIADDGRT-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSI 305

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQD-------- 321
           ++ KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP  +          
Sbjct: 306 IDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKSSATKGKGKA 365

Query: 322 -----------KYSPEFKDLISFMLKVDPKDRPDIHQVI 349
                      + S   K+++   L+V+P DRPDI ++I
Sbjct: 366 GGDDSRKDNTMQISAPVKEVVRKCLQVEPADRPDIDELI 404



>gi|500259216|gb|EOO02046.1| putative serine threonine protein [Togninia minima UCRPA7]
          Length = 418

 Score =  303 bits (775), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 171/408 (41%), Positives = 233/408 (57%), Gaps = 59/408 (14%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y++ +C  CFP +PTL IN R+FK+++LLGEGGFSYV+LVQDTST   +ALKKIRC 
Sbjct: 7   DLFYSLGNCLNCFPGSPTLKINSRSFKILRLLGEGGFSYVYLVQDTSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG++SV  AMKEVD Y+LF     II  +D  +  ++N    K VY+ LPYY+ G LQD+
Sbjct: 67  FGAESVAQAMKEVDAYKLFGRTPGIIHSVDYSIASERNDPSSKTVYVLLPYYRRGNLQDL 126

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSE------NGI-------- 168
           IN NL N+  F EK ++++F G+C  +R +H YR        E      NG+        
Sbjct: 127 INANLVNHTRFPEKHLMQLFLGVCKGLRNMHQYRGGGAAGGGERMEMRVNGVDENVAITK 186

Query: 169 ------TNSNLNGIENEMXXXXXXXXXXXXXEDGVV-PFAHRDIKPGNILLTDDADSQPI 221
                   +     E+E               +G V  +AHRDIKPGNI++ DD  S PI
Sbjct: 187 GSGKRAVQAAATDEEDETEQQRPLMSEEEGVPEGQVRSYAHRDIKPGNIMI-DDNGSTPI 245

Query: 222 LMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGC 281
           LMD GS+  + + I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++ KVDIWSLGC
Sbjct: 246 LMDLGSIASSPLPITSRSLAIATQDTAAEHSTMPYRAPELFDVKTGAVIDTKVDIWSLGC 305

Query: 282 TLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------------------- 316
           TLYA   G SPF+   +E GGS+++ VL   +RFP                         
Sbjct: 306 TLYACLVGKSPFEMRSDETGGSLSICVLGGDWRFPDEGPGAKKGKAKRTGTGLSESAAAA 365

Query: 317 ----PTEQD-KYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
               P   D   S   ++++   LKV+P +RPDI ++I  V+  L++L
Sbjct: 366 AAASPGADDTSISEPIREVVRRCLKVEPSERPDIDELIDIVEKVLDEL 413



>gi|169603361|ref|XP_001795102.1| hypothetical protein SNOG_04689 [Phaeosphaeria nodorum SN15]
 gi|111067329|gb|EAT88449.1| hypothetical protein SNOG_04689 [Phaeosphaeria nodorum SN15]
          Length = 412

 Score =  302 bits (774), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 172/397 (43%), Positives = 230/397 (57%), Gaps = 48/397 (12%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y+ T+C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD S  +  ALKKIRC 
Sbjct: 10  DVVYSFTNCMVCFPSSPQLKINSRSFKILRLLGEGGFSYVYLVQDNSNQQLLALKKIRCP 69

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  A+KEV+ Y LFS H NII  ID  V  DK     K VYI LPYY+ G LQD+
Sbjct: 70  FGQESVSLALKEVEAYTLFSPHPNIIHSIDYSVETDKGDASAKTVYILLPYYRRGNLQDM 129

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP--LRSENGIT----------- 169
           IN NL N+  F E+ ++ +F G+C A++A+H Y+    P   RSE               
Sbjct: 130 INANLVNHTKFPERRLMVLFLGVCKALKAMHQYKIKGGPGGARSEGKAKKVRREAARADA 189

Query: 170 ------------------NSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNIL 211
                             + +    E  +             E G   +AHRDIKPGNI+
Sbjct: 190 QAAETMEMRPSRKHREHDDDDDQEAEGLLEDSNVTMAQEGIAEGGERAYAHRDIKPGNIM 249

Query: 212 LTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELN 271
           + DD  S PILMD GSL  +   + +R+ AL  QD A++HSTMPYRAPELFDVKT   ++
Sbjct: 250 IDDDGKS-PILMDLGSLAPSPTPVTSRSLALQIQDTAAEHSTMPYRAPELFDVKTGSVID 308

Query: 272 EKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP---------PTEQDK 322
            KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP            ++ 
Sbjct: 309 TKVDIWSLGCTLYACLVGKSPFEFRSDETGGSLSICVLGGDWRFPDEGPQRGKAKQTEEV 368

Query: 323 YSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            S   K+++   LK++P +RPD+ ++I+ V+  LE L
Sbjct: 369 ISEPVKEVVRKCLKLEPSERPDVDELISIVEELLESL 405



>gi|482812259|gb|EOA88991.1| hypothetical protein SETTUDRAFT_176381 [Setosphaeria turcica Et28A]
          Length = 413

 Score =  302 bits (773), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 169/398 (42%), Positives = 234/398 (58%), Gaps = 49/398 (12%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y++T+C  CFP+ P L +N R+FK+++LLGEGGFSYV+LVQD S  +  ALKKIRC 
Sbjct: 10  DVVYSLTNCMVCFPSSPQLKVNSRSFKILRLLGEGGFSYVYLVQDNSNQQLLALKKIRCP 69

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  A+KEV+ Y LF+ H NII  ID  V  DK+    K VYI LPYY+ G LQD+
Sbjct: 70  FGQESVSLALKEVEAYSLFAPHPNIIHSIDYSVETDKSDPSAKTVYILLPYYRRGNLQDM 129

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP--LRSENGIT----------- 169
           IN NL N+  F E+ ++ +F G+C A++A+H Y+    P   RS+               
Sbjct: 130 INANLVNHTKFPERRLMVLFLGVCKALKAMHQYKVKGGPGGARSDGKAKKVRRDAKRADA 189

Query: 170 -------------NSNLNGIENEMXXXXXXXXXXXXXEDGVVP-----FAHRDIKPGNIL 211
                        N +    +                 +G+ P     +AHRDIKPGNI+
Sbjct: 190 EAAESMEMRPSRRNRDHEDDDELEAEGLLEESEVTAAHEGIAPGGERAYAHRDIKPGNIM 249

Query: 212 LTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELN 271
           + DD  + PILMD GSL  +   I +R+ AL  QD A++HSTMPYRAPELFDVKT   ++
Sbjct: 250 IDDDGKT-PILMDLGSLAPSPTPITSRSLALQVQDTAAEHSTMPYRAPELFDVKTGSVID 308

Query: 272 EKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------PTEQD 321
            KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP             +D
Sbjct: 309 TKVDIWSLGCTLYACLVGKSPFEARSDETGGSLSICVLGGDWRFPDEGVQRGKQKANAED 368

Query: 322 KYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
             S   K+++   LK++P +RPD+ ++I+ V+  L++L
Sbjct: 369 AVSDSVKEVVRKCLKLEPSERPDVDELISIVEDVLKEL 406



>gi|452836488|gb|EME38432.1| hypothetical protein DOTSEDRAFT_181583 [Dothistroma septosporum
           NZE10]
          Length = 433

 Score =  302 bits (773), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 170/411 (41%), Positives = 227/411 (55%), Gaps = 59/411 (14%)

Query: 8   VRDTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           V D ++ + +C  CFP NP+L +N R+ K+++LLGEGGFSYV+LVQ       YALKKIR
Sbjct: 14  VLDGVWQLGNCFSCFPSNPSLRVNGRSLKILRLLGEGGFSYVYLVQSPGDPTLYALKKIR 73

Query: 65  CQFGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKNG---GKIVYIFLPYYKSG-L 119
           C FG +SV  A+KEV+ Y LFS H NII  +D  V  ++ G    K VYI LPYY+ G L
Sbjct: 74  CPFGEESVSQALKEVEAYSLFSPHPNIIHAVDHSVESERGGDAGSKTVYILLPYYRRGNL 133

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP-----------LRSE--- 165
           QD IN NL N   F E+ ++ +F G+C A++A+H YR    P           +R E   
Sbjct: 134 QDAINANLVNRARFPERRLMILFLGVCRALKAMHQYRVKGAPGDEQSRRNARSVRQEAAE 193

Query: 166 ------------NGITNSNLNGIENE---MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNI 210
                        G         E E   +             E G+  +AHRDIKPGNI
Sbjct: 194 ADRDARDEVLANQGRRRREREDGETEHEPLMEGEVMAAQDGVAEGGIRSYAHRDIKPGNI 253

Query: 211 LLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVEL 270
           ++ D+  +QPILMD GS+  +   I +R  AL  QD A++HSTMPYRAPELFDVKT+  +
Sbjct: 254 MIADNG-TQPILMDLGSIAPSPTPITSRAMALQVQDQAAEHSTMPYRAPELFDVKTDTTI 312

Query: 271 NEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP-------------- 316
           + KVDIWS+GCTLYA   G SPF+    E GGS++L VL   +RFP              
Sbjct: 313 DTKVDIWSMGCTLYACLVGKSPFEARSEETGGSLSLCVLGGDWRFPDEGATEARRGKQRV 372

Query: 317 -------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
                    ++D  S   K ++   L V+P +RPDI Q+IA V+  +  L+
Sbjct: 373 SDVDQNASKKEDAISDPVKQVVRRCLAVEPAERPDIDQLIAMVEQVITALA 423



>gi|302667311|ref|XP_003025242.1| hypothetical protein TRV_00558 [Trichophyton verrucosum HKI 0517]
 gi|327305165|ref|XP_003237274.1| NAK protein kinase [Trichophyton rubrum CBS 118892]
 gi|291189340|gb|EFE44631.1| hypothetical protein TRV_00558 [Trichophyton verrucosum HKI 0517]
 gi|326460272|gb|EGD85725.1| NAK protein kinase [Trichophyton rubrum CBS 118892]
          Length = 417

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 175/409 (42%), Positives = 227/409 (55%), Gaps = 60/409 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCLCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTDELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ + NII  ID  VV +            G K VYI LPYY
Sbjct: 67  FGQESVSLALKEVEAYSLFTPNRNIIHSIDYSVVTESGSKFRSDGADAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSE-NGITNSNL 173
           + G LQD IN NL N+  F E++++ +  G+  A++ +H Y+      R   NG      
Sbjct: 127 QRGNLQDAINANLVNHTSFPERDLMILMLGVARALKCMHQYKVKDSASRGNGNGAAKGKS 186

Query: 174 NGIENEMXXXXXXXXXXXXXE----DGVV-------------PFAHRDIKPGNILLTDDA 216
            G                       DG V             P++HRDIKPGNI++ DD 
Sbjct: 187 KGKPTRRTSRRVDDDEDESEHEPLMDGEVAISQEGVEEGEYRPYSHRDIKPGNIMIDDDG 246

Query: 217 DSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDI 276
            + PILMD GSL  + I I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++EKVDI
Sbjct: 247 KT-PILMDLGSLSPSPIAITSRSLAIAVQDTAAEHSTMPYRAPELFDVKTGSIIDEKVDI 305

Query: 277 WSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP-------------------- 316
           WSLGCTLYA   G SPF+    E GGS+A+ VL   +RFP                    
Sbjct: 306 WSLGCTLYACLVGKSPFEARSEETGGSLAMCVLGGDWRFPDEKGGNTDAGKGKTRVSSQG 365

Query: 317 ------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                  TE    SP  K+L+   L+V+P +RPDI ++IA +   ++QL
Sbjct: 366 NVADAGSTESGGISPPVKELVRRCLRVEPAERPDIDELIALIKETIQQL 414



>gi|134083676|emb|CAK47067.1| unnamed protein product [Aspergillus niger]
          Length = 375

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 169/365 (46%), Positives = 218/365 (59%), Gaps = 42/365 (11%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSTPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHEN-IIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVIN 124
           FG +SV  A+KEV+ Y LF+ +N II  ID CV   ++G K VYI LPYY+ G LQD IN
Sbjct: 67  FGQESVSQALKEVEAYNLFTTQNNIIHSIDHCV-STESGSKTVYILLPYYQRGNLQDAIN 125

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXX 184
            NL N+  F EK ++ +  G+  A+RA+H                       ENE     
Sbjct: 126 ANLVNHSRFPEKRLMVLMLGVANALRAMHLQNVDEEE---------------ENEPLMDD 170

Query: 185 XXXXXXXXXEDG-VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALM 243
                    +DG + P+AHRDIKPGNI++ DD  + PILMD GSL  + I I +R+ AL 
Sbjct: 171 EVTISQEGVQDGDLRPYAHRDIKPGNIMIADDGRT-PILMDLGSLAPSPIAITSRSLALA 229

Query: 244 QQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGS 303
            QD A++HSTMPYRAPELFDVKT   ++ KVDIWSLGCTLYA   G SPF+    E GGS
Sbjct: 230 VQDTAAEHSTMPYRAPELFDVKTGSIIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGS 289

Query: 304 IALAVLNAQFRFPPTEQD-------------------KYSPEFKDLISFMLKVDPKDRPD 344
           +++ VL   +RFP  +                     + S   K+++   L+V+P DRPD
Sbjct: 290 LSMCVLGGDWRFPDEKSSATKGKGKAGGDDSRKDNTMQISAPVKEVVRKCLQVEPADRPD 349

Query: 345 IHQVI 349
           I ++I
Sbjct: 350 IDELI 354



>gi|189203749|ref|XP_001938210.1| serine/threonine kinase 16 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187985309|gb|EDU50797.1| serine/threonine kinase 16 [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 415

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 172/400 (43%), Positives = 233/400 (58%), Gaps = 51/400 (12%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y+ T+C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD S  +  ALKKIRC 
Sbjct: 10  DVVYSFTNCMVCFPSSPHLKINSRSFKILRLLGEGGFSYVYLVQDNSNQQLLALKKIRCP 69

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  A+KEV+ Y LFS H NII  ID  V  DK+    K VYI LPYY+ G LQD+
Sbjct: 70  FGQESVSLALKEVEAYALFSPHPNIIHSIDYSVETDKSDASAKTVYILLPYYRRGNLQDM 129

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP-----------LRSENGIT-- 169
           IN NL N+  F E+ ++ +F G+C A++A+H Y+    P           +R E      
Sbjct: 130 INANLVNHTKFPERRLMVLFLGVCKALKAMHQYKVKGGPGGTRSQQKAKKVRGEAKRADA 189

Query: 170 -------------NSNLNGIENEMXXXXXXXXXXXXXEDGVVP-----FAHRDIKP--GN 209
                        N +    + +              +DG+ P     +AHRDIKP  GN
Sbjct: 190 EAAASMEMRPSRRNRDQEDDDEQEAEGLLEESEVTAAQDGIAPGGERAYAHRDIKPESGN 249

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + PILMD GSL  +   I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 250 IMIDDDGQT-PILMDLGSLAPSPTPITSRSLALQVQDTAAEHSTMPYRAPELFDVKTGSV 308

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------PTE 319
           ++ KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP             
Sbjct: 309 IDTKVDIWSLGCTLYACLVGKSPFEARSDETGGSLSICVLGGDWRFPDEGIQRGKQKANP 368

Query: 320 QDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            D  +   K+++   LK++P +RPD+ Q+I+ V+  L +L
Sbjct: 369 DDAITESVKEVVRQCLKLEPSERPDVDQLISIVEGVLREL 408



>gi|406864183|gb|EKD17229.1| serine/threonine kinase 16 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 412

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 171/402 (42%), Positives = 231/402 (57%), Gaps = 54/402 (13%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y + +C  CFP +P L IN R+FK+++LLGEGGFSYV+LVQDTS    YALKKIRC 
Sbjct: 7   DLVYTLINCMSCFPGSPQLKINNRSFKILRLLGEGGFSYVYLVQDTSNEALYALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  AMKEV+ Y LF+ H NII  +D CV  D++  G K VYI LPYY+ G LQD+
Sbjct: 67  FGQESVAQAMKEVEAYALFTPHPNIICSVDYCVSSDRSDPGAKTVYILLPYYRRGNLQDI 126

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP-----------LRSENGITNS 171
           IN NL N+  F E+ ++ +F G+C A++A+H Y+    P           +R E    + 
Sbjct: 127 INANLVNHTKFPERRLMVLFLGVCKALKAMHNYKEGGGPGGVKSQRKAKKIRGEAAQADQ 186

Query: 172 NLNGIENEMXXXXXXXXXXXXXED--------------GVVP-----FAHRDIKPGNILL 212
                  +              E               GV P     +AHRDIKPG    
Sbjct: 187 EEEDESEQRRGRQKGREVDPDSEQQEPLMDGEVTQSQVGVAPGDIKAYAHRDIKPGK--Q 244

Query: 213 TDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNE 272
            D  D +PILMD GSL  +   I +R+ AL  QD A++HSTMPYRAPELFDVKT   ++ 
Sbjct: 245 RDREDDEPILMDLGSLAPSPTPITSRSLALAVQDQAAEHSTMPYRAPELFDVKTGSTVDT 304

Query: 273 KVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP---------------P 317
           KVDIWSLGCTLYA   G SPF+   +E GGS++L VL   +RFP                
Sbjct: 305 KVDIWSLGCTLYACLVGKSPFEMRSDETGGSLSLCVLGGDWRFPDEGAGGKKKAVNQPGQ 364

Query: 318 TEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +E  + S   ++++   L+V+P +RPD++++I  V+T + +L
Sbjct: 365 SEDSEISESIREVVRKCLRVEPAERPDVNELIDIVETVIGEL 406



>gi|315046264|ref|XP_003172507.1| NAK protein kinase [Arthroderma gypseum CBS 118893]
 gi|311342893|gb|EFR02096.1| NAK protein kinase [Arthroderma gypseum CBS 118893]
          Length = 417

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 176/409 (43%), Positives = 234/409 (57%), Gaps = 60/409 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCLCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTDELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ + NII  ID  VV +            G K VYI LPYY
Sbjct: 67  FGQESVSLALKEVEAYGLFTPNRNIIHSIDYSVVTESGSKFRSDGADAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSE-NGI----- 168
           + G LQD IN NL N+  F EKE++ +  G+  A++ +H Y+      R   NG      
Sbjct: 127 QRGNLQDAINANLVNHTSFPEKELMVLMLGVARALKCMHQYKVKDSASRGNGNGAAKGKS 186

Query: 169 -------TNSNLNGIENEMXXXXXXXXXXXXXEDGVV-----PFAHRDIKPGNILLTDDA 216
                  T+  ++  ++E              ++GV      P++HRDIKPGNI++ DD 
Sbjct: 187 RGKPTRRTSRRVDNDDDETEQEPLMDGEVAISQEGVEEGEYRPYSHRDIKPGNIMIDDDG 246

Query: 217 DSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDI 276
            + PILMD GSL  + I I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++EKVDI
Sbjct: 247 KT-PILMDLGSLSPSPIAITSRSLAIAVQDTAAEHSTMPYRAPELFDVKTGSIIDEKVDI 305

Query: 277 WSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------------PT-- 318
           WSLGCTLYA   G SPF+    E GGS+A+ VL   +RFP                P+  
Sbjct: 306 WSLGCTLYACLVGKSPFEARSEETGGSLAMCVLGGDWRFPDEKSGNTDAGKGKTRVPSPG 365

Query: 319 --------EQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                   E    S   K+L+   L+V+P +RPDI ++IA +   ++QL
Sbjct: 366 DAAGADAAESGGISQPVKELVRRCLRVEPAERPDIDELIALIKETIQQL 414



>gi|326472058|gb|EGD96067.1| NAK protein kinase [Trichophyton tonsurans CBS 112818]
          Length = 417

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 176/409 (43%), Positives = 234/409 (57%), Gaps = 60/409 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCLCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTDELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ + NII  ID  VV +            G K VYI LPYY
Sbjct: 67  FGQESVSLALKEVEAYSLFTPNRNIIHSIDYSVVTESGSKFRSDGADAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSE-NGI----- 168
           + G LQD IN NL N+  F E++++ +  G+  A++ +H Y+      R   NG      
Sbjct: 127 QRGNLQDAINANLVNHTSFPERDLMILMLGVARALKCMHQYKVKDSASRGNGNGAAKGKS 186

Query: 169 -------TNSNLNGIENEMXXXXXXXXXXXXXEDGVV-----PFAHRDIKPGNILLTDDA 216
                  T+  ++  E+E              ++GV      P++HRDIKPGNI++ DD 
Sbjct: 187 KSKPTRRTSRRVDDDEDESEHEPLMEGEVAISQEGVEEGEYRPYSHRDIKPGNIMIDDDG 246

Query: 217 DSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDI 276
            + PILMD GSL  + I I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++EKVDI
Sbjct: 247 KT-PILMDLGSLSPSPIAITSRSLAIAVQDTAAEHSTMPYRAPELFDVKTGSIIDEKVDI 305

Query: 277 WSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP-------------------- 316
           WSLGCTLYA   G SPF+    E GGS+A+ VL   +RFP                    
Sbjct: 306 WSLGCTLYACLVGKSPFEARSEETGGSLAMCVLGGDWRFPDEKGGNTDAGKGKARVPSQG 365

Query: 317 ------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                  TE    SP  K+L+   L+V+P +RPDI ++IA +   ++QL
Sbjct: 366 NAANTDSTESGGISPPVKELVRRCLRVEPAERPDIDELIALIKETIQQL 414



>gi|70983492|ref|XP_747273.1| serine/threonine protein kinase [Aspergillus fumigatus Af293]
 gi|66844899|gb|EAL85235.1| serine/threonine protein kinase, putative [Aspergillus fumigatus
           Af293]
 gi|159123721|gb|EDP48840.1| serine/threonine protein kinase, putative [Aspergillus fumigatus
           A1163]
          Length = 426

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 176/411 (42%), Positives = 230/411 (55%), Gaps = 61/411 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSTPQLKINNRSFKLLRLLGEGGFSYVYLVQDKATSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF S  NII  ID CV  D            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYSLFTSQPNIIHSIDHCVSTDSGSKFRSDGGEPGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS--------VPLRSEN 166
           + G LQD IN NL N+  F EK ++ +  G+  A++A+H YR  S          +R E 
Sbjct: 127 QRGNLQDAINANLVNHTRFPEKRLMVLMLGVANALKAMHQYRVKSGAGSTRRAKAVRREG 186

Query: 167 GITNSNLN-----------------GIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPG 208
              ++ L+                   ENE              ++G + P+AHRDIKPG
Sbjct: 187 EAADAQLSMQMGKPKRRASQRVDEEDSENEPLMDDEVTISQEGVQEGDLRPYAHRDIKPG 246

Query: 209 NILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNV 268
           NI++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT  
Sbjct: 247 NIMIDDDGQT-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGS 305

Query: 269 ELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDK------ 322
            ++ KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP  +         
Sbjct: 306 IIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKPGATKGKGR 365

Query: 323 -------------YSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
                         S   K+++   L+V+P DRPDI ++I  +   ++ LS
Sbjct: 366 AGAEDAGKDNTATISEPVKEVVRKCLQVEPADRPDIDELIQIIKDVIKDLS 416



>gi|326477077|gb|EGE01087.1| NAK protein kinase [Trichophyton equinum CBS 127.97]
          Length = 417

 Score =  300 bits (768), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 176/409 (43%), Positives = 234/409 (57%), Gaps = 60/409 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCLCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTDELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ + NII  ID  VV +            G K VYI LPYY
Sbjct: 67  FGQESVSLALKEVEAYSLFTPNRNIIHSIDYSVVTESGSKFRSDGADAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSE-NGI----- 168
           + G LQD IN NL N+  F E++++ +  G+  A++ +H Y+      R   NG      
Sbjct: 127 QRGNLQDAINANLVNHTSFPERDLMILMLGVARALKCMHQYKVRDSASRGNGNGAAKGKS 186

Query: 169 -------TNSNLNGIENEMXXXXXXXXXXXXXEDGVV-----PFAHRDIKPGNILLTDDA 216
                  T+  ++  E+E              ++GV      P++HRDIKPGNI++ DD 
Sbjct: 187 KSKPTRRTSRRVDDDEDESEHEPLMEGEVAISQEGVEEGEYRPYSHRDIKPGNIMIDDDG 246

Query: 217 DSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDI 276
            + PILMD GSL  + I I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++EKVDI
Sbjct: 247 KT-PILMDLGSLSPSPIAITSRSLAIAVQDTAAEHSTMPYRAPELFDVKTGSIIDEKVDI 305

Query: 277 WSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP-------------------- 316
           WSLGCTLYA   G SPF+    E GGS+A+ VL   +RFP                    
Sbjct: 306 WSLGCTLYACLVGKSPFEARSEETGGSLAMCVLGGDWRFPDEKGGNTDAGKGKARVPSQG 365

Query: 317 ------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                  TE    SP  K+L+   L+V+P +RPDI ++IA +   ++QL
Sbjct: 366 NAANTDSTESGGISPPVKELVRRCLRVEPAERPDIDELIALIKETIQQL 414



>gi|296806105|ref|XP_002843872.1| serine/threonine-protein kinase [Arthroderma otae CBS 113480]
 gi|238845174|gb|EEQ34836.1| serine/threonine-protein kinase [Arthroderma otae CBS 113480]
          Length = 423

 Score =  300 bits (767), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 176/408 (43%), Positives = 228/408 (55%), Gaps = 59/408 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCLCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTDELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ + NII  ID  VV +            G K VYI LPYY
Sbjct: 67  FGQESVSLALKEVEAYSLFTPNRNIIHSIDYSVVTESGSKFRSDGADAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSE-NGITNSNL 173
           + G LQD IN NL N+  F EKE++ +  G+  A++ +H Y+      R   NG   S  
Sbjct: 127 QRGNLQDAINANLVNHTSFPEKELMVLMLGVAKALKCMHQYKVKDSASRGNGNGAAKSKS 186

Query: 174 NG---------------IENEMXXXXXXXXXXXXXEDGVV-PFAHRDIKPGNILLTDDAD 217
                             E E              E+G   P++HRDIKPGNI++ DD  
Sbjct: 187 RAKPTRRTSRRVDDDDDTEQEPLMEGEVAISQEGVEEGEYRPYSHRDIKPGNIMIDDDGK 246

Query: 218 SQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIW 277
           + PILMD GSL  + I I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++EKVDIW
Sbjct: 247 T-PILMDLGSLSPSPIAITSRSLAIAVQDTAAEHSTMPYRAPELFDVKTGSIIDEKVDIW 305

Query: 278 SLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------------PTEQD 321
           SLGCTLYA   G SPF+    E GGS+A+ VL   +RFP                P+  D
Sbjct: 306 SLGCTLYACLVGKSPFEARSEETGGSLAMCVLGGDWRFPDEKGGNTDAGKGKARTPSHGD 365

Query: 322 KY----------SPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                       S   K+L+   L+V+P +RPDI ++I  +   ++QL
Sbjct: 366 TADADSSGSGGISQPVKELVRRCLRVEPAERPDIDELITLIKETIQQL 413



>gi|121719755|ref|XP_001276576.1| serine/threonine protein kinase, putative [Aspergillus clavatus
           NRRL 1]
 gi|119404788|gb|EAW15150.1| serine/threonine protein kinase, putative [Aspergillus clavatus
           NRRL 1]
          Length = 425

 Score =  300 bits (767), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 174/410 (42%), Positives = 230/410 (56%), Gaps = 60/410 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYTFTDCICCFPSTPQLKINNRSFKLLRLLGEGGFSYVYLVQDKATSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF S  NII  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYNLFTSQNNIIHSIDHCVSTESGSKFRSDGGEAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFP--------SVPLRSEN 166
           + G LQD IN NL N+  F EK ++ +  G+  A++A+H YR          +  +R E 
Sbjct: 127 QRGNLQDAINANLVNHTRFPEKRLMMLMLGVANALKAMHQYRVKRGAGSTRRAKAIRREG 186

Query: 167 GITNSNLN----------------GIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGN 209
             T++ L+                  ENE              ++G V P+ HRD+KPGN
Sbjct: 187 EETDAELSMQMGKPKRRASQRVDEDSENEPLMDDEVTRSQEGIQEGDVRPYTHRDVKPGN 246

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 247 IMIDDDGQT-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSI 305

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDK------- 322
           ++ KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP  +          
Sbjct: 306 IDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKPGATKGKGRA 365

Query: 323 ------------YSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
                        S   K+++   L+V+P DRPDI ++I  +   ++ LS
Sbjct: 366 GGDDASKDNAATISEPVKEVVRKCLQVEPADRPDIDELIQLMKDVIQDLS 415



>gi|169772815|ref|XP_001820876.1| serine/threonine protein kinase [Aspergillus oryzae RIB40]
 gi|238490724|ref|XP_002376599.1| serine/threonine protein kinase, putative [Aspergillus flavus
           NRRL3357]
 gi|83768737|dbj|BAE58874.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220697012|gb|EED53353.1| serine/threonine protein kinase, putative [Aspergillus flavus
           NRRL3357]
 gi|391865567|gb|EIT74846.1| serine/threonine protein kinase/TGF-beta stimulated factor
           [Aspergillus oryzae 3.042]
          Length = 423

 Score =  299 bits (766), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 175/397 (44%), Positives = 223/397 (56%), Gaps = 58/397 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSTPQLKINNRSFKMLRLLGEGGFSYVYLVQDKATSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF S  NII  ID  V  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYNLFASQSNIIHSIDHSVSTESGSKFRADGGEAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV--PLRSENGITN-- 170
           + G LQD IN NL N   F EK ++ +  G+  A+RA+H YR  S   P R    +    
Sbjct: 127 QRGNLQDAINANLVNQTRFPEKRLMVLMLGVATALRAMHQYRVKSGAGPTRKAKAVRREG 186

Query: 171 -------------------SNLNGIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGNI 210
                              ++    ENE              +DG + P+AHRDIKPGNI
Sbjct: 187 EEVDTSMRMSKPKRRATQVADDEDSENEPLMDDEVTRSQEGVQDGGLRPYAHRDIKPGNI 246

Query: 211 LLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVEL 270
           ++ DD  + P+LMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   +
Sbjct: 247 MIDDDGQT-PVLMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSII 305

Query: 271 NEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRF----PPTEQDK---- 322
           + KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RF    P T + K    
Sbjct: 306 DTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKPGTSKGKGKAG 365

Query: 323 ----------YSPEFKDLISFMLKVDPKDRPDIHQVI 349
                      S   KD++   L+V+P DRPDI ++I
Sbjct: 366 DESRKDATTTISAPVKDVVRKCLQVEPADRPDIDELI 402



>gi|452001840|gb|EMD94299.1| hypothetical protein COCHEDRAFT_1130806 [Bipolaris maydis C5]
 gi|477590329|gb|ENI07403.1| hypothetical protein COCC4DRAFT_58301 [Bipolaris maydis ATCC 48331]
          Length = 413

 Score =  299 bits (765), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 166/398 (41%), Positives = 231/398 (58%), Gaps = 49/398 (12%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y+ T+C  CFP+ P L +N R+FK+++LLGEGGFSYV+LVQD S  +  ALKKIRC 
Sbjct: 10  DFVYSFTNCMVCFPSSPQLKVNSRSFKILRLLGEGGFSYVYLVQDNSNQQLLALKKIRCP 69

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  A+KEV+ Y LF+ H NII  ID  V  DK+    K VYI LPYY+ G LQD+
Sbjct: 70  FGQESVSLALKEVEAYSLFAPHPNIIHSIDYSVETDKSDPSAKTVYILLPYYRRGNLQDM 129

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP--------------------- 161
           IN NL N+  F E+ ++++F G+C A++A+H Y+    P                     
Sbjct: 130 INANLVNHTKFPERRLMELFLGVCKALKAMHQYKVKEGPGGGASEGKAKKVRKDAKRADA 189

Query: 162 -----LRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVP-----FAHRDIKPGNIL 211
                +       N + +  + +               +G+ P     +AHRDIKPGNI+
Sbjct: 190 EAAESMEMRPSRRNRDHDEDDEQEAEGLLEESEVTAAHEGIAPGGERAYAHRDIKPGNIM 249

Query: 212 LTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELN 271
           + DD  + PILMD GSL  +   I +R+ AL  QD A++HSTMPYRAPELFDVKT   ++
Sbjct: 250 IDDDGKT-PILMDLGSLAPSPTPITSRSLALQVQDTAAEHSTMPYRAPELFDVKTGSVID 308

Query: 272 EKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------PTEQD 321
            KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP             +D
Sbjct: 309 TKVDIWSLGCTLYACLVGKSPFEARSDETGGSLSICVLGGDWRFPDEGIQRGKQKANPED 368

Query: 322 KYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
             S   K+++   L+++P +RPD+ ++I  V+  L  L
Sbjct: 369 AISDSVKEVVRKCLRLEPSERPDVDELIRIVEDVLRNL 406



>gi|212541238|ref|XP_002150774.1| serine/threonine protein kinase, putative [Talaromyces marneffei
           ATCC 18224]
 gi|210068073|gb|EEA22165.1| serine/threonine protein kinase, putative [Talaromyces marneffei
           ATCC 18224]
          Length = 422

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 172/412 (41%), Positives = 230/412 (55%), Gaps = 63/412 (15%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQ---------DKNGGKIVYIFLPYYK 116
           FG +SV  A+KEV+ Y LF+ +  II+  D CVV          D +  K VYI LPYY+
Sbjct: 67  FGQESVSQALKEVEAYSLFTPNPYIIQSYDHCVVNESANKFRGGDDSSSKTVYILLPYYQ 126

Query: 117 SG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS--VPLRSENGI----- 168
            G LQD IN NL N+  F EKE++ +  G+  A++A+H YR  S     R   G+     
Sbjct: 127 RGNLQDAINANLVNHTSFPEKELMTLMLGVAKALKAMHQYRVKSGSASTRQARGVRIEGE 186

Query: 169 -------------TNSNLNGIENEMXXXXXXXXXXXXXEDGV-----VPFAHRDIKPGNI 210
                           N +G++ ++             ++GV      P+AHRDIKPGNI
Sbjct: 187 EADEELSRKVGKPKRRNTHGMDEDVEQEPLMDDEVTRSQEGVGEGEFRPYAHRDIKPGNI 246

Query: 211 LLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVEL 270
           ++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   +
Sbjct: 247 MIDDDGRT-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSII 305

Query: 271 NEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPE---- 326
           + KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP         +    
Sbjct: 306 DTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDENASSAKGKAKSN 365

Query: 327 -------------------FKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                               KD++   L+V+P +RPDI ++I  +   ++ L
Sbjct: 366 TPAASGSSQSSGEGGISESVKDIVRKCLQVEPAERPDIDELIQLIQDAIKSL 417



>gi|119195613|ref|XP_001248410.1| hypothetical protein CIMG_02181 [Coccidioides immitis RS]
 gi|392862387|gb|EAS36971.2| serine/threonine protein kinase [Coccidioides immitis RS]
          Length = 420

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 172/409 (42%), Positives = 232/409 (56%), Gaps = 60/409 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMSCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF  + NII  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYTLFVDNSNIIHSIDHCVATESGSKFRSDGGDAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS--VP------LRSEN 166
           ++G LQD IN N+ N+  F EKE++ I  G+  A++ +H YR  S   P      +R E 
Sbjct: 127 QNGNLQDAINANIVNHTQFPEKELMIIMLGVAKALKGMHQYRINSGATPAKKAKLVRQEG 186

Query: 167 GITNS------------NLNGIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGNILLT 213
              ++            +   IE E              E+G   P+AHRDIKPGNI+L 
Sbjct: 187 KAADAPRRKQMRKGSQIDDEDIEQEPLMDGEVTRSQEGMEEGDYRPYAHRDIKPGNIMLD 246

Query: 214 DDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEK 273
           DD  + PILMD GS+  + I I +R+ A+  QD A++HST+PYRAPELFDVKT   ++ K
Sbjct: 247 DDGKT-PILMDLGSMAPSPIAITSRSLAIAVQDTAAEHSTIPYRAPELFDVKTGSIIDTK 305

Query: 274 VDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTE------QDKYSP-- 325
            DIWS GCTLYA   G SPF+   +E GGS+++ +L   +RFP  +      + K SP  
Sbjct: 306 ADIWSFGCTLYACLVGKSPFEARSDETGGSLSMCILGGDWRFPDEKTGTVQGKSKVSPAN 365

Query: 326 ---------------EFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                          E K+++   L+V+P +RPDI ++I  +   ++ L
Sbjct: 366 GASDESTRERSAISREVKEVVRRCLRVEPSERPDIDELIEIIQQTIQAL 414



>gi|119484224|ref|XP_001262015.1| serine/threonine protein kinase, putative [Neosartorya fischeri
           NRRL 181]
 gi|119410171|gb|EAW20118.1| serine/threonine protein kinase, putative [Neosartorya fischeri
           NRRL 181]
          Length = 426

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 175/411 (42%), Positives = 230/411 (55%), Gaps = 61/411 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSTPQLKINNRSFKLLRLLGEGGFSYVYLVQDKATSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF S  NII  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYNLFTSQPNIIHSIDHCVSTEPGSKFRSDGGEPGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS--------VPLRSEN 166
           + G LQD IN NL N+  F EK ++ +  G+  A++A+H YR  S          +R E 
Sbjct: 127 QRGNLQDAINANLVNHTRFPEKRLMVLMLGVANALKAMHQYRVKSGAGSTRRAKAVRREG 186

Query: 167 GITNSNLN-----------------GIENEMXXXXXXXXXXXXXEDGVV-PFAHRDIKPG 208
              ++ L+                   ENE              ++G + P+AHRDIKPG
Sbjct: 187 EEADAQLSMQMGKPKRRASQRVDEEDSENEPLMDDEVTISQEGVQEGEIRPYAHRDIKPG 246

Query: 209 NILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNV 268
           NI++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT  
Sbjct: 247 NIMIDDDGQT-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGS 305

Query: 269 ELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDK------ 322
            ++ KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP  +         
Sbjct: 306 IIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKPGATKGKGR 365

Query: 323 -------------YSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
                         S   K+++   L+V+P DRPDI ++I  +   ++ LS
Sbjct: 366 AGAEDAGKDNTATISEPVKEVVRKCLQVEPADRPDIDELIQIIKDVIKDLS 416



>gi|322706981|gb|EFY98560.1| serine/threonine protein kinase, putative [Metarhizium anisopliae
           ARSEF 23]
          Length = 419

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 167/410 (40%), Positives = 234/410 (57%), Gaps = 59/410 (14%)

Query: 8   VRDTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           V D  Y++ +C  CFP +PTL IN R+FK+++LLGEGGFSYV+LV+DT+T   +ALKKIR
Sbjct: 5   VLDLFYSLGNCLNCFPGSPTLKINSRSFKILRLLGEGGFSYVYLVEDTATHELFALKKIR 64

Query: 65  CQFGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKN---GGKIVYIFLPYYKSG-L 119
           C FG++SV  AM+EVD YRLF+H   II  +D  V  ++      K VY+ LPYY+ G L
Sbjct: 65  CPFGAESVHQAMREVDAYRLFAHIPTIISAVDHAVATERGADEATKTVYVLLPYYRRGNL 124

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFP-----------SVPLRSENGI 168
           QD+IN NL N   F E+ ++ +F G+C A+R++H Y+ P             P  +    
Sbjct: 125 QDMINANLVNRGSFPERHLMTLFLGVCKALRSMHEYQAPPAERMEMGNEEDAPGANSRRG 184

Query: 169 TNSNLN--GIENEMXXXXXXXXXXXXXEDGVVP------FAHRDIKPGNILLTDDADSQP 220
           T S +   G   E              E+ V        +AHRDIKPGNI++ DD+ S P
Sbjct: 185 TGSKMGTRGKRTEADEEEDQERPLMESENRVSAGGKVRSYAHRDIKPGNIMI-DDSGSTP 243

Query: 221 ILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLG 280
           ILMD GS+  + I + +++ AL  QD A++HSTMPYRAPELFDV T   ++ K DIWSLG
Sbjct: 244 ILMDLGSVAPSPIPVTSQSVALQIQDTAAEHSTMPYRAPELFDVHTGSVIDTKTDIWSLG 303

Query: 281 CTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------------------ 316
           CTLYA   G SPF+   +E GG+++L VL   +RFP                        
Sbjct: 304 CTLYACLVGKSPFEMRSDETGGTLSLCVLGGDWRFPDETPGGAKRINSISQAKARAASGD 363

Query: 317 ---PTEQDKYSPEF----KDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
               +  +  +P      ++++   LKV+P +RPDI ++I  V+  +E L
Sbjct: 364 HSAASASENTNPTISEPVRNIVRQCLKVEPAERPDIGELITMVEGVIEDL 413



>gi|429856192|gb|ELA31116.1| serine threonine protein [Colletotrichum gloeosporioides Nara gc5]
          Length = 417

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 169/408 (41%), Positives = 235/408 (57%), Gaps = 61/408 (14%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y+  +C  CFP +PTL IN R FK+++LLGEGGFSYV+LVQDTST   +ALKKIRC 
Sbjct: 7   DIVYSFGNCLNCFPGSPTLKINSRNFKILRLLGEGGFSYVYLVQDTSTNEEFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKNG---GKIVYIFLPYYKSG-LQD 121
           FG++SV  AMKEV+ YRLF+    II   D  +  ++ G    K VY+ LPYY+ G LQD
Sbjct: 67  FGAESVAQAMKEVEAYRLFARVPGIIHAADHAIATERGGEPGSKTVYVLLPYYRRGNLQD 126

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPL-RSENG------------- 167
           +IN NL N+  F E+ ++ +F G+C A++  +    P V + R E G             
Sbjct: 127 LINANLVNHTAFPERRLMLLFLGVCKALQ--NDGAAPPVAMERMEMGNGDEEDSTEINSK 184

Query: 168 -----------ITNSNLNGI--ENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTD 214
                      +T++   G   E+E                 V  ++HRDIKPGNI++ D
Sbjct: 185 RKKGKNKGGNRVTSAAAGGADDEDEEDQQRPLMEGETPGSGDVKSYSHRDIKPGNIMI-D 243

Query: 215 DADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKV 274
           D+ S PILMD GS+  + I I + + A+  QD+A++HSTMPYRAPELFDV+T   ++ KV
Sbjct: 244 DSGSNPILMDLGSIAPSPIAITSHSLAIATQDIAAEHSTMPYRAPELFDVRTGTVIDTKV 303

Query: 275 DIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------------ 316
           DIWS+GCTLYA   G SPF+   +E GGS++L VL   +RFP                  
Sbjct: 304 DIWSMGCTLYACLVGKSPFEARSDETGGSLSLCVLGGDWRFPDEGVRRTGTGMKGKAVDS 363

Query: 317 -----PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                   + K S   +D++   LKV+P +RPDI ++I  V+T +E+L
Sbjct: 364 GNGGASASEPKISEPIRDVVRKCLKVEPAERPDIDELIDMVETVIEEL 411



>gi|320582714|gb|EFW96931.1| Putative protein kinase [Ogataea parapolymorpha DL-1]
          Length = 355

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/349 (44%), Positives = 215/349 (61%), Gaps = 27/349 (7%)

Query: 19  CFP-----NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVK 73
           CFP      P L IN+ +F+++ LLGEGGFSYV+LVQ  +    YALKKIRC FG+ + K
Sbjct: 10  CFPCIFNTTPVLKINQASFRILNLLGEGGFSYVYLVQSKNNHGLYALKKIRCPFGNSNFK 69

Query: 74  DAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKY 132
            AMKEVD YR F    IIK ID+ VVQ+ +G K +YI LPY+++G LQD+IN N  NN  
Sbjct: 70  AAMKEVDNYREFRSPFIIKSIDSSVVQEPDGSKTIYILLPYFENGSLQDIINKNSVNNAR 129

Query: 133 FSEKEMLKIFRGICYAVRALHTYRFP-------SVPLRSENGITNSN--LNGIENEMXXX 183
             E E L++F GIC  ++++H ++         S+     +G   +N  L+ +E  +   
Sbjct: 130 MDETEALRLFVGICRGLQSMHRHQVSKNYTIVSSMEPNDSDGADENNPFLSNVEESIRDG 189

Query: 184 XXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALM 243
                         V FAHRDIKP N++L  D    P+L D GS  RAR+ I++R +A+ 
Sbjct: 190 TELQE--------TVSFAHRDIKPANVMLAKDG--TPVLCDLGSCERARVSIKSRAQAIT 239

Query: 244 QQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGS 303
            Q+L+++H T+PYRAPEL D+K   +++EK+DIWSLGCTLYA+ YG SPF+      G +
Sbjct: 240 VQELSNEHCTLPYRAPELLDIKVGDKIDEKIDIWSLGCTLYALLYGYSPFEREELVNGAN 299

Query: 304 IALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
           I LA+ +  + FPPT +  YSP  KDL+ + L VDP  RP I +V+ + 
Sbjct: 300 ITLAISSGSYSFPPTPE--YSPALKDLVRYCLVVDPAQRPSIEEVLTRA 346



>gi|255945327|ref|XP_002563431.1| Pc20g09350 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211588166|emb|CAP86264.1| Pc20g09350 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 426

 Score =  297 bits (761), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 173/412 (41%), Positives = 224/412 (54%), Gaps = 63/412 (15%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKTTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF S  NII  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYNLFNSQSNIIHSIDHCVSTESGSKFRSDGGDPGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS--VPLRSENGITNSN 172
           + G LQD IN NL N+  F EK ++ +  G+  A+R++H YR  S     R   G+    
Sbjct: 127 QRGNLQDAINANLVNHTKFPEKRLMVLILGVADALRSMHQYRVKSGAASTRKAKGVRREG 186

Query: 173 LNGIENEMXXXX------------------------XXXXXXXXXEDG-VVPFAHRDIKP 207
               E                                        EDG + P+AHRD+KP
Sbjct: 187 EQADEERGMQMKPKRRASHRMAEGEEDEENEPLMDDEVTRSQEGVEDGDLRPYAHRDVKP 246

Query: 208 GNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTN 267
           GNI++ D+  S PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT 
Sbjct: 247 GNIMIDDNGQS-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTG 305

Query: 268 VELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPP---------- 317
             ++ KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP           
Sbjct: 306 SMIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKSGASKGKG 365

Query: 318 ----------TEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                     ++    S   KD++   L V+P +RPDI ++I  +   +EQ+
Sbjct: 366 KSGESEEASNSDGPAISAPVKDIVRKCLTVEPSERPDIDELIELMKGVIEQM 417



>gi|451850018|gb|EMD63321.1| hypothetical protein COCSADRAFT_120619 [Bipolaris sorokiniana
           ND90Pr]
          Length = 413

 Score =  297 bits (760), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 167/400 (41%), Positives = 233/400 (58%), Gaps = 53/400 (13%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y+ T+C  CFP+ P L +N R+FK+++LLGEGGFSYV+LVQD S  +  ALKKIRC 
Sbjct: 10  DFVYSFTNCMVCFPSSPQLKVNSRSFKILRLLGEGGFSYVYLVQDNSNQQLLALKKIRCP 69

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQDV 122
           FG +SV  A+KEV+ Y LF+ H NII  ID  V  DK+    K VYI LPYY+ G LQD+
Sbjct: 70  FGQESVSLALKEVEAYSLFAPHPNIIHSIDYSVETDKSDPSAKTVYILLPYYRRGNLQDM 129

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFP------------------------ 158
           IN NL N+  F E+ ++++F G+C A++A+H Y+                          
Sbjct: 130 INANLVNHTKFPERRLMELFLGVCKALKAMHQYKVKGGPGGGASEGKAKKVRRDAKRADA 189

Query: 159 ----SVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVP-----FAHRDIKPGN 209
               S+ +R      N + +  + +               +G+ P     +AHRDIKPGN
Sbjct: 190 EAAESMEMRPSR--RNRDHDEDDEQEAEGLLEESEVTAAHEGIAPGGERAYAHRDIKPGN 247

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + PILMD GSL  +   I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 248 IMIDDDGKT-PILMDLGSLAPSPTPITSRSLALQVQDTAAEHSTMPYRAPELFDVKTGSV 306

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------PTE 319
           ++ KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP             
Sbjct: 307 IDTKVDIWSLGCTLYACLVGKSPFEARSDETGGSLSICVLGGDWRFPDEGIQRGKQKANP 366

Query: 320 QDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +D  S   K+++   L+++P +RPD+ ++I  V+  L  L
Sbjct: 367 EDAISDSVKEVVRKCLRLEPSERPDVDELIRIVEDVLRNL 406



>gi|406603414|emb|CCH45092.1| SNF1-related protein kinase catalytic subunit alpha
           [Wickerhamomyces ciferrii]
          Length = 377

 Score =  297 bits (760), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 153/367 (41%), Positives = 221/367 (60%), Gaps = 37/367 (10%)

Query: 19  CFP----NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKD 74
           CFP     P L IN+  FK++KLLGEGGFSYV+LV+  S G +YALKKIRC FG++SVK 
Sbjct: 7   CFPCFSSQPELRINKSKFKILKLLGEGGFSYVYLVE-ASNGAHYALKKIRCPFGAESVKI 65

Query: 75  AMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQDVINNNLENNKYFS 134
           AM EV+ Y+ F    II+ ID+ ++Q+ +G K VYI LP+++S LQD+IN+N+ N+    
Sbjct: 66  AMTEVENYKEFHSPYIIRAIDSNIIQEDDGSKTVYILLPFFESSLQDIINSNVINDTKMD 125

Query: 135 EKEMLKIFRGICYAVRALHTY-----RFPSVPLRSENGITNSN----------------- 172
           E E+++IF GIC  ++ +H +     + P++     N I   +                 
Sbjct: 126 EVEVIRIFIGICRGLQNMHRHHISVNKHPTLTDLDSNNIDEGDEQDNLLLDNDDDDGESE 185

Query: 173 -------LNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDF 225
                  +N   N+                  + +AH+DIKP N++L+ D    P+L+D 
Sbjct: 186 IDTLPGLVNSGNNQGNDEDDDEFNDATELTSTIAYAHKDIKPSNVMLSKDG--LPVLVDL 243

Query: 226 GSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYA 285
           GS  +AR+K +TR+ A+  Q+LA++H T+PYRAPEL DVKT  +++EK+DIWSLGCTLYA
Sbjct: 244 GSCSKARVKAKTRSAAIAIQELAAEHCTLPYRAPELLDVKTGSKIDEKIDIWSLGCTLYA 303

Query: 286 MAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDI 345
           + YG SPF+   NE G SI LA+ N    F P + D YS E K LI   + +DP++RP I
Sbjct: 304 LLYGCSPFEYEENENGASITLAISNGTLNF-PKKGDLYSDELKSLIKMCIVIDPEERPSI 362

Query: 346 HQVIAKV 352
             V+++ 
Sbjct: 363 EDVLSRA 369



>gi|453082909|gb|EMF10956.1| serine/threonine protein kinase [Mycosphaerella populorum SO2202]
          Length = 433

 Score =  297 bits (760), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 172/411 (41%), Positives = 228/411 (55%), Gaps = 60/411 (14%)

Query: 8   VRDTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           V D L+ + +C  CFP+ P+L IN R+FK+++LLGEGGFS+V+LVQ       YALKKIR
Sbjct: 13  VLDGLWQLGNCFSCFPSSPSLKINGRSFKILRLLGEGGFSFVYLVQSPGDPTLYALKKIR 72

Query: 65  CQFGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKNG---GKIVYIFLPYYKSG-L 119
           C FG +SV  A+KEV+ Y LFS H NII  ID  V  D+ G    K VYI LPYY+ G L
Sbjct: 73  CPFGEESVSLALKEVEAYSLFSPHPNIIHAIDHAVETDRGGDAGSKTVYILLPYYRRGNL 132

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP-----------LRSENG- 167
           QD IN NL N   F E+ ++ +F G+C A++A+H Y+    P           +R E   
Sbjct: 133 QDAINANLVNRARFPERRLMILFLGVCRALKAMHQYKVGEAPGGKASRRKAKSVRQEAAQ 192

Query: 168 --------ITNSNLNGIE----NEMXXXXXXXXXXXXXEDGVV-----PFAHRDIKPGNI 210
                   +T +N +       +E              +DG+       +AHRDIKPGNI
Sbjct: 193 ADREAQEEVTRANQSRRRSQRGDETDQEPLMESEVMAAQDGLADGQMRSYAHRDIKPGNI 252

Query: 211 LLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVEL 270
           ++ D   +QPILMD GSL  +   I +R  AL  QD A++HSTMPYRAPELFDVKT+  +
Sbjct: 253 MIADTG-TQPILMDLGSLAPSPTPITSRAMALQVQDQAAEHSTMPYRAPELFDVKTDTVI 311

Query: 271 NEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP-------------- 316
           + KVDIWS+GCTLYA   G SPF+    E GGS++L VL   +RFP              
Sbjct: 312 DTKVDIWSMGCTLYACLVGKSPFEARSEETGGSLSLCVLGGDWRFPDEGAAEAKRGKQRV 371

Query: 317 --------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                       D  S   K+++   L V+P +RPDI Q+I  V+  +  L
Sbjct: 372 SDVDEASKKQRDDIISDPIKEVVRRCLAVEPAERPDIDQLIGMVEEVIAAL 422



>gi|378732459|gb|EHY58918.1| serine/threonine kinase 16 [Exophiala dermatitidis NIH/UT8656]
          Length = 446

 Score =  296 bits (759), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 167/426 (39%), Positives = 238/426 (55%), Gaps = 77/426 (18%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y++ +C  CFP  P L IN R+F++++LLGEGGFSYV+LVQDTS    YALKKIRC 
Sbjct: 7   DVFYSLCNCIYCFPGTPQLKINNRSFRMLRLLGEGGFSYVYLVQDTSDSALYALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQD---------------KNGGKIVYI 110
           FG +SV  A+KEV+ Y LF+ H NII+ ID  V  D                +  K VYI
Sbjct: 67  FGQESVSQALKEVEAYTLFAPHPNIIRSIDHAVQNDSSTKVSGIGTEAGSGSSASKTVYI 126

Query: 111 FLPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRS----- 164
            LPYY+ G LQD+IN NL N+  F E+ ++++  G+C A++A+H Y   + P RS     
Sbjct: 127 LLPYYRRGNLQDMINANLVNHTRFGERRLMQLMLGVCKALKAMHQYHVRNTPSRSAARAI 186

Query: 165 ---------------------ENGIT--NSNLNGIENEMXXXXXXXXXXXXXEDGVVP-- 199
                                +  +T   ++   +E E              ++G  P  
Sbjct: 187 RDEAASQDQDAAARQKRMQQKQRSMTADQTHQAELEGEQEQPLMPEDEVTRAQEGKQPGE 246

Query: 200 ---FAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRDIKPGNI++ DD  + PILMD GSL  +   I +R+ A+  QD A++HSTMPY
Sbjct: 247 IRAYAHRDIKPGNIMIDDDGRT-PILMDLGSLAPSPTPITSRSMAIAVQDTAAEHSTMPY 305

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELFDVKT   ++ KVDIWSLGCT+YA   G SPF+   +E GGS+++ VL+  +R+P
Sbjct: 306 RAPELFDVKTGSVIDTKVDIWSLGCTMYACLVGKSPFEARSDETGGSLSICVLSGDWRWP 365

Query: 317 -----PTEQDKYS------------------PEFKDLISFMLKVDPKDRPDIHQVIAKVD 353
                   +DK +                  P  ++++   L+V+P +RPD+ +++  +D
Sbjct: 366 GEGSAAKGKDKVAQTQGTHATGAQSERIYPHPAVREVVRRCLQVEPAERPDVDELMTMID 425

Query: 354 TQLEQL 359
           T L +L
Sbjct: 426 TCLSEL 431



>gi|226290970|gb|EEH46398.1| serine/threonine-protein kinase [Paracoccidioides brasiliensis
           Pb18]
          Length = 429

 Score =  296 bits (759), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 169/420 (40%), Positives = 225/420 (53%), Gaps = 71/420 (16%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFPN P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPNSPQLKINSRSFKLLRLLGEGGFSYVYLVQDKATAELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LFS +  II  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSRALKEVEAYSLFSPNRYIIHSIDYCVTTESGSKFRADGGDAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRF----------------- 157
           + G LQD IN NL N+  F EK+++++  G+   ++++H YR                  
Sbjct: 127 QRGNLQDAINANLVNHTRFPEKKLMELMLGVAKGLKSMHQYRIRGGPGAVKKAKMVRNEA 186

Query: 158 --------PSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGN 209
                   PS       G    + + +   +             E G+ P+AHRDIKPGN
Sbjct: 187 AAADAEAAPSRGRSVRQGSRRESDDTVHQPLMDGEVTASQEGVEEGGIRPYAHRDIKPGN 246

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + P++MD GSL  + I I +R+ AL  QD+A++HSTMPYRAPELFDVKT   
Sbjct: 247 IMIDDDGIT-PVVMDLGSLAPSPIAITSRSLALAVQDIAAEHSTMPYRAPELFDVKTGSI 305

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQD-------- 321
           ++ KVDIWSLGCTLYA   G SPF+    E GGS+ + VL   +RFP  +          
Sbjct: 306 IDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLTMCVLGGDWRFPDEKGSGQKGKATA 365

Query: 322 ----------------------KYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                                   S   KD++   L+V+P DRPDI ++I  +   +E L
Sbjct: 366 AAAVGEDAAGASSAAAGGSGSGGISEAVKDVVRRCLQVEPADRPDIDELIELLKQTIEML 425



>gi|367044022|ref|XP_003652391.1| hypothetical protein THITE_2113845 [Thielavia terrestris NRRL 8126]
 gi|346999653|gb|AEO66055.1| hypothetical protein THITE_2113845 [Thielavia terrestris NRRL 8126]
          Length = 426

 Score =  296 bits (758), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 165/415 (39%), Positives = 237/415 (57%), Gaps = 66/415 (15%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D + ++ SC  CFP+ PTL IN R+FK+++LLGEGGFSYV+LVQDT+T   +ALKKIRC 
Sbjct: 7   DLVSSIGSCLNCFPSSPTLKINSRSFKILRLLGEGGFSYVYLVQDTATSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKNGG---KIVYIFLPYYKSG-LQD 121
           FG++SV  AMKEV+ Y+LF+H   II  +D  +  ++ GG   K VY+ LPYY+ G LQD
Sbjct: 67  FGAESVAQAMKEVEAYKLFAHSPGIIHSVDYAIATERGGGEESKTVYVLLPYYRRGNLQD 126

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP-------------------- 161
           +IN NL N+  F EK ++++F G+C A+R +H YR P                       
Sbjct: 127 MINANLVNHTAFPEKRLMQLFLGVCRALRDMHHYRGPGAGAGAGAGPERMEMRVDGVDEN 186

Query: 162 LRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVV-PFAHRDIKPGNILLTDDADSQP 220
           +R   G   ++ +    +                G V  +AHRDIKP NI+++D   ++P
Sbjct: 187 VRHAKGRPGADEDDETEQQRPLMTEDERLPPAAPGTVRSYAHRDIKPANIMISDSG-AEP 245

Query: 221 ILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLG 280
           I+MD GS+  + + I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++ KVDIWSLG
Sbjct: 246 IIMDLGSIAVSPLPITSRSLAIATQDTAAEHSTMPYRAPELFDVKTGTVIDTKVDIWSLG 305

Query: 281 CTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------------------ 316
           CTLYA   G SPF+   +E GGS+++ VL+  +RFP                        
Sbjct: 306 CTLYACLVGKSPFEMRSDETGGSLSICVLSGDWRFPDEGPGGAKDKAKAKAKAKAPAAAA 365

Query: 317 ----------PTEQDK--YSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                     P   D    S   ++++   LKV+P +RPDI ++I  V+  +++L
Sbjct: 366 GGSSSSAAVRPGADDGPVISEPIREVVRRCLKVEPSERPDIDELIELVERVVDEL 420



>gi|320040199|gb|EFW22132.1| serine/threonine protein kinase [Coccidioides posadasii str.
           Silveira]
          Length = 420

 Score =  296 bits (758), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 170/409 (41%), Positives = 229/409 (55%), Gaps = 60/409 (14%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMSCFPSSPQLKINSRSFKLLRLLGEGGFSYVYLVQDKSTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF  + NII  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYTLFVDNSNIIHSIDHCVATESGSKFRSDGGDAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS--VP------LRSEN 166
           ++G LQD IN N+ N+  F EKE++ I  G+  A++ +H YR  S   P      +R E 
Sbjct: 127 QNGNLQDAINANIVNHTQFPEKELMIIMLGVAKALKGMHQYRINSGATPAKKAKLVRQEG 186

Query: 167 GITNS------------NLNGIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGNILLT 213
              ++            +    E E              E+G   P+AHRDIKPGNI+L 
Sbjct: 187 KAADAPRRKQMRKGSQIDDEDTEQEPLMDGEVTRNQEGMEEGDYRPYAHRDIKPGNIMLD 246

Query: 214 DDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEK 273
           DD  + PILMD GS+  + I I +R+ A+  QD A++HST+PYRAPELFDVKT   ++ K
Sbjct: 247 DDGKT-PILMDLGSMAPSPIAITSRSLAIAVQDTAAEHSTIPYRAPELFDVKTGSIIDTK 305

Query: 274 VDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------------- 316
            DIWS GCTLYA   G SPF+   +E GGS+++ +L   +RFP                 
Sbjct: 306 ADIWSFGCTLYACLVGKSPFEARSDETGGSLSMCILGGDWRFPDEKTGTVQGKSKVSPAN 365

Query: 317 ------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                   E+   S E K+++   L+V+P +RPDI ++I  +   ++ L
Sbjct: 366 GESDESSRERSAISREVKEVVRRCLRVEPSERPDIDELIEIIQQTIQAL 414



>gi|310790825|gb|EFQ26358.1| hypothetical protein GLRG_01502 [Glomerella graminicola M1.001]
          Length = 429

 Score =  296 bits (757), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 171/418 (40%), Positives = 229/418 (54%), Gaps = 69/418 (16%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY+  +C  CFP +PTL IN R FK+++LLGEGGFSYV+LVQDT T    ALKKIRC 
Sbjct: 7   DVLYSFGNCLNCFPGSPTLKINNRNFKILRLLGEGGFSYVYLVQDTQTSEELALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKN---GGKIVYIFLPYYKSG-LQD 121
           FG++SV  AMKEVD YRLF+    II  ID  +  ++    G K VY+ LPYY+ G LQD
Sbjct: 67  FGAESVAQAMKEVDAYRLFARSPGIIHSIDHAIATERGGEPGSKTVYVLLPYYRRGNLQD 126

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP--------LRSENGITNSNL 173
           +IN NL N+  F E+ ++ +F G+C A+R +H Y              +   NG      
Sbjct: 127 LINANLVNHTAFPERRLMLLFLGVCKALREMHFYTGGGGGRGQPGIERMEMGNGDEEDQG 186

Query: 174 NGI-------------------------ENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPG 208
           NG                          E+E                 V  +AHRDIKPG
Sbjct: 187 NGPKRKKSGKNKGGKRVASMAAATGADDEDENEQQRPLMEGETPGSGDVKSYAHRDIKPG 246

Query: 209 NILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNV 268
           NI++ DD+ S PILMD GS+  + I I + + A+  QD A++HSTMPYRAPELFDV+T  
Sbjct: 247 NIMI-DDSGSNPILMDLGSIAPSPIPITSHSLAIATQDTAAEHSTMPYRAPELFDVQTGT 305

Query: 269 ELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------ 316
            ++ KVDIWSLGCTLYA   G SPF+   +E GGS+++ VL   +RFP            
Sbjct: 306 VIDTKVDIWSLGCTLYACLVGKSPFEARSDETGGSLSMCVLGGDWRFPDEGIKRTGTSGG 365

Query: 317 ---------------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                             + K S   +D++   LKV+P +RPDI+++I  V+  +E+L
Sbjct: 366 MRGQAAAAAADPGASSAGEVKISEPIRDVVRKCLKVEPAERPDINELIDMVEGVIEEL 423



>gi|342890204|gb|EGU89066.1| hypothetical protein FOXB_00415 [Fusarium oxysporum Fo5176]
 gi|475666045|gb|EMT63836.1| Serine/threonine-protein kinase ppk13 [Fusarium oxysporum f. sp.
           cubense race 4]
 gi|477511935|gb|ENH64496.1| Serine/threonine-protein kinase ppk13 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 402

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 166/383 (43%), Positives = 228/383 (59%), Gaps = 47/383 (12%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y+  +C  CFP NP L IN R+FK+++LLGEGGFSYV+LV+DTST   +ALKKIRC 
Sbjct: 7   DLFYSFGNCLNCFPGNPNLKINNRSFKILRLLGEGGFSYVYLVEDTSTHELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKNGG---KIVYIFLPYYKSG-LQD 121
           FG++SV+ AM+EVD YRLFSH   II  +D  V  ++      K VY+ LPYYK G LQD
Sbjct: 67  FGAESVQQAMREVDAYRLFSHVPTIISAVDHSVATERGADEATKTVYVLLPYYKRGNLQD 126

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENE-- 179
           +IN NL N+  F E+ ++ +F G+C A+RA+H Y+ P+V  R   G     LN  E    
Sbjct: 127 MINANLVNHDRFPERRLMLLFLGVCKALRAMHDYK-PAVE-RMHMGREEDELNHGERNNT 184

Query: 180 -----MXXXXXXXXXXXXXEDGVVP-------FAHRDIKPGNILLTDDADSQPILMDFGS 227
                              E+  V        +AHRDIKPGNI++ DD+ S PILMD GS
Sbjct: 185 RGKRTEEEEEGEQERGLLEEENQVSGGRSIQHYAHRDIKPGNIMI-DDSGSTPILMDLGS 243

Query: 228 LVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMA 287
           +  + I + +++ AL  QD A++HSTMPYRAPELFDV+T + ++ KVDIWS+GCTLYA  
Sbjct: 244 VAPSPIPVTSQSLALQIQDTAAEHSTMPYRAPELFDVQTGMVIDTKVDIWSMGCTLYACL 303

Query: 288 YGSSPFDNNINEQGGSIALAVLNAQFRFP----------------------PTEQDKYSP 325
            G SPF+   +E GG+++L VL   +RFP                           + S 
Sbjct: 304 VGKSPFEMRSDETGGTLSLCVLGGDWRFPDEGPAGVKRSNSMRPQQGQQQQQAPAVEISE 363

Query: 326 EFKDLISFMLKVDPKDRPDIHQV 348
             ++++   L+V+  +RPDIH++
Sbjct: 364 PIREVVRKCLRVEAAERPDIHEL 386



>gi|295665350|ref|XP_002793226.1| serine/threonine-protein kinase [Paracoccidioides sp. 'lutzii'
           Pb01]
 gi|226278140|gb|EEH33706.1| serine/threonine-protein kinase [Paracoccidioides sp. 'lutzii'
           Pb01]
          Length = 429

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 168/420 (40%), Positives = 225/420 (53%), Gaps = 71/420 (16%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFPN P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPNSPQLKINSRSFKLLRLLGEGGFSYVYLVQDKATAELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LFS + +II  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSHALKEVEAYSLFSPNRHIIHSIDYCVTTESGSKFRADGGDAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRF----------------- 157
           + G LQD IN NL N+  F EK+++++  G+   ++++H YR                  
Sbjct: 127 QRGNLQDAINANLVNHTIFPEKKLMELMLGVAKGLKSMHQYRIRGGAGAVKKAKMVRNEA 186

Query: 158 --------PSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGN 209
                   PS       G    + + +   +             E G+ P+AHRDIKPGN
Sbjct: 187 ASADAEAAPSRGRSVRQGSRRESDDTVHQPLMDGEVTVSQEGVEEGGIRPYAHRDIKPGN 246

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + P++MD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 247 IMIDDDGIT-PVVMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSI 305

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQD-------- 321
           ++ KVDIWSLGCTLYA   G SPF+    E GGS+ + VL   +RFP  +          
Sbjct: 306 IDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLTMCVLGGDWRFPDEKGSGQKGKGTA 365

Query: 322 ----------------------KYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                                   S   K+++   L+V+P DRPDI ++I  +   +E L
Sbjct: 366 AVAVGEDAAGASSAAAGGSGSGGISEAVKEVVRRCLQVEPADRPDIDELIELLKQTIEIL 425



>gi|225679259|gb|EEH17543.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 429

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 168/420 (40%), Positives = 225/420 (53%), Gaps = 71/420 (16%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFPN P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPNSPQLKINSRSFKLLRLLGEGGFSYVYLVQDKATAELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LFS +  II  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSRALKEVEAYSLFSPNRYIIHSIDYCVTTESGSKFRADGGDAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRF----------------- 157
           + G LQD IN NL N+  F EK+++++  G+   ++++H YR                  
Sbjct: 127 QRGNLQDAINANLVNHTRFPEKKLMELMLGVAKGLKSMHQYRIRGGPGAVKKAKMVRNEA 186

Query: 158 --------PSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGN 209
                   PS       G    + + +   +             E G+ P+AHRDIKPGN
Sbjct: 187 AAADAEAAPSRGRFVRQGSRRESDDTVHQPLMDGEVTASQEGVEEGGIRPYAHRDIKPGN 246

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + P++MD GSL  + I I +R+ AL  QD+A++HSTMPYRAPELFDVKT   
Sbjct: 247 IMIDDDGIT-PVVMDLGSLAPSPIAITSRSLALAVQDIAAEHSTMPYRAPELFDVKTGSI 305

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQD-------- 321
           ++ KVDIWSLGCTLYA   G SPF+    E GGS+ + VL   +RFP  +          
Sbjct: 306 IDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLTMCVLGGDWRFPDEKGSGQKGKVTA 365

Query: 322 ----------------------KYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                                   S   K+++   L+V+P DRPDI ++I  +   +E L
Sbjct: 366 AAAVGEDAAGASSAAAGGSGSGGISEAVKEVVRRCLQVEPADRPDIDELIELLKQTIEML 425



>gi|358377964|gb|EHK15647.1| hypothetical protein TRIVIDRAFT_38891 [Trichoderma virens Gv29-8]
          Length = 425

 Score =  294 bits (753), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 169/414 (40%), Positives = 234/414 (56%), Gaps = 66/414 (15%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y+  +C  CFP +PTL IN R+FK+ +LLGEGGFSYV+LV+DTST   +ALKKIRC 
Sbjct: 7   DLFYSFGNCLNCFPGSPTLKINSRSFKIQRLLGEGGFSYVYLVEDTSTHELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKNGG------KIVYIFLPYYKSG- 118
           FG++SV+ AM+EVD YRLF H   II   D  V  D+ GG      K VY+ LPYY+ G 
Sbjct: 67  FGAESVQQAMREVDAYRLFDHVPTIISAYDHSVATDRGGGTGDDASKTVYVLLPYYRRGN 126

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIEN 178
           LQD+IN NL N+ +F E++++ +F G+C A+RA+H Y+ P+   R + G    +    E 
Sbjct: 127 LQDMINANLVNHGHFPERQLMMLFLGVCKALRAMHEYQ-PAPAERMQMGREEDHDEAAEG 185

Query: 179 EMXXXXXXXXXXXX--------------------XEDG--VVPFAHRDIKPGNILLTDDA 216
                                              E G  +  +AHRDIKPGNI++ DD+
Sbjct: 186 SRGGRKLGTRGKRTEEEEQGEHERPLMDSENRIEGESGGKIKSYAHRDIKPGNIMI-DDS 244

Query: 217 DSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDI 276
            S PILMD GS+  +   + +++ AL  QD A++HSTMPYRAPELFDV+T   ++ K DI
Sbjct: 245 GSIPILMDLGSVAPSPTPVTSQSLALQIQDTAAEHSTMPYRAPELFDVRTGTVIDTKTDI 304

Query: 277 WSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP---PTEQDK----------- 322
           WSLGCTLYA   G SPF+   +E GG+++L VL   +RFP   P    K           
Sbjct: 305 WSLGCTLYACLVGKSPFELRSDETGGTLSLCVLGGDWRFPDENPGGGPKRTNTIQAAKAK 364

Query: 323 -----------------YSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                             S   ++L+   LKV+P +RP+I ++I  V+  +++L
Sbjct: 365 ASGEAGAGGGGSSGDVNISEPIRNLVRACLKVEPAERPNIDELITMVEQVIDEL 418



>gi|85090576|ref|XP_958483.1| hypothetical protein NCU07399 [Neurospora crassa OR74A]
 gi|28919849|gb|EAA29247.1| hypothetical protein NCU07399 [Neurospora crassa OR74A]
          Length = 412

 Score =  293 bits (751), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 162/407 (39%), Positives = 235/407 (57%), Gaps = 59/407 (14%)

Query: 8   VRDTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           V D +Y + +C  CFP +PTL IN R+FK+++LLGEGGFSYV+LVQDTST    ALKKIR
Sbjct: 5   VSDFIYWLGNCMVCFPGSPTLKINNRSFKILRLLGEGGFSYVYLVQDTSTSELLALKKIR 64

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKNG---GKIVYIFLPYYKSG-L 119
           C FG +SV  AM EV+ Y++F +   II  +D  +  ++      K VY+ LPYY+ G L
Sbjct: 65  CPFGQESVAQAMHEVEAYKIFGNTPGIIHHVDYSIATERGSEGQDKTVYVLLPYYRRGNL 124

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYR-------------FPSVPLRSEN 166
           QD+IN NL N+  F EK ++ +F G+C A+R +H Y+              P    + ++
Sbjct: 125 QDMINANLVNHTRFPEKRLMMLFLGVCKALRGMHKYKGGAGGDTSGESMEVPGAAGKRKS 184

Query: 167 GITNSNLNGIENEMXXXXXXXXXXXXXEDGVVP-------FAHRDIKPGNILLTDDADSQ 219
               + + G + +              E+G +P       +AHRDIKPGNI+++D     
Sbjct: 185 KTRQAAVGGADED---DETEQQVPLIEEEGRLPGSGETRSYAHRDIKPGNIMISDSG-RD 240

Query: 220 PILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSL 279
           PILMD GS+  + + I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++ KVDIWSL
Sbjct: 241 PILMDLGSIAVSPLPITSRSLAIATQDTAAEHSTMPYRAPELFDVKTGTIIDTKVDIWSL 300

Query: 280 GCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------------------- 316
           GCTLYA   G SPF+   +E GGS+++ VL+  +RFP                       
Sbjct: 301 GCTLYACLVGKSPFEMRSDETGGSLSICVLSGDWRFPDEGPGQTKGKGKAGAGGGAGGDS 360

Query: 317 ----PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                 +++  S   +D++   L+V+P +RPDI ++I  V+  +E+L
Sbjct: 361 TATNKDDENYISEPIRDVVRRCLRVEPAERPDIDELIELVERVVEEL 407



>gi|340923805|gb|EGS18708.1| serine/threonine-protein kinase-like protein [Chaetomium
           thermophilum var. thermophilum DSM 1495]
          Length = 421

 Score =  293 bits (750), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 158/399 (39%), Positives = 231/399 (57%), Gaps = 60/399 (15%)

Query: 20  FPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMKE 78
           FP+ PTL +N R+ K+++LLGEGGFSYV+LVQDTS+   +ALKKIRC FG++SV  AM+E
Sbjct: 19  FPSSPTLKVNSRSLKILRLLGEGGFSYVYLVQDTSSSELFALKKIRCPFGAESVAQAMRE 78

Query: 79  VDMYRLFSH-ENIIKVIDTCVVQDKNGG---KIVYIFLPYYKSG-LQDVINNNLENNKYF 133
           V+ Y+LF+H + II  +D  +  ++ GG   K VY+ LPYY+ G LQD+IN NL N+  F
Sbjct: 79  VEAYKLFAHSKGIIHAVDYAIATERGGGEESKTVYVLLPYYRRGNLQDMINANLVNHTRF 138

Query: 134 SEKEMLKIFRGICYAVRALHTYRFP---------------SVPLRSENGITNSNL---NG 175
            EK ++ +F G+C A+R +H YR P                VP R +           + 
Sbjct: 139 PEKRLMCLFLGVCKALRDMHQYRGPGLGGQGATGGQAERMEVPSRGKGKGKGKGKGGQSA 198

Query: 176 IENEMXXXXXXXXXXXXXEDGVVP---------FAHRDIKPGNILLTDDADSQPILMDFG 226
              +              ED  +P         +AHRDIKP NI+++D   + PI+MD G
Sbjct: 199 GREDEEEDENEQQKPLMTEDERMPAPAPGQVRSYAHRDIKPANIMISDSG-TDPIIMDLG 257

Query: 227 SLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAM 286
           S+  + + I +R+ A+  QD+A++HSTMPYRAPELFDVKT   ++ KVDIWSLGCTLYA 
Sbjct: 258 SIAESPLPITSRSLAIATQDIAAEHSTMPYRAPELFDVKTGSVIDTKVDIWSLGCTLYAC 317

Query: 287 AYGSSPFDNNINEQGGSIALAVLNAQFRFPP--------------------------TEQ 320
             G SPF+   +E GGS+++ V++  +RFP                            E+
Sbjct: 318 LVGKSPFEMRSDETGGSLSMCVMSGDWRFPDEGPGAAGGKGKGKQIGGGQGQGANGRAEE 377

Query: 321 DKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            + S   ++++   L+V+P +RPDI ++I  V+  +E+L
Sbjct: 378 YRISEPIREVVRRCLRVEPSERPDIDELIEMVEKVVEEL 416



>gi|350296141|gb|EGZ77118.1| kinase-like protein [Neurospora tetrasperma FGSC 2509]
          Length = 411

 Score =  293 bits (749), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 165/407 (40%), Positives = 236/407 (57%), Gaps = 60/407 (14%)

Query: 8   VRDTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           V D +Y + +C  CFP +PTL IN R+FK+++LLGEGGFSYV+LVQDTST    ALKKIR
Sbjct: 5   VSDFIYWLGNCMVCFPGSPTLKINNRSFKILRLLGEGGFSYVYLVQDTSTSELLALKKIR 64

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKNG---GKIVYIFLPYYKSG-L 119
           C FG +SV  AM EV+ Y+LF +   II  +D  +  ++      K VY+ LPYY+ G L
Sbjct: 65  CPFGQESVAQAMHEVEAYKLFGNTPGIIHHVDYSIATERGSEGQDKTVYVLLPYYRRGNL 124

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYR-------------FPSVPLRSEN 166
           QD+IN NL N+  F EK ++ +F G+C A+R +H Y+              P V  R ++
Sbjct: 125 QDMINANLVNHTRFPEKRLMMLFLGVCKALRGMHKYKGGAAGDTSGESMEVPGVGKR-KS 183

Query: 167 GITNSNLNGIENEMXXXXXXXXXXXXXEDGVVP-------FAHRDIKPGNILLTDDADSQ 219
               + + G + +              E+G +P       +AHRDIKPGNI+++D     
Sbjct: 184 KTRQAAVGGADED---DETEQQVPLIEEEGRLPGSGETRSYAHRDIKPGNIMISDSG-RD 239

Query: 220 PILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSL 279
           PILMD GS+  + + I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++ KVDIWSL
Sbjct: 240 PILMDLGSIAVSPLPITSRSLAIATQDTAAEHSTMPYRAPELFDVKTGTIIDTKVDIWSL 299

Query: 280 GCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------------------- 316
           GCTLYA   G SPF+   +E GGS+++ VL+  +RFP                       
Sbjct: 300 GCTLYACLVGKSPFEMRSDETGGSLSICVLSGDWRFPDEGPGQTKGKGKAGAGGGAGGDN 359

Query: 317 ----PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                 +++  S   +D++   L+V+P +RPDI ++I  V+  +E+L
Sbjct: 360 TATNKDDENYISEPIRDVVRRCLRVEPAERPDIDELIELVERVVEEL 406



>gi|358391461|gb|EHK40865.1| hypothetical protein TRIATDRAFT_227009 [Trichoderma atroviride IMI
           206040]
          Length = 429

 Score =  292 bits (748), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 170/432 (39%), Positives = 238/432 (55%), Gaps = 96/432 (22%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y+  +C  CFP +PTL IN R+FK+ +LLGEGGFSYV+LV+DT++   +ALKKIRC 
Sbjct: 7   DLFYSFGNCLNCFPGSPTLKINNRSFKIQRLLGEGGFSYVYLVEDTASHELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKNGG------KIVYIFLPYYKSG- 118
           FG++SV+ AM+EVD YRLF H   II   D  V  D+ GG      K VY+ LPYY+ G 
Sbjct: 67  FGAESVQQAMREVDAYRLFDHVPTIISAFDHSVATDRGGGSGDDASKTVYVLLPYYRRGN 126

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENG----------- 167
           LQD+IN NL N+ +F E+ ++ +F G+C A+RA+H Y+ P+   R + G           
Sbjct: 127 LQDMINANLVNHGHFPERHLMLLFLGVCKALRAMHEYQ-PAPAERMQMGREEDHDENADS 185

Query: 168 --------------------------ITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFA 201
                                     + +S  N IE E                 +  +A
Sbjct: 186 SRPGGRKMGTRGKRTEEQEQGEQERPLMDSGPNRIEGESRGGK------------IKSYA 233

Query: 202 HRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPEL 261
           HRDIKPGNI++ DD+ S PILMD GS+  + + + +++ AL  QD A++HSTMPYRAPEL
Sbjct: 234 HRDIKPGNIMI-DDSGSIPILMDLGSVAASPVPVTSQSLALQIQDTAAEHSTMPYRAPEL 292

Query: 262 FDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP---PT 318
           FDV+T   ++ K DIWSLGCTLYA   G SPF+   +E GG+++L VL   +RFP   P 
Sbjct: 293 FDVRTGTVIDTKTDIWSLGCTLYACLVGKSPFELRSDETGGTLSLCVLGGDWRFPDENPG 352

Query: 319 EQDK-------------------------------YSPEFKDLISFMLKVDPKDRPDIHQ 347
              K                                S   ++++   LKV+P +RPDI++
Sbjct: 353 GAPKRTNTIQAAKAKATAADGAAGAAAAGGSGDVSISEPIRNIVRACLKVEPAERPDINE 412

Query: 348 VIAKVDTQLEQL 359
           +I  V+  +E+L
Sbjct: 413 LITMVEHVVEEL 424



>gi|336274094|ref|XP_003351801.1| hypothetical protein SMAC_00346 [Sordaria macrospora k-hell]
 gi|380096082|emb|CCC06129.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 410

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 164/406 (40%), Positives = 233/406 (57%), Gaps = 59/406 (14%)

Query: 8   VRDTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           + D +Y + +C  CFP +PTL IN R+FK+++LLGEGGFSYV+LVQDTST    ALKKIR
Sbjct: 5   ISDLIYWLGNCMVCFPGSPTLKINNRSFKILRLLGEGGFSYVYLVQDTSTSELLALKKIR 64

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKNG---GKIVYIFLPYYKSG-L 119
           C FG +SV  AM EV+ Y+LF +   II  +D  +  ++ G    K VY+ LPYY+ G L
Sbjct: 65  CPFGQESVAQAMHEVEAYKLFGNTPGIIHHVDYSIATERGGEGQDKTVYVLLPYYRRGNL 124

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYR------------FPSVPLRSENG 167
           QD+IN NL N+  F EK ++ +F G+C A+R +H Y+             P    R    
Sbjct: 125 QDMINANLVNHTRFPEKRLMMLFLGVCKALRGMHKYKGGGGDTSGESMEVPGAGKRKSK- 183

Query: 168 ITNSNLNGIENEMXXXXXXXXXXXXXEDGVVP-------FAHRDIKPGNILLTDDADSQP 220
            T     G  +E              ++G +P       +AHRDIKPGNI+++D     P
Sbjct: 184 -TRQTAVGGADE--DDETEQQVPLIEDEGRLPGANETRSYAHRDIKPGNIMISDSG-RDP 239

Query: 221 ILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLG 280
           ILMD GS+  + + I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++ KVDIWSLG
Sbjct: 240 ILMDLGSIAVSPLPITSRSLAIATQDTAAEHSTMPYRAPELFDVKTGTVIDTKVDIWSLG 299

Query: 281 CTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------------------ 316
           CTLYA   G SPF+   +E GGS+++ VL+  +RFP                        
Sbjct: 300 CTLYACLVGKSPFEMRSDETGGSLSICVLSGDWRFPDEGPGQTKGKGKAGAGGGAGGDNT 359

Query: 317 ---PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                +++  S   +D++   L+V+P +RPDI ++I  V+  +++L
Sbjct: 360 ATNKDDENYISEPIRDVVRRCLRVEPAERPDIDELIELVERVVDEL 405



>gi|336464058|gb|EGO52298.1| hypothetical protein NEUTE1DRAFT_71734 [Neurospora tetrasperma FGSC
           2508]
          Length = 411

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 164/406 (40%), Positives = 237/406 (58%), Gaps = 58/406 (14%)

Query: 8   VRDTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           V D +Y + +C  CFP +PTL IN R+FK+++LLGEGGFSYV+LVQDTST    ALKKIR
Sbjct: 5   VSDFIYWLGNCMVCFPGSPTLKINNRSFKILRLLGEGGFSYVYLVQDTSTSELLALKKIR 64

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHE-NIIKVIDTCVVQDKNG---GKIVYIFLPYYKSG-L 119
           C FG +SV  AM EV+ Y+LF +   II  +D  +  ++      K VY+ LPYY+ G L
Sbjct: 65  CPFGQESVAQAMHEVEAYKLFGNTPGIIHHVDYSIATERGSEGQDKTVYVLLPYYRRGNL 124

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS----------VP--LRSENG 167
           QD+IN NL N+  F EK ++ +F G+C A+R +H Y+  +          VP   + ++ 
Sbjct: 125 QDMINANLVNHTRFPEKRLMMLFLGVCKALRGMHKYKGGAGGDTSGESMEVPGAGKRKSK 184

Query: 168 ITNSNLNGIENEMXXXXXXXXXXXXXEDGVVP-------FAHRDIKPGNILLTDDADSQP 220
              + + G + +              E+G +P       +AHRDIKPGNI+++D     P
Sbjct: 185 TRQAAVGGADED---DETEQQVPLIEEEGRLPGSGETRSYAHRDIKPGNIMISDSG-RDP 240

Query: 221 ILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLG 280
           ILMD GS+  + + I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++ KVDIWSLG
Sbjct: 241 ILMDLGSIAVSPLPITSRSLAIATQDTAAEHSTMPYRAPELFDVKTGTIIDTKVDIWSLG 300

Query: 281 CTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------------------ 316
           CTLYA   G SPF+   +E GGS+++ VL+  +RFP                        
Sbjct: 301 CTLYACLVGKSPFEMRSDETGGSLSICVLSGDWRFPDEGPGQTKGKGKAGAGGGAGGDST 360

Query: 317 ---PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
                +++  S   +D++   L+V+P +RPDI ++I  V+  +E+L
Sbjct: 361 ATNKDDENYISEPIRDVVRRCLRVEPAERPDIDELIELVERVVEEL 406



>gi|398398297|ref|XP_003852606.1| hypothetical protein MYCGRDRAFT_72191 [Zymoseptoria tritici IPO323]
 gi|339472487|gb|EGP87582.1| hypothetical protein MYCGRDRAFT_72191 [Zymoseptoria tritici IPO323]
          Length = 431

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 167/407 (41%), Positives = 229/407 (56%), Gaps = 66/407 (16%)

Query: 8   VRDTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           V D ++ + +C  CFP+ P+L IN R+FK+++LLGEGGFSYV+LVQ       YALKKIR
Sbjct: 13  VLDGIWQLGNCFSCFPSTPSLKINGRSFKILRLLGEGGFSYVYLVQSPGDPTLYALKKIR 72

Query: 65  CQFGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN---GGKIVYIFLPYYKSG-L 119
           C FG +SV  A+KEV+ Y LF+ H NII  ID  V  D+    G K VYI LPYY+ G L
Sbjct: 73  CPFGEESVSLALKEVEAYSLFTPHPNIIHAIDHSVETDRGGDAGSKTVYILLPYYRRGNL 132

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVP------------------ 161
           QD IN NL N   F E+ ++ +F G+C A++A+H YR    P                  
Sbjct: 133 QDAINANLVNRARFPERRLMILFLGVCKALKAMHQYRVKGPPGGETSRRKAKKVRQQAEE 192

Query: 162 --------LRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVP-----FAHRDIKPG 208
                   +R+  G        +++E+             +DGV       + HRD+KPG
Sbjct: 193 ADREAEEEVRANQGRRRQ----MDDEVEEEPLMNSEVMAAQDGVAAGKIRSYCHRDLKPG 248

Query: 209 NILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNV 268
           NI+++DD  +QPILMDFGSL  +   I +R++AL  QD A++ STMPYRAPEL+D KT  
Sbjct: 249 NIMISDDG-TQPILMDFGSLKASPTHITSRSQALKIQDEAAEQSTMPYRAPELYDPKTGS 307

Query: 269 ELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP---PTEQDK--- 322
           E++ KVDIWSLGCTLYA  +G SPF+    E GGS++L +L   + FP   P ++ +   
Sbjct: 308 EIDTKVDIWSLGCTLYACFFGKSPFEARSEETGGSLSLCILGGDWAFPDESPADKKRGKQ 367

Query: 323 ----------------YSPEFKDLISFMLKVDPKDRPDIHQVIAKVD 353
                            S   KD+I   L V+P  RPD+ ++I  V+
Sbjct: 368 RVVEDSTASKSRDDLVISEPVKDVIRRCLTVEPSARPDVDELINIVE 414



>gi|512190593|gb|EPE06356.1| serine threonine protein [Ophiostoma piceae UAMH 11346]
          Length = 424

 Score =  290 bits (743), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 173/423 (40%), Positives = 239/423 (56%), Gaps = 71/423 (16%)

Query: 7   SVRDTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKI 63
           S  D +Y++ SC  CFP+ PTL IN+R+FK+++LLGEGGFSYV+LVQD +T   +ALKKI
Sbjct: 2   SFLDIVYSMGSCLSCFPSTPTLKINQRSFKILRLLGEGGFSYVYLVQDNATAELFALKKI 61

Query: 64  RCQFGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKNG-----------GKIVYIF 111
           RC FG++SV  AM+EV+ YR F+H + II  ID  V  ++ G            K VYI 
Sbjct: 62  RCPFGAESVAQAMREVEAYRQFAHADGIIHSIDYSVATERGGGGGGIGGDNGPAKTVYIV 121

Query: 112 LPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFP------------ 158
           LPYY+ G LQD+IN NL N+  F EK +L++F GIC A+R +H YR              
Sbjct: 122 LPYYRRGNLQDLINANLVNHTQFPEKHLLELFLGICQALREMHHYRGAAAAGPGAASEQM 181

Query: 159 -----SVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXED--GVVP---FAHRDIKPG 208
                 VP +   G   ++ +                   E+  GV     ++HRDIKPG
Sbjct: 182 TVPGQQVPQKGRRGGAGASSSASGAADDEFESEQQRPLMAEEDHGVASGKSYSHRDIKPG 241

Query: 209 NILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNV 268
           NI++ DD  + PILMD GS+  + + I +R+ A+  QD+A++HSTMPYRAPELFDVKT  
Sbjct: 242 NIMIADDG-TTPILMDLGSIADSPLAITSRSLAIATQDVAAEHSTMPYRAPELFDVKTGG 300

Query: 269 ELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP---PTEQDK--- 322
            ++ KVDIWS+GCTLYA   G SPF+   +E GGS+ + VL+  +RFP   P  + K   
Sbjct: 301 IIDNKVDIWSMGCTLYACLVGKSPFELRSDETGGSLQICVLSGDWRFPDEGPGGKKKQPQ 360

Query: 323 --------------------------YSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL 356
                                      S   ++++   L V+P +RPDI ++I  V+  L
Sbjct: 361 PKRTGTGMSASGGSGGAAAAAAEDAVISEPVREVVRRCLSVEPAERPDIDELIKLVEETL 420

Query: 357 EQL 359
           EQL
Sbjct: 421 EQL 423



>gi|400602943|gb|EJP70541.1| serine/threonine protein kinase, putative [Beauveria bassiana ARSEF
           2860]
          Length = 437

 Score =  290 bits (743), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 165/428 (38%), Positives = 238/428 (55%), Gaps = 78/428 (18%)

Query: 8   VRDTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           ++D +Y++ +C  CFP +PTL +N R+FK+++LLGEGGFSYV+LVQD ST  ++ALKKIR
Sbjct: 5   LQDLIYSLGNCLSCFPGSPTLKVNSRSFKILQLLGEGGFSYVYLVQDLSTKEHFALKKIR 64

Query: 65  CQFGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDK---------NGGKIVYIFLPY 114
           C FG++SV+ AM+EV+ YRLF H  NII  ID  V  ++            K VY+ LPY
Sbjct: 65  CPFGAESVQQAMREVEAYRLFQHVPNIISAIDHTVATERGGGGAAADEAANKTVYVLLPY 124

Query: 115 YKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNL 173
           Y+ G LQD+IN NL N+  F E+ ++ +F G+C A+RA+H +  P    R E G    N 
Sbjct: 125 YRRGNLQDMINANLVNHARFPERHLMALFLGVCRALRAMHDHHAPPAE-RMEMGHEADND 183

Query: 174 NG------------------------IENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPG 208
            G                         E                + G +  +AHRDIKPG
Sbjct: 184 PGPSGSSSGSRSRGGGARSSTKRTEEDEETEQERPLMEAENQIGQGGKIKSYAHRDIKPG 243

Query: 209 NILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNV 268
           NI++ DD+ S PILMD GS+  + + + +++ AL  Q+ A++HSTMPYRAPELFDV+T  
Sbjct: 244 NIMI-DDSGSNPILMDLGSVAPSPMPVTSQSVALQIQETAAEHSTMPYRAPELFDVQTGT 302

Query: 269 ELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------ 316
            ++ KVDIWSLGCTL+A   G SPF+   +E GG+++L V+   +RFP            
Sbjct: 303 VIDTKVDIWSLGCTLFACLVGKSPFEMRSDETGGTLSLCVMGGDWRFPDQSPNGARRVNS 362

Query: 317 -------------------------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAK 351
                                     + +   S   ++++   LKV+P +RPDIHQ+I  
Sbjct: 363 IQVAKAKAAAGAPGAAGATGAGEGSSSGEAVISEPIREIVRACLKVEPAERPDIHQLITM 422

Query: 352 VDTQLEQL 359
           V+  ++ L
Sbjct: 423 VENVIQNL 430



>gi|302506855|ref|XP_003015384.1| hypothetical protein ARB_06507 [Arthroderma benhamiae CBS 112371]
 gi|291178956|gb|EFE34744.1| hypothetical protein ARB_06507 [Arthroderma benhamiae CBS 112371]
          Length = 436

 Score =  290 bits (742), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 173/428 (40%), Positives = 227/428 (53%), Gaps = 79/428 (18%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCLCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKSTDELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ + NII  ID  VV +            G K VYI LPYY
Sbjct: 67  FGQESVSLALKEVEAYSLFTPNRNIIHSIDYSVVTESGSKFRSDGADAGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSE-NGITNSNL 173
           + G LQD IN NL N+  F E++++ +  G+  A++ +H Y+      R   NG      
Sbjct: 127 QRGNLQDAINANLVNHTSFPERDLMILMLGVARALKCMHQYKVKDSASRGNGNGAAKGKS 186

Query: 174 NGIENE-----------------MXXXXXXXXXXXXXEDGVVPFAHRDIKPG-------- 208
            G  +                  +             E    P++HRDIKPG        
Sbjct: 187 KGKPSRRTSRRVDDDEDESEHEPLMEGEVAISQEGVEEGEYRPYSHRDIKPGIYVPSSCH 246

Query: 209 -----------NILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYR 257
                      NI++ DD  + PILMD GSL  + I I +R+ A+  QD A++HSTMPYR
Sbjct: 247 HMTSITNTYVGNIMIDDDGKT-PILMDLGSLSPSPIAITSRSLAIAVQDTAAEHSTMPYR 305

Query: 258 APELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP- 316
           APELFDVKT   ++EKVDIWSLGCTLYA   G SPF+    E GGS+A+ VL   +RFP 
Sbjct: 306 APELFDVKTGSIIDEKVDIWSLGCTLYACLVGKSPFEARSEETGGSLAMCVLGGDWRFPD 365

Query: 317 -------------------------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAK 351
                                     TE    SP  K+L+   L+V+P +RPDI ++IA 
Sbjct: 366 EKGGNTDAGKGKTRVPSQGNVGDAGSTESGGISPPVKELVRRCLRVEPAERPDIDELIAL 425

Query: 352 VDTQLEQL 359
           +   ++QL
Sbjct: 426 IKETIQQL 433



>gi|261197992|ref|XP_002625398.1| serine/threonine protein kinase [Ajellomyces dermatitidis SLH14081]
 gi|239595361|gb|EEQ77942.1| serine/threonine protein kinase [Ajellomyces dermatitidis SLH14081]
          Length = 441

 Score =  290 bits (741), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 173/432 (40%), Positives = 233/432 (53%), Gaps = 83/432 (19%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFPN P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPNSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKNTAELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LFS +  II  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYTLFSPNRYIIHSIDYCVSTESGSKFRADGGDPGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRF--------PSVPLRSEN 166
           + G LQD IN NL N+  F EK+++    G+  A++A+H YR          +  +R+E 
Sbjct: 127 QRGNLQDAINANLVNHTSFPEKKLMTFMLGVAKALKAMHQYRVRGGAGAVKKAKMVRNEA 186

Query: 167 GI----------------TNSNLNGIENE-MXXXXXXXXXXXXXEDGVVPFAHRDIKPGN 209
                             T  + +  E+E +             E G  P+AHRDIKPGN
Sbjct: 187 DAADADAAASRGRPARRNTRRDSDDTEHEPLMDGEVTISQEGVDEGGFRPYAHRDIKPGN 246

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + PI+MD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 247 IMIDDDGLT-PIVMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSI 305

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDK------- 322
           ++ KVDIWSLGCT+YA   G SPF+   +E GGS+++ VL   +RFP  +QD+       
Sbjct: 306 IDTKVDIWSLGCTIYACLVGKSPFEARSDETGGSLSMCVLGGDWRFPDEDQDQGPKGKGK 365

Query: 323 -----------------------------------YSPEFKDLISFMLKVDPKDRPDIHQ 347
                                               S   K+++   L+V+P DRPD+ +
Sbjct: 366 GVVGVGAGAGAGESEGEGSASAAAATGGSPGKKGGISEASKEVVRRCLQVEPADRPDVDE 425

Query: 348 VIAKVDTQLEQL 359
           +I  +   +E+L
Sbjct: 426 LIELLKATIEEL 437



>gi|171687497|ref|XP_001908689.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943710|emb|CAP69362.1| unnamed protein product [Podospora anserina S mat+]
          Length = 411

 Score =  290 bits (741), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 163/394 (41%), Positives = 230/394 (58%), Gaps = 51/394 (12%)

Query: 16  TSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRY--YALKKIRCQFGSD 70
           TSC  C P  PTL IN R+ K+++LLGEGGFSYV+LVQ  S+  +  YALKKIRC FG++
Sbjct: 14  TSCLPCLPGTPTLKINSRSLKILRLLGEGGFSYVYLVQSLSSPNHELYALKKIRCPFGAE 73

Query: 71  SVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKNGG---KIVYIFLPYYKSG-LQDVINN 125
           SV  AMKEV+ Y++F S   II  +D  +  ++ GG   K VY+ LPYYK G LQD+IN 
Sbjct: 74  SVAQAMKEVEAYKIFGSTPGIIHSVDYSIATERGGGEESKTVYVLLPYYKRGNLQDMINA 133

Query: 126 NLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXX- 184
           NL N+  F E++++ +F G+C A+R +H Y+        E  +      G +N +     
Sbjct: 134 NLVNHSKFPERKLMGLFLGVCRALRGMHVYQGGGGAGGQEEMVVPGRKLGGKNTVNGGAD 193

Query: 185 ----XXXXXXXXXEDGVV-----------PFAHRDIKPGNILLTDDADSQPILMDFGSLV 229
                        ED  V            +AHRDIKPGNI+++D  D +PILMD GS+ 
Sbjct: 194 VDDEQEQGRSLLTEDERVTQARETGGKRRSYAHRDIKPGNIMISDSGD-EPILMDLGSVA 252

Query: 230 RARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYG 289
            + + I +R+ A+  QD A++HSTMPYRAPELFDVKT   ++ KVDIWS+GCTLYA   G
Sbjct: 253 ESPLPITSRSLAIATQDTAAEHSTMPYRAPELFDVKTGTVVDTKVDIWSMGCTLYACLVG 312

Query: 290 SSPFDNNINEQGGSIALAVLNAQFRF----PPTEQDK--------------------YSP 325
            SPF+   +E GGS+++ VL+  +RF    P  +++K                     S 
Sbjct: 313 KSPFEMRSDETGGSLSICVLSGDWRFPDEGPGAKKNKGKGPVSPGGATAAAATEEEGISE 372

Query: 326 EFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
             ++++   L+V+P +RPDI ++I  V+  LE L
Sbjct: 373 PIREVVRRCLRVEPSERPDIDELIEMVERVLEVL 406



>gi|239607789|gb|EEQ84776.1| serine/threonine protein kinase [Ajellomyces dermatitidis ER-3]
 gi|327354637|gb|EGE83494.1| serine/threonine protein kinase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 441

 Score =  289 bits (740), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 173/432 (40%), Positives = 233/432 (53%), Gaps = 83/432 (19%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFPN P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPNSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKNTAELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LFS +  II  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYTLFSPNRYIIHSIDYCVSTESGSKFRADGGDPGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRF--------PSVPLRSEN 166
           + G LQD IN NL N+  F EK+++    G+  A++A+H YR          +  +R+E 
Sbjct: 127 QRGNLQDAINANLVNHTSFPEKKLMTFMLGVAKALKAMHQYRVRGGAGAVKKAKMVRNEA 186

Query: 167 GI----------------TNSNLNGIENE-MXXXXXXXXXXXXXEDGVVPFAHRDIKPGN 209
                             T  + +  E+E +             E G  P+AHRDIKPGN
Sbjct: 187 DAADADAAASRGRPARRNTRRDSDDTEHEPLMDGEVTISQEGVDEGGFRPYAHRDIKPGN 246

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + PI+MD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 247 IMIDDDGLT-PIVMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSI 305

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDK------- 322
           ++ KVDIWSLGCT+YA   G SPF+   +E GGS+++ VL   +RFP  +QD+       
Sbjct: 306 IDTKVDIWSLGCTIYACLVGKSPFEARSDETGGSLSMCVLGGDWRFPDEDQDQGPKGKGK 365

Query: 323 -----------------------------------YSPEFKDLISFMLKVDPKDRPDIHQ 347
                                               S   K+++   L+V+P DRPD+ +
Sbjct: 366 GVVGVGAGAGAGESEGEGSASAAAATGGSPGKKGGISEASKEVVRRCLQVEPADRPDVDE 425

Query: 348 VIAKVDTQLEQL 359
           +I  +   +E+L
Sbjct: 426 LIELLKATIEEL 437



>gi|425779381|gb|EKV17445.1| Serine/threonine protein kinase, putative [Penicillium digitatum
           PHI26]
 gi|425784095|gb|EKV21894.1| Serine/threonine protein kinase, putative [Penicillium digitatum
           Pd1]
          Length = 427

 Score =  288 bits (738), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 168/402 (41%), Positives = 219/402 (54%), Gaps = 63/402 (15%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGEGGFSYV+LVQD ++   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPSSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKASSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y +F +  NII  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYNIFNAQPNIIHSIDHCVSTESGSKFRSDGGDPGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFP--SVPLRSENGITNSN 172
           + G LQD IN NL N+  F EK ++ +  G+  A+R++H YR    +   R   G+    
Sbjct: 127 QRGNLQDAINANLVNHTKFPEKRLMILILGVADALRSMHQYRVKNGTASTRKAKGVRREG 186

Query: 173 LNGIE------------------------NEMXXXXXXXXXXXXXEDG-VVPFAHRDIKP 207
               E                        N               EDG + P+AHRD+KP
Sbjct: 187 EEIDEERTMQMKPKRRASQHIAEDEEDEENAPLMDDEVTRSQEGVEDGDLRPYAHRDVKP 246

Query: 208 GNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTN 267
           GNI++ D+  S PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT 
Sbjct: 247 GNIMIDDNGKS-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTG 305

Query: 268 VELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP----------- 316
             ++ KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP           
Sbjct: 306 SIIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKSGASKGKA 365

Query: 317 ---------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
                      +    S   KD++   L V+P +RPDI ++I
Sbjct: 366 KLGESEDASKNDTPAISAPVKDIVRRCLTVEPSERPDIDELI 407



>gi|346322631|gb|EGX92230.1| serine/threonine protein kinase, putative [Cordyceps militaris
           CM01]
          Length = 434

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 165/423 (39%), Positives = 234/423 (55%), Gaps = 73/423 (17%)

Query: 8   VRDTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGE----------GGFSYVHLVQDTST 54
           ++D +Y+ T+C  CFP +PTL +N R+FK+++LLGE          GGFSYV+LV+D ST
Sbjct: 5   LQDLVYSFTNCLSCFPGSPTLKVNSRSFKILQLLGERIILTPLPTKGGFSYVYLVEDLST 64

Query: 55  GRYYALKKIRCQFGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKN---GGKIVYI 110
             ++ALKKIRC FG++SV+ AM+EV+ YRLF H  NII   D  V  ++      K VY+
Sbjct: 65  KEHFALKKIRCPFGAESVQQAMREVEAYRLFRHVPNIIPAADHAVATERGADEATKTVYV 124

Query: 111 FLPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENG-- 167
            LPYY+ G LQD+IN NL N+  F +  +L +F G+C A+RA+H Y  P    R E G  
Sbjct: 125 LLPYYRRGNLQDMINANLVNHARFPQGHLLTLFLGVCKALRAMHDYHAPPAE-RMEMGHE 183

Query: 168 ------------------ITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGN 209
                              T       E E                 +  +AHRDIKPGN
Sbjct: 184 ADTNPDPSNSSSGRGGRSSTKRTEEDEETEQERPLMESENQMGQGGKIKAYAHRDIKPGN 243

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD+ S PILMD GS+  + I + +++ AL  Q+ A++HSTMPYRAPELFDV+T   
Sbjct: 244 IMI-DDSGSNPILMDLGSVAPSPIPVTSQSIALQIQETAAEHSTMPYRAPELFDVQTGTV 302

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------- 316
           ++ KVDIWSLGCTL+A   G SPF+   +E GG+++L V+   +RFP             
Sbjct: 303 IDTKVDIWSLGCTLFACLVGKSPFEMRSDETGGTLSLCVMGGDWRFPDQSPNGAKRVNSI 362

Query: 317 --------------------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL 356
                                + +   S   ++++   LKV+P +RPDIHQ+I  V+  +
Sbjct: 363 QVAKAKAAAGPPTAGAGEGSSSGEAAISEPIREIVRQCLKVEPAERPDIHQLITMVENAI 422

Query: 357 EQL 359
           + L
Sbjct: 423 QSL 425



>gi|471559833|gb|EMR62113.1| putative serine threonine-protein kinase protein [Eutypa lata
           UCREL1]
          Length = 346

 Score =  286 bits (732), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 149/334 (44%), Positives = 207/334 (61%), Gaps = 38/334 (11%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D +Y++ +C  CFP +PTL IN R+FK+++LLGEGGFSYV+LVQDT+T   +ALKKIRC 
Sbjct: 7   DLVYSLGNCLNCFPGSPTLKINSRSFKILRLLGEGGFSYVYLVQDTATAELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVVQDKNGG--KIVYIFLPYYKSG-LQDV 122
           FG++SV+ AM+EV+ Y+ F+H   II  +D  V QD++    K VY+ LPYY+ G LQD+
Sbjct: 67  FGAESVQQAMREVEAYKTFAHVPGIIHAVDYSVAQDRSDADAKTVYVLLPYYRRGNLQDI 126

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIEN---- 178
           IN NL N+  F E+E++ +F G+C A++A+H YR P    R E G   +    I+     
Sbjct: 127 INANLVNHTRFPERELMHLFLGVCRALKAMHQYRGPPRGERMEPGNPKAGEEDIDGRNTN 186

Query: 179 ---------------------EMXXXXXXXXXXXXXEDGVVP-----FAHRDIKPGNILL 212
                                +              E+ V P     +AHRDIKPGNI++
Sbjct: 187 NNNKNNNNNNNNRRNRAVAATDADDETEQARPLMIDEEVVAPGERRSYAHRDIKPGNIMI 246

Query: 213 TDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNE 272
            D   S+PILMD GS+  + + I +R+ A+  QD A++HSTMPYRAPELFDVKT   +  
Sbjct: 247 ADSG-SEPILMDLGSVAESPLAITSRSLAIATQDTAAEHSTMPYRAPELFDVKTGSVVGP 305

Query: 273 KVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIAL 306
           +VD+WSLGCTLYA   G SPF+   +E GGS+++
Sbjct: 306 EVDVWSLGCTLYACLVGKSPFEARSDETGGSLSI 339



>gi|340520232|gb|EGR50469.1| predicted protein [Trichoderma reesei QM6a]
          Length = 438

 Score =  283 bits (723), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 169/427 (39%), Positives = 232/427 (54%), Gaps = 79/427 (18%)

Query: 10  DTLYAVTSC--CFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D  Y+  +C  CFP +PTL IN R+FK+ +LLGEGGFSYV+LV+DTST   +ALKKIRC 
Sbjct: 7   DLFYSFGNCLNCFPGSPTLKINNRSFKIQRLLGEGGFSYVYLVEDTSTHELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFSH-ENIIKVIDTCVV--------QDKNGGKIVYIFLPYYKS 117
           FG++SV+ AM+EVD YRLF H   II   D CV          D +  K VY+ LPYY+ 
Sbjct: 67  FGAESVQQAMREVDAYRLFDHVPTIISAYDHCVATDRGSGGGGDDDASKTVYVLLPYYRR 126

Query: 118 G-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENG--------- 167
           G LQD+IN NL N+  F E+ ++ +F G+C A+RA+H Y+ P+   R + G         
Sbjct: 127 GNLQDMINANLVNHGRFPERHLMMLFLGVCKALRAMHEYQ-PAPAERMQMGREEDQDHDD 185

Query: 168 ITNSNLNGIENEMXXXXXXXXXXX------------------XXEDG--VVPFAHRDIKP 207
            T    +G                                    E G  +  +AHRDIKP
Sbjct: 186 TTAGAASGGSRSGRKMGTRGKRTEEQEQGEQERPLMEQGSRLEGESGGKIKSYAHRDIKP 245

Query: 208 GNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTN 267
           GNI++ DD+ S PILMD GS+  + I + +++ AL  QD A++HSTMPYRAPELFDV+T 
Sbjct: 246 GNIMI-DDSGSIPILMDLGSVAPSPIPVTSQSLALQIQDQAAEHSTMPYRAPELFDVRTG 304

Query: 268 VELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQD------ 321
             ++ K DIWSLGCTLYA   G SPF+   +E GG+++L VL   +RFP           
Sbjct: 305 SVIDTKTDIWSLGCTLYACLVGKSPFELRSDETGGTLSLCVLGGDWRFPDENPGGGKAKR 364

Query: 322 -----------------------------KYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
                                          S   ++L+   LKV+P +RPDI+++I  V
Sbjct: 365 TNTIQAAKAKASAAAGESGGPGGGSSGDVAISEPIRNLVRACLKVEPAERPDINELITMV 424

Query: 353 DTQLEQL 359
           +  +++L
Sbjct: 425 EQVIDEL 431



>gi|452979818|gb|EME79580.1| hypothetical protein MYCFIDRAFT_208836 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 1422

 Score =  282 bits (722), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 168/403 (41%), Positives = 219/403 (54%), Gaps = 52/403 (12%)

Query: 8   VRDTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           V D  + + +C  CFP+ P+L IN R+FK+++LLGEGGFSYV+LVQ       YALKKIR
Sbjct: 147 VLDGFWQLGNCFNCFPSTPSLKINGRSFKILRLLGEGGFSYVYLVQSPGDPTLYALKKIR 206

Query: 65  CQFGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN--GGKIVYIFLPYYKSG-LQ 120
           C FG +SV  A+KEV+ Y LF+ H NII  ID  V  ++     K VYI LPYY+ G LQ
Sbjct: 207 CPFGQESVAQALKEVEAYSLFTPHPNIIHAIDHSVESERGDPANKTVYILLPYYRRGNLQ 266

Query: 121 DVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFP-SVP------------------ 161
           D IN NL N   F E+ ++ +FRG+C A++A+H YR    VP                  
Sbjct: 267 DAINANLVNRARFPERRLMVLFRGVCRALKAMHQYRVKGGVPGGEASRKKAKKVRQEAAR 326

Query: 162 ---------LRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHR-----DIKP 207
                    + +      S     + +              +DGV     R     DIKP
Sbjct: 327 ADAEAEEEVVHANQSRRRSQKEDDDEDDAQAPLMDGEVVAAQDGVPEGGMRSYAHRDIKP 386

Query: 208 GNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTN 267
           GNI+++D   +QPILMD GSL  +   I +R  AL  QD A++HSTMPYRAPELFDVKT 
Sbjct: 387 GNIMISDTG-TQPILMDLGSLAPSPTPITSRALALQVQDQAAEHSTMPYRAPELFDVKTG 445

Query: 268 VELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP---PTEQDKYS 324
             ++ KVDIWSLGCTLYA   G SPF+    E GGS++L VL   +RFP   P E  +  
Sbjct: 446 TVIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSLCVLGGDWRFPDEGPAEAKRGK 505

Query: 325 PEFKDLISFMLKVD--------PKDRPDIHQVIAKVDTQLEQL 359
               D+     K D        P+ RPDI Q+I+ V+  +  L
Sbjct: 506 QRVSDVAPAAPKEDSISEAVKEPEHRPDIDQLISMVEEVVAAL 548



>gi|345561453|gb|EGX44542.1| hypothetical protein AOL_s00188g210 [Arthrobotrys oligospora ATCC
           24927]
          Length = 373

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 225/369 (60%), Gaps = 21/369 (5%)

Query: 10  DTLYAVTSC--CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQF 67
           D +Y +TSC  CFP P L IN R+FK+++LLGEGGFSYV+LVQDTS G  YALKKIRC F
Sbjct: 7   DLVYTLTSCMSCFPTPALVINHRSFKILRLLGEGGFSYVYLVQDTS-GTLYALKKIRCPF 65

Query: 68  GSDSVKDAMKEVDMYRLFSHENI-IKVIDTCVVQDK-NGGKIVYIFLPYYKSG-LQDVIN 124
           G +S+  A  E++ Y+LF    + I +ID+ ++ ++ +  K  YI LPYY+ G LQD+IN
Sbjct: 66  GQESLTRATSEIESYKLFPPSPLLIPLIDSTIITERRDDSKTAYILLPYYRRGNLQDLIN 125

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFP-------SVPLRSENGITNSNLNGIE 177
            NL + K+F EK++L++F G+C  +  +H ++         S    +      +  +  E
Sbjct: 126 ANLVDKKWFPEKQVLELFLGVCEGLALIHGHKVTPTGSSSTSSSANAAGARNRAGADDEE 185

Query: 178 NEMXXXXXXXXXXXXXEDGVV-PFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQ 236
             +               G +  FAHRDIKPGN++++DD  + P+LMDFGS+  + I + 
Sbjct: 186 EGVALMEESRDISGGAHSGELRSFAHRDIKPGNVMISDDGVT-PVLMDFGSIAPSPIHVS 244

Query: 237 TRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNN 296
           +R+ A+  QD A++HSTM YRAPELFDVKT+  ++ KVDIWS+GC LYA+ Y  SPF+ +
Sbjct: 245 SRSLAIQIQDEAAEHSTMSYRAPELFDVKTDSIIDTKVDIWSMGCLLYALMYHHSPFELS 304

Query: 297 INEQGGSIALAVLNAQFRFPPTEQ------DKYSPEFKDLISFMLKVDPKDRPDIHQVIA 350
               GGS+ALA+ +  ++FP   Q           + KD++   L ++P  RPDI ++I 
Sbjct: 305 TELGGGSLALAIASGDWKFPGAGQMGARVEGDVGDKTKDVVRKCLAIEPDARPDIRELIG 364

Query: 351 KVDTQLEQL 359
            V   +  L
Sbjct: 365 VVKEAINVL 373



>gi|470288620|ref|XP_004342629.1| serine/threonine protein kinase [Capsaspora owczarzaki ATCC 30864]
 gi|320165997|gb|EFW42896.1| serine/threonine protein kinase [Capsaspora owczarzaki ATCC 30864]
          Length = 340

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 154/371 (41%), Positives = 217/371 (58%), Gaps = 67/371 (18%)

Query: 14  AVTSCCF-PNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSV 72
           AV S C     T+ IN+ T  + ++LGEGGFS V+L +D  T R YALK++ C    +  
Sbjct: 3   AVLSLCLGSGETVVINKHTLTIKQVLGEGGFSVVYLAEDNLTSRLYALKRMTCH-DDEQQ 61

Query: 73  KDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGG----KIVYIFLPYYKSG-LQDVINNNL 127
           +D+M+EV++YR+F HEN+++V+D+ ++  +       K +Y+ LPYY  G LQD I    
Sbjct: 62  RDSMREVELYRMFDHENLMRVVDSAILPSRTNPNSHVKDLYVMLPYYPRGTLQDRIEAVK 121

Query: 128 ENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXX 187
            +   FSE+E+L +FRGIC  V+ALH Y   + P+R+             N M       
Sbjct: 122 AHGSQFSEREILSVFRGICLGVKALHQY---TPPMRN-------------NRM------- 158

Query: 188 XXXXXXEDGVVPFAHRDIKPGNILLTDDADS------------------------QPILM 223
                      P+AHRD+KPGN+LL D A+S                         PILM
Sbjct: 159 -----------PYAHRDLKPGNVLLADHAESGAPFARSASASVPAGMADTPLDRLTPILM 207

Query: 224 DFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTL 283
           DFGS+  AR+KI +R EAL  QDLA++  TMPYRAPELFDV ++  ++E+VDIW+LGC L
Sbjct: 208 DFGSMAPARVKITSRLEALQLQDLAAEKCTMPYRAPELFDVPSDTTIDERVDIWALGCIL 267

Query: 284 YAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           Y++ Y  SPF++  NEQGGSIALAV++ +  F P  Q  +S   ++L+ FML V  + RP
Sbjct: 268 YSLMYLQSPFESAANEQGGSIALAVISGRVNFLP--QFNHSASLQNLVKFMLVVSHEARP 325

Query: 344 DIHQVIAKVDT 354
            I QVI ++D 
Sbjct: 326 HIDQVIEEIDA 336



>gi|344233875|gb|EGV65745.1| kinase-like protein [Candida tenuis ATCC 10573]
          Length = 365

 Score =  278 bits (711), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 147/360 (40%), Positives = 219/360 (60%), Gaps = 26/360 (7%)

Query: 10  DTLYAVTSCCFP------NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTS-TGRYYALKK 62
           + + +V +CCFP      +P L IN   +K+I+LLGEGGFSYV+LV   S     YALK+
Sbjct: 2   EAILSVFNCCFPCFPDLSSPYLIINNERYKIIRLLGEGGFSYVYLVSHKSHNNSLYALKR 61

Query: 63  IRCQFGS--DSVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFLPYYKS 117
           IRC +GS  ++ K+AMKE+  +  F++     II+ ID  VVQ+K+G + + I LPY++ 
Sbjct: 62  IRCPYGSNDEAYKNAMKEIRNHHRFTYAKTPYIIQSIDEAVVQEKDGSRTICILLPYFEK 121

Query: 118 GLQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI- 176
            LQD+IN  + NN+  +E+E+L+IF GIC  ++ +H Y+  +   R+ NG T S      
Sbjct: 122 SLQDIINYKVLNNETMNEEEILRIFVGICRGLQVMHKYKKVT---RAANGDTRSTTQSED 178

Query: 177 ENEMXXXXXXXXXXXXXEDG-------VVPFAHRDIKPGNILLTDDADSQPILMDFGSLV 229
           E ++               G       ++PFAHRDIKP N++L+  A+  P+L+D GS  
Sbjct: 179 EADLLLPEVSDDEEGLSSSGAGLEMEEMIPFAHRDIKPANVMLS--AEGLPVLVDLGSCS 236

Query: 230 RARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYG 289
           RAR+ ++ R +AL   D AS+H T+PYRAPEL DV+TN E+ EK DIWSLGC LY+  +G
Sbjct: 237 RARLTVKNRQQALTLTDFASEHCTLPYRAPELIDVETNAEITEKTDIWSLGCLLYSCCFG 296

Query: 290 SSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
            SPF+    EQG ++ +A+ N ++  P    D YSP+   +I   L +D K RP + +++
Sbjct: 297 FSPFEKMEIEQGANLTVAISNGRYSIPENTHD-YSPDLIKMIESCLVLDSKARPSVDELL 355



>gi|465797000|emb|CCU97755.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 381

 Score =  274 bits (700), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 213/374 (56%), Gaps = 36/374 (9%)

Query: 8   VRDTLYAVTSC---CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           V+D  YA+  C      +  +H+N   +++++LLGEGGFS V+LV+D  T   YALKKIR
Sbjct: 17  VQDAWYALWQCLSHASGSSVVHVNGTAYEIVRLLGEGGFSMVYLVRDARTHELYALKKIR 76

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGG------------------- 105
           CQ G +SV++A+ E++  R F   + + ++D  VVQD   G                   
Sbjct: 77  CQHGPESVREALAEIEAMRRFRGPHTLPLVDAAVVQDDGRGASLILGQVPAHDEESLRTS 136

Query: 106 KIVYIFLPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRS 164
           K+VY+ LPY   G LQD I+ +      F E  ML++F G C  VRALH Y  P V + +
Sbjct: 137 KLVYLVLPYMPRGHLQDEIHAHAVRGTRFDEARMLRLFLGACEGVRALHRYTLPHVSVEA 196

Query: 165 ENGITNSNLNGIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGNILLTDDADSQPILM 223
            +   +      + E                G VVP+AHRDIKP   +L         LM
Sbjct: 197 PDVTRDDTALLFDAEAYPMAAPMQARSTDGPGEVVPYAHRDIKPAYSVL---------LM 247

Query: 224 DFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTL 283
           DFGS +RAR+ I+TR +A+  QD+A++ S+MPYRAPELFDV+T+ EL E+VDIWSLGCTL
Sbjct: 248 DFGSTIRARVPIRTRRDAVAAQDVAAERSSMPYRAPELFDVQTDTELTEQVDIWSLGCTL 307

Query: 284 YAMAYGSSPFDN-NINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDR 342
           YAMAY  SPF+  +  EQGGS+ALA+ N  + +P    D YS   + LIS  L  DP  R
Sbjct: 308 YAMAYLHSPFETPSTTEQGGSLALAISNGAYSWP--ADDPYSDAVRTLISQCLARDPAAR 365

Query: 343 PDIHQVIAKVDTQL 356
           P I ++I +V   +
Sbjct: 366 PSIDELIMRVKAAM 379



>gi|459369215|gb|EMG47682.1| hypothetical protein G210_1908, partial [Candida maltosa Xu316]
          Length = 359

 Score =  273 bits (699), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 211/365 (57%), Gaps = 38/365 (10%)

Query: 10  DTLYAVTSCCFP------NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKI 63
           D L+++   C P      +P++ IN   +K+IKLLGEGGFSYV+LV  T++  YYALKKI
Sbjct: 2   DLLFSLCGACLPCFPSLSSPSIVINNNKYKIIKLLGEGGFSYVYLVS-TNSQSYYALKKI 60

Query: 64  RCQFG--SDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQD 121
           RC +G   +S K+A+KE+  Y  F    II  ID  +  + +G K + I LPY++  LQD
Sbjct: 61  RCPYGVQDESFKNAIKEIKNYHRFKSPYIISSIDELIQSENDGSKNIMILLPYFERSLQD 120

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS--------------VPLRSENG 167
           +IN  + NN    E E+L+IF GIC  ++ +H Y+  S              +P+ SE+ 
Sbjct: 121 LINQLVLNNSKMEESEILRIFVGICRGLKVMHNYKKVSNNNPRFDDDEQDILLPV-SEDE 179

Query: 168 ITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGS 227
               N+NG                     +VPFAH D+KP N++L+  A+  P+L D GS
Sbjct: 180 DFEDNVNG-----------TTAGDLQMSELVPFAHHDLKPANVMLS--AEGLPVLCDLGS 226

Query: 228 LVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMA 287
             RARI ++ R +AL  QD A +H T+PYRAPEL DV TN E+ EK DIWSLGC LY   
Sbjct: 227 CSRARISVKNRQQALTVQDFAQEHCTLPYRAPELVDVATNTEITEKTDIWSLGCLLYCCC 286

Query: 288 YGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQ 347
           +G SPF+    EQG S+ LA+L  ++   P + + Y P+  DLI   L++ P++RPD  +
Sbjct: 287 FGYSPFEKLEIEQGASLNLAILQGKYEI-PADNNGYDPKIIDLIKQCLQLKPENRPDTDE 345

Query: 348 VIAKV 352
           ++ K 
Sbjct: 346 ILEKA 350



>gi|255729588|ref|XP_002549719.1| hypothetical protein CTRG_04016 [Candida tropicalis MYA-3404]
 gi|240132788|gb|EER32345.1| hypothetical protein CTRG_04016 [Candida tropicalis MYA-3404]
          Length = 360

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 144/361 (39%), Positives = 213/361 (59%), Gaps = 34/361 (9%)

Query: 19  CFP---NPTLHINRRTFKVIKLLGEGGFSYVHLVQDT--STGRYYALKKIRCQFG--SDS 71
           CFP   +P+++IN R +K+IKLLGEGGFSYV+LV  T  S+  YYALKKIRC +G   +S
Sbjct: 14  CFPTLSSPSININNRNYKIIKLLGEGGFSYVYLVSTTTQSSQSYYALKKIRCPYGIQDES 73

Query: 72  VKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQDVINNNLENNK 131
            K+A+KE+  Y  F    II  ID  +  + +G K + I LPY++  LQD+IN  + NN 
Sbjct: 74  FKNALKEIKNYHRFKSPYIISSIDELIQSESDGSKNILILLPYFEKSLQDIINELVLNNS 133

Query: 132 YFSEKEMLKIFRGICYAVRALHTYRFPS------------VPLRSENGITNSNLNGIENE 179
              + E+++IF G+C  ++A+H Y+  +            V L + +       NG EN 
Sbjct: 134 KMEQGEIMRIFIGVCRGLKAMHRYKKTTTNNTRLDDDEQDVLLPTSDDEDFEEPNGNENS 193

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
           +                 VP+AH D+KP N++L+  A+  P+L D GS  RARI ++ R 
Sbjct: 194 LQMQES------------VPYAHHDLKPANVMLS--AEGLPVLCDLGSCSRARISVKNRQ 239

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           +AL  QD A +H T+PYRAPEL DV TN E+ EK DIWSLGC LY   +G SPF+    E
Sbjct: 240 QALTVQDFAQEHCTLPYRAPELVDVATNAEITEKTDIWSLGCLLYCCCFGYSPFEKLEIE 299

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           QG ++ LA+L  +++  P +  ++ P+  +LI   L++ P++RPDI +++ +      QL
Sbjct: 300 QGANLNLAILQGKYQI-PADNGQFDPKVIELIKKCLQLKPENRPDIDELLNQALEVARQL 358

Query: 360 S 360
           +
Sbjct: 359 N 359



>gi|350633170|gb|EHA21536.1| hypothetical protein ASPNIDRAFT_129315 [Aspergillus niger ATCC
           1015]
          Length = 894

 Score =  269 bits (687), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 165/399 (41%), Positives = 216/399 (54%), Gaps = 72/399 (18%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LL            D ST   +ALKKIRC 
Sbjct: 7   DLLYNFTDCMCCFPSTPQLKINNRSFKLLRLL------------DKSTSELFALKKIRCP 54

Query: 67  FGSDSVKDAMKEVDMYRLFSHEN-IIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF+ +N II  ID CV  +            G K VYI LPYY
Sbjct: 55  FGQESVSQALKEVEAYNLFTTQNNIIHSIDHCVSTESGSKFRADGGDAGSKTVYILLPYY 114

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV--PLRSENGI---- 168
           + G LQD IN NL N+  F EK ++ +  G+  A+RA+H YR  S   P R    +    
Sbjct: 115 QRGNLQDAINANLVNHSRFPEKRLMVLMLGVANALRAMHLYRVKSGTGPTRKAKAVRREG 174

Query: 169 -----------------TNSNLNGIE-NEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGN 209
                            T+ N++  E NE              +DG + P+AHRDIKPGN
Sbjct: 175 AEADADTAMRMPKPKRRTSQNVDEEEENEPLMDDEVTISQEGVQDGDLRPYAHRDIKPGN 234

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
           I++ DD  + PILMD GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 235 IMIADDGRT-PILMDLGSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSI 293

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQD-------- 321
           ++ KVDIWSLGCTLYA   G SPF+    E GGS+++ VL   +RFP  +          
Sbjct: 294 IDTKVDIWSLGCTLYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKSSATKGKGKA 353

Query: 322 -----------KYSPEFKDLISFMLKVDPKDRPDIHQVI 349
                      + S   K+++   L+V+P DRPDI ++I
Sbjct: 354 GGDDSRKDNTMQISAPVKEVVRKCLQVEPADRPDIDELI 392



>gi|294656615|ref|XP_458913.2| DEHA2D10296p [Debaryomyces hansenii CBS767]
 gi|199431608|emb|CAG87067.2| DEHA2D10296p [Debaryomyces hansenii CBS767]
          Length = 359

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/366 (41%), Positives = 205/366 (56%), Gaps = 38/366 (10%)

Query: 10  DTLYAVTSCCFP------NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGR-YYALKK 62
           +TL  V S C P       P + IN   +K+I+LLGEGGFSYV+LV   S     YALKK
Sbjct: 2   ETLLTVFSKCLPCFPDLSTPYVSINNAKYKIIRLLGEGGFSYVYLVSHKSNNNSQYALKK 61

Query: 63  IRCQFGSD--SVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFLPYYKS 117
           IRC FGSD  + K+AMKE+  Y  FS+     II+ ID  ++ + +G K +YI LPY+++
Sbjct: 62  IRCPFGSDDETFKNAMKEIKNYHRFSNSKTPYIIQSIDETIINENDGSKTIYILLPYFEN 121

Query: 118 GLQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIE 177
            LQD+I  N+ N+    E E+LKIF G+C  ++A+H ++          G T+S  N  E
Sbjct: 122 SLQDIITYNVLNDLTMDEDEILKIFIGVCRGLQAMHKFK--------RTGRTHSTANDEE 173

Query: 178 NEMXXXXXXXXXXXXXEDGV-----------VPFAHRDIKPGNILLTDDADSQPILMDFG 226
            E              EDGV            PFAHRDIKP N++L+  A+  P+L+D G
Sbjct: 174 EE----DLLLPAASDDEDGVSASNGTELQELTPFAHRDIKPANVMLS--AEGLPVLVDLG 227

Query: 227 SLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAM 286
           S  +A   I+ R +AL   D A +H T+PYRAPEL DV TN E+ EK DIWSLGC LYA 
Sbjct: 228 SCSKANFSIKNRQQALTLTDFAQEHCTLPYRAPELLDVATNTEITEKTDIWSLGCLLYAC 287

Query: 287 AYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIH 346
            +G SPF+    EQG ++ LA+    +  P   +  YS E   LI   L +D   RP + 
Sbjct: 288 CFGFSPFEKLEIEQGANLNLAISQGNYSIPQNNK-GYSDELISLIKDCLVLDSSKRPSVD 346

Query: 347 QVIAKV 352
           +++ K 
Sbjct: 347 ELLDKA 352



>gi|344299722|gb|EGW30075.1| hypothetical protein SPAPADRAFT_63693 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 353

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 213/355 (60%), Gaps = 33/355 (9%)

Query: 15  VTSCCFP----NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTST-GRYYALKKIRCQFGS 69
           + +CCFP    +PTL +N  ++K+ +LLGEGGFSYV+LV  TS    +YALKKIRC FG+
Sbjct: 3   ILACCFPCLPTSPTLSLNSTSYKIHRLLGEGGFSYVYLVSPTSNPNSFYALKKIRCPFGT 62

Query: 70  --DSVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQDVIN 124
             +S K+AM+E+  Y  F++     II+ ID C++ + +GG+ VYI LPY++S LQDVI 
Sbjct: 63  GDESYKNAMREIHNYHRFTNSQTPYIIQTIDECIISEVDGGQSVYILLPYFQSSLQDVIT 122

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYR-----FPSVPLRSENGIT-----NSNLN 174
            N+ N++   E E+++IF G+C  ++ +H Y+       +    +E G          L 
Sbjct: 123 KNVLNDEKMPESEIIRIFTGVCRGLKVMHNYQATSTTNTTTDDDNEQGQLLPDNDEDTLA 182

Query: 175 GIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIK 234
           GI+N+                 + P+AH DIKP N++++ +    P+L+D GS  +AR  
Sbjct: 183 GIDNDPESTQLTE---------LTPYAHHDIKPANVMVSPEG--LPVLVDLGSCTKARFN 231

Query: 235 IQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFD 294
           I++R +AL   D A +H T+PYRAPEL DV TN  + E  DIWS+GC LY++ +G SPF+
Sbjct: 232 IRSRQQALALTDFAQEHCTLPYRAPELLDVSTNSTITEATDIWSMGCLLYSLCFGFSPFE 291

Query: 295 NNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
               EQG ++ +A+   ++  P  +  +YS E   LI   L+V P++RP + +++
Sbjct: 292 KMELEQGANLNIAISQGKYIIP--QGHEYSQELIKLIDSCLQVKPENRPTVAELL 344



>gi|225561907|gb|EEH10187.1| serine/threonine-protein kinase [Ajellomyces capsulatus G186AR]
          Length = 420

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 162/428 (37%), Positives = 216/428 (50%), Gaps = 96/428 (22%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFPN P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPNSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKNTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LFS +  II  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYSLFSPNRYIIHSIDYCVSTESGSKFRADGGDPGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPL------------ 162
           + G LQD IN NL N+  F EK+++    G+  A++A+H YR  S               
Sbjct: 127 QRGNLQDAINANLVNHTSFPEKKLMTFMLGVAKALKAMHQYRVRSGASAVKKAKIVRNDA 186

Query: 163 ------------RSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGN 209
                       R    ++  + +  E+E              ++G   P+AHRDIKP  
Sbjct: 187 EAADAEAAASRGRPARRVSRRDSDDTEHEPLMDGEVTISQEGVDEGDFRPYAHRDIKP-- 244

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
                           GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 245 ----------------GSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSI 288

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------- 316
           ++ KVDIWSLGCT+YA   G SPF+    E GGS+++ VL   +RFP             
Sbjct: 289 IDTKVDIWSLGCTIYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKSAGQKGKGTA 348

Query: 317 -------------------------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAK 351
                                    P  +   S   K+++   L+V+P DRPD+ ++I  
Sbjct: 349 SAGTGSAGVGEGEGSAAAVDGETGSPARKGGISEASKEVVRRCLQVEPADRPDVDELIEL 408

Query: 352 VDTQLEQL 359
           + T +E+L
Sbjct: 409 LKTTIEKL 416



>gi|240275515|gb|EER39029.1| serine/threonine protein kinase [Ajellomyces capsulatus H143]
 gi|325091352|gb|EGC44662.1| serine/threonine protein kinase [Ajellomyces capsulatus H88]
          Length = 420

 Score =  263 bits (671), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 161/428 (37%), Positives = 216/428 (50%), Gaps = 96/428 (22%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFPN P L IN R+FK+++LLGEGGFSYV+LVQD +T   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMCCFPNSPQLKINNRSFKLLRLLGEGGFSYVYLVQDKNTSELFALKKIRCP 66

Query: 67  FGSDSVKDAMKEVDMYRLFS-HENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LFS +  II  ID CV  +            G K VYI LPYY
Sbjct: 67  FGQESVSQALKEVEAYSLFSPNRYIIHSIDYCVSTESGSKFRADGGDPGSKTVYILLPYY 126

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPL------------ 162
           + G LQD IN NL N+  F EK+++    G+  A++A+H YR  S               
Sbjct: 127 QRGNLQDAINANLVNHTSFPEKKLMTFMLGVAKALKAMHQYRVRSGASAVKKAKIVRNDV 186

Query: 163 ------------RSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPGN 209
                       R    ++  + +  E+E              ++G   P+AHRDIKP  
Sbjct: 187 EAADAEAAASRGRPARRVSRRDSDDTEHEPLMDGEVTISQEGVDEGDFRPYAHRDIKP-- 244

Query: 210 ILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVE 269
                           GSL  + I I +R+ AL  QD A++HSTMPYRAPELFDVKT   
Sbjct: 245 ----------------GSLAPSPIAITSRSLALAVQDTAAEHSTMPYRAPELFDVKTGSI 288

Query: 270 LNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP------------- 316
           ++ +VDIWSLGCT+YA   G SPF+    E GGS+++ VL   +RFP             
Sbjct: 289 IDTQVDIWSLGCTIYACLVGKSPFEARSEETGGSLSMCVLGGDWRFPDEKSAGQKGKGTA 348

Query: 317 -------------------------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAK 351
                                    P  +   S   K+++   L+V+P DRPD+ ++I  
Sbjct: 349 SAGTGSADVSEGEGSAAAVDGETGSPARKGGISEASKEVVRRCLQVEPGDRPDVDELIEL 408

Query: 352 VDTQLEQL 359
           + T +E+L
Sbjct: 409 LKTTIEKL 416



>gi|260951069|ref|XP_002619831.1| hypothetical protein CLUG_00990 [Clavispora lusitaniae ATCC 42720]
 gi|238847403|gb|EEQ36867.1| hypothetical protein CLUG_00990 [Clavispora lusitaniae ATCC 42720]
          Length = 368

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 138/361 (38%), Positives = 210/361 (58%), Gaps = 20/361 (5%)

Query: 1   MSLVLSSVRDTLYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLV-QDTSTGRY 57
           M L+L+S+         CC    +P + +N   +K+I+LLGEGGFSYV+LV Q  +    
Sbjct: 13  MDLILNSISKCF----PCCPDISSPQISVNGTKYKIIRLLGEGGFSYVYLVSQKNNASIL 68

Query: 58  YALKKIRCQFGSD--SVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFL 112
           YA+KKIRC +GS   + ++AM+E+  Y  F+      I+  ID  +V + +G +  Y+ L
Sbjct: 69  YAMKKIRCPYGSSDATFRNAMREIKSYHRFAPAKSPYIVHTIDEAIVSEPDGSRTFYVLL 128

Query: 113 PYYKSGLQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNS- 171
           PY+K  LQD+IN N+ N     E+E+LKIF G+   ++ +H Y+       S+ G  +S 
Sbjct: 129 PYFKHSLQDIINYNVLNGVTMDEEEVLKIFIGVLSGIQTMHKYK----KTGSDPGEEDSQ 184

Query: 172 NLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRA 231
           N       M                + P+AHRDIKP N++L+  A+  P+L+D GS ++A
Sbjct: 185 NEQDAMLPMGLDDDTGAMESTEMSELCPYAHRDIKPANVMLS--AEGLPVLVDLGSCMKA 242

Query: 232 RIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSS 291
           R+ +++R +AL   D AS+H T+PYRAPEL DV TN E+ E  DIWSLGC LY   +G S
Sbjct: 243 RVSVKSRQQALALTDFASEHCTLPYRAPELLDVATNAEITEATDIWSLGCLLYCCCFGFS 302

Query: 292 PFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAK 351
           PF+    EQG ++++A+  A++   P +   YSPE  D+I   L++DP  RP + +++ K
Sbjct: 303 PFEKLEMEQGANLSVAIAQAKYNI-PQDIKGYSPEIMDIIRSCLQLDPTKRPTVDELLEK 361

Query: 352 V 352
            
Sbjct: 362 C 362



>gi|303321478|ref|XP_003070733.1| kinase domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240110430|gb|EER28588.1| kinase domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 430

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 161/429 (37%), Positives = 219/429 (51%), Gaps = 90/429 (20%)

Query: 10  DTLYAVTSC--CFPN-PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           D LY  T C  CFP+ P L IN R+FK+++LLGE          D ST   +ALKKIRC 
Sbjct: 7   DLLYTFTDCMSCFPSSPQLKINSRSFKLLRLLGE----------DKSTSELFALKKIRCP 56

Query: 67  FGSDSVKDAMKEVDMYRLF-SHENIIKVIDTCVVQDKN----------GGKIVYIFLPYY 115
           FG +SV  A+KEV+ Y LF  + NII  ID CV  +            G K VYI LPYY
Sbjct: 57  FGQESVSQALKEVEAYTLFVDNSNIIHSIDHCVATESGSKFRSDGGDAGSKTVYILLPYY 116

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS--VP------LRSEN 166
           ++G LQD IN N+ N+  F EKE++ I  G+  A++ +H YR  S   P      +R E 
Sbjct: 117 QNGNLQDAINANIVNHTQFPEKELMIIMLGVAKALKGMHQYRINSGATPAKKAKLVRQEG 176

Query: 167 GITNS------------NLNGIENEMXXXXXXXXXXXXXEDG-VVPFAHRDIKPG----- 208
              ++            +    E E              E+G   P+AHRDIKPG     
Sbjct: 177 KAADAPRRKQMRKGSQIDDEDTEQEPLMDGEVTRSQEGMEEGDYRPYAHRDIKPGMFQVI 236

Query: 209 ---------------NILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHST 253
                          NI+L DD  + PILMD GS+  + I I +R+ A+  QD A++HST
Sbjct: 237 NSSCGILSPRVLRSGNIMLDDDGKT-PILMDLGSMAPSPIAITSRSLAIAVQDTAAEHST 295

Query: 254 MPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQF 313
           +PYRAPELFDVKT   ++ K DIWS GCTLYA   G SPF+   +E GGS+++ +L   +
Sbjct: 296 IPYRAPELFDVKTGSIIDTKADIWSFGCTLYACLVGKSPFEARSDETGGSLSMCILGGDW 355

Query: 314 RFP-----------------------PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIA 350
           RFP                         E+   S E K+++   L+V+P +RPDI ++I 
Sbjct: 356 RFPDEKTGTVQGKSKVSPANGESDESSRERSAISREVKEVVRRCLRVEPSERPDIDELIE 415

Query: 351 KVDTQLEQL 359
            +   ++ L
Sbjct: 416 IIQQTIQAL 424



>gi|190348168|gb|EDK40577.2| hypothetical protein PGUG_04675 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 365

 Score =  256 bits (655), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 138/355 (38%), Positives = 205/355 (57%), Gaps = 24/355 (6%)

Query: 14  AVTSC--CFPN---PTLHINRRTFKVIKLLGEGGFSYVHLVQ-DTSTGRYYALKKIRCQF 67
           A + C  CFP+   P + +N   +K+I+LLGEGGFSYV+LV    +    YALKKIRC F
Sbjct: 7   AFSKCLPCFPDLSAPLVSLNDSRYKIIRLLGEGGFSYVYLVSLKGNPSSLYALKKIRCPF 66

Query: 68  GS--DSVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQDV 122
           G+  ++ K+A+KE++ Y  F++     I++ ID  ++ D +G   +YI LPY+   +QD 
Sbjct: 67  GTNDETYKNAIKEINNYHRFANSKTPYIVQSIDDAIIPDVDGSYTIYILLPYFHKSVQDE 126

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXX 182
           IN  + NN    E E+L+IF G+C  ++ +H Y       R+ N +   + N  E+E+  
Sbjct: 127 INYRVLNNTSMEEPEVLRIFIGVCRGLQIMHKYSGTGTS-RTSNMVEGESQNPEEDELLP 185

Query: 183 XXXXXXXXXXXEDG--------VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIK 234
                                 +VP+AH DIKP N++L+  A+  P+L+D GS  +AR+ 
Sbjct: 186 GGSDAEEGEELGGLSGGTELRELVPYAHHDIKPANVMLS--AEGLPVLVDLGSCSKARVT 243

Query: 235 IQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFD 294
           + TR +AL   D A +H T+PYRAPEL DV T   + EK DIWSLGC LY   +G SPF+
Sbjct: 244 VTTRQQALSLTDFAQEHCTLPYRAPELLDVSTGANITEKTDIWSLGCLLYCCCFGLSPFE 303

Query: 295 NNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
               EQG +I LA+   ++  P     K+SPE  +LI   LK+DP++RP + Q++
Sbjct: 304 KLEIEQGANINLAITQGKYSVP--TNHKFSPELINLIDDCLKLDPQNRPSVDQLL 356



>gi|146413499|ref|XP_001482720.1| hypothetical protein PGUG_04675 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 365

 Score =  256 bits (654), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 138/355 (38%), Positives = 205/355 (57%), Gaps = 24/355 (6%)

Query: 14  AVTSC--CFPN---PTLHINRRTFKVIKLLGEGGFSYVHLVQ-DTSTGRYYALKKIRCQF 67
           A + C  CFP+   P + +N   +K+I+LLGEGGFSYV+LV    +    YALKKIRC F
Sbjct: 7   AFSKCLPCFPDLLAPLVSLNDSRYKIIRLLGEGGFSYVYLVSLKGNPSSLYALKKIRCPF 66

Query: 68  GS--DSVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQDV 122
           G+  ++ K+A+KE++ Y  F++     I++ ID  ++ D +G   +YI LPY+   +QD 
Sbjct: 67  GTNDETYKNAIKEINNYHRFANSKTPYIVQSIDDAIIPDVDGSYTIYILLPYFHKSVQDE 126

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXX 182
           IN  + NN    E E+L+IF G+C  ++ +H Y       R+ N +   + N  E+E+  
Sbjct: 127 INYRVLNNTSMEEPEVLRIFIGVCRGLQIMHKYSGTGTS-RTSNMVEGESQNPEEDELLP 185

Query: 183 XXXXXXXXXXXEDG--------VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIK 234
                                 +VP+AH DIKP N++L+  A+  P+L+D GS  +AR+ 
Sbjct: 186 GGSDAEEGEELGGLSGGTELRELVPYAHHDIKPANVMLS--AEGLPVLVDLGSCSKARVT 243

Query: 235 IQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFD 294
           + TR +AL   D A +H T+PYRAPEL DV T   + EK DIWSLGC LY   +G SPF+
Sbjct: 244 VTTRQQALSLTDFAQEHCTLPYRAPELLDVSTGANITEKTDIWSLGCLLYCCCFGLSPFE 303

Query: 295 NNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
               EQG +I LA+   ++  P     K+SPE  +LI   LK+DP++RP + Q++
Sbjct: 304 KLEIEQGANINLAITQGKYSVP--TNHKFSPELINLIDDCLKLDPQNRPSVDQLL 356



>gi|448088885|ref|XP_004196658.1| Piso0_003883 [Millerozyma farinosa CBS 7064]
 gi|448093050|ref|XP_004197689.1| Piso0_003883 [Millerozyma farinosa CBS 7064]
 gi|359378080|emb|CCE84339.1| Piso0_003883 [Millerozyma farinosa CBS 7064]
 gi|359379111|emb|CCE83308.1| Piso0_003883 [Millerozyma farinosa CBS 7064]
          Length = 358

 Score =  256 bits (653), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 138/357 (38%), Positives = 213/357 (59%), Gaps = 25/357 (7%)

Query: 12  LYAVTSC--CFPN---PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGR-YYALKKIRC 65
           L  V  C  CFPN   P++ +N + +K++ LLGEGGFSYV+LV D S     +A+KKIRC
Sbjct: 5   LSLVLKCFPCFPNISVPSVILNNKRYKILNLLGEGGFSYVYLVSDVSNNNSLFAMKKIRC 64

Query: 66  QFGS--DSVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQ 120
            FGS  ++ ++A+KEV  Y  F++ N   II+ +   V+ +K+G K VYI +PY++  LQ
Sbjct: 65  PFGSSDETFRNAIKEVRNYHRFANSNTPYIIQSLVDTVLDEKDGSKTVYILMPYFEKSLQ 124

Query: 121 DVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEM 180
           D+IN N+ NN+   E E+L++  GIC  ++ +H ++         +G      N  E+++
Sbjct: 125 DIINYNVINNQRMEEVEILRLLVGICRGLQVMHNFK-----KTGGSGQAQPQSND-EDDL 178

Query: 181 XXXXXXXXXXXXXEDGV-----VPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKI 235
                         +G       P+AHRDIKP N++L+  A+  P+L+D GS  +AR+ +
Sbjct: 179 LLPLGSDDEDGDTAEGTELQEFAPYAHRDIKPANVMLS--AEGLPVLVDLGSCSKARLSV 236

Query: 236 QTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN 295
           + R +AL   D A++H T+PYRAPEL DV  N E+ EK DIWSLGC +YA  +G SPF+ 
Sbjct: 237 KNRQQALAITDFAAEHCTLPYRAPELLDVAVNSEITEKTDIWSLGCLVYACCFGFSPFEK 296

Query: 296 NINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
              EQG ++ LA+   ++   P++Q+ YS E  +LI  ML ++   RP I +++ + 
Sbjct: 297 LEVEQGANLNLAITQGRYNI-PSDQNGYSDELINLIKDMLVLESTQRPSIDEILERA 352



>gi|241957731|ref|XP_002421585.1| protein kinase, putative [Candida dubliniensis CD36]
 gi|223644929|emb|CAX40928.1| protein kinase, putative [Candida dubliniensis CD36]
          Length = 362

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 142/372 (38%), Positives = 206/372 (55%), Gaps = 45/372 (12%)

Query: 1   MSLVLSSVRDTLYAVTSCCFP---NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRY 57
           M L+LS     ++     CFP   +P++ IN   +++I+LLGEGGFSYV+LV   S    
Sbjct: 1   MDLLLS-----IFGTCLPCFPTLSSPSIVINNNKYRIIRLLGEGGFSYVYLVSSQSQSSS 55

Query: 58  -YALKKIRCQFG--SDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPY 114
            YALKKIRC +G   DS K+A++E+  Y  F    II  ID  +  + +G K +YI LP+
Sbjct: 56  QYALKKIRCPYGVQDDSFKNAIREIRNYHRFKSPYIISTIDELIQSETDGSKSIYILLPF 115

Query: 115 YKSGLQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYR-----------------F 157
           ++  LQD+IN  + NN    E E+L++F G C  ++ +H Y+                  
Sbjct: 116 FQKSLQDIINELVLNNSRMDESEILRVFIGTCRGLKVMHNYKKTATSTTRLDDDEQDVLL 175

Query: 158 PSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDAD 217
           P+         TNSN N    +M                +VPFAH D+KP N++L+  A+
Sbjct: 176 PTSEDDEYEDFTNSNDNSNTVQMQE--------------LVPFAHHDLKPANVMLS--AE 219

Query: 218 SQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIW 277
             P+L D GS  RARI ++ R +AL  Q+ A +H T+PYRAPEL DV TN E+ EK DIW
Sbjct: 220 GLPVLCDLGSCSRARISVRNRQQALTVQEFAQEHCTLPYRAPELVDVATNCEITEKTDIW 279

Query: 278 SLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKV 337
           SLGC LY   +G SPF+    EQG ++ LA+L   +  P    + Y+ +  +LI   L++
Sbjct: 280 SLGCLLYCCCFGYSPFEKLEIEQGANLNLAILQGNYEIPKG-NNGYNLKLMELIKKCLQL 338

Query: 338 DPKDRPDIHQVI 349
           +P  RPDI +++
Sbjct: 339 NPDSRPDIDELL 350



>gi|238883539|gb|EEQ47177.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 362

 Score =  250 bits (639), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 138/374 (36%), Positives = 205/374 (54%), Gaps = 40/374 (10%)

Query: 11  TLYAVTSCCFP---NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRY-YALKKIRCQ 66
           +++     CFP   +P++ IN   +++I+LLGEGGFSYV+LV   S     YALKKIRC 
Sbjct: 6   SIFGTCLPCFPTLSSPSIIINNNKYRIIRLLGEGGFSYVYLVSSQSQPSSQYALKKIRCP 65

Query: 67  FG--SDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQDVIN 124
           +G   +S K+A++E+  Y  F    II  ID  +  + +G K +YI LP+++  LQD+IN
Sbjct: 66  YGIQDESFKNAVREIKNYHRFKSPYIISSIDELIQSETDGSKNIYILLPFFQKSLQDIIN 125

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYR-----------------FPSVPLRSENG 167
             + NN    E E+L++F G C  ++ +H ++                  P+        
Sbjct: 126 ELVLNNSKMEESEILRVFIGTCRGLKVMHNHKKTATSTTRLDDDEQDVLLPTSEDDEYED 185

Query: 168 ITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGS 227
            TNS  N    +M                +VPFAH D+KP N++L+  A+  P+L D GS
Sbjct: 186 FTNSTDNNNNVQMQE--------------LVPFAHHDLKPANVMLS--AEGLPVLCDLGS 229

Query: 228 LVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMA 287
             RARI ++ R +AL  Q+ A +H T+PYRAPEL DV TN E+ EK DIWSLGC LY   
Sbjct: 230 CSRARISVRNRQQALTVQEFAQEHCTLPYRAPELVDVATNCEITEKTDIWSLGCLLYCCC 289

Query: 288 YGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQ 347
           +G SPF+    EQG ++ LA+L  ++  P    + Y  +  +LI   L+++P  RPDI +
Sbjct: 290 FGYSPFEKLEIEQGANLNLAILQGKYEIPKG-NNGYDSKLIELIKKCLQLNPDSRPDIDE 348

Query: 348 VIAKVDTQLEQLSS 361
           ++  V     QL +
Sbjct: 349 LLNDVLELTRQLGT 362



>gi|388583622|gb|EIM23923.1| kinase-like protein [Wallemia sebi CBS 633.66]
          Length = 334

 Score =  250 bits (638), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 149/367 (40%), Positives = 219/367 (59%), Gaps = 55/367 (14%)

Query: 2   SLVLSSVRDTLYAVTSC---CFPN--PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGR 56
           +L + +++D+L++++S    C  +   T+ IN   + ++K L EG FSYV+LVQ++    
Sbjct: 11  NLFIEAIKDSLWSISSLLTQCMSSRTKTITINNTEYTILKYLSEGAFSYVYLVQNSHG-- 68

Query: 57  YYALKKIRCQFGSDSVKDAMK-EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYY 115
            YALKKI          D  + EV  Y+ F  + II +++  + QD   G I  IF PY+
Sbjct: 69  LYALKKI--------TNDGFEAEVSCYQRFKSKFIINLLNYSI-QD---GAINLIF-PYF 115

Query: 116 KSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLN 174
           K+G LQD IN N      F EK  LK+F G+C AV  LH Y                   
Sbjct: 116 KNGNLQDYINVN----NAFDEKTALKLFSGVCQAVAVLHNY------------------- 152

Query: 175 GIENEMXXXXXXXXXXXXXEDG--VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRAR 232
              N +             ++G   VP+AHRDIKPGN++LTD+A   P+LMDFGS ++AR
Sbjct: 153 ---NTLDSNSYPPSSIDDDDEGTDAVPYAHRDIKPGNVMLTDNA--LPVLMDFGSCIKAR 207

Query: 233 IKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSP 292
           +++  R+EAL+QQD+A++HS+MPYRAPELFDVK++  L+EKVDIWSLGCTLYA+ Y  SP
Sbjct: 208 VRVNNRSEALIQQDMAAEHSSMPYRAPELFDVKSDTTLDEKVDIWSLGCTLYALTYSHSP 267

Query: 293 F-DNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAK 351
           F D     QGGSIA+AV + ++ +P    D +S  FK++I   L+++P +RP + ++I  
Sbjct: 268 FEDPKQAAQGGSIAMAVQSGRYNYP--SNDTHSDGFKNVIDACLRLNPAERPSVDELIRL 325

Query: 352 VDTQLEQ 358
            ++ L +
Sbjct: 326 TESALSE 332



>gi|68481690|ref|XP_715213.1| potential protein kinase [Candida albicans SC5314]
 gi|77023142|ref|XP_889015.1| hypothetical protein CaO19_7164 [Candida albicans SC5314]
 gi|46436826|gb|EAK96182.1| potential protein kinase [Candida albicans SC5314]
 gi|76573828|dbj|BAE44912.1| hypothetical protein [Candida albicans]
          Length = 364

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 132/362 (36%), Positives = 205/362 (56%), Gaps = 14/362 (3%)

Query: 11  TLYAVTSCCFP---NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRY-YALKKIRCQ 66
           +++     CFP   +P++ IN   +++I+LLGEGGFSYV+LV   S     YALKKIRC 
Sbjct: 6   SIFGTCLPCFPTLSSPSIIINNNKYRIIRLLGEGGFSYVYLVSSQSQPSSQYALKKIRCP 65

Query: 67  FG--SDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQDVIN 124
           +G   +S K+A++E+  Y  F    II  ID  +  + +G K +YI LP+++  LQD+IN
Sbjct: 66  YGIQDESFKNAVREIKNYHRFKSPYIISSIDELIQSETDGSKNIYILLPFFQKSLQDIIN 125

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLR-----SENGITNSNLNGIENE 179
             + NN    E E+L++F G C  ++ +H ++  +          ++ +  ++ +    +
Sbjct: 126 ELVLNNSKMEESEILRVFIGTCRGLKVMHNHKKTATSTTRLDDDEQDVLLPTSEDDEYED 185

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
                            +VPFAH D+KP N++L+  A+  P+L D GS  RARI ++ R 
Sbjct: 186 FTNSTDNNNNNNVQMQELVPFAHHDLKPANVMLS--AEGLPVLCDLGSCSRARISVRNRQ 243

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           +AL  Q+ A +H T+PYRAPEL DV TN E+ EK DIWSLGC LY   +G SPF+    E
Sbjct: 244 QALTVQEFAQEHCTLPYRAPELVDVATNCEITEKTDIWSLGCLLYCCCFGYSPFEKLEIE 303

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           QG ++ LA+L  ++  P    + Y  +  +LI   L+++P  RPDI +++  V     QL
Sbjct: 304 QGANLNLAILQGKYEIPKG-NNGYDSKLIELIKKCLQLNPDSRPDIDELLNDVLELTRQL 362

Query: 360 SS 361
            +
Sbjct: 363 GT 364



>gi|150863878|ref|XP_001382503.2| serine/threonine protein kinase [Scheffersomyces stipitis CBS 6054]
 gi|149385134|gb|ABN64474.2| serine/threonine protein kinase [Scheffersomyces stipitis CBS 6054]
          Length = 362

 Score =  244 bits (623), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/357 (36%), Positives = 208/357 (58%), Gaps = 25/357 (7%)

Query: 10  DTLYAVTSCCFP------NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKI 63
           DT+ A  S C P      +P + +N   +K+++LLGEGGFSYV+LV+ ++    YALKKI
Sbjct: 2   DTILACLSACLPCFPDLASPYVFLNTHKYKIVRLLGEGGFSYVYLVK-SNNNSLYALKKI 60

Query: 64  RCQFGS--DSVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFLPYYKSG 118
           RC +GS  ++ K+AM E+  Y  F++     II+ I+  +V + +G K +Y+ LPY++  
Sbjct: 61  RCPYGSNDETYKNAMNEIKNYHRFANSKTPYIIQSIEEAIVNEPDGSKTIYVLLPYFEKS 120

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYR------FPSVPLRSENGITNSN 172
           LQD+IN+ + N++   + E+LKI  G+C  ++ +H ++         VP   E  +    
Sbjct: 121 LQDIINDLVLNDRKMDQDEILKIVIGVCRGLKVMHNFKKVGSSSTTVVPEEEEEDLLLPA 180

Query: 173 LNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRAR 232
            +  E+E+                + PFAHRDIKP N++L+  A+  P+L+D GS  +AR
Sbjct: 181 GSDDEDEVVSNLASGTELAE----LAPFAHRDIKPANVMLS--AEGLPVLVDLGSCSKAR 234

Query: 233 IKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSP 292
             ++ R +AL   D A +H T+PYRAPEL DV+TN  + EK DIWSLGC +Y   +G SP
Sbjct: 235 FHVKNRQQALTLTDFAQEHCTLPYRAPELLDVETNARITEKTDIWSLGCLIYCCCFGFSP 294

Query: 293 FDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
           F+    EQG ++ LA+   ++   P+++  YS +   +I   L + P++R D+  ++
Sbjct: 295 FEKLEIEQGANLNLAISQGRYSI-PSDKRGYSDDLIAIIKQCLVLKPENRADVDTIL 350



>gi|505756995|gb|EOR01129.1| Serine/threonine-protein kinase ENV7 [Wallemia ichthyophaga
           EXF-994]
          Length = 344

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 145/362 (40%), Positives = 213/362 (58%), Gaps = 41/362 (11%)

Query: 2   SLVLSSVRDTLYAV----TSCCFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGR 56
           ++ + + +D L+++    T C      T++IN   + +IK L EG FSYV+LV D     
Sbjct: 13  NVFIEAAKDALWSLQAWLTQCMSSRTKTININGTQYNIIKYLSEGAFSYVYLVSDADN-- 70

Query: 57  YYALKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYK 116
            YALKKI       +      EV  Y+ F  + II +++  +   ++G   + + LPY K
Sbjct: 71  VYALKKI-------TNGGFEGEVGCYQRFKSKYIISLLNYSI---QDGA--INLILPYLK 118

Query: 117 SG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNG 175
            G LQD IN N        E+  L++F G+C  V+ LH + +P+    S +    S+++ 
Sbjct: 119 KGNLQDYINLN----STLDERMSLQLFSGVCQGVQVLHNH-YPAHS-HSRSSYPPSSIDQ 172

Query: 176 IENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKI 235
             N+              + G VP+AHRDIKPGN++L DD    P+LMD GS ++AR++I
Sbjct: 173 DVND----------EEGDQPGHVPYAHRDIKPGNVMLADDG--TPVLMDLGSCIKARVRI 220

Query: 236 QTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPF-D 294
             R++AL+QQD+A++HS+MPYRAPELFDVK++  L+EKVDIWSLGCTLYA+AY  SPF D
Sbjct: 221 HNRSQALVQQDMAAEHSSMPYRAPELFDVKSDTTLDEKVDIWSLGCTLYALAYSHSPFED 280

Query: 295 NNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
                QGGSIA+A  + +F +P    D +S  FK +I   LK+DP  RP I+Q+I+  + 
Sbjct: 281 PKQAAQGGSIAMAAQSGRFTYP--ANDTHSDTFKAIIEACLKIDPSKRPTINQLISMTEH 338

Query: 355 QL 356
            L
Sbjct: 339 AL 340



>gi|254569012|ref|XP_002491616.1| Putative protein kinase that exhibits Akr1p-dependent
           palmitoylation [Komagataella pastoris GS115]
 gi|238031413|emb|CAY69336.1| Putative protein kinase that exhibits Akr1p-dependent
           palmitoylation [Komagataella pastoris GS115]
 gi|328351879|emb|CCA38278.1| serine/threonine kinase 16 [Komagataella pastoris CBS 7435]
          Length = 339

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 202/343 (58%), Gaps = 16/343 (4%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C   +PTL IN   +K+ +LLGEGGFSYV+LV++ + G+Y ALKKI C FG++++K A++
Sbjct: 13  CLSFDPTLKINGVNYKIERLLGEGGFSYVYLVKNYN-GQY-ALKKITCPFGNENLKVALQ 70

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSGLQDVINNNLENNKYFSEKE 137
           EV  Y+ F+   I++ ID  VV +K G K VYI LP++++G+QD+I +N  N+    EK 
Sbjct: 71  EVSNYKEFNSPFIVRSIDYSVVSEKEGYKTVYILLPFFETGIQDIITDNALNDTQIDEKV 130

Query: 138 MLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGV 197
            +++F  IC  + ++H +       R+    +N+ L   +++               +  
Sbjct: 131 AIRMFIDICRGLHSMHRHH------RNAASDSNAILLDTDSDAENQSLINNDFGTELNET 184

Query: 198 VPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYR 257
             FAH D+KP NI+L+   D  P++ D GS  +  I I +   A+  Q+L  +H T+PYR
Sbjct: 185 TIFAHGDLKPSNIMLS--KDETPVICDLGSCQKMPINITSFQHAISIQELVEEHCTLPYR 242

Query: 258 APELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPP 317
           APELFD+K+   + E +DIWSLGCTLYA+ YG +PF+      G +I LA+   ++ +P 
Sbjct: 243 APELFDIKSGDTITESIDIWSLGCTLYALLYGLNPFEREEQINGANITLAINAGKYTYPD 302

Query: 318 TEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
            +   Y+ + K LI   L VD K+RP I  V+A   T LE  S
Sbjct: 303 GD---YTQKIKSLIDMCLVVDQKERPSIETVLA---TALETTS 339



>gi|164662347|ref|XP_001732295.1| hypothetical protein MGL_0070 [Malassezia globosa CBS 7966]
 gi|159106198|gb|EDP45081.1| hypothetical protein MGL_0070 [Malassezia globosa CBS 7966]
          Length = 301

 Score =  236 bits (601), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 122/292 (41%), Positives = 176/292 (60%), Gaps = 27/292 (9%)

Query: 94  IDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRAL 152
           + T  V++    K+VY+ LPY+ +G +QD IN ++ +   F E++ML++F   C A++++
Sbjct: 11  VPTHDVENPRTQKVVYLVLPYFPNGNVQDAINAHIVHKTRFDERKMLQLFACACDALKSM 70

Query: 153 HTYRFPSVPLRS----------------------ENGITNSNLNGIENEMXXXXXXXXXX 190
           H Y  P V +++                      + G++ S        M          
Sbjct: 71  HQYVLPHVSVQAGDEDEDVNTTHAVSTKDDSLLFDAGLSESYAYPPPEPMATNAAASKPL 130

Query: 191 XXXEDGV--VPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLA 248
                    VP+AHRD+KPGNI+++DD ++  +LMDFGS +RAR+ I +R EA+  QDLA
Sbjct: 131 STSSTHAERVPYAHRDVKPGNIMISDDGNTG-VLMDFGSTMRARVTISSRREAIAHQDLA 189

Query: 249 SQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALA 307
           S HS+MPYRAPELFDVKT+  L+EKVDIW+LGCTLYAMAY  SPF+  +  EQGGSIALA
Sbjct: 190 SVHSSMPYRAPELFDVKTDAVLDEKVDIWALGCTLYAMAYLHSPFETLSTVEQGGSIALA 249

Query: 308 VLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           V+N  ++FPP ++D YSP  + +I   L+ DP+ RPDI  V+  V   L  +
Sbjct: 250 VMNGAYKFPPADEDPYSPHVRHIIERCLEHDPQARPDIDAVLNDVHMALASI 301



>gi|19114467|ref|NP_593555.1| serine/threonine protein kinase Ppk13 (predicted)
           [Schizosaccharomyces pombe 972h-]
 gi|19924242|sp|Q10078.2|PPK13_SCHPO RecName: Full=Serine/threonine-protein kinase ppk13
 gi|4490638|emb|CAA92266.2| serine/threonine protein kinase Ppk13 (predicted)
           [Schizosaccharomyces pombe]
          Length = 344

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 133/359 (37%), Positives = 200/359 (55%), Gaps = 16/359 (4%)

Query: 1   MSLVLSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYAL 60
           M  +  +  DTL    S  F N  + IN   +++ KLLGEGGF++V+LVQ+ S  + YAL
Sbjct: 1   MQNLWKNALDTLSPYISNLFDNDVVCINNERYRIQKLLGEGGFAFVYLVQNVSNEKLYAL 60

Query: 61  KKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-L 119
           KKI+C FG+  +K AMKE D +R F    ++K     +V++ +G + VYI  PY+  G +
Sbjct: 61  KKIKCSFGNKGIKKAMKEADYHRKFKSNYLLKSYTHQLVKEADGSEFVYILFPYFAKGSV 120

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENE 179
             VI N      Y SEK +L     +C A++ LH           EN   +S      N+
Sbjct: 121 AQVIRNCDIEGSYISEKRILVWCSCLCKALQYLH-----------ENVAGDSPKQPEVND 169

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
           +              + +V + H DIKP N+LL +++  + +L DFGS+    I     +
Sbjct: 170 LIMFDEPQVPQNTSNNNLVSYIHGDIKPDNLLLHENS-REIVLTDFGSICLVPIFASNNS 228

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           EA+  QD AS++ TMP+RAPELF VK    + EK DIWS GCTLY + + +SPF+  ++ 
Sbjct: 229 EAIAIQDKASENCTMPFRAPELFHVKAGSTITEKADIWSFGCTLYTIMFHASPFEREVS- 287

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQ 358
           QGGS+ALAV NAQ+ FP   +  YS    +++   L+ +P  RP   ++++K+D Q+ Q
Sbjct: 288 QGGSLALAVCNAQYSFP--RKHPYSTLLCEIVEACLQREPNKRPSARELLSKIDLQINQ 344



>gi|196002665|ref|XP_002111200.1| hypothetical protein TRIADDRAFT_54919 [Trichoplax adhaerens]
 gi|190587151|gb|EDV27204.1| hypothetical protein TRIADDRAFT_54919 [Trichoplax adhaerens]
          Length = 284

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 187/315 (59%), Gaps = 49/315 (15%)

Query: 42  GFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQD 101
           G+S+V L  D  TG+ +ALK+I+C     + + A KE+D Y++F+H N+I +ID+ V++ 
Sbjct: 4   GYSFVDLAVDVETGQKFALKRIKCH-DKCAERAASKEIDFYKMFNHPNLISIIDSSVIRP 62

Query: 102 KNGGKIVYIF--LPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFP 158
            + GK V I   LP    G L D+IN       YFSE  + +IF  +C AV+ LH  R  
Sbjct: 63  MSVGKPVEILMLLPLLTGGNLYDIINKASTTKSYFSEDYIFRIFYDVCLAVQHLHKSR-- 120

Query: 159 SVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADS 218
                                                  +P+AHRDIKPGNIL+  D + 
Sbjct: 121 --------------------------------------AIPYAHRDIKPGNILI--DEND 140

Query: 219 QPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNV-ELNEKVDIW 277
            P+LMDFGS+  ARI+I+T  +A+  +D A+Q  T+ YRAPELF++ ++V  ++EK+D+W
Sbjct: 141 NPMLMDFGSMEAARIEIKTHMDAMKMEDTAAQKCTIAYRAPELFNISSDVCGIDEKIDVW 200

Query: 278 SLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKV 337
           SLGC LY+MA+  SPF+  +NE+GGS++LA+++ ++  PP     YS    +LI F+L V
Sbjct: 201 SLGCLLYSMAFLQSPFEFQVNERGGSLSLAIVSGKYEIPPNPS--YSDHLLNLIKFLLVV 258

Query: 338 DPKDRPDIHQVIAKV 352
           +P DRP+I++V+ K+
Sbjct: 259 NPNDRPEINEVVEKL 273



>gi|448536343|ref|XP_003871101.1| hypothetical protein CORT_0G02980 [Candida orthopsilosis Co 90-125]
 gi|380355457|emb|CCG24976.1| hypothetical protein CORT_0G02980 [Candida orthopsilosis]
          Length = 365

 Score =  230 bits (586), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 202/352 (57%), Gaps = 24/352 (6%)

Query: 10  DTLYAVTSCCFP------NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKI 63
           D L ++   C P       P++  N   +K+++LLGEGGFSYV+LV  +S   Y ALK+I
Sbjct: 2   DLLLSIFGSCLPCLPPLSTPSIKFNNANYKIVRLLGEGGFSYVYLVHSSSQSPY-ALKQI 60

Query: 64  RCQFGS--DSVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFLPYYKSG 118
            C +G+  ++ K+A++E+  Y  F++     II+ ID  +V + +G + VYI LPY+   
Sbjct: 61  NCPYGTQDETYKNAIREIKNYHRFANTKTPYIIQSIDESIVTNPDGVRHVYILLPYFTKS 120

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV-PLRSENGITNSNLNGIE 177
           +QD++  ++ N     E E+LKIF G+C  +R +H ++  S    R ++      L  ++
Sbjct: 121 VQDILTEHVLNGTKMEESEILKIFVGVCRGLRIMHNHKQVSRNTARLDDDDEEEGL--LQ 178

Query: 178 NEMXXXXXXXXXXXXXEDG------VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRA 231
           +E               DG      +VP+AH DIKP N++++  A+  P+L+D GS  RA
Sbjct: 179 DEEDEEQVAAAATATTGDGSTEMEELVPYAHHDIKPANVMIS--AEGLPVLVDLGSCSRA 236

Query: 232 RIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSS 291
           R  ++TR +AL   + A +H T+PYRAPEL DV T  ++ E  DIWS+GC LY+  +G S
Sbjct: 237 RYHVRTRQQALALTNFAQEHCTLPYRAPELLDVATGSQITEATDIWSVGCLLYSCCFGYS 296

Query: 292 PFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           PF+    +QG ++ +A+ + +++  P + + YS E   LI   L+VD  +RP
Sbjct: 297 PFEKLEMDQGANLHVAIGSGRYQI-PKDYNGYSKELIGLIKKCLQVDAAERP 347



>gi|260794050|ref|XP_002592023.1| hypothetical protein BRAFLDRAFT_114536 [Branchiostoma floridae]
 gi|229277236|gb|EEN48034.1| hypothetical protein BRAFLDRAFT_114536 [Branchiostoma floridae]
          Length = 305

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 131/328 (39%), Positives = 191/328 (58%), Gaps = 47/328 (14%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMKEVDMYRLFS 86
           IN R F + + +GEGG++Y+ L++D  +G+++ALK+I C    D   +A+KE +  R+F+
Sbjct: 12  INNRAFYMQERIGEGGYAYIDLIEDKKSGKFFALKRITCHSKEDET-EALKEAEYCRMFN 70

Query: 87  HENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGI 145
           H NIIKV +   V+ K     V+I  P++K G LQD+I    +NN Y  E  +L IF+GI
Sbjct: 71  HPNIIKVEEFTTVK-KTQTTSVWIVFPFFKLGSLQDLIEKTAKNNSYIHEDRLLGIFKGI 129

Query: 146 CYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDI 205
           C  V+A+H                                        E    P  HRDI
Sbjct: 130 CEGVKAMH----------------------------------------EATPAPVTHRDI 149

Query: 206 KPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVK 265
           KP N+LL  D +  P+LMDFGS+  AR++I+   EA   Q  A++  TMP+RAPELF V+
Sbjct: 150 KPANVLL--DENDTPVLMDFGSVGPARVEIKGSAEAQAMQAAAAK-CTMPWRAPELFHVE 206

Query: 266 TNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSP 325
           ++  +++KVDIWSLGCTLYAM Y   PFD  + ++G S+ LAVL+   +FP  +Q  YS 
Sbjct: 207 SHCIIDDKVDIWSLGCTLYAMIYLEGPFD-AVWQKGDSVQLAVLSRNVKFPEDQQSLYSA 265

Query: 326 EFKDLISFMLKVDPKDRPDIHQVIAKVD 353
           E  DLI+ +L V+P +RP+I+ VI +V+
Sbjct: 266 ELLDLINALLVVNPAERPNINWVIQRVE 293



>gi|354548537|emb|CCE45274.1| hypothetical protein CPAR2_702870 [Candida parapsilosis]
          Length = 373

 Score =  228 bits (580), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 129/367 (35%), Positives = 206/367 (56%), Gaps = 24/367 (6%)

Query: 1   MSLVLSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYAL 60
           M+L+LS     L  + S     P++  N  ++ +++LLGEGGFSYV+LV  +S   + AL
Sbjct: 1   MNLLLSIFGSCLPCIPS--LSTPSIKFNNASYYIVRLLGEGGFSYVYLVHSSSQSPF-AL 57

Query: 61  KKIRCQFGS--DSVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIVYIFLPYY 115
           K+I C +G+  ++ K+A++E+  Y  F++     I++ ID  +V   +G + VYI LPY+
Sbjct: 58  KQINCPYGTQDETYKNAIREIKNYHRFANTKTPYIVQSIDESIVSSPDGVRHVYILLPYF 117

Query: 116 KSGLQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTY----RFPSVPLRSENGITNS 171
              +QD++  ++ N     E E+LKIF G+C  +R +H +    R  +V L  ++G    
Sbjct: 118 TKSVQDILTEHVLNGTKMDESEILKIFVGVCRGLRIMHNHKQVSRNTAVRLDDDDGDEEE 177

Query: 172 NLNGIEN---EMXXXXXXXXXXXXXEDG------VVPFAHRDIKPGNILLTDDADSQPIL 222
            L   E    ++              DG      +VP+AH DIKP N++++  A+  P+L
Sbjct: 178 ALLQDEEDDEQVAAAAAATVSTAPPADGATEMEELVPYAHHDIKPANVMIS--AEGLPVL 235

Query: 223 MDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCT 282
           +D GS  RAR  ++TR +AL   + A +H T+PYRAPEL DV T   + E  D+WSLGC 
Sbjct: 236 VDLGSCSRARYHVRTRQQALALTNFAQEHCTLPYRAPELLDVTTGSHITEATDVWSLGCL 295

Query: 283 LYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDR 342
           LY+  +G SPF+    EQG ++ +A+   +++  P   + YS E   LI   L+VD  DR
Sbjct: 296 LYSCCFGYSPFEKLEMEQGANLHVAIGQGRYQI-PKGNNGYSNEVIGLIKKCLQVDASDR 354

Query: 343 PDIHQVI 349
           P + Q++
Sbjct: 355 PTVDQLL 361



>gi|326433463|gb|EGD79033.1| NAK/MPSK protein kinase [Salpingoeca sp. ATCC 50818]
          Length = 313

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 127/341 (37%), Positives = 182/341 (53%), Gaps = 52/341 (15%)

Query: 24  TLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMKEVDMYR 83
           T+ +  R F + K L  GGFS V LV D  T   YA+K++ C   ++ V+ A  EV+ YR
Sbjct: 20  TVEVGSRRFSIRKRLATGGFSNVDLVCDVQTKDMYAMKRMLCTEKAE-VQRAKAEVEYYR 78

Query: 84  LFSHENIIKVIDTCVV-----QDKNGGKIVYIFLPYYKSGLQDVINNNLENNKYFSEKEM 138
           LF H NII+V+++ V+     Q     ++V +F  Y +  L D + +  E   Y  E E+
Sbjct: 79  LFDHPNIIQVVESGVLSLRRNQGAPSQEVVCVFPLYERGTLLDYVAHVHEQGGYLPEHEL 138

Query: 139 LKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVV 198
           L +F+GIC A+  +HT                                          V 
Sbjct: 139 LTLFKGICLALDQMHTR-----------------------------------------VE 157

Query: 199 PFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRA 258
           P  HRDIKPGN+LL  D    P+LMDFGS+ +  I + +R EA+ QQD+AS+ +T+P+R 
Sbjct: 158 PLCHRDIKPGNVLLARDGT--PVLMDFGSVEKGVIDVASRKEAIAQQDIASERTTLPFRP 215

Query: 259 PELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPT 318
           PEL DV +   L   +DIWSLGCTLY+MAY  +PF+ ++N QG S+ LA+   +  FP  
Sbjct: 216 PELVDVPSRCTLTTAIDIWSLGCTLYSMAYLDTPFE-HLNAQGASLPLAIAQGKVSFP-- 272

Query: 319 EQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
             D Y+   +DLI  M++VDP  RP I QV+ +    L+ L
Sbjct: 273 TNDPYTQRVRDLILSMIQVDPSQRPTIAQVLERTTEALQAL 313



>gi|307181418|gb|EFN69013.1| Serine/threonine-protein kinase 16 [Camponotus floridanus]
          Length = 318

 Score =  226 bits (575), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 191/350 (54%), Gaps = 57/350 (16%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ +N R ++V + LGEGGFS V LV+D  T + YA+KKI C +GS+  + AM+
Sbjct: 14  CICAKETITVNSRKYRVREHLGEGGFSTVLLVEDVVTHKKYAIKKIVC-YGSEDQQLAMR 72

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSGLQDVINNNLE----N 129
           E++ Y+L  H N+I+ ID+  +       N    V+I LPYY  G    + N LE    N
Sbjct: 73  EIEYYKLIKHPNVIECIDSTRIGTADPILNTTSEVFIVLPYYHKG---TVANELERRARN 129

Query: 130 NKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXX 189
             Y +  ++L IF  IC  V+A H  + P                               
Sbjct: 130 CDYMNPIDILSIFLQICEGVKAFHEIK-PE------------------------------ 158

Query: 190 XXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLAS 249
                    P AHRD+K  NI+L DD    PI+MD GS+  AR+++     A + QDLA+
Sbjct: 159 ---------PLAHRDLKTANIVLNDDG--TPIIMDLGSMATARVQVCGTQAARVLQDLAA 207

Query: 250 QHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVL 309
           +  +MPYRAPELF+V++   ++E+ DIWSLGC LYA+ Y  SPFD  + E+G S+ALAV+
Sbjct: 208 ERCSMPYRAPELFNVESYSMVDERTDIWSLGCILYALCYFKSPFD-TVYERGDSVALAVM 266

Query: 310 NAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +A   FP  E   Y+ + +DLI  MLKV+P +RP I+ VI  V   + +L
Sbjct: 267 SAHVTFP--ENTPYNEDMQDLILSMLKVNPMERPYIYSVIESVHDTIAKL 314



>gi|330799302|ref|XP_003287685.1| hypothetical protein DICPUDRAFT_78515 [Dictyostelium purpureum]
 gi|325082305|gb|EGC35791.1| hypothetical protein DICPUDRAFT_78515 [Dictyostelium purpureum]
          Length = 311

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 137/354 (38%), Positives = 198/354 (55%), Gaps = 57/354 (16%)

Query: 16  TSCCFP-NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKD 74
            S C+P + T  +N   + V ++LGEGGFS+V+LV+D S  R YALK + CQ  ++S+  
Sbjct: 3   ASLCYPSDKTYSVNGAKYTVNRVLGEGGFSFVYLVKD-SNSRKYALKVMICQ-TNESINT 60

Query: 75  AMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNN-LENNKY 132
           A +E+++++ F+H NI+K++D    Q    GK   + LPYYK G LQD+I+N  + + K+
Sbjct: 61  AKREINIFKTFNHPNIMKLVDHSSSQYSQDGKQYLLLLPYYKDGSLQDLIDNQRIVHGKH 120

Query: 133 -----FSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXX 187
                F EK +L  F+ IC A++  HT+                                
Sbjct: 121 TTKPLFDEKTLLIFFKKICEAIQVFHTHE------------------------------- 149

Query: 188 XXXXXXEDGVVPFAHRDIKPGNILLTDDADS--QPILMDFGSLVRARIKIQTRNEALMQQ 245
                      P AHRDIKPGNILL +  D    PIL DFGS+  ARIKI  R EAL  Q
Sbjct: 150 ----------PPLAHRDIKPGNILLANSNDGILNPILTDFGSVKEARIKISNRKEALSFQ 199

Query: 246 DLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIA 305
           D   Q++T  Y+APELFD+ ++  ++E++D+WSLGC LY  AY  SPF+ + +E  GS+A
Sbjct: 200 DEVEQNTTPFYKAPELFDIASDCVIDERIDVWSLGCLLYTAAYNRSPFEVSDDEPSGSVA 259

Query: 306 LAVLNA-QFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQ 358
           L VL+     FP T    YS EF  LI  M+ ++  DR  I+Q+I +++  L +
Sbjct: 260 LKVLSGLPSPFPST---NYSNEFNQLIRNMVNLNKDDRLHINQIITEIENILSK 310



>gi|307205079|gb|EFN83550.1| Serine/threonine-protein kinase 16 [Harpegnathos saltator]
          Length = 307

 Score =  224 bits (570), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 133/349 (38%), Positives = 186/349 (53%), Gaps = 51/349 (14%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ +N R + + + LGEGGFS V L +DT+T + YA+KKI C  G +  + AMK
Sbjct: 3   CICAKETVTVNSRKYTIREHLGEGGFSTVFLAEDTATHKKYAIKKIICH-GPEDQQLAMK 61

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-LQDVINNNLENNKY 132
           EV+ Y+   H N+IK ID+          N    V I LPYY  G L D +    +NN Y
Sbjct: 62  EVEYYKQIKHPNVIKCIDSAREGAADPIVNTTSEVLIVLPYYHRGTLADELEQRAKNNDY 121

Query: 133 FSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXX 192
            S  ++L IF  IC  V+A H                                       
Sbjct: 122 MSPVDILNIFLQICEGVKAFH--------------------------------------- 142

Query: 193 XEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHS 252
            E    P AHRD+K  NI+L+DD    P++MD GS+  AR+++     A   QDLA++  
Sbjct: 143 -EAKPEPLAHRDLKTANIVLSDDG--TPVIMDLGSVTTARVQVCGTQAARTLQDLAAERC 199

Query: 253 TMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQ 312
           +MPYRAPELF+V++   ++E+ DIWSLGCTLYA+ Y  SPFD  + E+G S+ALAV++A 
Sbjct: 200 SMPYRAPELFNVESYCMVDERTDIWSLGCTLYALCYFKSPFD-TVYERGDSVALAVISAH 258

Query: 313 FRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLSS 361
             FP  E   Y+ + + LI  MLKV+  +RP I+ VI  +   + +L S
Sbjct: 259 VTFP--EGAPYNEDMQSLILSMLKVNSMERPYIYSVIENIHDAIAKLES 305



>gi|470250690|ref|XP_004358442.1| putative protein serine/threonine kinase [Dictyostelium
           fasciculatum]
 gi|328872225|gb|EGG20592.1| putative protein serine/threonine kinase [Dictyostelium
           fasciculatum]
          Length = 305

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 136/341 (39%), Positives = 194/341 (56%), Gaps = 58/341 (17%)

Query: 19  CFPNP-TLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C P+  + +IN + +   +LLGEGGFS+V+LV+D+S G+ YALK + CQ   +S+  A K
Sbjct: 6   CHPSERSYNINGKRYTCSRLLGEGGFSFVYLVKDSS-GKKYALKSMLCQ-TPESLNVANK 63

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDK--NGGKIVYIFLPYYKSG-LQDVINNNLENN---- 130
           EV++ R  +H NIIKVID+  +     +  K V I LP+ K G LQDV++     N    
Sbjct: 64  EVNLLRQLNHPNIIKVIDSDTINSVQLDYAKEVLILLPFCKEGTLQDVLDKQRTVNGKSC 123

Query: 131 --KYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXX 188
               F++ E++ IF+ +C AV  LH+ + P+                             
Sbjct: 124 MISVFTQAEIINIFQQLCQAVLVLHSLQ-PT----------------------------- 153

Query: 189 XXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLA 248
                     P AHRD+KPGNILL +  +++PIL+DFGS+  ARI ++TR  AL  Q+ A
Sbjct: 154 ----------PLAHRDLKPGNILL-EGENNKPILLDFGSVSEARINVETRKRALEVQEDA 202

Query: 249 SQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAV 308
            QHST  YRAPELFDV TN  ++E+ D+W+LGC LYAMA+  SPF+    ++  S+AL V
Sbjct: 203 EQHSTPMYRAPELFDVATNCTIDERTDVWALGCILYAMAFNKSPFE---ADESSSVALKV 259

Query: 309 LNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
           ++ Q   PP    KYS  F  LI  ML     +RP I+Q++
Sbjct: 260 VSGQIEIPPNH--KYSQPFIQLIHKMLSHSISNRPFINQIL 298



>gi|380021181|ref|XP_003694450.1| PREDICTED: serine/threonine-protein kinase 16-like [Apis florea]
          Length = 318

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 137/362 (37%), Positives = 191/362 (52%), Gaps = 51/362 (14%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           ++S+  +L     C     T+ +N R + V + LGEGGFS V LV+DT T + YA+KKI 
Sbjct: 1   MNSLGLSLILKMGCICSKETITVNSRNYTVREHLGEGGFSIVLLVEDTITHKKYAIKKII 60

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTC----VVQDKNGGKIVYIFLPYYKSG-L 119
           C  G +  + A KE++ Y L  H N+I+ ID+     +    N    V I LPYY  G L
Sbjct: 61  CH-GLEDQRLAAKEIEYYNLVKHPNVIECIDSTYKGTIDPIINATSEVLIILPYYHRGTL 119

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENE 179
            + +    +N  +    ++L IF  IC  V+A H                          
Sbjct: 120 ANELERRAKNKNHMGALDILNIFLQICEGVKAFH-------------------------- 153

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
                         E    P AHRD+K  NILL D   S PI+MD GS+  ARIKI    
Sbjct: 154 --------------EAKPEPLAHRDLKTANILLDDG--SIPIIMDLGSVAPARIKICGSQ 197

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
            A   QDLA++  +MPYRAPELF+V++   ++E+ DIWSLGC LYA+ Y  SPFD  + E
Sbjct: 198 AAQTLQDLAAERCSMPYRAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-TVYE 256

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +G S+ALAV++A   FP  E   Y+ + ++LI  MLKV+P +RP I+ VI KV   + +L
Sbjct: 257 RGDSVALAVMSANIIFP--EDAPYTEDIQNLILLMLKVNPMERPYIYSVIEKVHDIISKL 314

Query: 360 SS 361
            +
Sbjct: 315 EN 316



>gi|336383935|gb|EGO25084.1| protein kinase [Serpula lacrymans var. lacrymans S7.9]
          Length = 422

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 104/163 (63%), Positives = 130/163 (79%), Gaps = 5/163 (3%)

Query: 198 VPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYR 257
           VP+AHRD+KPGN+++ DD  + PILMDFGS +RARI I+ R++AL+QQD+A++ STM YR
Sbjct: 263 VPYAHRDLKPGNVMIADDGVT-PILMDFGSTIRARINIENRSQALLQQDIAAEQSTMAYR 321

Query: 258 APELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRFP 316
           APELFDVKT V L++KVDIWSLGCTL+A+AY  SPF+N    EQGGSIA+AVLNAQ++ P
Sbjct: 322 APELFDVKTGVALDDKVDIWSLGCTLFALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP 381

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            +    YS   KDLI  MLKV+PKDRPDIHQVI+  D  L+ L
Sbjct: 382 NS---AYSQGLKDLIDSMLKVNPKDRPDIHQVISMTDRVLQTL 421



 Score =  183 bits (464), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 116/151 (76%), Gaps = 3/151 (1%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D ++A+TSC C  +  + IN RTF +IK+LGEGGFS+V+L QD  +GR +ALKKIRC 
Sbjct: 17  AKDAVWALTSCMCQQSAKVKINGRTFNIIKVLGEGGFSFVYLAQDDISGRQFALKKIRCP 76

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            GSD+VK+AM+EV+ YR F H NII+++D+ VVQD  G GKIVY+FLP YK G LQD IN
Sbjct: 77  TGSDAVKEAMREVEAYRRFKHPNIIRILDSAVVQDPEGEGKIVYLFLPLYKRGNLQDAIN 136

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTY 155
            ++ N  +F+E+EM+++F+G C AVRA+H Y
Sbjct: 137 THVVNRTHFAEQEMIRLFKGTCEAVRAMHDY 167



>gi|392594915|gb|EIW84239.1| other/NAK protein kinase [Coniophora puteana RWD-64-598 SS2]
          Length = 425

 Score =  217 bits (552), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 132/164 (80%), Gaps = 5/164 (3%)

Query: 198 VPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYR 257
           VP+AHRD+KPGN++++DD  + PILMDFGS ++AR++I+ R++AL+QQD+A++ STM YR
Sbjct: 266 VPYAHRDLKPGNVMISDDGIT-PILMDFGSCMKARVRIENRSQALLQQDIAAEQSTMAYR 324

Query: 258 APELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRFP 316
           APELFDVKT V L+EKVDIWSLGCTL+A+AY  SPF+N    EQGGSIA+AVLNA+++ P
Sbjct: 325 APELFDVKTGVTLDEKVDIWSLGCTLFALAYSHSPFENMQTTEQGGSIAMAVLNAKYKHP 384

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
              Q  YS   +DLI  MLKVDPKDRPDIHQV+   D  L+ L+
Sbjct: 385 ---QSAYSQGLRDLIDSMLKVDPKDRPDIHQVLDMTDKVLQTLA 425



 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/152 (55%), Positives = 117/152 (76%), Gaps = 3/152 (1%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D L+A++SC C  +  + IN R+F +IK+LGEGGFS+V+L QD S+GR +ALKKIRC 
Sbjct: 18  AKDALWALSSCMCQQSAKVKINGRSFNIIKVLGEGGFSFVYLAQDESSGRQFALKKIRCP 77

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            GSD+VK+AM+EV+ YR F H NII+++D+ VVQD  G GKIVY+FLP YK G LQD IN
Sbjct: 78  TGSDAVKEAMREVEAYRRFKHPNIIRILDSAVVQDPEGDGKIVYLFLPLYKRGNLQDAIN 137

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYR 156
            N+ N  +F E++M+++F+G C A+RALH Y+
Sbjct: 138 ANVVNGSHFPEQDMVRLFKGTCEALRALHNYQ 169



>gi|350398408|ref|XP_003485183.1| PREDICTED: serine/threonine-protein kinase 16-like isoform 1
           [Bombus impatiens]
          Length = 318

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 138/360 (38%), Positives = 189/360 (52%), Gaps = 51/360 (14%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           ++S+  +L     C     T+ IN R + V + LGEGGFS V LV+D  T + YA+KKI 
Sbjct: 1   MNSLGLSLILKMGCICSKDTITINSRKYTVREHLGEGGFSTVLLVEDIMTHKKYAIKKII 60

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-L 119
           C  G +  + A KE++ Y L  H NII+ ID+          N    V I LPYY  G L
Sbjct: 61  CH-GLEDQRLAAKEIEYYNLVKHPNIIECIDSTYKGTADPIANATSEVLIVLPYYHRGTL 119

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENE 179
            + +     N  Y S  ++L IF  IC  V+A H                          
Sbjct: 120 ANELERRARNKDYMSAIDILNIFLQICEGVKAFH-------------------------- 153

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
                         E    P AHRD+K  NI+L DD ++ PILMD GS+  AR+KI    
Sbjct: 154 --------------ETTPEPLAHRDLKTANIVL-DDGNT-PILMDLGSVAPARVKICGSQ 197

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
            A   QDLA++  +MPY+APELF+V++   ++E+ DIWSLGC LYA+ Y  SPFD  + E
Sbjct: 198 AAQSLQDLAAERCSMPYKAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-AVYE 256

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +G S+ALAV++A   FP  E   Y+ E ++LI  MLKV+P +RP I+ VI  V   + +L
Sbjct: 257 RGDSVALAVMSANITFP--EDAPYTEEMQNLILSMLKVNPMERPYIYSVIENVQDYISKL 314



>gi|336370516|gb|EGN98856.1| hypothetical protein SERLA73DRAFT_181545 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 439

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 104/163 (63%), Positives = 130/163 (79%), Gaps = 5/163 (3%)

Query: 198 VPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYR 257
           VP+AHRD+KPGN+++ DD  + PILMDFGS +RARI I+ R++AL+QQD+A++ STM YR
Sbjct: 280 VPYAHRDLKPGNVMIADDGVT-PILMDFGSTIRARINIENRSQALLQQDIAAEQSTMAYR 338

Query: 258 APELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRFP 316
           APELFDVKT V L++KVDIWSLGCTL+A+AY  SPF+N    EQGGSIA+AVLNAQ++ P
Sbjct: 339 APELFDVKTGVALDDKVDIWSLGCTLFALAYSHSPFENTQTTEQGGSIAMAVLNAQYKHP 398

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            +    YS   KDLI  MLKV+PKDRPDIHQVI+  D  L+ L
Sbjct: 399 NS---AYSQGLKDLIDSMLKVNPKDRPDIHQVISMTDRVLQTL 438



 Score =  174 bits (440), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 115/168 (68%), Gaps = 20/168 (11%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D ++A+TSC C  +  + IN RTF +IK+LGEGGFS+V+L QD  +GR +ALKKIRC 
Sbjct: 17  AKDAVWALTSCMCQQSAKVKINGRTFNIIKVLGEGGFSFVYLAQDDISGRQFALKKIRCP 76

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYK--------- 116
            GSD+VK+AM+EV+ YR F H NII+++D+ VVQD  G GKIVY+FLP YK         
Sbjct: 77  TGSDAVKEAMREVEAYRRFKHPNIIRILDSAVVQDPEGEGKIVYLFLPLYKVRLFFGIRP 136

Query: 117 ---------SGLQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTY 155
                      LQD IN ++ N  +F+E+EM+++F+G C AVRA+H Y
Sbjct: 137 RKGNNSPQRGNLQDAINTHVVNRTHFAEQEMIRLFKGTCEAVRAMHDY 184



>gi|149235514|ref|XP_001523635.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452614|gb|EDK46870.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 411

 Score =  216 bits (550), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 127/392 (32%), Positives = 201/392 (51%), Gaps = 62/392 (15%)

Query: 19  CFPN---PTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRY------------------ 57
           CFP+   P++ IN   +K+IKLLGEGGFSYV+LV  + +                     
Sbjct: 14  CFPDLSIPSVWINNDKYKIIKLLGEGGFSYVYLVHGSYSAAGASTTTTTLHSSSSPSSSS 73

Query: 58  ----YALKKIRCQFG--SDSVKDAMKEVDMYRLFSHEN---IIKVIDTCVVQDKNGGKIV 108
               YALK+I C FG   ++ K+AM+E+  Y  F+      II+ ID  +V + +G   +
Sbjct: 74  SSSPYALKRINCPFGVQDETYKNAMREIKNYHRFTASKTPYIIQSIDESIVTNPDGLGQI 133

Query: 109 YIFLPYYKSGLQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGI 168
            I LPY++  LQD+IN ++ +N    E ++L+ F GIC  +  +H Y+         NG 
Sbjct: 134 NILLPYFERSLQDIINEHVLSNTKMDEGDILRTFIGICRGLEVMHNYKSHKAVTNEING- 192

Query: 169 TNSNL----------------NGIENEMXXXXXXXXXXXXXED--GV----------VPF 200
            NSN+                +G E+ +             +D  G+          +P+
Sbjct: 193 GNSNISRNEEAEEEEAALLPHDGEEDAVGVEPDSNSNNIDGDDSNGILLLLLLLLTKIPY 252

Query: 201 AHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPE 260
           AH D+KP N++ +  +   P+L+D GS  +ARI + TR +AL   D A +H T+PYRAPE
Sbjct: 253 AHHDLKPANVMFS--SSGLPVLVDLGSCSKARIHVTTRQQALTVTDFAQEHCTLPYRAPE 310

Query: 261 LFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQ 320
           L DV T  ++ E  DIWSLGC LY   +G SPF+    +QG ++ +A++  ++   P ++
Sbjct: 311 LMDVSTGAKITEATDIWSLGCLLYCCCFGYSPFEKLEIQQGANLNIAIVQGKYEI-PEDR 369

Query: 321 DKYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
             YS E  ++I   L+V  + RP   +++ + 
Sbjct: 370 AGYSEELVEMIRKCLQVKAEKRPSAAELVEEA 401



>gi|332348546|gb|AEE60827.1| serine/threonine kinase [Haemaphysalis longicornis]
          Length = 307

 Score =  216 bits (550), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 127/344 (36%), Positives = 184/344 (53%), Gaps = 51/344 (14%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C      + IN + + V   LGEGGFS V LV D S  R YALK+I C    +S +DAM+
Sbjct: 3   CTCTKEAVCINGKRYVVKTRLGEGGFSVVDLVYDASKQRLYALKRIPCH-THESERDAMR 61

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKI----VYIFLPYYKSG-LQDVINNNLENNKY 132
           E ++Y+ F H N+++ +D  +V   +  K       I LPY++ G LQD +     +  +
Sbjct: 62  EAELYKSFDHPNLVRCVDAALVPCHDLSKPFSSEALILLPYFRRGTLQDELTMRARSRDH 121

Query: 133 FSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXX 192
            +E  +L++F G+C  V+A+H+    ++P                               
Sbjct: 122 MAETRLLELFLGMCQGVQAIHS----AMP------------------------------- 146

Query: 193 XEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHS 252
                +  AHRD+KP N+LL +D    P+ MDFGS+ RAR+ I   +EA+  QDLA++  
Sbjct: 147 -----IALAHRDLKPANVLLGED--DVPVWMDFGSMGRARLDIGRTSEAMALQDLATEKC 199

Query: 253 TMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQ 312
           +M YRAPELF+V++   ++E+VDIWSLGC LYAM +  SPF+    E+G S+ALAVL+  
Sbjct: 200 SMSYRAPELFNVESRTSIDERVDIWSLGCCLYAMCFFRSPFEAA-RERGDSVALAVLSGH 258

Query: 313 FRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL 356
              P  E   YS     LI  ML+VD   RP I  V+ +V   L
Sbjct: 259 VDIP--EDSPYSGGLHTLIRTMLEVDCLQRPFIETVLDQVTALL 300



>gi|393221439|gb|EJD06924.1| other/NAK protein kinase [Fomitiporia mediterranea MF3/22]
          Length = 439

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 125/165 (75%), Gaps = 5/165 (3%)

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
           VVP+AHRD+KPGN+++ DD    PILMDFGS +RARIKI+TR +AL+QQD+A++ STM Y
Sbjct: 279 VVPYAHRDLKPGNVMVADDG--SPILMDFGSAIRARIKIETRQQALLQQDIAAEQSTMAY 336

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRF 315
           RAPELFDVKT V L+EKVDIWSLGCTLYA+AY  SPF+     EQGGSIA+AV+NA ++ 
Sbjct: 337 RAPELFDVKTGVTLDEKVDIWSLGCTLYALAYLHSPFETLATTEQGGSIAMAVMNAAYKH 396

Query: 316 PPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
           P      YS   +DLI  MLK DP  RPDIHQVI + D  L  LS
Sbjct: 397 P--RDSAYSQGLRDLIDSMLKADPTQRPDIHQVIEQTDAVLRSLS 439



 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 119/152 (78%), Gaps = 3/152 (1%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D LYA+TSC C P+  + IN RTFK++K+LGEGGFS+V+LVQD  +GR +ALKKIRC 
Sbjct: 18  AKDALYALTSCLCHPSAKVKINGRTFKILKVLGEGGFSFVYLVQDEDSGRQFALKKIRCP 77

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            GS+ VK+AM+EV+ YR F H NII+++D+ VVQD +G GKIVY+FLP YK G LQD IN
Sbjct: 78  TGSEGVKEAMREVEAYRRFKHPNIIRILDSAVVQDADGEGKIVYLFLPLYKRGNLQDAIN 137

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYR 156
            +L N   FSE EML++FRG C AVRA+HT+R
Sbjct: 138 AHLINGTGFSEAEMLRLFRGTCEAVRAMHTFR 169



>gi|291392273|ref|XP_002712533.1| PREDICTED: serine/threonine kinase 16 [Oryctolagus cuniculus]
          Length = 305

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 117/338 (34%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  +DA +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EDAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ ++++     ++ LP++K G L   I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERDAKHEAWLLLPFFKRGTLWAEIERLKDKGSFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           E+L++  GIC  + A+H                                           
Sbjct: 124 EILRLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++SP  + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSPALRQLLASMMTVDPQQRPHIPLLLSQLEA 292



>gi|390354882|ref|XP_796127.2| PREDICTED: serine/threonine-protein kinase 16-like
           [Strongylocentrotus purpuratus]
          Length = 294

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 188/337 (55%), Gaps = 47/337 (13%)

Query: 17  SCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAM 76
            C      + +  R F V+K LGEGGFS V  V+D   G  +ALK+I+C  G++  + A 
Sbjct: 2   GCTCTKDRVTVGGRRFYVMKRLGEGGFSVVDQVED-EVGEKFALKRIQCH-GAEDDRQAK 59

Query: 77  KEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSE 135
           KE + +  F H+N+I + +   V+ K G   + + LP +K G LQD ++    + +  +E
Sbjct: 60  KEAEYHCQFKHKNLIGLEEWGSVKGKEGVTEILLVLPLFKRGTLQDELDKMKADGRCMAE 119

Query: 136 KEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXED 195
           + + +IF+G+C  ++ALHT + P                                     
Sbjct: 120 ERIWRIFKGVCEGIKALHTAK-PK------------------------------------ 142

Query: 196 GVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMP 255
              P AHRD+KPGN++L +D    P++MDFGS+  ARI+++ R+EA   QDLA++  +M 
Sbjct: 143 ---PLAHRDMKPGNVMLAED--DTPVIMDFGSMGEARIEVKGRSEACALQDLAAEKCSML 197

Query: 256 YRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRF 315
           +RAPELF V ++  + EKVDIWSLGC L+ MAY  SPF+  I  +G SI LAVL   F+F
Sbjct: 198 FRAPELFHVDSHCIVEEKVDIWSLGCVLFNMAYLHSPFE-PIYARGDSIHLAVLGRNFKF 256

Query: 316 PPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
           P   ++  S     LI+ ML+VD  +RP I++++ K+
Sbjct: 257 PENSRES-SGLLNQLITEMLQVDANERPSINEILEKL 292



>gi|444514915|gb|ELV10670.1| Serine/threonine-protein kinase 16 [Tupaia chinensis]
          Length = 305

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 188/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEHQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGAKHEAWLLLPFFKKGTLWEEIERLKDKGSFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+HT                                          
Sbjct: 124 QILQLLLGICRGLEAIHTK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+  A I +++  +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNEACIHVESSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  +YS   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRYSSALRQLLASMMTVDPQQRPHIPLLLSQLEA 292



>gi|401842929|gb|EJT44928.1| ENV7-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 364

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/360 (34%), Positives = 191/360 (53%), Gaps = 31/360 (8%)

Query: 5   LSSVRDTLYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ----------DT 52
           +SS+   L+    CC  F + T+ +N R +K+ +LLGEGG S+V+LVQ            
Sbjct: 1   MSSIVFELFQYLCCCRGFSDTTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSA 60

Query: 53  STGRYYALKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFL 112
           +T   YALKKI C    +++ + M+E++ Y+ F    +I+ ID+ V+Q+K+G K +YI L
Sbjct: 61  ATAELYALKKIICP-SVENISNGMREIENYKRFQSPYVIQSIDSQVMQEKDGSKTIYIIL 119

Query: 113 PYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNS 171
           PYY  G LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  T +
Sbjct: 120 PYYSLGSLQDSINRRLLEGTFISEAECVRIMLGVTRGLLCLHD---PAS--RQDNVTTRT 174

Query: 172 NLNGIENEMXXXXXXXXXXXXXE--------DGVVPFAHRDIKPGNILLTDDADSQPILM 223
            ++ I                 E         G++ +AHRDI P NIL +  +D  P++ 
Sbjct: 175 TVDTISMTYSDETAMLLEDTPLEMDMLSSSSAGLIAYAHRDITPSNILFS--SDGLPVIG 232

Query: 224 DFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTL 283
           D GS  +A I I  RN+    Q+  + + T+PY APEL ++K N  L+ KVDIWS+GCT 
Sbjct: 233 DLGSCSQADITIGNRNQLSELQEWVNDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTF 292

Query: 284 YAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           Y + +G SPF+      G S+  A+   ++ FP     ++S    D+I   ++VDP  RP
Sbjct: 293 YTLMFGISPFEREEQIHGASLTYAINTGKYSFP--RNSRFSERLLDVIKRCIQVDPIQRP 350



>gi|365758136|gb|EHM99994.1| YPL236C-like protein [Saccharomyces cerevisiae x Saccharomyces
           kudriavzevii VIN7]
          Length = 364

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/360 (34%), Positives = 191/360 (53%), Gaps = 31/360 (8%)

Query: 5   LSSVRDTLYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ----------DT 52
           +SS+   L+    CC  F + T+ +N R +K+ +LLGEGG S+V+LVQ            
Sbjct: 1   MSSIVFELFQYLCCCRGFSDTTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSV 60

Query: 53  STGRYYALKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFL 112
           +T   YALKKI C    +++ + M+E++ Y+ F    +I+ ID+ V+Q+K+G K +YI L
Sbjct: 61  ATAELYALKKIICP-SVENISNGMREIENYKRFQSPYVIQSIDSQVMQEKDGSKTIYIIL 119

Query: 113 PYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNS 171
           PYY  G LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  T +
Sbjct: 120 PYYSLGSLQDSINRRLLEGTFISEAECVRIMLGVTRGLLCLHD---PAS--RQDNVTTRT 174

Query: 172 NLNGIENEMXXXXXXXXXXXXXE--------DGVVPFAHRDIKPGNILLTDDADSQPILM 223
            ++ I                 E         G++ +AHRDI P NIL +  +D  P++ 
Sbjct: 175 TVDTISMTYSDETAMLLEDTPLEMDMLSSSSAGLIAYAHRDITPSNILFS--SDGLPVIG 232

Query: 224 DFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTL 283
           D GS  +A I I  RN+    Q+  + + T+PY APEL ++K N  L+ KVDIWS+GCT 
Sbjct: 233 DLGSCSQADITIGNRNQLSELQEWVNDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTF 292

Query: 284 YAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           Y + +G SPF+      G S+  A+   ++ FP     ++S    D+I   ++VDP  RP
Sbjct: 293 YTLMFGISPFEREEQIHGASLTYAINTGKYSFP--RNSRFSERLLDVIKRCIQVDPIQRP 350



>gi|254583071|ref|XP_002499267.1| ZYRO0E07876p [Zygosaccharomyces rouxii]
 gi|238942841|emb|CAR31012.1| ZYRO0E07876p [Zygosaccharomyces rouxii]
          Length = 369

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 181/341 (53%), Gaps = 28/341 (8%)

Query: 25  LHINRRTFKVIKLLGEGGFSYVHLVQD------TSTGR--YYALKKIRCQFGS-DSVKDA 75
           L IN R + + KLLGE  FS+++LVQ       +ST R   YALK+IRC FG+ +S+  A
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 76  MKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFS 134
           MKEVD Y+ F    II ++D+ V Q ++G K VYI LPY+  G LQD  + NL N  + S
Sbjct: 86  MKEVDNYKRFQSPYIIHLVDSQVAQQRDGSKTVYILLPYFPLGSLQDSTSRNLLNGTFIS 145

Query: 135 EKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXE 194
           E E ++I  GI   +R LH    PS   RS++       + +                 E
Sbjct: 146 EAECIRIVIGIARGLRCLHD---PSA--RSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLE 200

Query: 195 DGVVP---------FAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQ 245
             ++          +AHRDIKP NIL +  +D  P++ + GS  +A + I T  +    Q
Sbjct: 201 LDILSSANTINSNFYAHRDIKPSNILFS--SDGLPVISNLGSCSKADLSINTGMQLTELQ 258

Query: 246 DLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIA 305
              S H T+ Y APEL  +  N  ++ KVDIWSLGCT Y M +G SPF+      G S+ 
Sbjct: 259 AWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLK 318

Query: 306 LAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIH 346
            A+    F FP   QD+YS     LI+  L+V+P  RPDI+
Sbjct: 319 YAIGTGNFSFP--SQDRYSEGLLKLITKCLQVNPAARPDIN 357



>gi|402224919|gb|EJU04981.1| Pkinase-domain-containing protein, partial [Dacryopinax sp. DJM-731
           SS1]
          Length = 425

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 103/169 (60%), Positives = 129/169 (76%), Gaps = 4/169 (2%)

Query: 194 EDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHST 253
           +  VVP+AHRDIKPGNI++ DD  + PILMDFGS +RARI I+TR +AL+QQDLA++ ST
Sbjct: 260 QGAVVPYAHRDIKPGNIMVADDG-TTPILMDFGSAIRARIPIKTRQQALVQQDLAAEQST 318

Query: 254 MPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNIN-EQGGSIALAVLNAQ 312
           MPYRAPELFDVKTN  L E VDIWSLGCTL+A+AY  SPF+ N   EQGGS+A+AV+   
Sbjct: 319 MPYRAPELFDVKTNTTLTEAVDIWSLGCTLFALAYNHSPFETNATMEQGGSMAMAVMGGV 378

Query: 313 FRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLSS 361
           ++ PP  Q  YS  F++LI  MLKV P++RPDI+QVI   D  +  LS+
Sbjct: 379 YKHPPGYQ--YSQGFRNLIDAMLKVSPEERPDINQVIEMTDKVISTLSA 425



 Score =  186 bits (472), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 86/151 (56%), Positives = 116/151 (76%), Gaps = 3/151 (1%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D +YA++SC C    TL IN RTFK++K+LGEGGFS+V+L QD ++GR +ALKKIRC 
Sbjct: 18  AKDAIYALSSCICREQATLKINGRTFKLLKVLGEGGFSFVYLAQDETSGRMFALKKIRCP 77

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G++ V++AM+EV+ YR F H NII+++D+ VVQD++G G+IVY+FLPYYK G LQD IN
Sbjct: 78  TGAEGVREAMREVEAYRRFRHPNIIRILDSAVVQDRDGDGQIVYLFLPYYKRGNLQDQIN 137

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTY 155
           +N  N   FSE EM ++FRG C  VRA+H Y
Sbjct: 138 SNTINGTRFSELEMCRLFRGACLGVRAMHDY 168



>gi|409048755|gb|EKM58233.1| hypothetical protein PHACADRAFT_252405 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 348

 Score =  213 bits (543), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 100/164 (60%), Positives = 132/164 (80%), Gaps = 6/164 (3%)

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
           +VP+AHRD+KPGN+++ DD   +PILMDFGS  +ARIKI+ R++AL+QQD+A++ STM Y
Sbjct: 190 LVPYAHRDLKPGNVMVADDG--RPILMDFGSATKARIKIENRSQALLQQDIAAEQSTMAY 247

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRF 315
           RAPELFDVKT + L+EKVDIWSLGCTL+A+AY  SPF+N    EQGGSIA+AV+NAQ++ 
Sbjct: 248 RAPELFDVKTGITLDEKVDIWSLGCTLFALAYLHSPFENTQTTEQGGSIAMAVMNAQYKH 307

Query: 316 PPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           P ++   YS  FK+LI   LKV+P+DRPDIHQV+   D  L++L
Sbjct: 308 PSSQ---YSQGFKELIDSTLKVNPQDRPDIHQVVEMTDKLLQRL 348



 Score =  110 bits (275), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 70/99 (70%), Gaps = 3/99 (3%)

Query: 76  MKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVINNNLENNKYF 133
           M+EV+ YR F H NII+++D+ VVQD  G G++VY+FLP YK G LQD IN N  N  +F
Sbjct: 1   MREVEAYRRFKHPNIIRILDSAVVQDSAGDGQVVYLFLPLYKRGNLQDAINANSINGTHF 60

Query: 134 SEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSN 172
           SEKEML++F+G C AVRA+H YR P +  RS   ++  N
Sbjct: 61  SEKEMLRLFKGTCEAVRAMHDYRAP-IASRSNPRVSREN 98



>gi|504126101|ref|XP_004576867.1| PREDICTED: serine/threonine-protein kinase 16 [Ochotona princeps]
          Length = 305

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  +DA +
Sbjct: 6   CICSRGTVLIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EDAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ ++++     ++ LP++K G L   I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERDAKHEAWLLLPFFKRGTLWTEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++SP  + L++ M+ VDP+ RP +  ++++++ 
Sbjct: 257 --QSPRHSPALRQLLASMMTVDPQQRPHVPLLLSQLEA 292



>gi|409039036|gb|EKM48782.1| hypothetical protein PHACADRAFT_266143 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 348

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 131/164 (79%), Gaps = 6/164 (3%)

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
           +VP+AHRD+KPGN+++ DD   +PILMDFGS  +ARIKI+ R++AL+QQD+A++ STM Y
Sbjct: 190 LVPYAHRDLKPGNVMVADDG--RPILMDFGSATKARIKIENRSQALLQQDIAAEQSTMAY 247

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRF 315
           RAPELFDVKT + L+EKVDIWSLGCTL+A+AY  SPF+N    EQGGSIA+AV+NAQ++ 
Sbjct: 248 RAPELFDVKTGITLDEKVDIWSLGCTLFALAYSHSPFENTQTTEQGGSIAMAVMNAQYKH 307

Query: 316 PPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           P ++   YS   K+LI   LKV+P+DRPDIHQV+   D  L++L
Sbjct: 308 PSSQ---YSQGLKELIDSTLKVNPQDRPDIHQVVEMTDKLLQRL 348



 Score =  110 bits (275), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/99 (53%), Positives = 70/99 (70%), Gaps = 3/99 (3%)

Query: 76  MKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVINNNLENNKYF 133
           M+EV+ YR F H NII+++D+ VVQD  G G++VY+FLP YK G LQD IN N  N  +F
Sbjct: 1   MREVEAYRRFKHPNIIRILDSAVVQDSAGDGQVVYLFLPLYKRGNLQDAINANSINGTHF 60

Query: 134 SEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSN 172
           SEKEML++F+G C AVRA+H YR P +  RS   ++  N
Sbjct: 61  SEKEMLRLFKGTCEAVRAMHDYRAP-IASRSNPRVSREN 98



>gi|348556480|ref|XP_003464049.1| PREDICTED: serine/threonine-protein kinase 16-like [Cavia
           porcellus]
          Length = 305

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 117/338 (34%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQ-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ ++       ++ LP+YK G L   I    +   + SE 
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-KEWGSKHEAWLLLPFYKRGTLWSEIERLKDKGNFLSED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +ARI ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQARIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V++   ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSQCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLIIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP++RP I  ++++++ 
Sbjct: 257 --QSSRHSSAVRQLLASMMTVDPQERPHIPHLLSQLEA 292



>gi|507641572|ref|XP_004701680.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 16
           [Echinops telfairi]
          Length = 307

 Score =  213 bits (541), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 186/338 (55%), Gaps = 50/338 (14%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  +DA +
Sbjct: 6   CVCSRGTVTIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQD-CEDAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H N+++++  C+ +++   +  ++ LP++K G +   I    +   + +E+
Sbjct: 65  EADMHRLFHHPNVLRLVAYCM-RERGSKQEAWLLLPFFKRGTVWSEIERLKDKGSFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILLLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QPILMD GS+ +A I++++  +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPILMDLGSMNQASIQVESSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLNIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
           P+ +         L++ M+ VDP+ RP I  ++++V+ 
Sbjct: 257 PSPRXGEGAWSILLLASMMTVDPQQRPRIPALLSQVEA 294



>gi|409077712|gb|EKM78077.1| hypothetical protein AGABI1DRAFT_114902 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 430

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 130/168 (77%), Gaps = 5/168 (2%)

Query: 194 EDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHST 253
           E G+VP+AHRDIKPGN+++ DD +  PILMDFGS ++AR+ I+ R+ AL+QQD+A++ ST
Sbjct: 267 EVGIVPYAHRDIKPGNVMIADD-NVTPILMDFGSTMKARVHIENRSLALLQQDIAAEQST 325

Query: 254 MPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNN-INEQGGSIALAVLNAQ 312
           M YRAPELFDVKT   ++EKVDIWSLGCTLYA+AY  SPF+N    EQGGSIA+AVLNAQ
Sbjct: 326 MAYRAPELFDVKTGNTIDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVLNAQ 385

Query: 313 FRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
           ++ P +    YS   K LI  MLKV+PKDRPDIHQVI   +  L+ L+
Sbjct: 386 YKHPAS---AYSQGLKSLIDSMLKVNPKDRPDIHQVIEMTNRVLQSLA 430



 Score =  187 bits (475), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/183 (50%), Positives = 129/183 (70%), Gaps = 11/183 (6%)

Query: 8   VRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
            +D  +A++SC C   P++ IN RTFK+IK+LGEGGFS+V+L QD  +GR++ALKKIRC 
Sbjct: 18  AKDAFWALSSCLCQQTPSVKINGRTFKIIKVLGEGGFSFVYLAQDEYSGRHFALKKIRCP 77

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVIN 124
            G++ VK+AM+EV+ YR F H NII++ D+ VVQD  G G+IVY+FLP+YK G LQD IN
Sbjct: 78  TGAEGVKEAMREVEAYRRFKHPNIIRIFDSAVVQDPEGEGQIVYLFLPHYKRGNLQDAIN 137

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS-----VPLRSEN--GITNSNLNGIE 177
            N+ N ++F E+EM+  F+G C AVRA+H+Y  PS     +P  S    G ++SN  G  
Sbjct: 138 ANVVNGQHFREQEMVHFFKGTCEAVRAMHSYH-PSAGSAGLPPTSNGVAGASSSNARGNG 196

Query: 178 NEM 180
           N +
Sbjct: 197 NAI 199



>gi|512808907|ref|XP_004876210.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1
           [Heterocephalus glaber]
 gi|512808909|ref|XP_004876211.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2
           [Heterocephalus glaber]
 gi|512808911|ref|XP_004876212.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3
           [Heterocephalus glaber]
 gi|513006298|ref|XP_004864601.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1
           [Heterocephalus glaber]
 gi|513006300|ref|XP_004864602.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2
           [Heterocephalus glaber]
 gi|513006302|ref|XP_004864603.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3
           [Heterocephalus glaber]
 gi|351694641|gb|EHA97559.1| Serine/threonine-protein kinase 16 [Heterocephalus glaber]
          Length = 305

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 186/339 (54%), Gaps = 52/339 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQ-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+ LF H NI++++  C+ +++      ++ LP+YK G L + I    +   + +E 
Sbjct: 65  EADMHHLFYHPNILRLVAYCL-KERGAKHEAWLLLPFYKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +ARI ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQARIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLVIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQ 355
             +  ++S   + L++ M+ VDP+ RP I  ++++++ Q
Sbjct: 257 --QSSRHSSAMRQLLASMMTVDPQQRPHIPLLLSQLEAQ 293



>gi|344268508|ref|XP_003406100.1| PREDICTED: serine/threonine-protein kinase 16-like [Loxodonta
           africana]
          Length = 305

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 117/338 (34%), Positives = 185/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVVIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI+ ++  C+ +D+      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILHLVAYCM-RDRGSKHEAWLLLPFFKRGTLWNEIERLKDRGSFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILLLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +ARI ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQARIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDEQTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++V+ 
Sbjct: 257 --QSSRHSSALRQLVASMMTVDPQQRPLIPVLLSQVEA 292



>gi|334347165|ref|XP_003341897.1| PREDICTED: serine/threonine-protein kinase 16-like [Monodelphis
           domestica]
          Length = 305

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/330 (36%), Positives = 180/330 (54%), Gaps = 54/330 (16%)

Query: 16  TSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDA 75
           T C     TL I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A
Sbjct: 4   TLCICSRGTLTIDNKRYLFIQKLGEGGFSYVDLVEGLQDGHFYALKRILCHEQQDQ-EEA 62

Query: 76  MKEVDMYRLFSHENIIKVIDTCVVQDKNGGKI-VYIFLPYYKSG-LQDVINNNLENNKYF 133
            +E DM+RLF H NI+++   C+ +   G K   ++ LP++K G L + +    +   + 
Sbjct: 63  QREADMHRLFQHPNILRLEAYCLTE--RGSKCEAWLLLPFFKRGTLWNEVEGLKDKGSFL 120

Query: 134 SEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXX 193
            E ++L +  GIC  + A+H                                        
Sbjct: 121 PEDQILLLLLGICRGLEAIHAK-------------------------------------- 142

Query: 194 EDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHST 253
                 FAHRD+KP NILL DD   QP+LMD GS+ +ARI+++   +AL  QD A+Q  T
Sbjct: 143 -----GFAHRDLKPTNILLGDDG--QPVLMDLGSMNQARIQVEGSRQALALQDWAAQRCT 195

Query: 254 MPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQF 313
           + YRAPELF V+++  ++E+ D+WSLGC L+AM +G  P+D  + ++G S+ALAV N Q 
Sbjct: 196 ISYRAPELFSVQSHCVIDERTDVWSLGCVLFAMMFGEGPYD-MVFQKGDSVALAVQN-QL 253

Query: 314 RFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
             P  +  ++SP  + L++ M+ VDP+ RP
Sbjct: 254 SIP--QNPRHSPALRQLLASMMTVDPQCRP 281



>gi|472366526|ref|XP_004402801.1| PREDICTED: serine/threonine-protein kinase 16 [Odobenus rosmarus
           divergens]
          Length = 305

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++ +C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFRHPNILRLVASCL-RERGTKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAR----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              FAHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GFAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLTSMMTVDPQQRPPISVLLSRLEA 292



>gi|410969478|ref|XP_003991222.1| PREDICTED: serine/threonine-protein kinase 16 isoform 1 [Felis
           catus]
 gi|410969480|ref|XP_003991223.1| PREDICTED: serine/threonine-protein kinase 16 isoform 2 [Felis
           catus]
          Length = 305

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAR----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
            +   ++S   + L++ M+ VDP+ RP IH ++++++ 
Sbjct: 257 HSP--RHSSALRQLLASMMTVDPQQRPPIHLLLSQLEA 292



>gi|471376801|ref|XP_004376394.1| PREDICTED: serine/threonine-protein kinase 16 [Trichechus manatus
           latirostris]
          Length = 305

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 186/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CICSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILRLVAYCM-RERGSKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILLLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +ARI ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQARIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDEQTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP +  ++++V+ 
Sbjct: 257 --QSSRHSSALRQLLASMMTVDPQQRPHVPVLLSQVEA 292



>gi|367009434|ref|XP_003679218.1| hypothetical protein TDEL_0A06750 [Torulaspora delbrueckii]
 gi|359746875|emb|CCE90007.1| hypothetical protein TDEL_0A06750 [Torulaspora delbrueckii]
          Length = 372

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/348 (35%), Positives = 187/348 (53%), Gaps = 33/348 (9%)

Query: 25  LHINRRTFKVIKLLGEGGFSYVHLVQ----DTSTG--------RYYALKKIRCQFGS-DS 71
           + IN R + + +LLGEG  S+V+LVQ     T+TG          YALK+IRC FG+ +S
Sbjct: 26  VSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIES 85

Query: 72  VKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENN 130
           +  AMKEVD Y+ F    II ++D+ VVQ+K+G K + I LPY+  G LQD++N NL   
Sbjct: 86  ISAAMKEVDNYKRFQSPYIITLVDSQVVQEKDGSKTLCILLPYFPLGSLQDMVNRNLLKG 145

Query: 131 KYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXX 190
            + SE E ++I  GI   +R LH       P   E     +  + +              
Sbjct: 146 TFVSEAECIRIMIGIARGLRCLHD------PSARETSDAETMRDTVSLSYSDEAAFLLDD 199

Query: 191 XXXEDGVVP---------FAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEA 241
              E  V+          + HRDI+  NIL +  ++  P++ D GS  +A I + T+++ 
Sbjct: 200 TPLELDVLSSHNTVNTRSYVHRDIRLANILFS--SEGLPVVSDLGSCCKADITVSTKHQL 257

Query: 242 LMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQG 301
              QD  + + + PY APEL +VK N  ++ K DIWS+GCT YAM +G SPF+  +   G
Sbjct: 258 NELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSG 317

Query: 302 GSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
            S+  A+   ++ FP  +Q +YS     +I   L+VDP  RPDI++++
Sbjct: 318 ASLTYAIGCGKYTFP--KQTRYSESLLAVIKSCLQVDPTARPDINELL 363



>gi|395823407|ref|XP_003784978.1| PREDICTED: serine/threonine-protein kinase 16 [Otolemur garnettii]
          Length = 305

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 122/343 (35%), Positives = 187/343 (54%), Gaps = 56/343 (16%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QPILMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPILMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
             E  ++S   + L++ M+ VDP+ RP I  +I    TQLE L
Sbjct: 257 --ESPRHSSAVRQLLASMMTVDPQQRPHIPLLI----TQLEAL 293



>gi|507672610|ref|XP_004638249.1| PREDICTED: serine/threonine-protein kinase 16 [Octodon degus]
          Length = 305

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 117/338 (34%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CACSRGTVLIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQ-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI+ ++  C+ ++       ++ LP+YK G L   I    +   + SE+
Sbjct: 65  EADMHRLFHHPNILHLVAYCL-KEWGTKHEAWLLLPFYKKGTLWSEIERLKDKGNFLSEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +ARI ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQARIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFTVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLIIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSSRHSSAMRQLLASMMMVDPQKRPHIPLLLSQLEA 292



>gi|255719470|ref|XP_002556015.1| KLTH0H03080p [Lachancea thermotolerans]
 gi|238941981|emb|CAR30153.1| KLTH0H03080p [Lachancea thermotolerans CBS 6340]
          Length = 346

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 125/362 (34%), Positives = 192/362 (53%), Gaps = 35/362 (9%)

Query: 14  AVTSCCFPN-PT-LHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGS-D 70
            +  CC  + P+ + +N   + + +LLGEGGFS+V+LV+    G   ALKKIRC FGS  
Sbjct: 6   TLCGCCGSSQPSYVSVNGHRYHIKRLLGEGGFSFVYLVESRENG-LMALKKIRCPFGSIG 64

Query: 71  SVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLEN 129
           S+  AMKEVD Y+ F    I ++ID+ VVQ+++G K VYI LPY+  G LQD IN +L +
Sbjct: 65  SISPAMKEVDNYQKFKSPYIAQIIDSQVVQERDGSKTVYILLPYFSKGSLQDEINRHLLD 124

Query: 130 NKYFSEKEMLKIFRGICYAVRALH----------TYRFPSVPLRSENGITNSNLNGIENE 179
                E E++++  G+   +  +H          TY   S P   ++ +    LN +E +
Sbjct: 125 CTQVPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSL----LNDLELD 180

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
                               +AH DIKP NI+++  ++  P++ D GS  RA ++I +R 
Sbjct: 181 TFGESHQA------------YAHHDIKPSNIMIS--SEGMPVISDLGSCSRACVEINSRQ 226

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
             L  Q+  S+H T+ + APE+ DVK N  + EK D+WS GCT+Y M +G SPF+     
Sbjct: 227 ALLQFQEWRSEHCTLTFMAPEILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQI 286

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            G S+  ++   ++  P      YS    D++   L VDP  RP + ++I+ +     QL
Sbjct: 287 SGASVTYSLTTGKYSIP--SGTNYSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQSQL 344

Query: 360 SS 361
            S
Sbjct: 345 VS 346



>gi|385303442|gb|EIF47515.1| serine threonine protein [Dekkera bruxellensis AWRI1499]
          Length = 371

 Score =  210 bits (535), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 117/356 (32%), Positives = 187/356 (52%), Gaps = 53/356 (14%)

Query: 12  LYAVTSCCFP-----NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQ 66
           ++ + +C  P      PTL +N   F+++ +LGEGGFS+V+LV+ T     YALKK+ C 
Sbjct: 1   MWDIFNCXCPCVLDQTPTLKVNGSKFRILNVLGEGGFSFVYLVEXTRNKSXYALKKVNCS 60

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINN 125
           + + + +  MKE++ YR F    II ++ + +VQ+ +G K VYI LPY+K+G LQD I+ 
Sbjct: 61  YNNGNFQQTMKELEFYREFKSPYIIHLVGSSIVQEPDGSKTVYILLPYFKNGXLQDXIDK 120

Query: 126 NLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSV-------------PLRSENGITNSN 172
           B  +    SEK+ L+ F GIC  + A+H ++  +              P    +    ++
Sbjct: 121 BSVDESNISEKQALRYFVGICRGLIAMHRHQLSTNTRIRISQNFQSRDPFTELSSNEXNS 180

Query: 173 LNGIENE---------------------------MXXXXXXXXXXXXXEDG-----VVPF 200
            NG  N+                           +             EDG      +  
Sbjct: 181 GNGTSNDDSEERNPFLSHEEEXNRRSSSSTRPLTISSESDLSQNSIISEDGTELSETISI 240

Query: 201 AHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPE 260
           AHRDIKP NI+L++D  +  +L D GS  +    IQ++++AL  Q+  ++  T+ YRAPE
Sbjct: 241 AHRDIKPANIMLSEDGTA--VLCDLGSCEKVNYTIQSQSQALSIQENINERCTLAYRAPE 298

Query: 261 LFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           L DV +  ++ +KVDIWSLGCTLYA+ YG SPF+      G +++LA+ + ++ FP
Sbjct: 299 LIDVSSGDKITDKVDIWSLGCTLYALLYGFSPFEREEMSNGANMSLAISSGKYSFP 354



>gi|403266827|ref|XP_003925562.1| PREDICTED: serine/threonine-protein kinase 16 isoform 1 [Saimiri
           boliviensis boliviensis]
 gi|403266829|ref|XP_003925563.1| PREDICTED: serine/threonine-protein kinase 16 isoform 2 [Saimiri
           boliviensis boliviensis]
          Length = 305

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 186/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVVIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+ LF+H N++ ++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHHLFNHPNVLHLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILRLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL DD   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDDG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I Q++++++ 
Sbjct: 257 --QSPRHSSALRQLLASMMTVDPQQRPHIPQLLSQLEV 292



>gi|194043857|ref|XP_001928241.1| PREDICTED: serine/threonine-protein kinase 16 [Sus scrofa]
          Length = 305

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 188/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G++YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLRDGQFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIEKLKDKGNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILRLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSVP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLTMMMTVDPQQRPHIPFLLSQLEA 292



>gi|50750866|ref|XP_426593.1| PREDICTED: serine/threonine-protein kinase 16 isoformX2 [Gallus
           gallus]
          Length = 305

 Score =  210 bits (534), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 120/337 (35%), Positives = 177/337 (52%), Gaps = 52/337 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ +    + +++ L EGGFSYV LV+    GR+YALK+I C    D  + A++
Sbjct: 6   CVCSRGTVSLGGARYLLLQRLAEGGFSYVDLVEGLRDGRFYALKRILCHDKEDR-QAALR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           EV+M+ LF H NI+++   C+V +K      ++ LPY K G L   +    E   +  E+
Sbjct: 65  EVEMHNLFQHPNILRLEAHCMV-EKGAKHEAWLLLPYVKGGTLWSEVEALREKGTFMPEQ 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
            +L I RGIC  ++A+H                                           
Sbjct: 124 RILLILRGICSGLQAIHGK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP N+LL  D D QPILMD GS+ RAR+++    EA+  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNVLL--DEDDQPILMDLGSMNRARMEVTNSREAMAVQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V +   ++E+ DIWSLGC LY M +G  PFD  I ++G S+ALAV N     P
Sbjct: 199 RAPELFTVPSQCIIDERTDIWSLGCVLYCMMFGEGPFD-AIFQKGDSVALAVQNP-IAIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVD 353
            T   +YS     L+  M+ V+P++RP I  ++ +++
Sbjct: 257 TT--SRYSAALHRLLFSMMTVNPQERPSIEDILQQLE 291



>gi|511886174|ref|XP_004762884.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Mustela
           putorius furo]
 gi|511886176|ref|XP_004762885.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Mustela
           putorius furo]
 gi|511886178|ref|XP_004762886.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Mustela
           putorius furo]
 gi|511978642|ref|XP_004807201.1| PREDICTED: serine/threonine-protein kinase 16 isoform X1 [Mustela
           putorius furo]
 gi|511978644|ref|XP_004807202.1| PREDICTED: serine/threonine-protein kinase 16 isoform X2 [Mustela
           putorius furo]
 gi|511978646|ref|XP_004807203.1| PREDICTED: serine/threonine-protein kinase 16 isoform X3 [Mustela
           putorius furo]
          Length = 305

 Score =  210 bits (534), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 186/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAR----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QPILMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPILMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
            T   ++S   + L++ M+ VDP+ RP +  ++++++ 
Sbjct: 257 QTP--RHSSALRQLLTSMMTVDPQQRPPVSLLLSQLEA 292



>gi|465966528|ref|XP_004262741.1| PREDICTED: serine/threonine-protein kinase 16 [Orcinus orca]
 gi|470626529|ref|XP_004320388.1| PREDICTED: serine/threonine-protein kinase 16 [Tursiops truncatus]
          Length = 305

 Score =  210 bits (534), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G++YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGQFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L D I    +   + +E+
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGTKHEAWLLLPFFKRGTLWDEIEQLKDKGNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++   IC  + A+H                                           
Sbjct: 124 QILQLLLSICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMSQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP +  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLTLMMTVDPQQRPHVPFLLSQLEA 292



>gi|301755705|ref|XP_002913702.1| PREDICTED: serine/threonine-protein kinase 16-like [Ailuropoda
           melanoleuca]
          Length = 305

 Score =  209 bits (533), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAR----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLASMMTVDPQQRPPISLLLSQLEA 292



>gi|57111227|ref|XP_545656.1| PREDICTED: serine/threonine-protein kinase 16 [Canis lupus
           familiaris]
          Length = 305

 Score =  209 bits (533), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVLIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAR----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP++RP I  ++++++ 
Sbjct: 257 --QSPRHSSTLRQLLASMMTVDPQERPPISLLLSQLEA 292



>gi|432103436|gb|ELK30541.1| Serine/threonine-protein kinase 16 [Myotis davidii]
          Length = 305

 Score =  209 bits (533), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 118/338 (34%), Positives = 188/338 (55%), Gaps = 53/338 (15%)

Query: 19  CFPNP-TLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C  +P T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D V++A +
Sbjct: 6   CICSPGTVIIDNKRYLFIQKLGEGGFSYVDLVEGFHDGHFYALKRILCHEQQD-VEEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+ LF+H NI+ ++  C+ +++      ++ LPY K G L + I    +   + +E 
Sbjct: 65  EADMHHLFNHPNILHLVAYCL-KERGTKHEAWLLLPYLKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           E+L++  GIC  + A+H   +                                       
Sbjct: 124 EILQLLLGICRGLEAIHAQGY--------------------------------------- 144

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
               AHRD+KP NILL D+   QP+LMD GS+ +ARI +++  +AL  QD A+Q  T+ Y
Sbjct: 145 ----AHRDLKPTNILLGDEG--QPVLMDLGSMKQARIHVESSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLASMMTVDPLQRPYIPFLLSQLEA 292



>gi|392564252|gb|EIW57430.1| Pkinase-domain-containing protein [Trametes versicolor FP-101664
           SS1]
          Length = 425

 Score =  209 bits (532), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 97/154 (62%), Positives = 127/154 (82%), Gaps = 6/154 (3%)

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
           +VP+AHRD+KPGN+++ DD  +QPILMDFGS V+ARIK++ R++AL+QQD+A++ STM Y
Sbjct: 266 LVPYAHRDLKPGNVMIADD--NQPILMDFGSTVKARIKVENRSQALLQQDIAAEQSTMAY 323

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRF 315
           RAPELFDVKT + L+EKVDIWSLGCTLYA+AY  SPF+N    EQGGSIA+AV+ AQ++ 
Sbjct: 324 RAPELFDVKTGITLDEKVDIWSLGCTLYALAYSHSPFENTQTTEQGGSIAMAVMGAQYKH 383

Query: 316 PPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
           P +    YS   K+LI  MLKV+P++RPDIH+VI
Sbjct: 384 PSS---AYSQGLKNLIDSMLKVNPQERPDIHEVI 414



 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 85/153 (55%), Positives = 116/153 (75%), Gaps = 3/153 (1%)

Query: 9   RDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQF 67
           +D  +A++SC C     + IN RTF++I++LGEGGFS+V+LV+D ++GR +ALKKIRC  
Sbjct: 19  KDAFWALSSCICQQAAKVKINGRTFRIIRVLGEGGFSFVYLVEDENSGRQFALKKIRCPS 78

Query: 68  GSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVINN 125
           G++ V+ AM+EV+ YR F H NII+++D+ VVQD NG G+IVY+FLP YK G LQD IN 
Sbjct: 79  GNEDVRQAMREVEAYRRFKHPNIIRIMDSAVVQDPNGDGQIVYLFLPLYKRGNLQDAINA 138

Query: 126 NLENNKYFSEKEMLKIFRGICYAVRALHTYRFP 158
           N  NN +FSE+EML  F+G C A+RA+H YR P
Sbjct: 139 NSINNTHFSEREMLHYFKGTCEAIRAMHDYRAP 171



>gi|296205653|ref|XP_002749858.1| PREDICTED: serine/threonine-protein kinase 16 [Callithrix jacchus]
 gi|166831534|gb|ABY89799.1| serine/threonine kinase 16, isoform 2 (predicted) [Callithrix
           jacchus]
          Length = 305

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 186/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+ LF+H NI+ ++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHHLFNHPNILHLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILRLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I Q++++++ 
Sbjct: 257 --QSPRHSSALRQLLASMMTVDPQQRPHIPQLLSQLEV 292



>gi|114053103|ref|NP_001039720.1| serine/threonine-protein kinase 16 [Bos taurus]
 gi|86438136|gb|AAI12770.1| Serine/threonine kinase 16 [Bos taurus]
 gi|154426230|gb|AAI51567.1| Serine/threonine kinase 16 [Bos taurus]
 gi|296490298|tpg|DAA32411.1| TPA: serine/threonine-protein kinase 16 [Bos taurus]
          Length = 305

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     TL I+ + +  I  LGEGGFS+V LV+    G++YALK+I C    D  ++A +
Sbjct: 6   CICSRGTLTIDHKRYLFIHKLGEGGFSFVDLVEGLHDGQFYALKRILCHEQQDQ-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIEKLKDKGNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           +++++  GIC  + A+H                                           
Sbjct: 124 QIIRLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL ++   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGNEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  +YS   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRYSSALRQLLTSMMTVDPQQRPHIPLLLSQLEV 292



>gi|388454737|ref|NP_001253902.1| serine/threonine-protein kinase 16 [Macaca mulatta]
          Length = 305

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 185/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLFSH NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFSHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACINVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLASMMTVDPHQRPHIPLLLSQLEA 292



>gi|426222609|ref|XP_004005479.1| PREDICTED: serine/threonine-protein kinase 16 [Ovis aries]
          Length = 307

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/339 (33%), Positives = 189/339 (55%), Gaps = 52/339 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I  LGEGGFS+V LV+    G++YALK+I C    D  ++A +
Sbjct: 6   CICSRGTVTIDHKRYLFIHKLGEGGFSFVDLVEGLHDGQFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI+ ++  C+ +++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFHHPNILHLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIEKLKDKGNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           +++++  GIC  + A+HT                                          
Sbjct: 124 QIIQLLLGICRGLEAIHTK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I+++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIRVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQ 355
             +  ++S   + L++ M+ VDP+ RP I  ++++++ +
Sbjct: 257 --QNPRHSLALRQLLTSMMTVDPQQRPHIPLLLSQLEVE 293



>gi|488552965|ref|XP_004467828.1| PREDICTED: serine/threonine-protein kinase 16 isoform 2 [Dasypus
           novemcinctus]
          Length = 305

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-KERGPKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILLLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N +   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-KLNIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  +YS   + L++ M+ VDP++RP I  ++++V+ 
Sbjct: 257 --QSPRYSSAARQLLASMMTVDPQERPHIPLLLSQVEA 292



>gi|54696040|gb|AAV38392.1| serine/threonine kinase 16 [Homo sapiens]
          Length = 310

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 186/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D +++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQD-LEEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|440911047|gb|ELR60776.1| Serine/threonine-protein kinase 16 [Bos grunniens mutus]
          Length = 305

 Score =  207 bits (526), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     TL I+ + +  I  LGEGGFS+V LV+    G++YALK+I C    D  ++A +
Sbjct: 6   CICSRGTLTIDHKRYLFIHKLGEGGFSFVDLVEGLHDGQFYALKRILCHEQQDQ-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIEKLKDKGNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           +++++  GIC  + A+H                                           
Sbjct: 124 QIIRLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL ++   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGNEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLTSMMTVDPQQRPHIPLLLSQLEV 292



>gi|478506695|ref|XP_004427642.1| PREDICTED: serine/threonine-protein kinase 16 [Ceratotherium simum
           simum]
          Length = 305

 Score =  207 bits (526), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  +DA +
Sbjct: 6   CACSRGTVVIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EDAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF   NI++++  C+ +++      ++ LP++K G L   I    +   + +E 
Sbjct: 65  EADMHRLFYQPNILRLVAYCL-KERGSKHEAWLLLPFFKRGTLWTEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILRLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLASMMTVDPQQRPHIPLLLSQLEA 292



>gi|57165436|ref|NP_001008910.1| serine/threonine-protein kinase 16 [Homo sapiens]
 gi|297669495|ref|XP_002812932.1| PREDICTED: serine/threonine-protein kinase 16 isoform 1 [Pongo
           abelii]
 gi|297669497|ref|XP_002812933.1| PREDICTED: serine/threonine-protein kinase 16 isoform 2 [Pongo
           abelii]
 gi|426338668|ref|XP_004033297.1| PREDICTED: serine/threonine-protein kinase 16 isoform 1 [Gorilla
           gorilla gorilla]
 gi|426338670|ref|XP_004033298.1| PREDICTED: serine/threonine-protein kinase 16 isoform 2 [Gorilla
           gorilla gorilla]
 gi|46577677|sp|O75716.4|STK16_HUMAN RecName: Full=Serine/threonine-protein kinase 16; AltName:
           Full=Myristoylated and palmitoylated
           serine/threonine-protein kinase; Short=MPSK; AltName:
           Full=Protein kinase PKL12; AltName:
           Full=TGF-beta-stimulated factor 1; Short=TSF-1; AltName:
           Full=Tyrosine-protein kinase STK16; AltName: Full=hPSK
 gi|10834569|gb|AAG23728.1|AF203910_1 serine/threonine kinase KRCT [Homo sapiens]
 gi|10640971|dbj|BAB16311.1| F5-2 [Homo sapiens]
 gi|32449793|gb|AAH53998.1| Serine/threonine kinase 16 [Homo sapiens]
 gi|119591120|gb|EAW70714.1| serine/threonine kinase 16, isoform CRA_a [Homo sapiens]
 gi|119591123|gb|EAW70717.1| serine/threonine kinase 16, isoform CRA_a [Homo sapiens]
          Length = 305

 Score =  206 bits (525), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 185/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|3367705|emb|CAA06700.1| PKL12 protein [Homo sapiens]
          Length = 310

 Score =  206 bits (525), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  + E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIGERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|195108215|ref|XP_001998688.1| GI23494 [Drosophila mojavensis]
 gi|193915282|gb|EDW14149.1| GI23494 [Drosophila mojavensis]
          Length = 318

 Score =  206 bits (525), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 126/363 (34%), Positives = 192/363 (52%), Gaps = 57/363 (15%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           + S+  TL     C      L+IN   + V + L +GGFS + L ++ +T R YA+K++ 
Sbjct: 1   MQSIGWTLIVKRGCFCSKERLNINGSRYTVRERLAQGGFSLIDLAENVATRRCYAIKRVT 60

Query: 65  CQFGSDSVKD---AMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKS 117
           C     S++D   A++E++  R    E++I+V+D  +V       N    ++I LPYYK 
Sbjct: 61  CH----SIEDQNIALREIENCRKIDSEHVIRVVDYELVGQADIVINTTSTLFIVLPYYKH 116

Query: 118 G-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI 176
           G L D +        +  E ++L+IF GIC  +RA+H                       
Sbjct: 117 GSLSDHLQLRARKQDHMPEAQILQIFLGICEGLRAIH----------------------- 153

Query: 177 ENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQ 236
                            E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I 
Sbjct: 154 -----------------ETKPVPMAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIC 194

Query: 237 TRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNN 296
            +++A   QD A + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y +SPFD  
Sbjct: 195 GQSDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPFD-P 253

Query: 297 INEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL 356
           I E+G S+ALAVL+     P  E   Y+ +  +LI +ML++DP +RP I+ VI +    +
Sbjct: 254 IYERGDSVALAVLSGNVNIP--EDSIYTEDMHELIKYMLRIDPMERPFIYSVIEQTHDLI 311

Query: 357 EQL 359
           ++L
Sbjct: 312 QKL 314



>gi|349581585|dbj|GAA26742.1| K7_Ypl236cp [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 364

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 188/353 (53%), Gaps = 31/353 (8%)

Query: 12  LYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ----------DTSTGRYYA 59
           L+    CC  F + T+ +N + +++ +LLGEGG S+V+LVQ            +T   YA
Sbjct: 8   LFQNLCCCRGFSDATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYA 67

Query: 60  LKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG- 118
           LKKI C    +S+ + M+E++ Y+ F    +IK ID+ V+Q+K+G K +YI LPYY  G 
Sbjct: 68  LKKIICP-SVESISNGMREIENYKRFQSPYVIKSIDSQVMQEKDGSKTIYIVLPYYSLGS 126

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI-- 176
           LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  +  N++ +  
Sbjct: 127 LQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHD---PAS--RQDNATSRVNVDAVSM 181

Query: 177 ----ENEMXXXXXXXXXXXXXED--GVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVR 230
               E  M              +  G + +AHRDI P NIL +  +D  P++ D GS  +
Sbjct: 182 TYSDETAMLLEDTPLEMDMLSSNSAGSIAYAHRDITPSNILFS--SDGLPVIGDLGSCSQ 239

Query: 231 ARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGS 290
           A I I+ R++    Q+  + + T+PY  PEL ++K N  L+ KVDIWSLGCT Y + +G 
Sbjct: 240 ADITIENRHQLSELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGI 299

Query: 291 SPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           SPF+      G S+  A+   ++ FP     ++S    ++I   ++VDP  RP
Sbjct: 300 SPFEREEQIHGASLTYAINTGKYSFP--RNSRFSEGLLNVIKKCIQVDPIQRP 350



>gi|443921288|gb|ELU40987.1| other/NAK protein kinase [Rhizoctonia solani AG-1 IA]
          Length = 516

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 123/167 (73%), Gaps = 2/167 (1%)

Query: 194 EDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHST 253
           E  +VP+AHRDIKP N++  DD  + PILMDFGS +RARIKI+ R++AL+QQDLA++ ST
Sbjct: 350 EGVIVPYAHRDIKPANVMYADDGVT-PILMDFGSTIRARIKIEDRSQALVQQDLAAEQST 408

Query: 254 MPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNIN-EQGGSIALAVLNAQ 312
           MPYRAPELFDVKT   L E VDIWSLGCTL+A+AYG SPF+     EQGGS+A+AV+  +
Sbjct: 409 MPYRAPELFDVKTGTTLTEAVDIWSLGCTLFALAYGHSPFETTQTMEQGGSMAMAVMGGK 468

Query: 313 FRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           ++ PP    ++S     LI   LKVDP +RPDIHQ+IA  D  +  L
Sbjct: 469 YKHPPEAVGRWSAGLIGLIDACLKVDPSERPDIHQLIAMTDKVIAGL 515



 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/155 (50%), Positives = 116/155 (74%), Gaps = 2/155 (1%)

Query: 7   SVRDTLYAVTSC-CFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRC 65
           +V D ++A++SC C  + T+ +N R+F V ++LGEGGFS+V+LV+D ++GR +ALKKIRC
Sbjct: 99  TVTDAVFALSSCMCRQSATIKVNGRSFVVKRVLGEGGFSFVYLVEDATSGRLFALKKIRC 158

Query: 66  QFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVIN 124
             G D V++AM+EV+ YR F H NII+++D+ VVQD + GKIVY+FLP+Y+ G LQD I 
Sbjct: 159 PTGEDGVREAMREVEAYRRFRHPNIIRILDSAVVQDHDEGKIVYLFLPFYQRGNLQDAIT 218

Query: 125 NNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPS 159
           ++     +F E E+ ++FRG C AVRA+H YR P+
Sbjct: 219 SHSLAGTHFGELELAQLFRGTCLAVRAMHAYRAPA 253



>gi|383865679|ref|XP_003708300.1| PREDICTED: serine/threonine-protein kinase 16-like [Megachile
           rotundata]
          Length = 318

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 131/363 (36%), Positives = 187/363 (51%), Gaps = 57/363 (15%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           ++S+  +L     C     T+ +N R + V + LGEGGFS + LV+D ST + YA+KKI 
Sbjct: 1   MNSLGLSLILKMGCICSKETITVNSRNYTVREHLGEGGFSTILLVEDASTRKKYAIKKII 60

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSGLQ 120
           C  G +  + A KE++ + L  H N+I+ ID           N      + LPYY  G  
Sbjct: 61  CH-GLEDQRLAAKEIEYHNLVKHPNVIECIDFTYKGTADPIVNSTSEALMVLPYYHRG-- 117

Query: 121 DVINNNLE----NNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI 176
             I N LE    N  Y S  ++L IF  IC  V+A H                       
Sbjct: 118 -TIANELERRARNKDYMSTIDILNIFLQICEGVKAFH----------------------- 153

Query: 177 ENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQ 236
                            E    P AHRD+K  NI+L D   + P++MD GS+  AR+K+ 
Sbjct: 154 -----------------EAKPEPLAHRDLKTANIVLGDG--NTPVIMDLGSVAPARVKVC 194

Query: 237 TRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNN 296
               A   QDLA++  +MPYRAPELF+V++   ++E+ DIWSLGC LYA+ Y  SPFD  
Sbjct: 195 GSQAAQTLQDLAAERCSMPYRAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-T 253

Query: 297 INEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL 356
           + E+G S+ALAV++A   FP  +   Y+ + ++LI  MLKV+P +RP I+ VI  V   +
Sbjct: 254 VYERGDSVALAVISANITFP--DDAPYNEDMQNLILSMLKVNPMERPYIYSVIENVHDLI 311

Query: 357 EQL 359
            +L
Sbjct: 312 TKL 314



>gi|505847450|ref|XP_004617190.1| PREDICTED: serine/threonine-protein kinase 16 [Sorex araneus]
          Length = 305

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 117/343 (34%), Positives = 186/343 (54%), Gaps = 56/343 (16%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T  ++ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTFVVDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQ-EEAER 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI+ ++  CV +++   +  ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFYHPNILHLVAYCV-KERGPKQEAWLLLPFFKRGTLWNEIERLKDKGSFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL ++   QP+LMD GS+ +ARI+++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGEEG--QPVLMDLGSMNQARIQVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM YG  P+D  + ++G S+ALAV N   +  
Sbjct: 199 RAPELFTVQSHCVIDERTDVWSLGCVLYAMMYGEGPYD-MVFQKGDSVALAVQN---KLI 254

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
             +  +YS   + L+  M+ VD + RP +  ++    TQLE L
Sbjct: 255 IPQSPRYSAAMQQLLDSMMTVDSEQRPHVPVLL----TQLEAL 293



>gi|158258825|dbj|BAF85383.1| unnamed protein product [Homo sapiens]
          Length = 305

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 185/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGPRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|149711139|ref|XP_001493234.1| PREDICTED: serine/threonine-protein kinase 16-like [Equus caballus]
          Length = 305

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  +DA +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EDAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+ LF H NI++++  C+ +++      ++ LP++K G L   I    +   + ++ 
Sbjct: 65  EADMHHLFHHPNILRLVAYCL-KERGAKHEAWLLLPFFKRGTLWTEIERLKDKGNFLTQD 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLNIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSAAMRQLLASMMTVDPQQRPHIPLLLSQLEA 292



>gi|354490994|ref|XP_003507641.1| PREDICTED: serine/threonine-protein kinase 16-like [Cricetulus
           griseus]
          Length = 305

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D   +A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQ-DEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-KERGAKHEAWLLLPFFKRGTLWNEIERLKDQGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILPLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I+++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N +   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-ELSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L+  M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLGSMMTVDPQQRPHIPVLLSQLEA 292



>gi|507558456|ref|XP_004662965.1| PREDICTED: serine/threonine-protein kinase 16 [Jaculus jaculus]
          Length = 305

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 186/338 (55%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDQGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILRLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL+D+   QP+LMD GS+ +A I++++  +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLSDEG--QPVLMDLGSMNQACIQVESSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N   +  
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN---KLC 254

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S     L+  M+ V+P+ RP I  ++++++ 
Sbjct: 255 IPQSPRHSSAMLQLLDSMMTVEPQQRPHIPPLLSQLEA 292



>gi|332246609|ref|XP_003272445.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 16
           [Nomascus leucogenys]
          Length = 305

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 183/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVTIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  +  +G S+ALAV N   + P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFXKGDSVALAVHN---QLP 254

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  + S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 255 IPQSPRQSSALRQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|151942565|gb|EDN60911.1| conserved protein [Saccharomyces cerevisiae YJM789]
          Length = 364

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 187/353 (52%), Gaps = 31/353 (8%)

Query: 12  LYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ----------DTSTGRYYA 59
           L+    CC  F + T+ IN + +++ +LLGEGG S+V+LVQ            +T   YA
Sbjct: 8   LFQNLCCCRGFSDATIRINDKRYRIQRLLGEGGMSFVYLVQLSKNPLIIDNGIATPELYA 67

Query: 60  LKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG- 118
           LKKI C    +S+ + M+E++ Y+ F    +IK ID+ V+Q+K+G K +YI LPYY  G 
Sbjct: 68  LKKIICP-SVESISNGMREIENYKRFQSPYVIKSIDSQVMQEKDGSKTIYIVLPYYSLGS 126

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI-- 176
           LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  +  N++ +  
Sbjct: 127 LQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHD---PAS--RQDNATSRVNVDAVSM 181

Query: 177 ----ENEMXXXXXXXXXXXXXED--GVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVR 230
               E  M              +  G + +AHRDI P NIL +  +D  P++ D GS  +
Sbjct: 182 TYSDETAMLLEDTPLEMDMLSSNSAGSIAYAHRDITPSNILFS--SDGLPVIGDLGSCSQ 239

Query: 231 ARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGS 290
           A I I+ R++    Q+  + + T+PY  PEL ++K N  L+ KVDIWSLGCT Y + +G 
Sbjct: 240 ADITIENRHQLSELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGI 299

Query: 291 SPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           SPF+      G S+  A+   ++ FP     ++S     +I   ++VDP  RP
Sbjct: 300 SPFEREEQIHGASLTYAINTGKYSFP--RNSRFSEGLLSVIKKCIQVDPIQRP 350



>gi|431917953|gb|ELK17182.1| Serine/threonine-protein kinase 16 [Pteropus alecto]
          Length = 305

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 185/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+ LF H NI+ ++  C+ +++      ++ LP++K G L + I    + + + +E+
Sbjct: 65  EADMHHLFHHPNILHLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIERLKDKSNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAQ----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D    QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDGG--QPVLMDLGSMNQACIHVENSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSAMRQLLASMMTVDPQQRPHIPLILSQLEA 292



>gi|114583441|ref|XP_001162451.1| PREDICTED: serine/threonine-protein kinase 16 isoform 3 [Pan
           troglodytes]
 gi|114583443|ref|XP_001162494.1| PREDICTED: serine/threonine-protein kinase 16 isoform 4 [Pan
           troglodytes]
          Length = 305

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V ++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVPSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|397495728|ref|XP_003818698.1| PREDICTED: serine/threonine-protein kinase 16 isoform 1 [Pan
           paniscus]
 gi|397495730|ref|XP_003818699.1| PREDICTED: serine/threonine-protein kinase 16 isoform 2 [Pan
           paniscus]
          Length = 305

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V ++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVPSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|125777862|ref|XP_001359753.1| GA11523 [Drosophila pseudoobscura pseudoobscura]
 gi|195157234|ref|XP_002019501.1| GL12189 [Drosophila persimilis]
 gi|54639503|gb|EAL28905.1| GA11523 [Drosophila pseudoobscura pseudoobscura]
 gi|194116092|gb|EDW38135.1| GL12189 [Drosophila persimilis]
          Length = 318

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/360 (34%), Positives = 190/360 (52%), Gaps = 51/360 (14%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           + S+  TL     C     TL+IN   + + + L +GGFS + L ++ +T R YA+K+I 
Sbjct: 1   MQSIGWTLIMKRGCFCRKETLNINGSRYTIRERLAQGGFSLIDLGENPATRRSYAIKRIT 60

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-L 119
           C    D    A++E++  R    EN+I+V+D  +        N    +YI LPYYK G L
Sbjct: 61  CH-SIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLYIVLPYYKHGAL 119

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENE 179
            D +        +  E ++++IF G+C  V+A+H                          
Sbjct: 120 LDHLQLRARKQDHMPEAQIVQIFLGVCEGVKAIH-------------------------- 153

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
                         E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I +++
Sbjct: 154 --------------EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIVSQS 197

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           +A   QD A + S++ YRAPELF VK+   ++E+ DIWSLGC LYAM Y +SPFD  I E
Sbjct: 198 DAQRLQDEAEERSSIVYRAPELFSVKSYCTIDERTDIWSLGCVLYAMCYFNSPFD-PIYE 256

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +G S+ALAVL+     P  E   Y+ +  DLI++ML+ DP +RP I+ VI +    +++L
Sbjct: 257 RGDSVALAVLSGNINIP--EDSIYTEDMHDLINYMLRTDPMERPFIYSVIERTHDLIQKL 314



>gi|323302644|gb|EGA56450.1| YPL236C-like protein [Saccharomyces cerevisiae FostersB]
          Length = 364

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 187/353 (52%), Gaps = 31/353 (8%)

Query: 12  LYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ----------DTSTGRYYA 59
           L+    CC  F + T+ +N + +++ +LLGEGG S+V+LVQ            +T   YA
Sbjct: 8   LFQNLCCCRGFSDATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNXLIIDNGIATPELYA 67

Query: 60  LKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG- 118
           LKKI C    +S+ + M+E++ Y+ F    +IK ID+ V+Q+K+G K +YI LPYY  G 
Sbjct: 68  LKKIICP-SVESISNGMREIENYKRFQSPYVIKSIDSQVMQEKDGSKTIYIVLPYYSLGS 126

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI-- 176
           LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  +  N++ +  
Sbjct: 127 LQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHD---PAS--RQDNATSRVNVDAVSM 181

Query: 177 ----ENEMXXXXXXXXXXXXXED--GVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVR 230
               E  M              +  G + +AHRDI P NIL +  +D  P++ D GS  +
Sbjct: 182 TYSDETAMLLEDTPLEMDMLSSNSAGSIAYAHRDITPSNILFS--SDGLPVIGDLGSCSQ 239

Query: 231 ARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGS 290
           A I I+ R++    Q+  + + T+PY  PEL ++K N  L+ KVDIWSLGCT Y + +G 
Sbjct: 240 ADITIENRHQLSELQEWVNDNCTLPYTXPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGI 299

Query: 291 SPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           SPF+      G S+  A+   ++ FP     ++S     +I   ++VDP  RP
Sbjct: 300 SPFEREEQIHGASLTYAINTGKYSFP--RNSRFSEGLLSVIKKCIQVDPIQRP 350



>gi|195445463|ref|XP_002070336.1| GK11088 [Drosophila willistoni]
 gi|194166421|gb|EDW81322.1| GK11088 [Drosophila willistoni]
          Length = 318

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 188/350 (53%), Gaps = 57/350 (16%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKD--- 74
           C     TLHIN   + + + L +GGFS + L ++ +T R YA+K+I C     S++D   
Sbjct: 14  CFCSKETLHINGSRYTIRERLAQGGFSLIDLGENAATRRSYAIKRITCH----SIEDQNI 69

Query: 75  AMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-LQDVINNNLEN 129
           A++E++  +    +N+I+V+D  +        N    ++I LP+YK G L D +      
Sbjct: 70  ALREIENGKKIDSDNVIQVVDYELKGHADIVINTTSTLFIVLPFYKHGSLADHLQMRARK 129

Query: 130 NKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXX 189
           + Y  E ++L+IF GIC  ++A+H                                    
Sbjct: 130 HDYMPEAQILQIFLGICEGLKAIH------------------------------------ 153

Query: 190 XXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLAS 249
               E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I  +++A   QD A 
Sbjct: 154 ----EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIVGQSDAQRLQDEAE 207

Query: 250 QHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVL 309
           + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y SSPFD  I E+G S+ALAVL
Sbjct: 208 ERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFSSPFD-PIYERGDSVALAVL 266

Query: 310 NAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +     P  E   Y+ E  +LI +ML++DP +RP I+ VI +    +++L
Sbjct: 267 SGNVNIP--EDSIYTDEMHELIKYMLRIDPMERPFIYSVIEQTHDLIQKL 314



>gi|6325020|ref|NP_015088.1| Env7p [Saccharomyces cerevisiae S288c]
 gi|74676496|sp|Q12003.1|ENV7_YEAST RecName: Full=Serine/threonine-protein kinase ENV7; AltName:
           Full=Late endosome and vacuole interface protein 7
 gi|1061253|emb|CAA91608.1| putative protein [Saccharomyces cerevisiae]
 gi|1370488|emb|CAA97954.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|256270463|gb|EEU05657.1| YPL236C-like protein [Saccharomyces cerevisiae JAY291]
 gi|259149921|emb|CAY86724.1| EC1118_1P2_0430p [Saccharomyces cerevisiae EC1118]
 gi|285815308|tpg|DAA11200.1| TPA: Env7p [Saccharomyces cerevisiae S288c]
 gi|323346086|gb|EGA80376.1| YPL236C-like protein [Saccharomyces cerevisiae Lalvin QA23]
 gi|365762686|gb|EHN04219.1| YPL236C-like protein [Saccharomyces cerevisiae x Saccharomyces
           kudriavzevii VIN7]
 gi|392296142|gb|EIW07245.1| hypothetical protein CENPK1137D_1832 [Saccharomyces cerevisiae
           CEN.PK113-7D]
          Length = 364

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 187/353 (52%), Gaps = 31/353 (8%)

Query: 12  LYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ----------DTSTGRYYA 59
           L+    CC  F + T+ +N + +++ +LLGEGG S+V+LVQ            +T   YA
Sbjct: 8   LFQNLCCCRGFSDATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYA 67

Query: 60  LKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG- 118
           LKKI C    +S+ + M+E++ Y+ F    +IK ID+ V+Q+K+G K +YI LPYY  G 
Sbjct: 68  LKKIICP-SVESISNGMREIENYKRFQSPYVIKSIDSQVMQEKDGSKTIYIVLPYYSLGS 126

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI-- 176
           LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  +  N++ +  
Sbjct: 127 LQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHD---PAS--RQDNATSRVNVDAVSM 181

Query: 177 ----ENEMXXXXXXXXXXXXXED--GVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVR 230
               E  M              +  G + +AHRDI P NIL +  +D  P++ D GS  +
Sbjct: 182 TYSDETAMLLEDTPLEMDMLSSNSAGSIAYAHRDITPSNILFS--SDGLPVIGDLGSCSQ 239

Query: 231 ARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGS 290
           A I I+ R++    Q+  + + T+PY  PEL ++K N  L+ KVDIWSLGCT Y + +G 
Sbjct: 240 ADITIENRHQLSELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGI 299

Query: 291 SPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           SPF+      G S+  A+   ++ FP     ++S     +I   ++VDP  RP
Sbjct: 300 SPFEREEQIHGASLTYAINTGKYSFP--RNSRFSEGLLSVIKKCIQVDPIQRP 350



>gi|225581134|gb|ACN94704.1| GA11523 [Drosophila miranda]
          Length = 318

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/360 (34%), Positives = 190/360 (52%), Gaps = 51/360 (14%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           + S+  TL     C     TL+IN   + + + L +GGFS + L ++ +T R YA+K+I 
Sbjct: 1   MQSIGWTLIMKRGCFCRKETLNINGSRYTIRERLAQGGFSLIDLGENPATRRSYAIKRIT 60

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-L 119
           C    D    A++E++  R    EN+I+V+D  +        N    +YI LPYYK G L
Sbjct: 61  CH-SIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLYIVLPYYKHGAL 119

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENE 179
            D +        +  E ++++IF G+C  V+A+H                          
Sbjct: 120 LDHLQLRARKQDHMPEAQIVQIFLGVCEGVKAIH-------------------------- 153

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
                         E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I +++
Sbjct: 154 --------------EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIVSQS 197

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           +A   QD A + S++ YRAPELF VK+   ++E+ DIWSLGC LYAM Y +SPFD  I E
Sbjct: 198 DAQRLQDEAEERSSIVYRAPELFSVKSYCTIDERTDIWSLGCVLYAMCYFNSPFD-PIYE 256

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +G S+ALAVL+     P  E   Y+ +  DLI++ML+ DP +RP I+ VI +    +++L
Sbjct: 257 RGDSVALAVLSGNINIP--EDSIYTEDMHDLINYMLRTDPMERPFIYSVIERTHDLIQKL 314



>gi|507926127|ref|XP_004674323.1| PREDICTED: serine/threonine-protein kinase 16 [Condylura cristata]
          Length = 308

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 185/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ ++ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIMDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQ-EEAKR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI+ ++  C+ +++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFQHPNILHLVAYCL-RERGTKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L++  GIC  + A+H                                           
Sbjct: 124 QILQLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+  A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNHACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLASMMTVDPEQRPHIPFLLSQLEA 292



>gi|432851991|ref|XP_004067141.1| PREDICTED: serine/threonine-protein kinase 16-like [Oryzias
           latipes]
          Length = 305

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 185/336 (55%), Gaps = 52/336 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     ++ I+ + +  ++ L EGGFSYV LV+    GR+YALK+I C    +  K+A  
Sbjct: 6   CVCSRGSMTIDNKKYYFVQKLDEGGFSYVDLVEGAKDGRFYALKRILCH-DREGRKEAQT 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           EV+M+++FSH NI+ ++    V D  G    ++ LPY   G L  V+    +      EK
Sbjct: 65  EVEMHQMFSHPNILSLVSHTFV-DAGGKTEAWLLLPYMSKGSLWSVLEKLRDKGSSMPEK 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L+IFRGIC  ++A+H           E G                             
Sbjct: 124 QILQIFRGICSGLKAIH-----------EKG----------------------------- 143

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP N+LL  D +++P+LMD GS+ RARI+++   EA+  QD A+Q  T+ Y
Sbjct: 144 ---YAHRDLKPTNVLL--DENNKPLLMDLGSMNRARIEVKGSREAMTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ DIWSLGC LY M     P+D  + ++G S+ALAV N     P
Sbjct: 199 RAPELFHVESHCIIDERTDIWSLGCVLYCMMMLEGPYD-LVFQKGDSVALAVQNP-VSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
           P+   +YS   + L+S ++  +P++RP+I  V+ +V
Sbjct: 257 PS--CRYSSGLQVLLSSIMVSNPQERPNISWVLDQV 290



>gi|358060316|dbj|GAA94070.1| hypothetical protein E5Q_00717 [Mixia osmundae IAM 14324]
          Length = 421

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/167 (58%), Positives = 124/167 (74%), Gaps = 4/167 (2%)

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
           + P+AHRDIKP NI++TDD     ILMDFGS   AR+++ +R+ AL QQDLA++  +MP+
Sbjct: 256 MTPWAHRDIKPANIMVTDDGQDA-ILMDFGSAAPARVEVPSRSVALTQQDLAAEQCSMPF 314

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELFDVKT  +L++KVDIWSLGCTL+A+A+  SPF+    +QGGSIA+AVLN Q++FP
Sbjct: 315 RAPELFDVKTGQDLDQKVDIWSLGCTLFALAFHHSPFETEQEQQGGSIAMAVLNGQYKFP 374

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL---EQLS 360
               DKYS   KDLIS ML VDP+ RPDIHQVI      L   EQ+S
Sbjct: 375 SGSGDKYSQPLKDLISSMLIVDPESRPDIHQVITSTKAALARNEQVS 421



 Score =  166 bits (421), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 109/145 (75%), Gaps = 3/145 (2%)

Query: 12  LYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDS 71
           L A T+ C P+  + +N RTFK+++LLGEGGF++V+L +DTS+GR +ALKKIRCQ  S+ 
Sbjct: 7   LLACTALCAPSKDVKLNGRTFKIVRLLGEGGFAFVYLAEDTSSGRQFALKKIRCQ-SSEG 65

Query: 72  VKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENN 130
            + AMKEV+ Y+ F H   I+ +D+CV+QD+ G +++Y+FLP+YK G LQD IN+++ + 
Sbjct: 66  YRIAMKEVEAYKRFRHPYCIRCLDSCVIQDEEG-QVIYLFLPFYKRGNLQDAINDHVTSG 124

Query: 131 KYFSEKEMLKIFRGICYAVRALHTY 155
             F E+EML++F   C AVRA+HTY
Sbjct: 125 SRFGEREMLRLFLKTCEAVRAMHTY 149



>gi|323335259|gb|EGA76548.1| YPL236C-like protein [Saccharomyces cerevisiae Vin13]
          Length = 364

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 187/353 (52%), Gaps = 31/353 (8%)

Query: 12  LYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ----------DTSTGRYYA 59
           L+    CC  F + T+ +N + +++ +LLGEGG S+V+LVQ            +T   YA
Sbjct: 8   LFQNLCCCRGFSDATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNXLIIDNGIATPELYA 67

Query: 60  LKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG- 118
           LKKI C    +S+ + M+E++ Y+ F    +IK ID+ V+Q+K+G K +YI LPYY  G 
Sbjct: 68  LKKIICP-SVESISNGMREIENYKRFQSPYVIKSIDSQVMQEKDGSKTIYIVLPYYSLGS 126

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI-- 176
           LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  +  N++ +  
Sbjct: 127 LQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHD---PAS--RQDNATSRVNVDAVSM 181

Query: 177 ----ENEMXXXXXXXXXXXXXED--GVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVR 230
               E  M              +  G + +AHRDI P NIL +  +D  P++ D GS  +
Sbjct: 182 TYSDETAMLLEDTPLEMDMLSSNSAGSIAYAHRDITPSNILFS--SDGLPVIGDLGSCSQ 239

Query: 231 ARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGS 290
           A I I+ R++    Q+  + + T+PY  PEL ++K N  L+ KVDIWSLGCT Y + +G 
Sbjct: 240 ADITIENRHQLSELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGI 299

Query: 291 SPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           SPF+      G S+  A+   ++ FP     ++S     +I   ++VDP  RP
Sbjct: 300 SPFEREEQIHGASLTYAINTGKYSFP--RNSRFSEGLLSVIKKCIQVDPIQRP 350



>gi|190407728|gb|EDV10993.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gi|207340743|gb|EDZ68997.1| YPL236Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|323331123|gb|EGA72541.1| YPL236C-like protein [Saccharomyces cerevisiae AWRI796]
 gi|323351919|gb|EGA84458.1| YPL236C-like protein [Saccharomyces cerevisiae VL3]
          Length = 364

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 187/353 (52%), Gaps = 31/353 (8%)

Query: 12  LYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ----------DTSTGRYYA 59
           L+    CC  F + T+ +N + +++ +LLGEGG S+V+LVQ            +T   YA
Sbjct: 8   LFQNLCCCRGFSDATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNPLIIDNGIATPELYA 67

Query: 60  LKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG- 118
           LKKI C    +S+ + M+E++ Y+ F    +IK ID+ V+Q+K+G K +YI LPYY  G 
Sbjct: 68  LKKIICP-SVESISNGMREIENYKRFQSPYVIKSIDSQVMQEKDGSKTIYIVLPYYSLGS 126

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI-- 176
           LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  +  N++ +  
Sbjct: 127 LQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHD---PAS--RQDNATSRVNVDAVSM 181

Query: 177 ----ENEMXXXXXXXXXXXXXED--GVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVR 230
               E  M              +  G + +AHRDI P NIL +  +D  P++ D GS  +
Sbjct: 182 TYSDETAMLLEDTPLEMDMLSSNSAGSIAYAHRDITPSNILFS--SDGLPVIGDLGSCSQ 239

Query: 231 ARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGS 290
           A I I+ R++    Q+  + + T+PY  PEL ++K N  L+ KVDIWSLGCT Y + +G 
Sbjct: 240 ADITIENRHQLSELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGI 299

Query: 291 SPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           SPF+      G S+  A+   ++ FP     ++S     +I   ++VDP  RP
Sbjct: 300 SPFEREEQIHGASLTYAINTGKYSFP--RNSRFSEGLLSVIKKCIQVDPIQRP 350



>gi|12803571|gb|AAH02618.1| Serine/threonine kinase 16 [Homo sapiens]
 gi|47115287|emb|CAG28603.1| STK16 [Homo sapiens]
 gi|190689919|gb|ACE86734.1| serine/threonine kinase 16 protein [synthetic construct]
          Length = 305

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S     L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALWQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|33303961|gb|AAQ02488.1| serine/threonine kinase 16, partial [synthetic construct]
          Length = 306

 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S     L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALWQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|3372666|gb|AAC28337.1| myristilated and palmitylated serine-threonine kinase MPSK [Homo
           sapiens]
          Length = 305

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WS GC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSFGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|323306913|gb|EGA60197.1| YPL236C-like protein [Saccharomyces cerevisiae FostersO]
          Length = 364

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 187/353 (52%), Gaps = 31/353 (8%)

Query: 12  LYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ----------DTSTGRYYA 59
           L+    CC  F + T+ +N + +++ +LLGEGG S+V+LVQ            +T   YA
Sbjct: 8   LFQNLCCCRGFSDATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNPLIIDNGIATPELYA 67

Query: 60  LKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG- 118
           LKKI C    +S+ + M+E++ Y+ F    +IK ID+ V+Q+K+G K +YI LPYY  G 
Sbjct: 68  LKKIICP-SVESISNGMREIENYKRFQSPYVIKSIDSQVMQEKDGSKTIYIVLPYYSLGS 126

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI-- 176
           LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  +  N++ +  
Sbjct: 127 LQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHD---PAS--RQDNATSRVNVDAVSM 181

Query: 177 ----ENEMXXXXXXXXXXXXXED--GVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVR 230
               E  M              +  G + +AHRDI P NIL +  +D  P++ D GS  +
Sbjct: 182 TYSDETAMLLEDTPLEMDMLSSNSAGSIXYAHRDITPSNILFS--SDGLPVIGDLGSCSQ 239

Query: 231 ARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGS 290
           A I I+ R++    Q+  + + T+PY  PEL ++K N  L+ KVDIWSLGCT Y + +G 
Sbjct: 240 ADITIENRHQLSELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGI 299

Query: 291 SPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           SPF+      G S+  A+   ++ FP     ++S     +I   ++VDP  RP
Sbjct: 300 SPFEREEQIHGASLTYAINTGKYSFP--RNSRFSEGLLSVIKKCIQVDPIQRP 350



>gi|195037763|ref|XP_001990330.1| GH19283 [Drosophila grimshawi]
 gi|193894526|gb|EDV93392.1| GH19283 [Drosophila grimshawi]
          Length = 318

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 126/363 (34%), Positives = 191/363 (52%), Gaps = 57/363 (15%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           + S+  TL     C      L+IN   + V + L +GGFS + L ++ +T R YA+K+I 
Sbjct: 1   MHSIGWTLIVKRGCFCSKERLNINGSRYTVRERLAQGGFSLIDLAENAATRRCYAIKRIT 60

Query: 65  CQFGSDSVKD---AMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKS 117
           C     S++D   A++E++  R    E++I+V+D  ++       N    ++I LPYYK 
Sbjct: 61  CH----SIEDQNIALREIENCRKIDSEHVIRVVDYELIGHADIVINTTSTLFIVLPYYKH 116

Query: 118 G-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI 176
           G L D +        +  E ++L+IF GIC  + A+H                       
Sbjct: 117 GSLWDHLQLRARKQDHMPEAQILQIFLGICEGLLAIH----------------------- 153

Query: 177 ENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQ 236
                            E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I 
Sbjct: 154 -----------------EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIC 194

Query: 237 TRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNN 296
            +++A   QD A + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y +SPFD  
Sbjct: 195 GQSDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPFD-P 253

Query: 297 INEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL 356
           I E+G S+ALAVL+     P  E   Y+ +  DLI +ML++DP +RP I+ VI +    +
Sbjct: 254 IYERGDSVALAVLSGNVNIP--EDSIYTEDMHDLIKYMLRIDPMERPFIYSVIEQTHDLI 311

Query: 357 EQL 359
           ++L
Sbjct: 312 QKL 314



>gi|3646280|emb|CAA09387.1| serine/threonine kinase [Homo sapiens]
          Length = 305

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 183/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  + E+ D+WSL C LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIGERTDVWSLSCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|389750145|gb|EIM91316.1| Pkinase-domain-containing protein [Stereum hirsutum FP-91666 SS1]
          Length = 433

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 125/154 (81%), Gaps = 5/154 (3%)

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
           +VP+AHRD+KPGN++L DD  + PILMDFGS ++ARI I+ R++AL+QQD+A++HSTM Y
Sbjct: 277 LVPYAHRDLKPGNVMLADDGVT-PILMDFGSCMKARIPIENRSQALLQQDIAAEHSTMAY 335

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDN-NINEQGGSIALAVLNAQFRF 315
           RAPELFDVKT + L+EKVDIWSLGC L+A+AY  SPF+N    EQGGSIA+AVLNAQ++ 
Sbjct: 336 RAPELFDVKTGLTLDEKVDIWSLGCVLFALAYSHSPFENMQTTEQGGSIAMAVLNAQYKH 395

Query: 316 PPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
           P +    YS  FK L+  MLKV+P +RPDI+QV+
Sbjct: 396 PSS---GYSAGFKALVDSMLKVNPTERPDINQVL 426



 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/148 (56%), Positives = 112/148 (75%), Gaps = 2/148 (1%)

Query: 10  DTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGS 69
           + L   TSCC     L IN RTFK++K+LGEGGFS+V+L QD  + R +ALKKIRC  GS
Sbjct: 21  NVLSMFTSCCTSQAKLKINGRTFKIVKILGEGGFSFVYLAQDEQSERQFALKKIRCPTGS 80

Query: 70  DSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNG-GKIVYIFLPYYKSG-LQDVINNNL 127
           + VK+AM+EV+ YR F H NII+++D+ V+QD  G G+IVY+FLP YK G LQD INNNL
Sbjct: 81  EGVKEAMREVEAYRRFKHPNIIRILDSAVLQDPEGDGQIVYLFLPLYKRGNLQDAINNNL 140

Query: 128 ENNKYFSEKEMLKIFRGICYAVRALHTY 155
           + + +F E++ML++F+G C AVRA+HTY
Sbjct: 141 QTSSHFPERQMLRLFKGTCEAVRAMHTY 168



>gi|73536291|pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16
           In Complex With Staurosporine
 gi|73536292|pdb|2BUJ|B Chain B, Crystal Structure Of The Human Serine-Threonine Kinase 16
           In Complex With Staurosporine
          Length = 317

 Score =  203 bits (516), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 187/347 (53%), Gaps = 58/347 (16%)

Query: 9   RDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFG 68
           R+ LY      F    + I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C   
Sbjct: 14  RENLY------FQGHMVIIDNKHYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQ 67

Query: 69  SDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNL 127
            D  ++A +E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    
Sbjct: 68  QDR-EEAQREADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLK 125

Query: 128 ENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXX 187
           +   + +E ++L +  GIC  + A+H                                  
Sbjct: 126 DKGNFLTEDQILWLLLGICRGLEAIHAK-------------------------------- 153

Query: 188 XXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDL 247
                       +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD 
Sbjct: 154 -----------GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALTLQDW 200

Query: 248 ASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALA 307
           A+Q  T+ YRAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALA
Sbjct: 201 AAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALA 259

Query: 308 VLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
           V N Q   P  +  ++S     L++ M+ VDP  RP I  ++++++ 
Sbjct: 260 VQN-QLSIP--QSPRHSSALWQLLNSMMTVDPHQRPHIPLLLSQLEA 303



>gi|443693057|gb|ELT94510.1| hypothetical protein CAPTEDRAFT_162050 [Capitella teleta]
          Length = 315

 Score =  203 bits (516), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 183/340 (53%), Gaps = 50/340 (14%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ ++  T+ +   LGEGGFS+V L ++  T R  A K+I C    D  + A K
Sbjct: 12  CMCSRETIEVDGHTYSIRSRLGEGGFSFVDLAEERGTHRLLAAKRIVCHSSGDE-QLARK 70

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKI---VYIFLPYYKSG-LQDVINNNLENNKYF 133
           E++    F+H+N++      +   +N       V I +PYY+ G +QD +      + ++
Sbjct: 71  EIEYMNKFTHKNLVPCEGHVMNPVRNHATAISEVLILMPYYEKGSIQDELEILRRQSDHY 130

Query: 134 SEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXX 193
           +E ++L    GIC  ++ALHT    + P                                
Sbjct: 131 TETKVLFYLIGICEGLQALHT----ASPR------------------------------- 155

Query: 194 EDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHST 253
                P AHRD+KP N++L DD     +LMDFGS+  AR++I+T +EA    DLA++  +
Sbjct: 156 -----PLAHRDVKPHNVMLKDD--DTAVLMDFGSMGIARLEIKTTSEATAITDLAAERCS 208

Query: 254 MPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQF 313
           MPYRAPELF V+T+  L+EKVDIWSLGCTLYAM Y  SPFD  + ++G SIALAV     
Sbjct: 209 MPYRAPELFSVQTHASLDEKVDIWSLGCTLYAMCYYESPFD-KVYQRGDSIALAVQAGNV 267

Query: 314 RFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVD 353
           + PP +  +YS +   L+  MLKV+P++RP I  V+ K +
Sbjct: 268 Q-PPNDA-RYSADLLALMLSMLKVNPEERPAIDVVLRKAE 305



>gi|357477799|ref|XP_003609185.1| Serine/threonine protein kinase [Medicago truncatula]
 gi|355510240|gb|AES91382.1| Serine/threonine protein kinase [Medicago truncatula]
          Length = 342

 Score =  203 bits (516), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 189/361 (52%), Gaps = 69/361 (19%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQ----DTSTGRY---------------YALKKIRCQF 67
           IN   F++++ LGEGGF+YV+LV+    D++TG                 YA+KK+  Q 
Sbjct: 23  INENRFRILRQLGEGGFAYVYLVKEAPNDSATGGLANKLKDSSHLADDGSYAMKKVLIQ- 81

Query: 68  GSDSVKDAMKEVDMYRLFSHENIIKVIDTCVV-----QDKNGGKIVYIFLPYYKSG-LQD 121
            ++ ++   +E+ +  LFSH N++ ++D  ++     Q+ +     Y+  P +  G L D
Sbjct: 82  NNEQLELVREEIRVSSLFSHPNLLPLLDHAIISVKPTQETSWSHEAYLLFPVHLDGTLLD 141

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMX 181
                    +++S  ++L+IFR +C  ++ +H                  NL+       
Sbjct: 142 NAKTMKAKKEHYSTSDVLQIFRQLCAGLKHMH------------------NLD------- 176

Query: 182 XXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIKIQTRN 239
                            P+AH D+KPGN+L+T      P  ILMDFGS   AR KI +R+
Sbjct: 177 ----------------PPYAHNDVKPGNVLITHRKGQPPLAILMDFGSARPARKKISSRS 220

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           EAL  Q+ AS+H + P+RAPEL+D  ++ +++E+ D+WSLGCTLYA+ YG SPF+  + E
Sbjct: 221 EALQLQEWASEHVSAPFRAPELWDCPSHADIDERTDVWSLGCTLYAIMYGVSPFEYALGE 280

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            GGS+ LA++NAQ ++P   +  Y       +S+ML+     RP I  +I  VD  + + 
Sbjct: 281 SGGSLQLAIVNAQVKWPAGLKPSYPEALHQFVSWMLQPQAAMRPRIDDIIIHVDKLIAKF 340

Query: 360 S 360
           S
Sbjct: 341 S 341



>gi|190691291|gb|ACE87420.1| serine/threonine kinase 16 protein [synthetic construct]
          Length = 305

 Score =  202 bits (515), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 183/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF+H NI++++  C+ +++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFNHPNILRLVAYCL-RERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILWLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+L D GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLTDLGSMNQACIHVEGSRQALTLQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S     L++ M+ VDP  RP I  ++++++ 
Sbjct: 257 --QSPRHSSALWQLLNSMMTVDPHQRPHIPLLLSQLEA 292



>gi|148224868|ref|NP_001087851.1| serine/threonine kinase 16 [Xenopus laevis]
 gi|51949998|gb|AAH82377.1| MGC81705 protein [Xenopus laevis]
          Length = 305

 Score =  202 bits (515), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 120/328 (36%), Positives = 181/328 (55%), Gaps = 53/328 (16%)

Query: 28  NRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMKEVDMYRLFSH 87
           N+R F V KL GEGGFSYV LV+    GR+YALK+I C    D  K+A  EV+M+RLF+H
Sbjct: 17  NKRYFFVQKL-GEGGFSYVDLVEGVHDGRFYALKRILCHDREDR-KEAQHEVEMHRLFNH 74

Query: 88  ENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGIC 146
            NI+ ++  C+++ K      ++ LP+ K G L + +    + N +  E  ++ I   IC
Sbjct: 75  PNILSLVAHCIIE-KGPKWEAWLLLPFVKGGTLWNQVETLRDKNNFLPEDRIVHILHRIC 133

Query: 147 YAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIK 206
             ++A+H           + G                                +AHRD+K
Sbjct: 134 LGLKAIH-----------DRG--------------------------------YAHRDLK 150

Query: 207 PGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKT 266
           P N+LL DD   +P+LMD GS+ +ARI+++   +A+  QD ASQ  T+ YRAPELF V++
Sbjct: 151 PTNVLLEDD--DRPLLMDLGSMNQARIEVKDSRQAMAVQDWASQRCTISYRAPELFHVRS 208

Query: 267 NVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPE 326
           +  ++E+ DIWSLGC LY+M +G  P+D  I ++G S+ALAV N     P  E  +YS  
Sbjct: 209 DCVIDERTDIWSLGCVLYSMMFGEGPYD-MIFQKGDSVALAVQN-NISVPANE--RYSQG 264

Query: 327 FKDLISFMLKVDPKDRPDIHQVIAKVDT 354
            + L+  M+ V+ ++RP I  +I  V+ 
Sbjct: 265 LQSLLCSMMVVNHQERPFISTIINHVEA 292



>gi|156547996|ref|XP_001605375.1| PREDICTED: serine/threonine-protein kinase 16-like isoform 1
           [Nasonia vitripennis]
          Length = 318

 Score =  202 bits (515), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 122/348 (35%), Positives = 184/348 (52%), Gaps = 51/348 (14%)

Query: 17  SCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAM 76
            C     ++ +N + F V++ LG+GGFS V LV+D+ T + YA+KKI C  G +  + A+
Sbjct: 13  GCICAKESITVNGKKFTVLEHLGDGGFSTVSLVEDSITHKKYAIKKIICH-GPEDQRLAV 71

Query: 77  KEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-LQDVINNNLENNK 131
           KE++ + + +H N+I+++D+          N    V + LPYY  G L   +    +  +
Sbjct: 72  KEIEYHSVVNHPNVIELVDSTHQGTADPVVNATSEVLLVLPYYHKGTLAHELERRAKMKE 131

Query: 132 YFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXX 191
           Y    ++L IF  IC  V+A H  + P                                 
Sbjct: 132 YMGSIDILNIFLQICEGVKAFHEAK-PD-------------------------------- 158

Query: 192 XXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQH 251
                  P AHRD+K  NI+L D     P++MD GS+  AR+K+     A   Q+LA++ 
Sbjct: 159 -------PLAHRDLKTANIVLGDGM--TPVIMDLGSVAPARVKVCGNQAAQSLQELAAER 209

Query: 252 STMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNA 311
            +MPYRAPELF+V++   ++E+ DIWSLGC LYAM Y  SPFD  + E+G S+ALAV++A
Sbjct: 210 CSMPYRAPELFNVESYCMVDERTDIWSLGCILYAMCYFKSPFD-TVYERGDSVALAVISA 268

Query: 312 QFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
              FP  E   Y+ + ++LI  MLKV+P +RP I+ VI      L +L
Sbjct: 269 NITFP--ENAPYNEDMQNLILSMLKVNPMERPYIYSVIESTHEVLGRL 314



>gi|488552962|ref|XP_004467827.1| PREDICTED: serine/threonine-protein kinase 16 isoform 1 [Dasypus
           novemcinctus]
          Length = 310

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 116/343 (33%), Positives = 187/343 (54%), Gaps = 57/343 (16%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  I+ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDR-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++  C+ +++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EADMHRLFHHPNILRLVAYCL-KERGPKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEE 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILLLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I ++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIHVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVD-----IWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNA 311
           RAPELF V+++  ++E+ D     IWSLGC LYAM +G  P+D  + ++G S+ALAV N 
Sbjct: 199 RAPELFSVQSHCVIDERTDVWVRSIWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN- 256

Query: 312 QFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
           +   P  +  +YS   + L++ M+ VDP++RP I  ++++V+ 
Sbjct: 257 KLNIP--QSPRYSSAARQLLASMMTVDPQERPHIPLLLSQVEA 297



>gi|242022985|ref|XP_002431917.1| serine/threonine-protein kinase, putative [Pediculus humanus
           corporis]
 gi|212517261|gb|EEB19179.1| serine/threonine-protein kinase, putative [Pediculus humanus
           corporis]
          Length = 316

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 127/350 (36%), Positives = 176/350 (50%), Gaps = 52/350 (14%)

Query: 17  SCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAM 76
           SC     T+ +  + + V  ++G+GGFS V++ + +   R YA+KKI C    D    A+
Sbjct: 12  SCFCGQETIIVKSKKYYVKDVIGDGGFSTVYVAESSYNKRLYAIKKIICHSLDDQAV-AL 70

Query: 77  KEVDMYRLFSHENIIKVIDTCVVQD----KNGGKIVYIFLPYYKSG-LQDVINNNLENNK 131
            E+  +    HE +I++ID  ++      KN    +Y+ LP+Y+ G L   +       K
Sbjct: 71  NEIKGHEKVQHEYVIELIDYEIIGSPDPVKNLTSQLYLVLPFYRRGTLHHELEKRAAWKK 130

Query: 132 YFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXX 191
            F   E L +F  IC  VRA H                                      
Sbjct: 131 PFEPIEALNLFLKICSGVRAFHKLD----------------------------------- 155

Query: 192 XXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQH 251
                  P AHRDIK  NILL  D D  PI+MD GS   AR+ ++   EA   QDLA++ 
Sbjct: 156 ------PPIAHRDIKTANILL--DVDDTPIIMDLGSTAIARVNVENLVEAQNLQDLAAER 207

Query: 252 STMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNA 311
            +MPYRAPELF+V+ N  +NEK D+WSLGC LYA+ +  SP+D  I E+G S+ALAVLN 
Sbjct: 208 CSMPYRAPELFNVEKNTTVNEKTDVWSLGCVLYAICFYKSPYD-IIYEKGDSVALAVLNG 266

Query: 312 QFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLSS 361
           +  FP  E   Y    ++LI  +L V+PK RPDI  VI KV+  L+  S 
Sbjct: 267 KITFP--ENHIYGETMENLIMNLLNVNPKHRPDIDGVIEKVENALKSYSG 314



>gi|462405045|gb|EMJ10509.1| hypothetical protein PRUPE_ppa008104mg [Prunus persica]
          Length = 345

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 184/364 (50%), Gaps = 72/364 (19%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQDT----------------------STGRYYALKKIR 64
           IN   FK+++ LGEGGF+YV LV++                       S    YA+KK+ 
Sbjct: 23  INETRFKIVRQLGEGGFAYVFLVKEVVSDSSASGGGGLAKKFKDPSHVSDDGTYAMKKVL 82

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVV-----QDKNGGKIVYIFLPYYKSG- 118
            Q  S+ ++   +E+ +  LFSH N++ ++D  ++     Q+ +     Y+  P +  G 
Sbjct: 83  IQ-NSEQLELVKEEIRVSSLFSHPNLLPLLDHAIISVKPTQEASWNHEAYLLFPVHLDGT 141

Query: 119 LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIEN 178
           L D         ++FS  ++L+IFR IC  ++ +H++                       
Sbjct: 142 LLDNAKTMKTKKEFFSTSDVLQIFRQICAGLKHMHSFD---------------------- 179

Query: 179 EMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIKIQ 236
                               P+AH DIKPGN+L+T      P  ILMDFGS   AR +I+
Sbjct: 180 -------------------PPYAHNDIKPGNVLITHRKGQPPLAILMDFGSARPARRQIR 220

Query: 237 TRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNN 296
           +R+EAL  Q+ AS+H + P+RAPEL+D  ++ +++E+ DIWSLGCTLYA+ YG SPF+  
Sbjct: 221 SRSEALQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAILYGVSPFEYA 280

Query: 297 INEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL 356
           + E GGS+ LA++N Q ++P   +  Y       I++ML+     RP I  +I  VD  +
Sbjct: 281 LGESGGSLQLAIVNVQIKWPAGPKPPYPDALHQFITWMLQPQAAVRPRIDDIIIHVDKLI 340

Query: 357 EQLS 360
            + S
Sbjct: 341 SKFS 344



>gi|225455752|ref|XP_002269355.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0291350
           isoform 1 [Vitis vinifera]
 gi|297734124|emb|CBI15371.3| unnamed protein product [Vitis vinifera]
          Length = 341

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 181/353 (51%), Gaps = 68/353 (19%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQDTSTGRY------------------YALKKIRCQFG 68
           IN   F++++ LGEGGF+YV LV++  T                     YA+KK+  Q  
Sbjct: 23  INENRFRIVRPLGEGGFAYVFLVKEVVTDSSSSASKKFKDPSHVSDDGTYAMKKVLIQ-N 81

Query: 69  SDSVKDAMKEVDMYRLFSHENIIKVIDTCVV-----QDKNGGKIVYIFLPYYKSG-LQDV 122
           S+ ++   +E+ +  LFSH N++ ++D  ++     Q+       Y+  P +  G L D 
Sbjct: 82  SEQLELVREEIRVSSLFSHPNLLPLLDHAIIGVKTPQEGAWKHEAYLLFPVHLDGTLLDN 141

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXX 182
            N      ++FS  ++L+IFR +C  ++ +H+                            
Sbjct: 142 ANVMKAKKEFFSTSDVLQIFRQLCAGLKHMHSLE-------------------------- 175

Query: 183 XXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIKIQTRNE 240
                           P+AH D+KPGN+LLT      P  +LMDFGS   AR +I++R+E
Sbjct: 176 ---------------PPYAHNDVKPGNVLLTHRKGQPPLAVLMDFGSARPARKQIRSRSE 220

Query: 241 ALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQ 300
           AL  Q+ AS+H + P+RAPEL+D  ++ +++E+ DIWSLGCTLYA+ YG SPF+  + E 
Sbjct: 221 ALQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGES 280

Query: 301 GGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVD 353
           GGS+ LA++NAQ ++P   +  Y       +++ML+     RP I  +I  VD
Sbjct: 281 GGSLQLAIVNAQIKWPAGPKPPYPEALHQFVTWMLQPQATVRPRIDDIIIHVD 333



>gi|340724702|ref|XP_003400720.1| PREDICTED: serine/threonine-protein kinase 16-like isoform 1
           [Bombus terrestris]
          Length = 307

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 133/360 (36%), Positives = 184/360 (51%), Gaps = 62/360 (17%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           ++S+  +L     C     T+ IN R + V + LGEGGFS V LV+DT T + YA+KKI 
Sbjct: 1   MNSLGLSLILKMGCICSKETITINSRKYTVREHLGEGGFSTVLLVEDTITHKKYAIKKII 60

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-L 119
           C  G +  + A KE++ Y L  H NII+ ID+          N    V I LPYY  G L
Sbjct: 61  CH-GLEDQRLAAKEIEYYNLVKHPNIIECIDSTYKGTADPIANATSEVLIVLPYYHRGTL 119

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENE 179
            + +    +N  Y S  ++L IF  IC  V+A H                          
Sbjct: 120 ANELERRAKNKDYMSALDILNIFLQICEGVKAFH-------------------------- 153

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
                         E    P AHRD+K  NI+L DD ++ PILMD GS+  AR+KI    
Sbjct: 154 --------------ETTPEPLAHRDLKTANIVL-DDGNT-PILMDLGSVAPARVKICGSQ 197

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
            A   QDLA++  +MPY+APELF+V++   ++E+ DIWSLGC LYA+ Y  SPFD  + E
Sbjct: 198 AAQTLQDLAAERCSMPYKAPELFNVESYCMVDERTDIWSLGCILYALCYFKSPFD-AVYE 256

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +G S+ALAV++A   FP  E   Y+           +V+P +RP I+ VI  V   + +L
Sbjct: 257 RGDSVALAVMSANITFP--EDAPYT-----------EVNPMERPYIYSVIENVQDYISKL 303



>gi|71727712|gb|AAZ39949.1| serine/threonine protein kinase [Gossypium hirsutum]
          Length = 345

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 186/366 (50%), Gaps = 72/366 (19%)

Query: 25  LHINRRTFKVIKLLGEGGFSYVHLVQDTSTGR----------------------YYALKK 62
           + IN   FK+++ LGEGGF+YV+LV++ ++                         YA+KK
Sbjct: 21  IWINDIRFKIVRQLGEGGFAYVYLVKEVTSDSSSISAGGLAKKVKDPSHLSDDGTYAMKK 80

Query: 63  IRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVV-----QDKNGGKIVYIFLPYYKS 117
           +  Q  ++ ++   +E+ +  LFSH N++ ++D  ++     Q+ +     Y+  P +  
Sbjct: 81  VLIQ-NNEQLELVREEIRVSSLFSHRNLLPLLDHAIISVKPTQEGSWNHEAYLLFPVHLD 139

Query: 118 G-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI 176
           G L D        N +FS  ++ +IFR +C  +  +H+                      
Sbjct: 140 GTLLDNFKAMSAKNDFFSTSDVPQIFRQLCAGLEHMHSLE-------------------- 179

Query: 177 ENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIK 234
                                 P+AH D+KPGN+LLT      P  ILMDFGS   AR +
Sbjct: 180 ---------------------PPYAHNDVKPGNVLLTHRKGESPLAILMDFGSARPARRQ 218

Query: 235 IQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFD 294
           I++R+EAL  Q+ AS+H   P+RAPEL+D  ++ +++E+ DIW+LGCTLYA+ YG SPF+
Sbjct: 219 IRSRSEALQLQEWASEHCAAPFRAPELWDCPSHADVDERTDIWALGCTLYAIMYGVSPFE 278

Query: 295 NNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             + E GGS+ LA++NAQ ++P   + +Y       +++ML+  P  RP I  +I  VD 
Sbjct: 279 YALGESGGSLQLAIVNAQIKWPAGPKPQYPEALHQFVTWMLQPQPSVRPRIDDIIFHVDK 338

Query: 355 QLEQLS 360
            + + S
Sbjct: 339 LISKFS 344



>gi|195395566|ref|XP_002056407.1| GJ10245 [Drosophila virilis]
 gi|194143116|gb|EDW59519.1| GJ10245 [Drosophila virilis]
          Length = 318

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 125/363 (34%), Positives = 190/363 (52%), Gaps = 57/363 (15%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           + S+  TL     C      L+IN   + V + L +GGFS + L  + +T R YA+K+I 
Sbjct: 1   MHSIGWTLIVKRGCFCSKEKLNINGSRYTVRERLAQGGFSLIDLAVNAATRRSYAIKRIT 60

Query: 65  CQFGSDSVKD---AMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKS 117
           C     S++D   A++E++  R    E++I+V+D  +        N    ++I LPYYK 
Sbjct: 61  CH----SIEDQNIALREIENCRKIDSEHVIRVVDYELKGQADIVINTTNTLFIVLPYYKH 116

Query: 118 G-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGI 176
           G L D +        +  E ++L+IF G+C  +RA+H                       
Sbjct: 117 GSLSDHLQLRARKQDHMPEAQILQIFLGVCEGLRAIH----------------------- 153

Query: 177 ENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQ 236
                            E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I 
Sbjct: 154 -----------------EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIC 194

Query: 237 TRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNN 296
            +++A   QD A + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y +SPFD  
Sbjct: 195 GQSDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPFD-P 253

Query: 297 INEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQL 356
           I E+G S+ALAVL+     P  E   Y+ +  +LI +ML++DP +RP I+ VI +    +
Sbjct: 254 IYERGDSVALAVLSGNVNIP--EDSIYTEDMHELIKYMLRIDPMERPFIYSVIEQTHDLI 311

Query: 357 EQL 359
           ++L
Sbjct: 312 QKL 314



>gi|401623380|gb|EJS41482.1| YPL236C [Saccharomyces arboricola H-6]
          Length = 364

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 191/360 (53%), Gaps = 31/360 (8%)

Query: 5   LSSVRDTLYAVTSCC--FPNPTLHINRRTFKVIKLLGEGGFSYVHLVQ------DTSTG- 55
           +S++   L+    CC  F + T+ +N + +K+ +LLGEGG S+V+LVQ      +   G 
Sbjct: 1   MSAIISELFQYLCCCHGFSDTTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKGSLNMENGI 60

Query: 56  ---RYYALKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFL 112
                YALKKI C    +S+ + M+E++ Y+ F    II+ ID+ V+Q+K+G K +YI L
Sbjct: 61  IVPVLYALKKIICP-TVESISNGMREIENYKRFQSPYIIQSIDSQVMQEKDGSKSIYIIL 119

Query: 113 PYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNS 171
           P+Y  G LQD IN  L    + SE E ++I  G+   +  LH    P+   R +N  + +
Sbjct: 120 PFYSLGSLQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHD---PAS--RQDNSTSRA 174

Query: 172 NLNGIENEMXXXXXXXXXXXXXE--------DGVVPFAHRDIKPGNILLTDDADSQPILM 223
            ++ +                 E         G + +AHRDI P N+L +  +D  P++ 
Sbjct: 175 TVDAVSMTYSDETAILLEDTPLEMDMLSSNTAGSIAYAHRDITPSNVLFS--SDGLPVIG 232

Query: 224 DFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTL 283
           D GS  +A I I+ RN+    Q+  + + T+PY APEL +++ N  L+ KVDIWS+GCT 
Sbjct: 233 DLGSCSQADITIRNRNQLSELQEWVNDNCTLPYTAPELLNLRLNQVLSCKVDIWSIGCTF 292

Query: 284 YAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRP 343
           Y + +G SPF+      G S+  A+   ++ FP     ++S    ++I   ++VDP  RP
Sbjct: 293 YTLMFGISPFEREEQIHGASLTYAINTGKYSFP--RNSRFSEGLLNVIKRCIQVDPVQRP 350



>gi|443894753|dbj|GAC72100.1| serine/threonine protein kinase [Pseudozyma antarctica T-34]
          Length = 451

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 95/164 (57%), Positives = 123/164 (75%), Gaps = 2/164 (1%)

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
           ++P+AHRDIKPGN+++ DD  + PILMDFGS ++AR+ I+TR EA+  QDLA++ S+MPY
Sbjct: 288 LLPYAHRDIKPGNVMVADDGQT-PILMDFGSTIKARVHIKTRKEAVAHQDLAAERSSMPY 346

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNIN-EQGGSIALAVLNAQFRF 315
           RAPELFDV T+V L E VDIWSLGC LYA+AY  SPF+     EQGGSIALAVLN  ++ 
Sbjct: 347 RAPELFDVPTDVTLTEAVDIWSLGCLLYALAYLHSPFETTQTVEQGGSIALAVLNGSYKT 406

Query: 316 PPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           PP+ QD YS + +++I   ++V P+DRPDI QVI    T L  L
Sbjct: 407 PPSSQDPYSEKTREIIKRCIQVKPEDRPDIDQVIKLTQTALRGL 450



 Score =  156 bits (395), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (62%), Gaps = 28/185 (15%)

Query: 4   VLSSVRDTLYAVTSC--CFPNPT-LHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYAL 60
           +    +D ++A++SC  C P  + L +N R+F+++KLLGEGGFS+V+LV+D ++GR +AL
Sbjct: 15  LFERAQDAIFALSSCLPCTPETSVLKLNGRSFQIVKLLGEGGFSFVYLVKDQASGRLFAL 74

Query: 61  KKIRCQ-FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGG-------------- 105
           KKIRC  +G+DS ++AMKE++  + F   +II + D+CVVQD  G               
Sbjct: 75  KKIRCSGYGADSFQEAMKEIEATKRFRSPHIIPIYDSCVVQDDAGSGTLFGNLPSNDPDG 134

Query: 106 ---------KIVYIFLPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTY 155
                    K++Y+FLP+Y+ G LQDVIN ++     F E+EML  F G C AVR +H Y
Sbjct: 135 AGGRGSDGGKVIYLFLPFYEKGNLQDVINAHVVRGTRFGEREMLNFFLGTCKAVREMHHY 194

Query: 156 RFPSV 160
           R P+V
Sbjct: 195 RLPNV 199



>gi|395527665|ref|XP_003765963.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 16,
           partial [Sarcophilus harrisii]
          Length = 280

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/318 (34%), Positives = 175/318 (55%), Gaps = 52/318 (16%)

Query: 38  LGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTC 97
           L   GFSYV LV+    G++YALK+I C    D  ++A +E DM+RLF H NI+++   C
Sbjct: 1   LAPSGFSYVDLVEGLQDGQFYALKRILCHEQQDQ-EEARREADMHRLFQHPNILRLEAYC 59

Query: 98  VVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYR 156
           +  D+   +  ++ LP+ K G L   +    +   + SE ++L +  GIC  + A+H+  
Sbjct: 60  LT-DRGSKQEAWLLLPFLKRGTLWSEVEGLKDKGSFLSEDQILLLLLGICRGLEAIHSKG 118

Query: 157 FPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDA 216
           +                                           AHRD+KP NILL DD 
Sbjct: 119 Y-------------------------------------------AHRDLKPTNILLGDDG 135

Query: 217 DSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDI 276
             QP+LMD GS+ +A+I+++   +AL  QD A+Q  T+ YRAPELF V+++  ++E+ D+
Sbjct: 136 --QPVLMDLGSMNQAQIQVEGSRQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDV 193

Query: 277 WSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLK 336
           WSLGC LYAM +G  P+D  + ++G S+ALAV N Q   P  +  ++SPE + L++ M+ 
Sbjct: 194 WSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-QLSIP--QSPRHSPELRQLLASMMT 249

Query: 337 VDPKDRPDIHQVIAKVDT 354
           VDP+ RP    ++ ++++
Sbjct: 250 VDPQCRPHTSLLLNQLES 267



>gi|27465615|ref|NP_775165.1| serine/threonine-protein kinase 16 [Rattus norvegicus]
 gi|13124540|sp|P57760.2|STK16_RAT RecName: Full=Serine/threonine-protein kinase 16; AltName:
           Full=Myristoylated and palmitoylated
           serine/threonine-protein kinase; Short=MPSK; AltName:
           Full=Protein kinase PKL12; AltName:
           Full=TGF-beta-stimulated factor 1; Short=TSF-1; AltName:
           Full=Tyrosine-protein kinase STK16
 gi|10640952|dbj|BAB16310.1| F52 [Rattus norvegicus]
 gi|149016156|gb|EDL75402.1| serine/threonine kinase 16, isoform CRA_a [Rattus norvegicus]
 gi|149016157|gb|EDL75403.1| serine/threonine kinase 16, isoform CRA_a [Rattus norvegicus]
 gi|149016159|gb|EDL75405.1| serine/threonine kinase 16, isoform CRA_a [Rattus norvegicus]
          Length = 305

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  ++ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQ-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E DM+RLF H NI++++    ++++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EADMHRLFQHPNILRLM-AYSLKERGAKHEAWLLLPFFKRGTLWNEIERLKDQGNFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GIC  + A+H                                           
Sbjct: 124 QILPLLLGICRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I+++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N     P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-DLSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L++ M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLASMMTVDPQQRPHIPVLLSQLEA 292



>gi|470126586|ref|XP_004299264.1| PREDICTED: probable serine/threonine-protein kinase
           DDB_G0291350-like isoform 1 [Fragaria vesca subsp.
           vesca]
          Length = 343

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 116/362 (32%), Positives = 185/362 (51%), Gaps = 70/362 (19%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQ----DTSTGR----------------YYALKKIRCQ 66
           IN   FK+++ LGEGGF++V LV+    D+S+                   YA+KK+  Q
Sbjct: 23  INENRFKIVRQLGEGGFAFVFLVKEVVSDSSSATSLANKFKDASHVSDDGTYAMKKVLIQ 82

Query: 67  FGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVV-----QDKNGGKIVYIFLPYYKSG-LQ 120
             S+ ++   +E+ +  LF+H N++ ++D  ++     QD++     Y+  P +  G L 
Sbjct: 83  -NSEQLELVKEEIQVSSLFTHPNLLPLLDHAIISVKPTQDQSWNHEAYLLFPVHLDGTLL 141

Query: 121 DVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEM 180
           D         ++FS  ++L+IFR +C  ++ +H +                         
Sbjct: 142 DNAKVMKTKKEFFSTSDVLQIFRQLCAGLKHMHNFE------------------------ 177

Query: 181 XXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIKIQTR 238
                             P+AH DIKPGN+L+T      P  ILMDFGS   AR +I+TR
Sbjct: 178 -----------------PPYAHNDIKPGNVLITHRKGQPPLAILMDFGSARPARKQIRTR 220

Query: 239 NEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNIN 298
           +EAL  Q+ AS+H + P+RAPEL+D  +  +++E+ DIWSLGCTLYA+ YG SPF+  + 
Sbjct: 221 SEALQLQEWASEHCSAPFRAPELWDCPSQADIDERTDIWSLGCTLYAILYGVSPFEYALG 280

Query: 299 EQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQ 358
           E GGS+ LA++N Q ++P   +  +       I++ML+     RP I  +I  VD  + +
Sbjct: 281 ESGGSLQLAIVNVQIKWPAGPKPPFPDALHQFITWMLQPQAAVRPRIDDIIIHVDKLISK 340

Query: 359 LS 360
            S
Sbjct: 341 FS 342



>gi|465957484|gb|EMP27432.1| Serine/threonine-protein kinase 16 [Chelonia mydas]
          Length = 319

 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 183/351 (52%), Gaps = 68/351 (19%)

Query: 12  LYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDS 71
           L+ V SC  P  T    R            GFSYV LV+    GR+YALK+I C    D 
Sbjct: 26  LWGVGSCSCPTHTSLPLR------------GFSYVDLVEGLQDGRFYALKRILCHDKED- 72

Query: 72  VKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENN 130
            ++A+ EV+M+ LF H NI+++   C+V+ K      ++ LP+ + G L   +    +  
Sbjct: 73  CREALHEVEMHGLFEHPNILRLEAHCMVE-KGPKHEAWLLLPFLRRGTLWSEVEALRDKG 131

Query: 131 KYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXX 190
            + +E+ ++ I  GIC  ++A+H   +                                 
Sbjct: 132 TFLAEERIVPILLGICRGLQAIHAKGY--------------------------------- 158

Query: 191 XXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQ 250
                     AHRD+KP N+LL D+   QP+LMD GS+ +ARI+++   EA+  QD A+Q
Sbjct: 159 ----------AHRDLKPTNVLLDDE--EQPVLMDLGSMNQARIEVKGSREAMAVQDWAAQ 206

Query: 251 HSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLN 310
             T+ YRAPELF V+++  ++E+ DIWSLGC LY M +G  P+D  I ++G S+ALAV N
Sbjct: 207 RCTISYRAPELFTVESHCVIDERTDIWSLGCVLYCMMFGEGPYD-LIFQKGDSVALAVQN 265

Query: 311 AQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLSS 361
            Q R PP+   +YS   + L+S M+ V P++RP +  ++     QLE L S
Sbjct: 266 -QLRVPPS--SRYSAALERLLSSMMAVSPQERPHVSHIL----DQLEGLQS 309



>gi|147842217|emb|CAN66918.1| hypothetical protein VITISV_043041 [Vitis vinifera]
          Length = 341

 Score =  201 bits (510), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 180/353 (50%), Gaps = 68/353 (19%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQDTSTGRY------------------YALKKIRCQFG 68
           IN   F +++ LGEGGF+YV LV++  T                     YA+KK+  Q  
Sbjct: 23  INENRFXIVRPLGEGGFAYVFLVKEVVTDSSSSASKKFKDPSHVSDDGTYAMKKVLIQ-N 81

Query: 69  SDSVKDAMKEVDMYRLFSHENIIKVIDTCVV-----QDKNGGKIVYIFLPYYKSG-LQDV 122
           S+ ++   +E+ +  LFSH N++ ++D  ++     Q+       Y+  P +  G L D 
Sbjct: 82  SEQLELVREEIRVSSLFSHPNLLPLLDHAIIGVKTPQEGAWKHEAYLLFPVHLDGTLLDN 141

Query: 123 INNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXX 182
            N      ++FS  ++L+IFR +C  ++ +H+                            
Sbjct: 142 ANVMKAKKEFFSTSDVLQIFRQLCAGLKHMHSLE-------------------------- 175

Query: 183 XXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIKIQTRNE 240
                           P+AH D+KPGN+LLT      P  +LMDFGS   AR +I++R+E
Sbjct: 176 ---------------PPYAHNDVKPGNVLLTHRKGQPPLAVLMDFGSARPARKQIRSRSE 220

Query: 241 ALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQ 300
           AL  Q+ AS+H + P+RAPEL+D  ++ +++E+ DIWSLGCTLYA+ YG SPF+  + E 
Sbjct: 221 ALQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGES 280

Query: 301 GGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVD 353
           GGS+ LA++NAQ ++P   +  Y       +++ML+     RP I  +I  VD
Sbjct: 281 GGSLQLAIVNAQIKWPAGPKPPYPEALHQFVTWMLQPQATVRPRIDDIIIHVD 333



>gi|229366470|gb|ACQ58215.1| Serine/threonine-protein kinase 16 [Anoplopoma fimbria]
          Length = 305

 Score =  201 bits (510), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 119/341 (34%), Positives = 187/341 (54%), Gaps = 58/341 (17%)

Query: 16  TSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDA 75
           T C     ++ I+ + +  ++ L EGGFSYV LV+    GR+YALK+I C+   +  ++A
Sbjct: 4   TLCICSRGSITIDNKKYYFVQKLDEGGFSYVDLVEGAKDGRFYALKRILCR-DREGHQEA 62

Query: 76  MKEVDMYRLFSHENIIKVIDTCVVQDKNGGKI-VYIFLPYYKSG-LQDVINNNLENNKYF 133
             EV+M+++F+H N++ ++    V    GGK   ++ LPY + G L  V+    +     
Sbjct: 63  QTEVEMHQIFNHPNVLSLVANTFV--GRGGKTEAWLLLPYIRKGSLWSVLEKLRDKGSSM 120

Query: 134 SEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXX 193
            EK++L I RGIC  ++A+H           E G                          
Sbjct: 121 PEKQILHILRGICSGLKAIH-----------EKG-------------------------- 143

Query: 194 EDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHST 253
                 +AHRD+KP N+LL  D D +P+LMD GS+ RARI+++   EA+  QD A+Q  T
Sbjct: 144 ------YAHRDLKPTNVLL--DEDDRPLLMDLGSMNRARIEVRGTREAMTIQDWAAQRCT 195

Query: 254 MPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQF 313
           + YRAPELF+V+++  ++E+ DIWSLGC LY M     P+D  + ++G S+ALAV N   
Sbjct: 196 ISYRAPELFNVESHCVIDERTDIWSLGCVLYCMMMLEGPYD-MVFQKGDSVALAVQN--- 251

Query: 314 RFPPT--EQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
             P T  +   YS   + L+S ++  +P++RP+IH V+ +V
Sbjct: 252 --PVTIPQSCSYSQGLQMLLSSVMVSNPQERPNIHWVLDQV 290



>gi|498949238|ref|XP_004543459.1| PREDICTED: serine/threonine-protein kinase 16-like [Maylandia
           zebra]
          Length = 305

 Score =  200 bits (509), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 117/338 (34%), Positives = 186/338 (55%), Gaps = 52/338 (15%)

Query: 16  TSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDA 75
           T C     ++ I+ + +  ++ L EGGFS+V LV+    G +YALK+I C    +  ++A
Sbjct: 4   TMCVCSRASITIDNKKYYFVQKLDEGGFSFVDLVEGVKDGHFYALKRILCH-DREGRQEA 62

Query: 76  MKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFS 134
             EV+M+++F+H N++ ++    V D  G     + LPY + G L  V+    +      
Sbjct: 63  QTEVEMHQMFNHPNVLSLVAHSFV-DHGGKTEARLLLPYMRKGSLWSVLEKLRDKGSSMP 121

Query: 135 EKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXE 194
           EK++L+IFRGIC  ++A+H           + G                           
Sbjct: 122 EKQILQIFRGICSGLKAIH-----------DKG--------------------------- 143

Query: 195 DGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTM 254
                +AHRDIKP N+LL  D D +P+LMD GS+ RARI+++   EA+  QD A+Q  T+
Sbjct: 144 -----YAHRDIKPTNVLL--DEDDRPVLMDLGSMNRARIEVKGSREAMTIQDWAAQRCTI 196

Query: 255 PYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFR 314
            YRAPELF+V+++  ++E+ DIWSLGC LY M     P+D  I ++G S+ALAV N    
Sbjct: 197 SYRAPELFNVESHCIIDERTDIWSLGCVLYCMMMLEGPYD-LIFQKGDSVALAVQNP-VS 254

Query: 315 FPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
            PP+   +YS   + L+S ++  +P++RP+I+ V+ +V
Sbjct: 255 IPPS--CRYSEGLQMLLSSIMVSNPQERPNINWVLDQV 290



>gi|26327983|dbj|BAC27732.1| unnamed protein product [Mus musculus]
          Length = 305

 Score =  200 bits (509), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 110/338 (32%), Positives = 185/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  ++ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQ-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E +M+RLF H NI++++    ++++      ++ LP++K G L + I    +   + +E+
Sbjct: 65  EAEMHRLFQHPNILRLM-AYSLKERGAKHEAWLLLPFFKKGTLWNEIERLKDQGSFLTER 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GI   + A+H                                           
Sbjct: 124 QILPLLLGISRGLEAIHAK----------------------------------------- 142

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
              +AHRD+KP NILL D+   QP+LMD GS+ +A I+++   +AL  QD A+Q  T+ Y
Sbjct: 143 --GYAHRDLKPTNILLGDEG--QPVLMDLGSMNQACIQVERSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N +   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-ELSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L+S M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLSSMMTVDPQQRPHIPVLLSQLEA 292



>gi|118093736|ref|XP_001231623.1| PREDICTED: serine/threonine-protein kinase 16 isoformX1 [Gallus
           gallus]
          Length = 317

 Score =  200 bits (509), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 179/353 (50%), Gaps = 57/353 (16%)

Query: 7   SVRDTLYAVTSCCFPNPTLHIN-RRTFKVI----KLLGEGGFSYVHLVQDTSTGRYYALK 61
            V D   A+T+ C P   L    RR F       +     GFSYV LV+    GR+YALK
Sbjct: 2   GVTDDADALTTRCPPLAALRSPPRRHFGAAVPTRRSAPRRGFSYVDLVEGLRDGRFYALK 61

Query: 62  KIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQ 120
           +I C    D  + A++EV+M+ LF H NI+++   C+V+ K      ++ LPY K G L 
Sbjct: 62  RILCHDKEDR-QAALREVEMHNLFQHPNILRLEAHCMVE-KGAKHEAWLLLPYVKGGTLW 119

Query: 121 DVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEM 180
             +    E   +  E+ +L I RGIC  ++A+H   +                       
Sbjct: 120 SEVEALREKGTFMPEQRILLILRGICSGLQAIHGKGY----------------------- 156

Query: 181 XXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNE 240
                               AHRD+KP N+LL  D D QPILMD GS+ RAR+++    E
Sbjct: 157 --------------------AHRDLKPTNVLL--DEDDQPILMDLGSMNRARMEVTNSRE 194

Query: 241 ALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQ 300
           A+  QD A+Q  T+ YRAPELF V +   ++E+ DIWSLGC LY M +G  PFD  I ++
Sbjct: 195 AMAVQDWAAQRCTISYRAPELFTVPSQCIIDERTDIWSLGCVLYCMMFGEGPFD-AIFQK 253

Query: 301 GGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVD 353
           G S+ALAV N     P T   +YS     L+  M+ V+P++RP I  ++ +++
Sbjct: 254 GDSVALAVQNP-IAIPTT--SRYSAALHRLLFSMMTVNPQERPSIEDILQQLE 303



>gi|194741512|ref|XP_001953233.1| GF17312 [Drosophila ananassae]
 gi|190626292|gb|EDV41816.1| GF17312 [Drosophila ananassae]
          Length = 318

 Score =  200 bits (509), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 185/360 (51%), Gaps = 51/360 (14%)

Query: 5   LSSVRDTLYAVTSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIR 64
           + S+  TL     C     TL+IN   + +   L +GGFS + L ++  T R YA+K+I 
Sbjct: 1   MQSLGWTLIMKRGCFCRKETLNINGSRYTIRDRLAQGGFSLIDLAENAITRRSYAIKRIT 60

Query: 65  CQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-L 119
           C    D    A++E++  R    EN+I+V+D  +        N    ++I LPYYK G L
Sbjct: 61  CH-SIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGAL 119

Query: 120 QDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENE 179
            D +        +  E ++L+IF G+C  ++A+H                          
Sbjct: 120 ADHLQLRARKQDHMPEAQILQIFLGVCEGLKAIH-------------------------- 153

Query: 180 MXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRN 239
                         E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I  ++
Sbjct: 154 --------------EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIVGQS 197

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           +A   QD A + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y  SPFD  I E
Sbjct: 198 DAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFHSPFD-PIYE 256

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           +G S+ALAVL+     P  E   Y+ +  +LI++ML+ DP +RP I  VI +    +++L
Sbjct: 257 RGDSVALAVLSGNVNIP--EDSIYTEDMHELINYMLRTDPMERPFIFSVIERTHDLIQKL 314



>gi|460380689|ref|XP_004236087.1| PREDICTED: probable serine/threonine-protein kinase
           DDB_G0291350-like [Solanum lycopersicum]
          Length = 342

 Score =  200 bits (509), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 113/361 (31%), Positives = 183/361 (50%), Gaps = 69/361 (19%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQDT-------------------STGRYYALKKIRCQF 67
           IN   FK+++ LGEGGF+YV LV++                    S    YA+KK+  Q 
Sbjct: 23  INENRFKIVRQLGEGGFAYVFLVKEVISDPSNPGVSKKFKDSSHISDDGTYAMKKVLIQ- 81

Query: 68  GSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQ-----DKNGGKIVYIFLPYYKSG-LQD 121
            S+ +    +E+ +  LF+H N++ ++D  ++      D++     Y+  P +  G L D
Sbjct: 82  NSEQLALVKEEIRVSSLFTHPNLLPLLDHAIIAVKAGPDQSWKHEAYLLFPVHLDGTLLD 141

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMX 181
                    ++FS  ++L+IFR +C  ++ +H++                          
Sbjct: 142 NATGMKAKKEFFSTSDVLQIFRQLCAGLKHMHSFD------------------------- 176

Query: 182 XXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIKIQTRN 239
                            P+AH D+KPGN+LLT   +  P  +LMDFGS   AR +I++R 
Sbjct: 177 ----------------PPYAHNDVKPGNVLLTHRREQPPLAVLMDFGSTRPARKQIRSRQ 220

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           EAL  Q+ A++H + P+RAPEL+D  +  +++E+ DIWSLGCTLYA+ YG SPF+  + E
Sbjct: 221 EALQLQEWAAEHVSAPFRAPELWDCPSQCDIDERTDIWSLGCTLYAIMYGVSPFEYALGE 280

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            GGS+ LA++NAQ ++P   +  Y       +++ML+     RP I  +I  VD  + + 
Sbjct: 281 SGGSLQLAIVNAQIKWPAGPKPPYPEALHQFVTWMLQPQGTVRPRIDDIIIHVDKLISKF 340

Query: 360 S 360
           S
Sbjct: 341 S 341



>gi|52345488|ref|NP_001004792.1| serine/threonine kinase 16 [Xenopus (Silurana) tropicalis]
 gi|49257927|gb|AAH74528.1| MGC69350 protein [Xenopus (Silurana) tropicalis]
          Length = 305

 Score =  200 bits (508), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 117/328 (35%), Positives = 183/328 (55%), Gaps = 53/328 (16%)

Query: 28  NRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMKEVDMYRLFSH 87
           N+R F V KL GEGGFSYV LV+    GR+YALK+I C    D  K+A  EV+M+RLF+H
Sbjct: 17  NKRYFFVHKL-GEGGFSYVDLVEGVQDGRFYALKRILCHDREDR-KEAQHEVEMHRLFNH 74

Query: 88  ENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGIC 146
            N++ ++   +++ K      ++ LP+ K G L + +    + N + SE  ++ I  GIC
Sbjct: 75  PNVLPLVAHSIIE-KGPKWEAWLLLPFVKGGTLWNQVEVLRDRNSFLSEDRIVHILHGIC 133

Query: 147 YAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIK 206
             ++A+H           + G                                +AHRD+K
Sbjct: 134 LGLKAIH-----------DRG--------------------------------YAHRDLK 150

Query: 207 PGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKT 266
           P N+LL DD   +P+LMD GS+ +AR++++   +A+  QD A+Q  T+ YRAPELF+V +
Sbjct: 151 PTNVLLEDD--DRPLLMDLGSMNQARMEVKDSRQAMAVQDWAAQRCTISYRAPELFNVSS 208

Query: 267 NVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPE 326
           +  ++E+ DIWSLGC L++M +G  P+D  I ++G S+ALAV N     P  E  +YS  
Sbjct: 209 DCVIDERTDIWSLGCVLFSMMFGEGPYD-MIFQKGDSVALAVQN-NITVPANE--RYSQG 264

Query: 327 FKDLISFMLKVDPKDRPDIHQVIAKVDT 354
            + L+  M+ V+ ++RP I  +I+ V+ 
Sbjct: 265 LQTLLCSMMVVNSQERPFISTIISHVEA 292



>gi|357158203|ref|XP_003578050.1| PREDICTED: probable serine/threonine-protein kinase
           DDB_G0291350-like isoform 1 [Brachypodium distachyon]
          Length = 336

 Score =  200 bits (508), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 115/356 (32%), Positives = 186/356 (52%), Gaps = 65/356 (18%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQ------DTSTGRY---------YALKKIRCQFGSDS 71
           IN R F+V++ +GEGGF++V+LV+      D + GR+         YA+KK+  Q   + 
Sbjct: 23  INERRFRVLRQIGEGGFAFVYLVKEHEASSDAARGRHPSHVSEDGTYAMKKVLIQ-SKEQ 81

Query: 72  VKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-LQDVINNN 126
           +    +E+ +  LF+H N++ ++D  ++  K    +     Y+  P Y  G L D     
Sbjct: 82  LDLVKEEIRVSSLFNHPNLLPLLDHAIIAVKTEQGDWSHEAYLLFPVYLDGTLFDNSKAM 141

Query: 127 LENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXX 186
               +++S   +L+IFR IC  V+ +H++                               
Sbjct: 142 WSRKEFYSVFHILQIFRQICEGVKHMHSFD------------------------------ 171

Query: 187 XXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPI--LMDFGSLVRARIKIQTRNEALMQ 244
                       P+AH D+KPGN+L+T      P+  LMDFGS   AR KI++R+EAL  
Sbjct: 172 -----------PPYAHNDVKPGNVLITHRKGQAPLATLMDFGSSRPARNKIRSRSEALRL 220

Query: 245 QDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSI 304
           Q+ A++H + P+RAPEL+D  ++ +++E+ DIWSLGCTLYA+ YG SPF+  + E GGS+
Sbjct: 221 QEWAAEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGGSL 280

Query: 305 ALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQLS 360
            LA++N Q ++P      Y       +++ML   P  RP I+ ++  VD  +E+ S
Sbjct: 281 QLAIMNVQLKWPLVPS-PYPDSLHKFLTWMLHPQPAMRPRINDILLHVDKLVERYS 335



>gi|348516509|ref|XP_003445781.1| PREDICTED: serine/threonine-protein kinase 16-like [Oreochromis
           niloticus]
          Length = 305

 Score =  199 bits (507), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 186/338 (55%), Gaps = 52/338 (15%)

Query: 16  TSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDA 75
           T C     ++ I+ + +  ++ L EGGFS+V LV+    G +YALK+I C    +  ++A
Sbjct: 4   TMCVCSRASIIIDNKKYYFVQKLDEGGFSFVDLVEGVKDGHFYALKRILCH-DREGRQEA 62

Query: 76  MKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFS 134
             EV+M+++F+H N++ ++    V D       ++ LPY + G L  V+    +      
Sbjct: 63  QTEVEMHQMFNHPNVLSLVAHAFV-DHGAKTEAWLLLPYMRKGSLWSVLEKLRDKGSSMP 121

Query: 135 EKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXE 194
           EK++L+IFRGIC  ++A+H           + G                           
Sbjct: 122 EKQILQIFRGICSGLKAIH-----------DKG--------------------------- 143

Query: 195 DGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTM 254
                +AHRDIKP N+LL  D D +P+LMD GS+ RARI+++   EA+  QD A+Q  T+
Sbjct: 144 -----YAHRDIKPTNVLL--DEDDRPVLMDLGSMNRARIEVRGSREAMTIQDWAAQRCTI 196

Query: 255 PYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFR 314
            YRAPELF+V+++  ++E+ DIWSLGC LY M     P+D  I ++G S+ALAV N    
Sbjct: 197 SYRAPELFNVESHCIIDERTDIWSLGCVLYCMMMLEGPYD-LIFQKGDSVALAVQNP-VS 254

Query: 315 FPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
            PP+   +YS   + L+S ++  +P++RP+I+ V+ +V
Sbjct: 255 IPPS--CRYSEGLQMLLSSIMVSNPQERPNINWVLDQV 290



>gi|195482151|ref|XP_002086757.1| GE11119 [Drosophila yakuba]
 gi|194186547|gb|EDX00159.1| GE11119 [Drosophila yakuba]
          Length = 320

 Score =  199 bits (507), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 125/362 (34%), Positives = 188/362 (51%), Gaps = 53/362 (14%)

Query: 5   LSSVRDTLYAVTSCCFP--NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKK 62
           + S+  TL     C F     TL+IN   + + + L  GGFS + L +++ST R YA+K+
Sbjct: 1   MQSIGWTLIMKRGCLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENSSTRRSYAIKR 60

Query: 63  IRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG 118
           I C    D    A++E++  R    EN+I+V+D  +        N    ++I LPYYK G
Sbjct: 61  ITCH-SIDDQNIALREIENCRKIDSENVIQVVDYELKGQADIVINTTSTLFIVLPYYKHG 119

Query: 119 -LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIE 177
            L D +      + +  E ++L+IF G+C  ++A+H                        
Sbjct: 120 SLADHLQLRSRKHDHMPEAQILQIFLGVCEGLKAIH------------------------ 155

Query: 178 NEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQT 237
                           E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I  
Sbjct: 156 ----------------EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIVG 197

Query: 238 RNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNI 297
           + +A   QD A + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y +SP+D  I
Sbjct: 198 QTDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERSDIWSLGCVLYAMCYFNSPYD-PI 256

Query: 298 NEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLE 357
            E+G S+ALAVL+     P  E   Y+ +  +LI +ML+ DP +RP I  VI +    ++
Sbjct: 257 YERGDSVALAVLSGNINIP--EDSIYTEDMHELIKYMLRTDPMERPFIFSVIERTHDLIQ 314

Query: 358 QL 359
           +L
Sbjct: 315 KL 316



>gi|194899239|ref|XP_001979168.1| GG25282 [Drosophila erecta]
 gi|190650871|gb|EDV48126.1| GG25282 [Drosophila erecta]
          Length = 320

 Score =  199 bits (507), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 125/362 (34%), Positives = 187/362 (51%), Gaps = 53/362 (14%)

Query: 5   LSSVRDTLYAVTSCCFP--NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKK 62
           + S+  TL     C F     TL+IN   + + + L  GGFS + L +++ST R YA+K+
Sbjct: 1   MQSIGWTLIMKRGCLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENSSTRRSYAIKR 60

Query: 63  IRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG 118
           I C    D    A++E++  R    EN+I+V+D  +        N    ++I LPYYK G
Sbjct: 61  ITCH-SIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHG 119

Query: 119 -LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIE 177
            L D +        +  E ++L+IF G+C  ++A+H                        
Sbjct: 120 SLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIH------------------------ 155

Query: 178 NEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQT 237
                           E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I  
Sbjct: 156 ----------------EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIVG 197

Query: 238 RNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNI 297
           + +A   QD A + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y +SP+D  I
Sbjct: 198 QTDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERSDIWSLGCVLYAMCYFNSPYD-PI 256

Query: 298 NEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLE 357
            E+G S+ALAVL+     P  E   Y+ +  +LI +ML+ DP +RP I  VI +    ++
Sbjct: 257 YERGDSVALAVLSGNINIP--EDSIYTEDMHELIKYMLRTDPMERPFIFSVIERTHDLIQ 314

Query: 358 QL 359
           +L
Sbjct: 315 KL 316



>gi|502151836|ref|XP_004508637.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X1
           [Cicer arietinum]
 gi|502151838|ref|XP_004508638.1| PREDICTED: serine/threonine-protein kinase 16-like isoform X2
           [Cicer arietinum]
          Length = 342

 Score =  199 bits (507), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 113/361 (31%), Positives = 187/361 (51%), Gaps = 69/361 (19%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQD----TSTGRY---------------YALKKIRCQF 67
           IN   F++++ LGEGGF+YV+LV++    ++TG                 YA+KK+  Q 
Sbjct: 23  INENRFRILRQLGEGGFAYVYLVKELPNESATGGLANKIKDSSHISDDGSYAMKKVLIQ- 81

Query: 68  GSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK-----NGGKIVYIFLPYYKSG-LQD 121
            S+ ++   +E+ +  LFSH N++ ++D  ++  K     +     Y+  P +  G L D
Sbjct: 82  NSEQLELVREEIRVSSLFSHPNLLPLLDHAIISVKPTPETSWSHEAYLLFPVHLDGTLLD 141

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMX 181
                    ++++  ++L+IFR +C  ++ +H+                           
Sbjct: 142 NAKTMKAKKEHYTTSDVLQIFRQLCAGLKHMHSLD------------------------- 176

Query: 182 XXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIKIQTRN 239
                            P+AH D+KPGN+L+T   +  P  ILMDFGS   AR +I +R+
Sbjct: 177 ----------------PPYAHNDVKPGNVLITHRKEQPPLAILMDFGSARPARKQISSRS 220

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           EAL  Q+ AS+H + P+RAPEL+D  ++ +++E+ D+WSLGCTLYA+ YG SPF+  + E
Sbjct: 221 EALQLQEWASEHCSAPFRAPELWDCPSHADIDERTDVWSLGCTLYAIMYGVSPFEYALGE 280

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            GGS+ LA++NAQ ++P   +  Y       +S+ML+     RP I  +I  VD  + + 
Sbjct: 281 SGGSLQLAIVNAQVKWPAGLKPSYPEALHQFVSWMLQPQAAMRPRIDDIIIHVDKLVAKF 340

Query: 360 S 360
           S
Sbjct: 341 S 341



>gi|213512603|ref|NP_001133526.1| serine/threonine-protein kinase 16 [Salmo salar]
 gi|209154354|gb|ACI33409.1| Serine/threonine-protein kinase 16 [Salmo salar]
          Length = 305

 Score =  199 bits (506), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 187/338 (55%), Gaps = 52/338 (15%)

Query: 16  TSCCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDA 75
           T C     ++ I+ + +  I+ L EGGFSYV LV+    GR+YALK+I C    +  ++A
Sbjct: 4   TLCICSRGSITIDNKRYYFIQKLDEGGFSYVDLVEGVQDGRFYALKRILCH-DREGRQEA 62

Query: 76  MKEVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFS 134
             EV+M+RLFSH NI+ +     ++ + G    +I LPY + G L  V+    +   +  
Sbjct: 63  QTEVEMHRLFSHPNILGLAGHTFIE-RGGKSEAWILLPYVQKGSLWSVLEKLRDKGSFMP 121

Query: 135 EKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXE 194
           E+ +LK+ +GIC  ++A+H           + G                           
Sbjct: 122 ERRILKVLQGICSGLKAMH-----------DRG--------------------------- 143

Query: 195 DGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTM 254
                +AHRD+KP N+LL  + D +P+LMD GS+ R+R++++   EA+  QD A+Q  T+
Sbjct: 144 -----YAHRDLKPTNVLL--EEDDRPLLMDLGSMNRSRMEVKGTREAMTVQDWAAQRCTI 196

Query: 255 PYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFR 314
            YRAPELF+V+++  ++++ DIWSLGC LY+M +   P+D  + ++G S+ALAV N    
Sbjct: 197 SYRAPELFNVESHCVIDDRTDIWSLGCVLYSMMFLEGPYD-MVFQKGDSVALAVQNPVTI 255

Query: 315 FPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKV 352
             P     YS   ++L+S ++  +P++RPD++ ++ ++
Sbjct: 256 PQPC---SYSEGLQNLLSSIMVSNPQERPDVNWILDQI 290



>gi|224118834|ref|XP_002317918.1| predicted protein [Populus trichocarpa]
 gi|222858591|gb|EEE96138.1| predicted protein [Populus trichocarpa]
          Length = 352

 Score =  199 bits (506), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 191/372 (51%), Gaps = 79/372 (21%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQD--------TSTGRY--------------------- 57
           IN   F++++ LGEGGF+YV+LV++        +S GR                      
Sbjct: 23  INENRFRIVRQLGEGGFAYVYLVKEVVNVSSPASSGGRAAVGGGLSKKVKDKSHLSVDGT 82

Query: 58  YALKKIRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVV-----QDKNGGKIVYIFL 112
           YA+KK+  Q  ++ ++   +E+ +  LF+H N++ ++D  ++     Q+ +     Y+  
Sbjct: 83  YAMKKVLIQ-NNEQLELVREEIRVSSLFNHSNLLPLLDHAIISVKATQEGSWNHEAYLLF 141

Query: 113 PYYKSG-LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNS 171
           P +  G L D         ++FS  ++L+IFR +C  ++ +H                  
Sbjct: 142 PVHLDGTLLDNSAAMKSKKEFFSTTDVLQIFRQLCAGLKNMH------------------ 183

Query: 172 NLNGIENEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLV 229
           NL+                        P+AH D+KPGN+LLT      P  ILMDFGS  
Sbjct: 184 NLD-----------------------PPYAHNDVKPGNVLLTHRKGHSPLAILMDFGSAR 220

Query: 230 RARIKIQTRNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYG 289
            AR +I++R+EAL  Q+ AS+H + P+RAPEL+D  ++ +++E+ DIWSLGCTLYA+ YG
Sbjct: 221 PARKQIRSRSEALQLQEWASEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYG 280

Query: 290 SSPFDNNINEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVI 349
            SPF+  + E GGS+ LA++NAQ ++P   +  Y       +++ML+     RP I  +I
Sbjct: 281 VSPFEYALGESGGSLQLAIVNAQIKWPAGPKPPYPEALHQFVTWMLQPQAAVRPHIDDII 340

Query: 350 AKVDTQLEQLSS 361
             VD  + + S+
Sbjct: 341 IHVDKLISKFSN 352



>gi|195498791|ref|XP_002096676.1| GE25802 [Drosophila yakuba]
 gi|194182777|gb|EDW96388.1| GE25802 [Drosophila yakuba]
          Length = 320

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 125/362 (34%), Positives = 187/362 (51%), Gaps = 53/362 (14%)

Query: 5   LSSVRDTLYAVTSCCFP--NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKK 62
           + S+  TL     C F     TL+IN   + + + L  GGFS + L +++ST R YA+K+
Sbjct: 1   MQSIGWTLIMKRGCLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENSSTRRSYAIKR 60

Query: 63  IRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG 118
           I C    D    A++E++  R    EN+I+V+D  +        N    ++I LPYYK G
Sbjct: 61  ITCH-SIDDQNIALREIENCRKIDSENVIQVVDYELKGQADIVINTTSTLFIVLPYYKHG 119

Query: 119 -LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIE 177
            L D +        +  E ++L+IF G+C  ++A+H                        
Sbjct: 120 SLADHLQLRSRKKDHMPEAQILQIFLGVCEGLKAIH------------------------ 155

Query: 178 NEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQT 237
                           E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I  
Sbjct: 156 ----------------EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIVG 197

Query: 238 RNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNI 297
           + +A   QD A + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y +SP+D  I
Sbjct: 198 QTDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERSDIWSLGCVLYAMCYFNSPYD-PI 256

Query: 298 NEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLE 357
            E+G S+ALAVL+     P  E   Y+ +  +LI +ML+ DP +RP I  VI +    ++
Sbjct: 257 YERGDSVALAVLSGNINIP--EDSIYTEDMHELIKYMLRTDPMERPFIFSVIERTHDLIQ 314

Query: 358 QL 359
           +L
Sbjct: 315 KL 316



>gi|195568928|ref|XP_002102464.1| GD19491 [Drosophila simulans]
 gi|194198391|gb|EDX11967.1| GD19491 [Drosophila simulans]
          Length = 320

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 124/362 (34%), Positives = 186/362 (51%), Gaps = 53/362 (14%)

Query: 5   LSSVRDTLYAVTSCCFP--NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKK 62
           + S+  TL     C F     TL+IN   + + + L  GGFS + L ++ ST R YA+K+
Sbjct: 1   MQSIGWTLIMKRGCLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIKR 60

Query: 63  IRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG 118
           I C    D    A++E++  R    EN+I+V+D  +        N    ++I LPYYK G
Sbjct: 61  ITCH-SIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHG 119

Query: 119 -LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIE 177
            L D +        +  E ++L+IF G+C  ++A+H                        
Sbjct: 120 SLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIH------------------------ 155

Query: 178 NEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQT 237
                           E   VP AHRD+K  NI L+D    +PI++D GS+  AR++I  
Sbjct: 156 ----------------EAKPVPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIVG 197

Query: 238 RNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNI 297
           + +A   QD A + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y +SP+D  I
Sbjct: 198 QTDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYD-PI 256

Query: 298 NEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLE 357
            E+G S+ALAVL+     P  E   Y+ +  +LI +ML+ DP +RP +  VI +    ++
Sbjct: 257 YERGDSVALAVLSGNINIP--EDSIYTEDMHELIKYMLRTDPMERPFVFSVIERTHDLIQ 314

Query: 358 QL 359
           +L
Sbjct: 315 KL 316



>gi|460392023|ref|XP_004241617.1| PREDICTED: probable serine/threonine-protein kinase
           DDB_G0291350-like [Solanum lycopersicum]
          Length = 342

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 185/361 (51%), Gaps = 69/361 (19%)

Query: 27  INRRTFKVIKLLGEGGFSYVHLVQDT-------------------STGRYYALKKIRCQF 67
           IN   FK+I+ LGEGGF+YV LV++                    S    YA+KK+  Q 
Sbjct: 23  INENRFKIIRQLGEGGFAYVFLVKEVLSDPSNPGISKKFKDPSHISDDGTYAMKKVLIQ- 81

Query: 68  GSDSVKDAMKEVDMYRLFSHENIIKVIDTCVV-----QDKNGGKIVYIFLPYYKSG-LQD 121
            S+ ++   +E+ +  LFSH N++ ++D  ++     QD++     Y+  P +  G L D
Sbjct: 82  NSEQLEMVREEIRVSSLFSHPNLLPLLDHAIISVKVAQDQSLKHEAYLLFPVHLDGTLLD 141

Query: 122 VINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMX 181
                    ++FS  ++L+IFR +C  ++ +H+   PS                      
Sbjct: 142 NAKTMNAKKEFFSTSDVLQIFRQLCAGLKHMHSLD-PS---------------------- 178

Query: 182 XXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP--ILMDFGSLVRARIKIQTRN 239
                             +AH D+KPGN+LLT      P  ILMDFGS   AR +I++R+
Sbjct: 179 ------------------YAHNDVKPGNVLLTHRKGQPPLAILMDFGSARPARRQIRSRS 220

Query: 240 EALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINE 299
           EAL  Q+ A++H + P+RAPEL+D  +  +++E+ DIWSLGCTLYA+ YG SPF+  + E
Sbjct: 221 EALQLQEWAAEHVSAPFRAPELWDCPSQCDVDERTDIWSLGCTLYAIMYGVSPFEYALGE 280

Query: 300 QGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
            GGS+ LA++NAQ ++P   +  Y       +++ML+     RP I  ++  VD  + + 
Sbjct: 281 SGGSLQLAIVNAQIKWPTKPKSPYPEGLHQFVTWMLQPQATVRPRIDDILIHVDKLISKF 340

Query: 360 S 360
           S
Sbjct: 341 S 341



>gi|226958539|ref|NP_035624.3| serine/threonine-protein kinase 16 [Mus musculus]
 gi|487439482|ref|NP_001264921.1| serine/threonine-protein kinase 16 [Mus musculus]
 gi|13124556|sp|O88697.3|STK16_MOUSE RecName: Full=Serine/threonine-protein kinase 16; AltName:
           Full=Embryo-derived protein kinase; Short=Edpk; AltName:
           Full=Myristoylated and palmitoylated
           serine/threonine-protein kinase; Short=MPSK; AltName:
           Full=Protein kinase Krct; AltName: Full=Protein kinase
           PKL12; AltName: Full=TGF-beta-stimulated factor 1;
           Short=TSF-1; AltName: Full=Tyrosine-protein kinase STK16
 gi|3367718|emb|CAA06699.1| PKL12 protein [Mus musculus]
 gi|4063862|gb|AAC98502.1| serine/threonine kinase 16 [Mus musculus]
 gi|4191816|dbj|BAA74457.1| EDPK [Mus musculus]
 gi|20809422|gb|AAH28999.1| Serine/threonine kinase 16 [Mus musculus]
 gi|74146364|dbj|BAE28946.1| unnamed protein product [Mus musculus]
 gi|117616802|gb|ABK42419.1| MPSK1 [synthetic construct]
 gi|148667966|gb|EDL00383.1| serine/threonine kinase 16, isoform CRA_a [Mus musculus]
 gi|148667967|gb|EDL00384.1| serine/threonine kinase 16, isoform CRA_a [Mus musculus]
 gi|148667969|gb|EDL00386.1| serine/threonine kinase 16, isoform CRA_a [Mus musculus]
          Length = 305

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/338 (32%), Positives = 184/338 (54%), Gaps = 52/338 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     T+ I+ + +  ++ LGEGGFSYV LV+    G +YALK+I C    D  ++A +
Sbjct: 6   CVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQ-EEAQR 64

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDKNGGKIVYIFLPYYKSG-LQDVINNNLENNKYFSEK 136
           E +M+RLF H NI++++    ++++      ++ LP++K G L + I    +   + +E 
Sbjct: 65  EAEMHRLFQHPNILRLM-AYSLKERGAKHEAWLLLPFFKKGTLWNEIERLKDQGSFLTED 123

Query: 137 EMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXXXEDG 196
           ++L +  GI   + A+H   +                                       
Sbjct: 124 QILPLLLGISRGLEAIHAKGY--------------------------------------- 144

Query: 197 VVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHSTMPY 256
               AHRD+KP NILL D+   QP+LMD GS+ +A I+++   +AL  QD A+Q  T+ Y
Sbjct: 145 ----AHRDLKPTNILLGDEG--QPVLMDLGSMNQACIQVEGSRQALALQDWAAQRCTISY 198

Query: 257 RAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQFRFP 316
           RAPELF V+++  ++E+ D+WSLGC LYAM +G  P+D  + ++G S+ALAV N +   P
Sbjct: 199 RAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYD-MVFQKGDSVALAVQN-ELSIP 256

Query: 317 PTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDT 354
             +  ++S   + L+S M+ VDP+ RP I  ++++++ 
Sbjct: 257 --QSPRHSSALRQLLSSMMTVDPQQRPHIPVLLSQLEA 292



>gi|21358347|ref|NP_649712.1| CG1227 [Drosophila melanogaster]
 gi|7298833|gb|AAF54041.1| CG1227 [Drosophila melanogaster]
 gi|17862238|gb|AAL39596.1| LD17053p [Drosophila melanogaster]
 gi|220943298|gb|ACL84192.1| CG1227-PA [synthetic construct]
 gi|220953422|gb|ACL89254.1| CG1227-PA [synthetic construct]
          Length = 320

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 124/362 (34%), Positives = 188/362 (51%), Gaps = 53/362 (14%)

Query: 5   LSSVRDTLYAVTSCCFP--NPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKK 62
           + S+  TL     C F     TL+IN   + + + L  GGFS + L ++ ST R YA+K+
Sbjct: 1   MQSIGWTLIMKRGCLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIKR 60

Query: 63  IRCQFGSDSVKDAMKEVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG 118
           I C    D    A++E++  R    EN+I+V+D  +        N    ++I LPYYK G
Sbjct: 61  ITCH-SIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHG 119

Query: 119 -LQDVINNNLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIE 177
            L D +        +  E ++L+IF G+C  ++A+H     ++P                
Sbjct: 120 SLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIH----EAMP---------------- 159

Query: 178 NEMXXXXXXXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQT 237
                               VP AHRD+K  NI L+D    +PI++D GS+  AR++I  
Sbjct: 160 --------------------VPLAHRDLKTANICLSDSF--EPIIVDLGSMTEARLQIVG 197

Query: 238 RNEALMQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNI 297
           + +A   QD A + S++ YRAPELF VKT   ++E+ DIWSLGC LYAM Y +SP+D  I
Sbjct: 198 QTDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYD-PI 256

Query: 298 NEQGGSIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLE 357
            E+G S+ALAVL+     P  E   Y+ +  +LI +ML+ DP +RP +  VI +    ++
Sbjct: 257 YERGDSVALAVLSGNINIP--EDSIYTEDMHELIKYMLRTDPMERPFVFSVIERTHDLIQ 314

Query: 358 QL 359
           +L
Sbjct: 315 KL 316



>gi|91084617|ref|XP_974511.1| PREDICTED: similar to GA11523-PA [Tribolium castaneum]
 gi|270008645|gb|EFA05093.1| hypothetical protein TcasGA2_TC015191 [Tribolium castaneum]
          Length = 318

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/339 (36%), Positives = 175/339 (51%), Gaps = 51/339 (15%)

Query: 18  CCFPNPTLHINRRTFKVIKLLGEGGFSYVHLVQDTSTGRYYALKKIRCQFGSDSVKDAMK 77
           C     ++ +N   + V + LGEGGFS V L+++  T R YALK+I C    D  K AM 
Sbjct: 14  CICTRESVDVNGVKYVVKERLGEGGFSTVDLIENKGTKRKYALKRILCHSLEDQ-KVAMD 72

Query: 78  EVDMYRLFSHENIIKVIDTCVVQDK----NGGKIVYIFLPYYKSG-LQDVINNNLENNKY 132
           E+  Y+   H NII+++D+          N     YI LPYY+ G LQD +     N  Y
Sbjct: 73  EISYYKKLRHPNIIELVDSTFKGTADIVVNATSEAYIVLPYYRRGTLQDYLTLRSFNRNY 132

Query: 133 FSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXXXXXXXXX 192
              KE+L++F  I  AV+ LH +  P                                  
Sbjct: 133 LDVKEVLRLFSEISQAVKYLHDFA-PE--------------------------------- 158

Query: 193 XEDGVVPFAHRDIKPGNILLTDDADSQPILMDFGSLVRARIKIQTRNEALMQQDLASQHS 252
                 P AHRD+K GN+ LT+D    P+LMD GS   A++++    +A   QDLA++  
Sbjct: 159 ------PVAHRDLKAGNVCLTEDM--TPVLMDLGSCAPAKVQVCGAQDAQKLQDLAAERC 210

Query: 253 TMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGGSIALAVLNAQ 312
           +M YRAPELF V++   ++++ DIWSLGC L+A+ Y  SP+D  + E+G S+ LAV++  
Sbjct: 211 SMTYRAPELFHVESYCVIDQRTDIWSLGCLLFALCYFKSPYD-LVYERGDSVNLAVISGS 269

Query: 313 FRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAK 351
             FP  E   +  +  DLI FMLKV+P +RP I  VI K
Sbjct: 270 VHFP--EDTPFDEDVHDLILFMLKVNPSERPFIDSVIDK 306



>gi|302819093|ref|XP_002991218.1| hypothetical protein SELMODRAFT_133041 [Selaginella moellendorffii]
 gi|300141046|gb|EFJ07762.1| hypothetical protein SELMODRAFT_133041 [Selaginella moellendorffii]
          Length = 342

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/357 (30%), Positives = 188/357 (52%), Gaps = 66/357 (18%)

Query: 25  LHINRRTFKVIKLLGEGGFSYVHLVQDTSTGR------------YYALKKIRCQFGSDSV 72
           + IN R F++++ LGEGGF++V+L ++    R             YA+KK+  Q   + +
Sbjct: 21  IWINERRFRIVRQLGEGGFAFVYLAREIQGDRPLKQSSQVSDDGLYAVKKVLIQ-SEEQL 79

Query: 73  KDAMKEVDMYRLFSHENIIKVIDTCVVQDKNGGKI------VYIFLPYYKSG-LQDVINN 125
               +E+ +  LF H N++ +++  ++  K G +        Y+  P Y  G LQ  +  
Sbjct: 80  ALVKREIQVSSLFKHPNLLPLLEHSMIAVKQGSREGTWNTEAYLLFPVYPDGTLQSQLEE 139

Query: 126 NLENNKYFSEKEMLKIFRGICYAVRALHTYRFPSVPLRSENGITNSNLNGIENEMXXXXX 185
                ++F    +L IF+ IC A++ +H +  PS                          
Sbjct: 140 MRSRGEFFPAVTVLHIFQQICQALKQMHKHD-PS-------------------------- 172

Query: 186 XXXXXXXXEDGVVPFAHRDIKPGNILLTDDADSQP---ILMDFGSLVRARIKIQTRNEAL 242
                         ++H D+KPGN+LL+  ++  P   ++MDFGS   AR ++++R+EAL
Sbjct: 173 --------------YSHNDVKPGNVLLSKSSNQDPPKAVVMDFGSATLARKRVRSRSEAL 218

Query: 243 MQQDLASQHSTMPYRAPELFDVKTNVELNEKVDIWSLGCTLYAMAYGSSPFDNNINEQGG 302
             Q+ A++H + PYRAPEL+D  +  +++E+VD+WSLGCTL+A+ Y  SPF+++++E GG
Sbjct: 219 AIQEWAAEHCSAPYRAPELWDCPSIADIDERVDVWSLGCTLFAIMYCVSPFEHSLSEAGG 278

Query: 303 SIALAVLNAQFRFPPTEQDKYSPEFKDLISFMLKVDPKDRPDIHQVIAKVDTQLEQL 359
           S+ LA ++ Q ++P T    Y   F  L+S+M++    +RPD+  VIA V   L + 
Sbjct: 279 SLQLASMSGQIKWPST--PPYPRSFHKLVSWMVEPRVANRPDVEAVIAVVTKMLSKF 333