BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10381_c0_seq1-m.147 5prime_partial 107-1546(-) 480 (-)
         (479 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384490365|gb|EIE81587.1| 2,3-bisphosphoglycerate-independent ...   666   0.0     Rhizopus delemar RA 99-880
gi|384483579|gb|EIE75759.1| 2,3-bisphosphoglycerate-independent ...   663   0.0     Rhizopus delemar RA 99-880
gi|511003312|gb|EPB84718.1| 2,3-bisphosphoglycerate-independent ...   652   0.0     Mucor circinelloides f. circinelloides 1006PhL
gi|409048330|gb|EKM57808.1| hypothetical protein PHACADRAFT_2516...   617   e-174   Phanerochaete carnosa HHB-10118-sp
gi|403412140|emb|CCL98840.1| predicted protein [Fibroporia radic...   614   e-173   Fibroporia radiculosa
gi|328770253|gb|EGF80295.1| hypothetical protein BATDEDRAFT_1137...   614   e-173   Batrachochytrium dendrobatidis JAM81
gi|353235842|emb|CCA67848.1| probable phosphoglyceromutase [Piri...   609   e-172   Serendipita indica DSM 11827
gi|389738271|gb|EIM79471.1| phosphoglycerate mutase [Stereum hir...   605   e-171   Stereum hirsutum FP-91666 SS1
gi|395335112|gb|EJF67488.1| cofactor-independent phosphoglycerat...   605   e-170   Dichomitus squalens LYAD-421 SS1
gi|449541525|gb|EMD32508.1| hypothetical protein CERSUDRAFT_1185...   603   e-170   Gelatoporia subvermispora B
gi|169767532|ref|XP_001818237.1| phosphoglycerate mutase, 2,3-bi...   602   e-170   Aspergillus oryzae RIB40
gi|390595192|gb|EIN04598.1| cofactor-independent phosphoglycerat...   601   e-169   Punctularia strigosozonata HHB-11173 SS5
gi|302675128|ref|XP_003027248.1| hypothetical protein SCHCODRAFT...   600   e-169   Schizophyllum commune H4-8
gi|296420584|ref|XP_002839849.1| hypothetical protein [Tuber mel...   600   e-169   Tuber melanosporum Mel28
gi|260794729|ref|XP_002592360.1| hypothetical protein BRAFLDRAFT...   600   e-169   Branchiostoma floridae
gi|170099924|ref|XP_001881180.1| phosphoglycerate mutase [Laccar...   599   e-169   Laccaria bicolor S238N-H82
gi|392570591|gb|EIW63763.1| cofactor-independent phosphoglycerat...   599   e-169   Trametes versicolor FP-101664 SS1
gi|58260376|ref|XP_567598.1| phosphoglycerate mutase [Cryptococc...   598   e-168   Cryptococcus neoformans var. neoformans JEC21
gi|321264207|ref|XP_003196821.1| phosphoglycerate mutase [Crypto...   595   e-167   Cryptococcus gattii WM276
gi|405119383|gb|AFR94156.1| phosphoglycerate mutase [Cryptococcu...   593   e-167   Cryptococcus neoformans var. grubii H99
gi|345568179|gb|EGX51079.1| hypothetical protein AOL_s00054g639 ...   593   e-167   Arthrobotrys oligospora ATCC 24927
gi|296815104|ref|XP_002847889.1| 2,3-bisphosphoglycerate-indepen...   592   e-167   Arthroderma otae CBS 113480
gi|121705356|ref|XP_001270941.1| phosphoglycerate mutase, 2,3-bi...   590   e-166   Aspergillus clavatus NRRL 1
gi|67525203|ref|XP_660663.1| hypothetical protein AN3059.2 [Aspe...   590   e-166   Aspergillus nidulans FGSC A4
gi|358368295|dbj|GAA84912.1| phosphoglycerate mutase, 2,3-bispho...   588   e-165   Aspergillus kawachii IFO 4308
gi|119492039|ref|XP_001263514.1| phosphoglycerate mutase, 2,3-bi...   587   e-165   Aspergillus fischeri NRRL 181
gi|295659988|ref|XP_002790551.1| 2,3-bisphosphoglycerate-indepen...   587   e-165   Paracoccidioides lutzii Pb01
gi|70999946|ref|XP_754690.1| phosphoglycerate mutase, 2,3-bispho...   587   e-165   Aspergillus fumigatus Af293
gi|258566247|ref|XP_002583868.1| 2,3-bisphosphoglycerate-indepen...   587   e-165   Uncinocarpus reesii 1704
gi|402222936|gb|EJU03001.1| cofactor-independent phosphoglycerat...   587   e-165   Dacryopinax primogenitus
gi|145252196|ref|XP_001397611.1| phosphoglycerate mutase, 2,3-bi...   587   e-165   Aspergillus niger CBS 513.88
gi|393221924|gb|EJD07408.1| cofactor-independent phosphoglycerat...   587   e-165   Fomitiporia mediterranea MF3/22
gi|315054193|ref|XP_003176471.1| 2,3-bisphosphoglycerate-indepen...   587   e-165   Microsporum gypseum CBS 118893
gi|386289720|gb|AFJ04711.1| PGM protein [Volvariella volvacea]        587   e-165   Volvariella volvacea
gi|225678774|gb|EEH17058.1| 2,3-bisphosphoglycerate-independent ...   587   e-165   Paracoccidioides brasiliensis Pb03
gi|225560727|gb|EEH09008.1| 2,3-bisphosphoglycerate-independent ...   585   e-164   Histoplasma capsulatum G186AR
gi|226293610|gb|EEH49030.1| 2,3-bisphosphoglycerate-independent ...   585   e-164   Paracoccidioides brasiliensis Pb18
gi|494828283|gb|EON65124.1| 2,3-bisphosphoglycerate-independent ...   584   e-164   Coniosporium apollinis CBS 100218
gi|407918914|gb|EKG12174.1| Phosphoglycerate mutase 23-bisphosph...   582   e-164   Macrophomina phaseolina MS6
gi|426200857|gb|EKV50780.1| hypothetical protein AGABI2DRAFT_189...   582   e-164   Agaricus bisporus var. bisporus H97
gi|409084085|gb|EKM84442.1| hypothetical protein AGABI1DRAFT_110...   582   e-163   Agaricus bisporus var. burnettii JB137-S8
gi|326474865|gb|EGD98874.1| phosphoglycerate mutase [Trichophyto...   582   e-163   Trichophyton tonsurans CBS 112818
gi|485929591|gb|EOD52958.1| putative -bisphosphoglycerate-indepe...   581   e-163   Neofusicoccum parvum UCRNP2
gi|470290034|ref|XP_004343043.1| cofactor-independent phosphogly...   581   e-163   Capsaspora owczarzaki ATCC 30864
gi|302501123|ref|XP_003012554.1| hypothetical protein ARB_01167 ...   581   e-163   Arthroderma benhamiae CBS 112371
gi|449304305|gb|EMD00313.1| hypothetical protein BAUCODRAFT_3728...   580   e-163   Baudoinia panamericana UAMH 10762
gi|156390511|ref|XP_001635314.1| predicted protein [Nematostella...   579   e-163   Nematostella vectensis
gi|378732051|gb|EHY58510.1| 2,3-bisphosphoglycerate-independent ...   579   e-163   Exophiala dermatitidis NIH/UT8656
gi|261204029|ref|XP_002629228.1| 2,3-bisphosphoglycerate-indepen...   578   e-163   Blastomyces gilchristii SLH14081
gi|327308594|ref|XP_003238988.1| phosphoglycerate mutase [Tricho...   578   e-162   Trichophyton rubrum CBS 118892
gi|393233295|gb|EJD40868.1| phosphoglycerate mutase [Auricularia...   577   e-162   Auricularia subglabra TFB-10046 SS5
gi|119195025|ref|XP_001248116.1| 2,3-bisphosphoglycerate-indepen...   576   e-162   Coccidioides immitis RS
gi|302661880|ref|XP_003022601.1| hypothetical protein TRV_03258 ...   576   e-162   Trichophyton verrucosum HKI 0517
gi|398389767|ref|XP_003848344.1| phosphoglycerate mutase 2 [Zymo...   575   e-161   Zymoseptoria tritici IPO323
gi|336365174|gb|EGN93525.1| hypothetical protein SERLA73DRAFT_78...   575   e-161   Serpula lacrymans var. lacrymans S7.3
gi|303310775|ref|XP_003065399.1| 2,3-bisphosphoglycerate-indepen...   574   e-161   Coccidioides posadasii C735 delta SOWgp
gi|320034728|gb|EFW16671.1| 2,3-bisphosphoglycerate-independent ...   573   e-161   Coccidioides posadasii str. Silveira
gi|453081006|gb|EMF09056.1| 2,3-bisphosphoglycerate-independent ...   572   e-161   Sphaerulina musiva SO2202
gi|240280728|gb|EER44232.1| phosphoglycerate mutase [Ajellomyces...   572   e-160   Histoplasma capsulatum H143
gi|212543131|ref|XP_002151720.1| phosphoglycerate mutase, 2,3-bi...   571   e-160   Talaromyces marneffei ATCC 18224
gi|255934446|ref|XP_002558402.1| Pc12g16040 [Penicillium chrysog...   570   e-160   Penicillium rubens Wisconsin 54-1255
gi|425768376|gb|EKV06901.1| Phosphoglycerate mutase, 2,3-bisphos...   570   e-160   Penicillium digitatum Pd1
gi|452978128|gb|EME77892.1| hypothetical protein MYCFIDRAFT_5741...   570   e-160   Cercospora fijiensis CIRAD86
gi|154278251|ref|XP_001539942.1| 2,3-bisphosphoglycerate-indepen...   570   e-160   Histoplasma capsulatum NAm1
gi|396482897|ref|XP_003841574.1| similar to phosphoglycerate mut...   570   e-160   Leptosphaeria maculans JN3
gi|392574802|gb|EIW67937.1| hypothetical protein TREMEDRAFT_7206...   569   e-160   Tremella mesenterica DSM 1558
gi|189194371|ref|XP_001933524.1| 2,3-bisphosphoglycerate-indepen...   569   e-160   Pyrenophora tritici-repentis Pt-1C-BFP
gi|242785754|ref|XP_002480661.1| phosphoglycerate mutase, 2,3-bi...   568   e-160   Talaromyces stipitatus ATCC 10500
gi|330918849|ref|XP_003298365.1| hypothetical protein PTT_09083 ...   568   e-159   Pyrenophora teres f. teres 0-1
gi|452004480|gb|EMD96936.1| hypothetical protein COCHEDRAFT_1163...   568   e-159   Bipolaris maydis C5
gi|169625021|ref|XP_001805915.1| hypothetical protein SNOG_15777...   568   e-159   Parastagonospora nodorum SN15
gi|482813056|gb|EOA89760.1| hypothetical protein SETTUDRAFT_1675...   565   e-159   Setosphaeria turcica Et28A
gi|299754778|ref|XP_001828187.2| phosphoglycerate mutase [Coprin...   565   e-158   Coprinopsis cinerea okayama7#130
gi|451855436|gb|EMD68728.1| hypothetical protein COCSADRAFT_3360...   563   e-158   Bipolaris sorokiniana ND90Pr
gi|452838016|gb|EME39957.1| hypothetical protein DOTSEDRAFT_1788...   558   e-157   Dothistroma septosporum NZE10
gi|115384730|ref|XP_001208912.1| 2,3-bisphosphoglycerate-indepen...   558   e-156   Aspergillus terreus NIH2624
gi|312083081|ref|XP_003143712.1| independent phosphoglycerate mu...   558   e-156   Loa loa
gi|402590388|gb|EJW84318.1| 2,3-bisphosphoglycerate-independent ...   557   e-156   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|37681504|gb|AAQ97626.1| independent phosphoglycerate mutase i...   557   e-156   Brugia malayi [agent of lymphatic filariasis]
gi|430814274|emb|CCJ28479.1| unnamed protein product, partial [P...   556   e-156   Pneumocystis jirovecii
gi|308465595|ref|XP_003095056.1| hypothetical protein CRE_24737 ...   556   e-156   Caenorhabditis remanei
gi|171679573|ref|XP_001904733.1| hypothetical protein [Podospora...   556   e-156   Podospora anserina S mat+
gi|268568084|ref|XP_002640154.1| Hypothetical protein CBG12654 [...   555   e-155   Caenorhabditis briggsae
gi|32564249|ref|NP_871851.1| Protein F57B10.3, isoform b [Caenor...   555   e-155   Caenorhabditis elegans [roundworm]
gi|17507741|ref|NP_491896.1| Protein F57B10.3, isoform a [Caenor...   555   e-155   Caenorhabditis elegans [roundworm]
gi|160369917|gb|ABX38807.1| independent phosphoglycerate mutase ...   555   e-155   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|309360191|emb|CAP31601.2| Protein CBG12654 [Caenorhabditis br...   555   e-155   Caenorhabditis briggsae
gi|327494424|gb|AEA91534.1| 2,3-diphosphoglycerate-independent p...   554   e-155   Dirofilaria immitis [canine heartworm nematode]
gi|361128751|gb|EHL00678.1| putative 2,3-bisphosphoglycerate-ind...   554   e-155   Glarea lozoyensis 74030
gi|341882822|gb|EGT38757.1| hypothetical protein CAEBREN_04340 [...   554   e-155   Caenorhabditis brenneri
gi|341885151|gb|EGT41086.1| hypothetical protein CAEBREN_09913 [...   554   e-155   Caenorhabditis brenneri
gi|347841204|emb|CCD55776.1| similar to phosphoglycerate mutase ...   552   e-154   Botrytis cinerea T4
gi|472237248|gb|EMR82153.1| putative -bisphosphoglycerate-indepe...   551   e-154   Botrytis cinerea BcDW1
gi|54303719|gb|AAV33247.1| independent phosphoglycerate mutase [...   551   e-154   Onchocerca volvulus
gi|156042436|ref|XP_001587775.1| hypothetical protein SS1G_11015...   551   e-154   Sclerotinia sclerotiorum 1980 UF-70
gi|340966619|gb|EGS22126.1| phosphoglycerate mutase-like protein...   549   e-154   Chaetomium thermophilum var. thermophilum DSM 1495
gi|367031902|ref|XP_003665234.1| hypothetical protein MYCTH_2315...   548   e-153   Myceliophthora thermophila ATCC 42464
gi|440640357|gb|ELR10276.1| 2,3-bisphosphoglycerate-independent ...   546   e-153   Pseudogymnoascus destructans 20631-21
gi|391336466|ref|XP_003742601.1| PREDICTED: 2,3-bisphosphoglycer...   546   e-153   Metaseiulus occidentalis
gi|429850774|gb|ELA26014.1| 2,3-bisphosphoglycerate-independent ...   544   e-152   Colletotrichum gloeosporioides Nara gc5
gi|196015137|ref|XP_002117426.1| hypothetical protein TRIADDRAFT...   543   e-152   Trichoplax adhaerens
gi|500259136|gb|EOO01975.1| putative -bisphosphoglycerate-indepe...   543   e-152   Phaeoacremonium minimum UCRPA7
gi|116203495|ref|XP_001227558.1| conserved hypothetical protein ...   543   e-152   Chaetomium globosum CBS 148.51
gi|239608752|gb|EEQ85739.1| 2,3-bisphosphoglycerate-independent ...   542   e-152   Blastomyces dermatitidis ER-3
gi|340370710|ref|XP_003383889.1| PREDICTED: 2,3-bisphosphoglycer...   541   e-151   Amphimedon queenslandica
gi|291235963|ref|XP_002737918.1| PREDICTED: hypothetical protein...   540   e-151   
gi|380494148|emb|CCF33370.1| 2,3-bisphosphoglycerate-independent...   540   e-151   Colletotrichum higginsianum
gi|336467550|gb|EGO55714.1| hypothetical protein NEUTE1DRAFT_117...   539   e-151   Neurospora tetrasperma FGSC 2508
gi|85094513|ref|XP_959896.1| hypothetical protein NCU02252 [Neur...   539   e-151   Neurospora crassa OR74A
gi|406862032|gb|EKD15084.1| phosphoglycerate mutase, 2,3-bisphos...   538   e-150   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|389640855|ref|XP_003718060.1| 2,3-bisphosphoglycerate-indepen...   538   e-150   Magnaporthe oryzae 70-15
gi|336273262|ref|XP_003351386.1| hypothetical protein SMAC_03693...   538   e-150   Sordaria macrospora k-hell
gi|402080288|gb|EJT75433.1| 2,3-bisphosphoglycerate-independent ...   538   e-150   Gaeumannomyces graminis var. tritici R3-111a-1
gi|310791993|gb|EFQ27520.1| 2,3-bisphosphoglycerate-independent ...   537   e-150   Colletotrichum graminicola M1.001
gi|154300406|ref|XP_001550619.1| hypothetical protein BC1G_11392...   536   e-150   Botrytis cinerea B05.10
gi|392598131|gb|EIW87453.1| cofactor-independent phosphoglycerat...   536   e-150   Coniophora puteana RWD-64-598 SS2
gi|475670905|gb|EMT68258.1| 2,3-bisphosphoglycerate-independent ...   536   e-150   Fusarium oxysporum f. sp. cubense race 4
gi|320588325|gb|EFX00794.1| phosphoglycerate mutase, 2,3-bisphos...   536   e-150   Grosmannia clavigera kw1407
gi|408396407|gb|EKJ75565.1| hypothetical protein FPSE_04208 [Fus...   536   e-150   Fusarium pseudograminearum CS3096
gi|367047883|ref|XP_003654321.1| hypothetical protein THITE_2117...   536   e-150   Thielavia terrestris NRRL 8126
gi|358385935|gb|EHK23531.1| hypothetical protein TRIVIDRAFT_7402...   535   e-149   Trichoderma virens Gv29-8
gi|477516377|gb|ENH68658.1| 2,3-bisphosphoglycerate-independent ...   535   e-149   Fusarium oxysporum f. sp. cubense race 1
gi|46123355|ref|XP_386231.1| hypothetical protein FG06055.1 [Fus...   535   e-149   
gi|477524721|gb|ENH76652.1| phosphoglycerate -bisphosphoglycerat...   533   e-149   Colletotrichum orbiculare MAFF 240422
gi|340518957|gb|EGR49197.1| phosphoglycerate mutase [Trichoderma...   532   e-149   Trichoderma reesei QM6a
gi|471564776|gb|EMR65591.1| putative -bisphosphoglycerate-indepe...   531   e-148   Eutypa lata UCREL1
gi|399171882|emb|CCE27109.1| probable phosphoglyceromutase [Clav...   530   e-148   Claviceps purpurea 20.1
gi|241617737|ref|XP_002408207.1| phosphoglycerate mutase, putati...   528   e-147   Ixodes scapularis [blacklegged tick]
gi|358394544|gb|EHK43937.1| hypothetical protein TRIATDRAFT_3003...   528   e-147   Trichoderma atroviride IMI 206040
gi|342876395|gb|EGU78017.1| hypothetical protein FOXB_11494 [Fus...   527   e-147   Fusarium oxysporum Fo5176
gi|400601936|gb|EJP69561.1| putative phosphoglyceromutase [Beauv...   526   e-147   Beauveria bassiana ARSEF 2860
gi|322700211|gb|EFY91967.1| phosphoglycerate mutase, 2,3-bisphos...   526   e-147   Metarhizium acridum CQMa 102
gi|302916525|ref|XP_003052073.1| predicted protein [Nectria haem...   524   e-146   Nectria haematococca mpVI 77-13-4
gi|449017153|dbj|BAM80555.1| phosphoglycerate mutase [Cyanidiosc...   523   e-146   Cyanidioschyzon merolae strain 10D
gi|346326764|gb|EGX96360.1| phosphoglycerate mutase, 2,3-bisphos...   523   e-146   Cordyceps militaris CM01
gi|512186599|gb|EPE02389.1| bisphosphoglycerate-independent phos...   517   e-144   Ophiostoma piceae UAMH 11346
gi|440475184|gb|ELQ43885.1| 2,3-bisphosphoglycerate-independent ...   512   e-142   Magnaporthe oryzae Y34
gi|322708166|gb|EFY99743.1| 2,3-bisphosphoglycerate-independent ...   511   e-142   
gi|242785760|ref|XP_002480662.1| phosphoglycerate mutase, 2,3-bi...   509   e-142   Talaromyces stipitatus ATCC 10500
gi|346973721|gb|EGY17173.1| 2,3-bisphosphoglycerate-independent ...   503   e-140   Verticillium dahliae VdLs.17
gi|443920547|gb|ELU40450.1| phosphoglycerate mutase [Rhizoctonia...   498   e-138   Rhizoctonia solani AG-1 IA
gi|449687754|ref|XP_002157859.2| PREDICTED: 2,3-bisphosphoglycer...   489   e-135   
gi|401882184|gb|EJT46453.1| phosphoglycerate mutase [Trichosporo...   483   e-134   Trichosporon asahii var. asahii CBS 2479
gi|116753488|ref|YP_842606.1| phosphoglyceromutase [Methanosaeta...   482   e-133   
gi|470316583|gb|EMR08329.1| 2,3-bisphosphoglycerate-independent ...   481   e-133   Pneumocystis murina B123
gi|153003134|ref|YP_001377459.1| phosphoglyceromutase [Anaeromyx...   480   e-133   
gi|490175827|ref|WP_004074457.1| phosphoglyceromutase [Desulfoba...   473   e-131   Desulfobacter postgatei
gi|220932416|ref|YP_002509324.1| phosphoglyceromutase [Halotherm...   471   e-130   
gi|390351694|ref|XP_796254.3| PREDICTED: 2,3-bisphosphoglycerate...   470   e-130   
gi|220915378|ref|YP_002490682.1| phosphoglyceromutase [Anaeromyx...   470   e-130   
gi|308273470|emb|CBX30072.1| 2,3-bisphosphoglycerate-independent...   470   e-130   uncultured Desulfobacterium sp.
gi|489636174|ref|WP_003540614.1| phosphoglyceromutase [Desulfoto...   469   e-130   Desulfotomaculum nigrificans
gi|333922364|ref|YP_004495944.1| 2,3-bisphosphoglycerate-indepen...   468   e-129   
gi|197120666|ref|YP_002132617.1| phosphoglyceromutase [Anaeromyx...   468   e-129   
gi|435854765|ref|YP_007316084.1| 2,3-bisphosphoglycerate-indepen...   468   e-129   
gi|83589134|ref|YP_429143.1| phosphoglyceromutase [Moorella ther...   467   e-129   Moorella thermoacetica ATCC 39073
gi|495161616|ref|WP_007886415.1| phosphoglyceromutase [Roseburia...   464   e-128   Roseburia inulinivorans
gi|319789623|ref|YP_004151256.1| phosphoglycerate mutase, 2,3-bi...   462   e-128   
gi|86156664|ref|YP_463449.1| phosphoglyceromutase [Anaeromyxobac...   462   e-128   
gi|490740165|ref|WP_004602473.1| phosphoglyceromutase [Eubacteri...   462   e-127   [Eubacterium] cellulosolvens
gi|494767798|ref|WP_007503206.1| phosphoglyceromutase [Caldalkal...   461   e-127   Caldalkalibacillus thermarum
gi|491506219|ref|WP_005363866.1| phosphoglyceromutase [Eubacteri...   461   e-127   Eubacterium ventriosum
gi|242279957|ref|YP_002992086.1| phosphoglyceromutase [Desulfovi...   460   e-127   
gi|78042968|ref|YP_359155.1| phosphoglyceromutase [Carboxydother...   460   e-127   
gi|490169789|ref|WP_004068430.1| 2,3-bisphosphoglycerate-indepen...   460   e-127   Clostridium sp. ASF502
gi|494504626|ref|WP_007294087.1| phosphoglyceromutase [delta pro...   460   e-127   delta proteobacterium MLMS-1
gi|488647840|ref|WP_002584466.1| phosphoglyceromutase [Clostridi...   459   e-127   [Clostridium] clostridioforme
gi|488666501|ref|WP_002595328.1| 2,3-bisphosphoglycerate-indepen...   459   e-127   [Clostridium] clostridioforme
gi|410667039|ref|YP_006919410.1| 2,3-bisphosphoglycerate-indepen...   459   e-127   
gi|512513720|ref|WP_016440597.1| 2,3-bisphosphoglycerate-indepen...   459   e-126   Coprococcus sp. HPP0048
gi|496261981|ref|WP_008975366.1| phosphoglyceromutase [Coprococc...   458   e-126   Coprococcus sp. HPP0074
gi|491478821|ref|WP_005336562.1| phosphoglyceromutase [Dorea for...   458   e-126   Dorea formicigenerans
gi|488634548|ref|WP_002571217.1| 2,3-bisphosphoglycerate-indepen...   458   e-126   [Clostridium] bolteae
gi|491474807|ref|WP_005332548.1| phosphoglyceromutase [Dorea for...   458   e-126   Dorea formicigenerans
gi|493472556|ref|WP_006427594.1| phosphoglyceromutase [Dorea lon...   457   e-126   Dorea longicatena
gi|436842322|ref|YP_007326700.1| 2,3-bisphosphoglycerate-indepen...   457   e-126   
gi|496538084|ref|WP_009244352.1| phosphoglyceromutase [Lachnospi...   457   e-126   [Ruminococcus] gnavus
gi|490981166|ref|WP_004842928.1| phosphoglyceromutase [[Ruminoco...   457   e-126   
gi|496293281|ref|WP_009005319.1| phosphoglyceromutase [Clostridi...   456   e-126   Clostridiales
gi|347531325|ref|YP_004838088.1| phosphoglyceromutase [Roseburia...   456   e-126   
gi|479205097|ref|YP_007833688.1| 2,3-bisphosphoglycerate-indepen...   456   e-126   
gi|510801521|ref|WP_016176312.1| 2,3-bisphosphoglycerate-indepen...   456   e-126   Enterococcus saccharolyticus
gi|479148528|ref|YP_007778957.1| 2,3-bisphosphoglycerate-indepen...   456   e-126   
gi|495979469|ref|WP_008704048.1| phosphoglyceromutase [Ruminococ...   456   e-126   Clostridiales
gi|489576918|ref|WP_003481364.1| phosphoglyceromutase [Clostridi...   456   e-126   Clostridium perfringens
gi|110801419|ref|YP_695951.1| phosphoglyceromutase [Clostridium ...   456   e-126   
gi|489573474|ref|WP_003477920.1| phosphoglyceromutase [Clostridi...   456   e-126   Clostridium perfringens
gi|18310283|ref|NP_562217.1| phosphoglyceromutase [Clostridium p...   456   e-125   
gi|118444017|ref|YP_877495.1| phosphoglyceromutase [Clostridium ...   456   e-125   
gi|489555780|ref|WP_003460356.1| phosphoglyceromutase [Clostridi...   455   e-125   Clostridium perfringens
gi|126700791|ref|YP_001089688.1| phosphoglyceromutase [Clostridi...   455   e-125   Peptoclostridium difficile 630
gi|489636014|ref|WP_003540454.1| phosphoglyceromutase [Desulfoto...   455   e-125   Desulfotomaculum nigrificans
gi|488637369|ref|WP_002574027.1| 2,3-bisphosphoglycerate-indepen...   455   e-125   Lachnoclostridium
gi|489545829|ref|WP_003450482.1| phosphoglyceromutase [Clostridi...   455   e-125   Clostridium perfringens
gi|374997848|ref|YP_004973347.1| 2,3-bisphosphoglycerate-indepen...   455   e-125   
gi|493912729|ref|WP_006858103.1| phosphoglyceromutase [Roseburia...   455   e-125   Roseburia intestinalis
gi|497579679|ref|WP_009893863.1| phosphoglyceromutase [[Clostrid...   455   e-125   Clostridioides difficile
gi|260684710|ref|YP_003215995.1| phosphoglyceromutase [Clostridi...   454   e-125   
gi|489529413|ref|WP_003434147.1| phosphoglyceromutase [[Clostrid...   454   e-125   Clostridioides difficile
gi|479157227|ref|YP_007786822.1| 2,3-bisphosphoglycerate-indepen...   454   e-125   
gi|302390383|ref|YP_003826204.1| phosphoglycerate mutase [Thermo...   454   e-125   
gi|488632762|ref|WP_002569446.1| phosphoglyceromutase [Clostridi...   454   e-125   [Clostridium] bolteae
gi|489517132|ref|WP_003421955.1| phosphoglyceromutase [[Clostrid...   454   e-125   Clostridioides difficile
gi|490588079|ref|WP_004453099.1| phosphoglyceromutase [[Clostrid...   454   e-125   
gi|489561458|ref|WP_003465989.1| phosphoglyceromutase [Clostridi...   454   e-125   Clostridium perfringens
gi|497584119|ref|WP_009898303.1| phosphoglyceromutase [[Clostrid...   454   e-125   
gi|489524794|ref|WP_003429567.1| phosphoglyceromutase [[Clostrid...   454   e-125   
gi|110803633|ref|YP_698620.1| phosphoglyceromutase [Clostridium ...   454   e-125   
gi|489816941|ref|WP_003720761.1| 2,3-bisphosphoglycerate-indepen...   453   e-125   Listeria ivanovii
gi|493825767|ref|WP_006773217.1| phosphoglyceromutase [Clostridi...   453   e-125   Hungatella hathewayi
gi|16804494|ref|NP_465979.1| phosphoglyceromutase [Listeria mono...   453   e-125   Listeria monocytogenes EGD-e
gi|510891638|ref|WP_016224900.1| 2,3-bisphosphoglycerate-indepen...   453   e-125   Lachnospiraceae bacterium 3-2
gi|402574830|ref|YP_006624173.1| phosphoglycerate mutase [Desulf...   452   e-125   
gi|498350827|ref|WP_010664983.1| phosphoglyceromutase [Marinilab...   452   e-125   Marinilabilia salmonicolor
gi|497545703|ref|WP_009859901.1| phosphoglyceromutase [Parabacte...   452   e-125   Parabacteroides goldsteinii
gi|404282012|ref|YP_006682910.1| phosphoglycerate mutase [Lister...   452   e-125   
gi|493484938|ref|WP_006439752.1| phosphoglyceromutase [[Clostrid...   452   e-125   [Clostridium] hiranonis
gi|479194367|ref|YP_007823905.1| 2,3-bisphosphoglycerate-indepen...   452   e-125   
gi|217963442|ref|YP_002349120.1| phosphoglyceromutase [Listeria ...   452   e-125   
gi|489571486|ref|WP_003475932.1| phosphoglyceromutase [Clostridi...   452   e-125   Clostridium perfringens
gi|375266892|ref|YP_005024335.1| phosphoglyceromutase [Vibrio sp...   452   e-125   
gi|46908629|ref|YP_015018.1| phosphoglyceromutase [Listeria mono...   452   e-125   
gi|442318266|ref|YP_007358287.1| phosphoglyceromutase [Myxococcu...   452   e-124   
gi|16801612|ref|NP_471880.1| phosphoglyceromutase [Listeria inno...   452   e-124   
gi|489860225|ref|WP_003763866.1| 2,3-bisphosphoglycerate-indepen...   452   e-124   
gi|150009254|ref|YP_001303997.1| phosphoglyceromutase [Parabacte...   452   e-124   
gi|489835999|ref|WP_003739717.1| phosphoglyceromutase [Listeria ...   452   e-124   Listeria monocytogenes
gi|490751561|ref|WP_004613869.1| phosphoglyceromutase [Clostridi...   452   e-124   Tyzzerella nexilis
gi|116873820|ref|YP_850601.1| phosphoglyceromutase [Listeria wel...   452   e-124   
gi|489868820|ref|WP_003772389.1| phosphoglyceromutase [Listeria ...   452   e-124   Listeria innocua
gi|333924667|ref|YP_004498247.1| 2,3-bisphosphoglycerate-indepen...   452   e-124   
gi|511036544|ref|WP_016290578.1| 2,3-bisphosphoglycerate-indepen...   451   e-124   Lachnospiraceae bacterium 28-4
gi|284802894|ref|YP_003414759.1| phosphoglyceromutase [Listeria ...   451   e-124   
gi|334342104|ref|YP_004547084.1| phosphoglycerate mutase [Desulf...   451   e-124   
gi|493838022|ref|WP_006785195.1| phosphoglyceromutase [Turicibac...   451   e-124   Turicibacter
gi|496049430|ref|WP_008773937.1| phosphoglyceromutase [Bacteroid...   451   e-124   Bacteroides sp. 2_1_33B
gi|494273144|ref|WP_007157998.1| phosphoglyceromutase [Oribacter...   451   e-124   
gi|491569320|ref|WP_005426903.1| phosphoglyceromutase [[Ruminoco...   451   e-124   Blautia obeum
gi|347549759|ref|YP_004856087.1| putative phosphoglycerate mutas...   451   e-124   
gi|492483882|ref|WP_005861057.1| phosphoglyceromutase [Parabacte...   451   e-124   Parabacteroides
gi|498500086|ref|WP_010800788.1| 2,3-bisphosphoglycerate-indepen...   451   e-124   Parabacteroides
gi|406980990|gb|EKE02525.1| hypothetical protein ACD_20C00372G00...   451   e-124   uncultured bacterium
gi|492749396|ref|WP_005948548.1| phosphoglyceromutase [Blautia h...   451   e-124   
gi|491803893|ref|WP_005609229.1| phosphoglyceromutase [Ruminococ...   451   e-124   
gi|470208327|ref|YP_007604902.1| 3-bisphosphoglycerate-independe...   451   e-124   
gi|404494242|ref|YP_006718348.1| phosphoglyceromutase [Pelobacte...   451   e-124   
gi|494983851|ref|WP_007709874.1| phosphoglyceromutase [Clostridi...   451   e-124   
gi|496309210|ref|WP_009018388.1| phosphoglyceromutase [Parabacte...   451   e-124   Parabacteroides sp. D13
gi|337286377|ref|YP_004625850.1| phosphoglycerate mutase, 2,3-bi...   451   e-124   
gi|496056141|ref|WP_008780648.1| phosphoglyceromutase [Bacteroid...   451   e-124   Bacteroides sp. 3_1_19
gi|147679055|ref|YP_001213270.1| phosphoglyceromutase [Pelotomac...   451   e-124   
gi|495062646|ref|WP_007787476.1| phosphoglyceromutase [Desulfosp...   450   e-124   Desulfosporosinus youngiae
gi|495393546|ref|WP_008118247.1| phosphoglyceromutase [[Bacteroi...   450   e-124   
gi|492498904|ref|WP_005866663.1| phosphoglyceromutase [Bacteroid...   450   e-124   Parabacteroides
gi|479176641|ref|YP_007804242.1| 2,3-bisphosphoglycerate-indepen...   450   e-124   
gi|493361290|ref|WP_006317727.1| phosphoglyceromutase [Serratia ...   450   e-124   Serratia plymuthica
gi|325294775|ref|YP_004281289.1| 2,3-bisphosphoglycerate-indepen...   450   e-124   
gi|258517028|ref|YP_003193250.1| phosphoglyceromutase [Desulfoto...   450   e-124   
gi|297618009|ref|YP_003703168.1| phosphoglycerate mutase, 2,3-bi...   450   e-124   
gi|405756568|ref|YP_006680032.1| phosphoglycerate mutase [Lister...   450   e-124   
gi|386044758|ref|YP_005963563.1| 2,3-bisphosphoglycerate-indepen...   450   e-124   
gi|386048122|ref|YP_005966454.1| 2,3-bisphosphoglycerate-indepen...   449   e-124   
gi|490857532|ref|WP_004719574.1| phosphoglyceromutase [Yersinia ...   449   e-124   Yersinia ruckeri
gi|269837692|ref|YP_003319920.1| phosphoglycerate mutase [Sphaer...   449   e-124   
gi|386002570|ref|YP_005920869.1| 2,3-bisphosphoglycerate-indepen...   449   e-124   
gi|495207442|ref|WP_007932222.1| phosphoglyceromutase [Pelosinus...   449   e-124   Pelosinus fermentans
gi|342731878|ref|YP_004770717.1| 2,3-bisphosphoglycerate-indepen...   449   e-123   
gi|333929739|ref|YP_004503318.1| 2,3-bisphosphoglycerate-indepen...   449   e-123   
gi|511042796|ref|WP_016296776.1| 2,3-bisphosphoglycerate-indepen...   449   e-123   Lachnospiraceae bacterium M18-1
gi|496268309|ref|WP_008981531.1| phosphoglyceromutase [Ruminococ...   449   e-123   Ruminococcaceae bacterium D16
gi|496567185|ref|WP_009268305.1| phosphoglyceromutase [Lachnospi...   449   e-123   [Clostridium] glycyrrhizinilyticum
gi|262393021|ref|YP_003284875.1| 2,3-bisphosphoglycerate-indepen...   449   e-123   
gi|479338985|ref|YP_007850203.1| 2,3-bisphosphoglycerate-indepen...   448   e-123   
gi|297568622|ref|YP_003689966.1| phosphoglycerate mutase, 2,3-bi...   448   e-123   
gi|435850377|ref|YP_007311963.1| 2,3-bisphosphoglycerate-indepen...   448   e-123   
gi|497589413|ref|WP_009903597.1| phosphoglyceromutase [[Clostrid...   448   e-123   
gi|493834686|ref|WP_006781932.1| phosphoglyceromutase [Clostridi...   448   e-123   Hungatella hathewayi
gi|495674370|ref|WP_008398949.1| phosphoglyceromutase [Clostridi...   448   e-123   
gi|157373051|ref|YP_001481040.1| phosphoglyceromutase [Serratia ...   448   e-123   
gi|320353015|ref|YP_004194354.1| phosphoglycerate mutase [Desulf...   448   e-123   
gi|386054643|ref|YP_005972201.1| 2,3-bisphosphoglycerate-indepen...   448   e-123   
gi|493372583|ref|WP_006328897.1| phosphoglyceromutase [Serratia ...   448   e-123   
gi|158520110|ref|YP_001527980.1| phosphoglyceromutase [Desulfoco...   448   e-123   
gi|291288810|ref|YP_003505626.1| phosphoglycerate mutase [Denitr...   448   e-123   
gi|492699978|ref|WP_005927254.1| 2,3-bisphosphoglycerate-indepen...   448   e-123   
gi|491590758|ref|WP_005448323.1| phosphoglyceromutase [Vibrio sp...   448   e-123   
gi|20092802|ref|NP_618877.1| phosphoglyceromutase [Methanosarcin...   448   e-123   
gi|496546827|ref|WP_009252902.1| phosphoglyceromutase [Lachnospi...   447   e-123   
gi|512175775|ref|WP_016407724.1| 2 3-bisphosphoglycerate-indepen...   447   e-123   
gi|495998075|ref|WP_008722654.1| phosphoglyceromutase [Clostridi...   447   e-123   
gi|496535884|ref|WP_009242575.1| phosphoglyceromutase [Lachnospi...   447   e-123   
gi|433658928|ref|YP_007276307.1| 2,3-bisphosphoglycerate-indepen...   447   e-123   
gi|302385255|ref|YP_003821077.1| phosphoglycerate mutase [Clostr...   447   e-123   
gi|494740083|ref|WP_007475491.1| phosphoglyceromutase [Listeria ...   447   e-123   
gi|385799507|ref|YP_005835911.1| phosphoglycerate mutase [Halana...   447   e-123   
gi|491528791|ref|WP_005386416.1| phosphoglyceromutase [Vibrio al...   447   e-123   
gi|52081959|ref|YP_080750.1| phosphoglyceromutase [Bacillus lich...   447   e-123   
gi|496678682|ref|WP_009321172.1| phosphoglyceromutase [Lachnospi...   447   e-123   
gi|491523844|ref|WP_005381471.1| phosphoglyceromutase [Vibrio al...   447   e-123   
gi|488777800|ref|YP_007947216.1| 2,3-bisphosphoglycerate-indepen...   447   e-123   
gi|489845758|ref|WP_003749451.1| phosphoglyceromutase [Listeria ...   447   e-123   
gi|490984665|ref|WP_004846403.1| phosphoglyceromutase [[Ruminoco...   447   e-123   
gi|494810685|ref|WP_007546093.1| phosphoglyceromutase [Listeriac...   447   e-123   
gi|495685914|ref|WP_008410493.1| 2,3-bisphosphoglycerate-indepen...   447   e-123   
gi|510877475|ref|WP_016217281.1| 2,3-bisphosphoglycerate-indepen...   447   e-123   
gi|28899603|ref|NP_799208.1| phosphoglyceromutase [Vibrio paraha...   447   e-123   
gi|489850025|ref|WP_003753706.1| 2,3-bisphosphoglycerate-indepen...   447   e-123   
gi|495687604|ref|WP_008412183.1| 2,3-bisphosphoglycerate-indepen...   447   e-123   
gi|410659462|ref|YP_006911833.1| 2,3-bisphosphoglycerate-indepen...   447   e-123   
gi|511064403|ref|YP_008079721.1| phosphoglycerate mutase Pgm [Ba...   446   e-123   
gi|510897363|ref|WP_016230405.1| 2,3-bisphosphoglycerate-indepen...   446   e-123   
gi|305664484|ref|YP_003860771.1| phosphoglyceromutase [Maribacte...   446   e-123   
gi|493617780|ref|WP_006569978.1| phosphoglyceromutase [Thermoana...   446   e-123   
gi|490195614|ref|WP_004094166.1| phosphoglyceromutase [Hafnia al...   446   e-123   
gi|488673660|ref|WP_002602446.1| 2,3-bisphosphoglycerate-indepen...   446   e-123   
gi|491091656|ref|WP_004953264.1| phosphoglyceromutase [Serratia ...   446   e-123   
gi|289435716|ref|YP_003465588.1| phosphoglycerate mutase [Lister...   446   e-123   
gi|494743805|ref|WP_007479213.1| phosphoglyceromutase [Bacteroid...   446   e-123   
gi|340001209|ref|YP_004732093.1| 2,3-bisphosphoglycerate-indepen...   446   e-123   
gi|495693608|ref|WP_008418187.1| 2,3-bisphosphoglycerate-indepen...   446   e-122   
gi|490168248|ref|WP_004066892.1| 2,3-bisphosphoglycerate-indepen...   446   e-122   
gi|446038731|ref|WP_000116586.1| phosphoglyceromutase [Salmonell...   446   e-122   
gi|507077974|ref|WP_016148744.1| 2,3-bisphosphoglycerate-indepen...   446   e-122   
gi|20091494|ref|NP_617569.1| phosphoglyceromutase [Methanosarcin...   446   e-122   
gi|331268759|ref|YP_004395251.1| phosphoglycerate mutase [Clostr...   446   e-122   
gi|493918242|ref|WP_006863392.1| phosphoglyceromutase [Marvinbry...   445   e-122   
gi|336323059|ref|YP_004603026.1| 2,3-bisphosphoglycerate-indepen...   445   e-122   
gi|430751614|ref|YP_007214522.1| 2,3-bisphosphoglycerate-indepen...   445   e-122   
gi|291280269|ref|YP_003497104.1| phosphoglycerate mutase [Deferr...   445   e-122   
gi|479155070|ref|YP_007784845.1| 2,3-bisphosphoglycerate-indepen...   445   e-122   
gi|494759396|ref|WP_007494804.1| phosphoglyceromutase [Flavonifr...   445   e-122   
gi|495142931|ref|WP_007867738.1| phosphoglyceromutase [Clostridi...   445   e-122   
gi|298675707|ref|YP_003727457.1| phosphoglycerate mutase [Methan...   445   e-122   
gi|488622047|ref|WP_002558760.1| phosphoglyceromutase [Bacteroid...   444   e-122   
gi|498330683|ref|WP_010644839.1| phosphoglyceromutase [Vibrio ca...   444   e-122   
gi|146309790|ref|YP_001174864.1| phosphoglyceromutase [Enterobac...   444   e-122   
gi|338530178|ref|YP_004663512.1| phosphoglyceromutase [Myxococcu...   444   e-122   
gi|489458678|ref|WP_003363908.1| phosphoglyceromutase [Clostridi...   444   e-122   
gi|496552036|ref|WP_009258111.1| phosphoglyceromutase [Lachnospi...   444   e-122   
gi|492219430|ref|WP_005779296.1| phosphoglyceromutase [Bacteroid...   444   e-122   
gi|479189278|ref|YP_007819317.1| 2,3-bisphosphoglycerate-indepen...   444   e-122   
gi|153948376|ref|YP_001399076.1| phosphoglyceromutase [Yersinia ...   444   e-122   
gi|440683637|ref|YP_007158432.1| phosphoglycerate mutase [Anabae...   444   e-122   
gi|161501830|ref|NP_760209.2| phosphoglyceromutase [Vibrio vulni...   444   e-122   
gi|498129886|ref|WP_010444042.1| phosphoglyceromutase [Vibrio ro...   444   e-122   
gi|497332394|ref|WP_009646607.1| phosphoglyceromutase [Selenomon...   444   e-122   
gi|492330067|ref|WP_005812161.1| phosphoglyceromutase [Bacteroid...   444   e-122   
gi|497309402|ref|WP_009623619.1| phosphoglyceromutase [Desulfosp...   444   e-122   
gi|489603762|ref|WP_003508203.1| phosphoglyceromutase [Clostridi...   444   e-122   
gi|328956753|ref|YP_004374139.1| phosphoglycerate mutase [Carnob...   444   e-122   
gi|491690019|ref|WP_005545803.1| phosphoglyceromutase [Paenibaci...   444   e-122   
gi|320155076|ref|YP_004187455.1| 2,3-bisphosphoglycerate-indepen...   444   e-122   
gi|491567462|ref|WP_005425047.1| phosphoglyceromutase [Vibrio ha...   444   e-122   
gi|495229796|ref|WP_007954567.1| phosphoglyceromutase [Pelosinus...   443   e-122   
gi|488149986|ref|WP_002221194.1| phosphoglyceromutase [Yersinia ...   443   e-122   
gi|491632267|ref|WP_005489804.1| 2,3-bisphosphoglycerate-indepen...   443   e-122   
gi|490842993|ref|WP_004705065.1| phosphoglyceromutase [Yersinia ...   443   e-122   
gi|491332640|ref|WP_005190601.1| phosphoglyceromutase [Yersinia ...   443   e-122   
gi|312143200|ref|YP_003994646.1| phosphoglycerate mutase [Halana...   443   e-122   
gi|497393633|ref|WP_009707846.1| phosphoglyceromutase [Vibrio sp...   443   e-122   
gi|73668755|ref|YP_304770.1| phosphoglycerate mutase [Methanosar...   443   e-122   
gi|491582940|ref|WP_005440508.1| phosphoglyceromutase [Vibrio ha...   443   e-122   
gi|490419717|ref|WP_004292015.1| phosphoglyceromutase [Bacteroid...   443   e-122   
gi|350268698|ref|YP_004880006.1| 2,3-bisphosphoglycerate-indepen...   443   e-122   
gi|490536965|ref|WP_004402121.1| 2,3-bisphosphoglycerate-indepen...   443   e-122   
gi|493933750|ref|WP_006878188.1| phosphoglyceromutase [Vibrio br...   443   e-122   
gi|495676149|ref|WP_008400728.1| phosphoglyceromutase [Clostridi...   443   e-122   
gi|22123998|ref|NP_667421.1| phosphoglyceromutase [Yersinia pest...   443   e-122   
gi|491674800|ref|WP_005530942.1| phosphoglyceromutase [Vibrio ca...   443   e-122   
gi|332982050|ref|YP_004463491.1| phosphoglycerate mutase [Mahell...   443   e-122   
gi|296134197|ref|YP_003641444.1| phosphoglycerate mutase [Thermi...   442   e-122   
gi|51594418|ref|YP_068609.1| phosphoglyceromutase [Yersinia pseu...   442   e-122   
gi|495813368|ref|WP_008537947.1| phosphoglyceromutase [Megamonas...   442   e-122   
gi|134300820|ref|YP_001114316.1| phosphoglyceromutase [Desulfoto...   442   e-122   
gi|512137589|ref|WP_016406337.1| 2 3-bisphosphoglycerate-indepen...   442   e-122   
gi|494934743|ref|WP_007660774.1| phosphoglyceromutase [Bacteroid...   442   e-122   
gi|167037152|ref|YP_001664730.1| phosphoglyceromutase [Thermoana...   442   e-122   
gi|161486592|ref|NP_935875.2| phosphoglyceromutase [Vibrio vulni...   442   e-122   
gi|496540163|ref|WP_009246311.1| phosphoglyceromutase [Lachnospi...   442   e-122   
gi|489594466|ref|WP_003498910.1| phosphoglyceromutase [Clostridi...   442   e-122   
gi|492382921|ref|WP_005826939.1| phosphoglyceromutase [Brevibaci...   442   e-122   
gi|492406428|ref|WP_005834542.1| phosphoglyceromutase [Bacteroid...   442   e-122   
gi|238923897|ref|YP_002937413.1| phosphoglycerate mutase, 2,3-bi...   442   e-122   
gi|492394901|ref|WP_005830427.1| phosphoglyceromutase [Bacteroid...   442   e-122   
gi|238917116|ref|YP_002930633.1| phosphoglyceromutase [Eubacteri...   442   e-122   
gi|495732899|ref|WP_008457478.1| phosphoglyceromutase [Enterobac...   442   e-121   
gi|345018017|ref|YP_004820370.1| 2,3-bisphosphoglycerate-indepen...   442   e-121   
gi|493768361|ref|WP_006716914.1| phosphoglyceromutase [Desulfito...   442   e-121   
gi|490852335|ref|WP_004714390.1| phosphoglyceromutase [Yersinia ...   442   e-121   
gi|494995466|ref|WP_007721482.1| phosphoglyceromutase [Carnobact...   442   e-121   
gi|37200017|dbj|BAC95846.1| phosphoglyceromutase [Vibrio vulnifi...   442   e-121   
gi|489110142|ref|WP_003019998.1| phosphoglyceromutase [Blautia h...   442   e-121   
gi|330508511|ref|YP_004384939.1| 2,3-bisphosphoglycerate-indepen...   442   e-121   
gi|491015219|ref|WP_004876926.1| phosphoglyceromutase [Yersinia ...   442   e-121   
gi|188588099|ref|YP_001922185.1| phosphoglyceromutase [Clostridi...   442   e-121   
gi|490552475|ref|WP_004417584.1| phosphoglyceromutase [Vibrio or...   442   e-121   
gi|336477790|ref|YP_004616931.1| phosphoglycerate mutase [Methan...   442   e-121   
gi|489923980|ref|WP_003827325.1| phosphoglyceromutase [Citrobact...   441   e-121   
gi|495668927|ref|WP_008393506.1| phosphoglyceromutase [Anaerosti...   441   e-121   
gi|493729857|ref|WP_006679167.1| phosphoglyceromutase [Paenibaci...   441   e-121   
gi|489468993|ref|WP_003374118.1| phosphoglyceromutase [Clostridi...   441   e-121   
gi|490744464|ref|WP_004606772.1| phosphoglyceromutase [Clostridi...   441   e-121   
gi|488349557|ref|WP_002418942.1| phosphoglyceromutase [Yersinia ...   441   e-121   
gi|157149230|ref|YP_001456549.1| phosphoglyceromutase [Citrobact...   441   e-121   
gi|495057371|ref|WP_007782205.1| phosphoglyceromutase [Brevibaci...   441   e-121   
gi|489470705|ref|WP_003375804.1| phosphoglyceromutase [Clostridi...   441   e-121   
gi|494014738|ref|WP_006957104.1| phosphoglyceromutase [Vibrio co...   441   e-121   
gi|490550753|ref|WP_004415869.1| phosphoglyceromutase [Vibrio or...   441   e-121   
gi|479161467|ref|YP_007790736.1| 2,3-bisphosphoglycerate-indepen...   441   e-121   
gi|410670766|ref|YP_006923137.1| phosphoglycerate mutase [Methan...   441   e-121   
gi|333896656|ref|YP_004470530.1| 2,3-bisphosphoglycerate-indepen...   441   e-121   
gi|479207596|ref|YP_007835886.1| phosphoglycerate mutase [Megamo...   441   e-121   
gi|187934745|ref|YP_001887244.1| phosphoglyceromutase [Clostridi...   441   e-121   
gi|194733987|ref|YP_002116639.1| phosphoglyceromutase [Salmonell...   441   e-121   
gi|322421673|ref|YP_004200896.1| phosphoglycerate mutase [Geobac...   441   e-121   
gi|108757281|ref|YP_629495.1| phosphoglyceromutase [Myxococcus x...   441   e-121   
gi|94968102|ref|YP_590150.1| phosphoglyceromutase [Candidatus Ko...   441   e-121   
gi|339443558|ref|YP_004709563.1| hypothetical protein CXIVA_2493...   441   e-121   
gi|406950770|gb|EKD80952.1| hypothetical protein ACD_39C02077G00...   441   e-121   
gi|330839917|ref|YP_004414497.1| phosphoglycerate mutase, 2,3-bi...   441   e-121   
gi|488669508|ref|WP_002598312.1| 2,3-bisphosphoglycerate-indepen...   441   e-121   
gi|167039952|ref|YP_001662937.1| phosphoglyceromutase [Thermoana...   441   e-121   
gi|452122502|ref|YP_007472750.1| phosphoglyceromutase [Salmonell...   441   e-121   
gi|310819108|ref|YP_003951466.1| 2,3-bisphosphoglycerate-indepen...   441   e-121   
gi|446038732|ref|WP_000116587.1| phosphoglyceromutase [Salmonell...   441   e-121   
gi|490848431|ref|WP_004710494.1| phosphoglyceromutase [Yersinia ...   441   e-121   
gi|496559019|ref|WP_009265094.1| phosphoglyceromutase [Lachnospi...   441   e-121   
gi|496542312|ref|WP_009248460.1| phosphoglyceromutase [Lachnospi...   441   e-121   
gi|493351674|ref|WP_006308342.1| phosphoglyceromutase [Facklamia...   441   e-121   
gi|479164625|ref|YP_007793359.1| phosphoglycerate mutase [Bacter...   441   e-121   
gi|512184020|ref|WP_016410736.1| 2 3-bisphosphoglycerate-indepen...   441   e-121   
gi|497222487|ref|WP_009536749.1| phosphoglyceromutase [Oribacter...   441   e-121   
gi|446038734|ref|WP_000116589.1| phosphoglyceromutase [Salmonell...   441   e-121   
gi|488785800|ref|WP_002698207.1| phosphoglyceromutase [Microscil...   441   e-121   
gi|451821913|ref|YP_007458114.1| 2,3-bisphosphoglycerate-indepen...   440   e-121   
gi|488686525|ref|WP_002610744.1| phosphoglyceromutase [Stigmatel...   440   e-121   
gi|156972489|ref|YP_001443396.1| phosphoglyceromutase [Vibrio ha...   440   e-121   
gi|152994757|ref|YP_001339592.1| phosphoglyceromutase [Marinomon...   440   e-121   
gi|319900377|ref|YP_004160105.1| phosphoglycerate mutase [Bacter...   440   e-121   
gi|514419247|ref|WP_016566787.1| 2 3-bisphosphoglycerate-indepen...   440   e-121   
gi|167628774|ref|YP_001679273.1| phosphoglyceromutase [Heliobact...   440   e-121   
gi|297544977|ref|YP_003677279.1| phosphoglycerate mutase [Thermo...   440   e-121   
gi|494218825|ref|WP_007133018.1| phosphoglyceromutase [Paenibaci...   440   e-121   
gi|510837142|ref|WP_016208720.1| phosphoglyceromutase [Clostridi...   440   e-121   
gi|317153505|ref|YP_004121553.1| phosphoglycerate mutase [Desulf...   440   e-121   
gi|488711397|ref|WP_002635276.1| phosphoglyceromutase [Chondromy...   440   e-121   
gi|495299349|ref|WP_008024100.1| phosphoglyceromutase [Bacteroid...   440   e-121   
gi|486158251|ref|WP_001521932.1| phosphoglyceromutase [Salmonell...   440   e-121   
gi|486298637|ref|WP_001575127.1| phosphoglyceromutase [Salmonell...   440   e-121   
gi|508607506|ref|YP_006993428.2| 2,3-bisphosphoglycerate-indepen...   440   e-121   
gi|258405265|ref|YP_003198007.1| phosphoglyceromutase [Desulfoha...   440   e-121   
gi|446038720|ref|WP_000116575.1| phosphoglyceromutase [Salmonell...   439   e-121   
gi|497980091|ref|WP_010294247.1| phosphoglyceromutase [Clostridi...   439   e-121   
gi|379702965|ref|YP_005244693.1| phosphoglyceromutase [Salmonell...   439   e-121   
gi|487662209|ref|WP_001752103.1| 2,3-bisphosphoglycerate-indepen...   439   e-121   
gi|332799909|ref|YP_004461408.1| 2,3-bisphosphoglycerate-indepen...   439   e-121   
gi|507084220|ref|WP_016154967.1| 2,3-bisphosphoglycerate-indepen...   439   e-121   
gi|496043109|ref|WP_008767616.1| phosphoglyceromutase [Bacteroid...   439   e-121   
gi|487658921|ref|WP_001750609.1| phosphoglyceromutase [Salmonell...   439   e-121   
gi|197364521|ref|YP_002144158.1| phosphoglyceromutase [Salmonell...   439   e-121   
gi|219856329|ref|YP_002473451.1| hypothetical protein CKR_2986 [...   439   e-121   
gi|198245019|ref|YP_002217666.1| phosphoglyceromutase [Salmonell...   439   e-121   
gi|496138092|ref|WP_008862599.1| phosphoglyceromutase [Barnesiel...   439   e-121   
gi|16766989|ref|NP_462604.1| phosphoglyceromutase [Salmonella en...   439   e-121   
gi|493327273|ref|WP_006284512.1| phosphoglyceromutase [Paenibaci...   439   e-121   
gi|496666287|ref|WP_009308777.1| phosphoglyceromutase [Klebsiell...   439   e-121   
gi|479168833|ref|YP_007797332.1| 2,3-bisphosphoglycerate-indepen...   439   e-121   
gi|283787755|ref|YP_003367620.1| 2,3-bisphosphoglycerate-indepen...   439   e-121   
gi|491415849|ref|WP_005273651.1| phosphoglyceromutase [Yersinia ...   439   e-121   
gi|513037527|ref|WP_016505741.1| 2,3-bisphosphoglycerate-indepen...   439   e-121   
gi|78356800|ref|YP_388249.1| phosphoglyceromutase [Desulfovibrio...   439   e-121   
gi|153955988|ref|YP_001396753.1| phosphoglyceromutase [Clostridi...   439   e-120   
gi|496420812|ref|WP_009129659.1| 2,3-bisphosphoglycerate-indepen...   439   e-120   
gi|224585504|ref|YP_002639303.1| phosphoglyceromutase [Salmonell...   439   e-120   
gi|492740318|ref|WP_005942483.1| 2,3-bisphosphoglycerate-indepen...   439   e-120   
gi|161486772|ref|NP_807437.2| phosphoglyceromutase [Salmonella e...   439   e-120   
gi|378981275|ref|YP_005229416.1| phosphoglyceromutase [Klebsiell...   439   e-120   
gi|312793582|ref|YP_004026505.1| phosphoglycerate mutase, 2,3-bi...   439   e-120   
gi|16504911|emb|CAD03290.1| 2,3-bisphosphoglycerate-independent ...   439   e-120   
gi|446038730|ref|WP_000116585.1| phosphoglyceromutase [Salmonell...   439   e-120   
gi|238897056|ref|YP_002921802.1| phosphoglyceromutase [Klebsiell...   439   e-120   
gi|494842160|ref|WP_007568260.1| phosphoglyceromutase [Bacteroid...   439   e-120   
gi|150015489|ref|YP_001307743.1| phosphoglyceromutase [Clostridi...   439   e-120   
gi|487594859|ref|WP_001728210.1| phosphoglyceromutase [Salmonell...   439   e-120   
gi|123440477|ref|YP_001004471.1| phosphoglyceromutase [Yersinia ...   439   e-120   
gi|490292561|ref|WP_004188142.1| phosphoglyceromutase [Klebsiell...   439   e-120   
gi|497737443|ref|WP_010051627.1| phosphoglyceromutase [Carnobact...   439   e-120   
gi|497370783|ref|WP_009684996.1| phosphoglyceromutase [Pseudomon...   439   e-120   
gi|446038723|ref|WP_000116578.1| phosphoglyceromutase [Salmonell...   439   e-120   
gi|511024733|ref|WP_016279014.1| 2,3-bisphosphoglycerate-indepen...   439   e-120   
gi|498213597|ref|WP_010527753.1| phosphoglyceromutase [Anaeropha...   439   e-120   
gi|152972462|ref|YP_001337608.1| phosphoglyceromutase [Klebsiell...   439   e-120   
gi|332159702|ref|YP_004296279.1| phosphoglyceromutase [Yersinia ...   439   e-120   
gi|510411054|emb|CCV59608.1| 2,3-bisphosphoglycerate-independent...   439   e-120   
gi|390935575|ref|YP_006393080.1| 2,3-bisphosphoglycerate-indepen...   438   e-120   
gi|161505761|ref|YP_001572873.1| phosphoglyceromutase [Salmonell...   438   e-120   
gi|496056760|ref|WP_008781267.1| phosphoglyceromutase [Bacteroid...   438   e-120   
gi|148266137|ref|YP_001232843.1| phosphoglyceromutase [Geobacter...   438   e-120   
gi|312622372|ref|YP_004023985.1| phosphoglycerate mutase, 2,3-bi...   438   e-120   
gi|446038726|ref|WP_000116581.1| phosphoglyceromutase [Salmonell...   438   e-120   


>gi|384490365|gb|EIE81587.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Rhizopus delemar RA 99-880]
          Length = 520

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/479 (63%), Positives = 390/479 (81%), Gaps = 2/479 (0%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NAETPVMDKL++E+ +T + AHGL+VGLP+GLMGNSEVGHLNIGAGRVVYQDIVRIDLA+
Sbjct: 41  NAETPVMDKLEKEHAFTAISAHGLSVGLPDGLMGNSEVGHLNIGAGRVVYQDIVRIDLAM 100

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K K+F +++NI   F+RAK +NGR+HF+GL+SDGGVH HI+HL+ LLE AK  G+P++YV
Sbjct: 101 KKKEFGQIENIKNAFERAKSSNGRLHFMGLISDGGVHGHIDHLVSLLEAAKEAGVPESYV 160

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT P+S+  Y++QL +++D L YGKIA I GRYYAMDRDKRWER++IAF+ +T
Sbjct: 161 HFFGDGRDTAPKSAAGYMKQLVESLDKLQYGKIADISGRYYAMDRDKRWERVQIAFDGMT 220

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQT 240
           +  GE++ DP+  I +R++ +ETDEFLKPII+++EG IK++DT+F F+FR+DRMR+I Q 
Sbjct: 221 QAKGEEASDPVKAIEDRYAANETDEFLKPIIINKEGQIKDDDTIFCFNFRSDRMREISQA 280

Query: 241 FGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAET 300
           FG+ P PF++ +P+NL I  MT+YKS+FPF +AFP QSM+NVL+EW  K+ + Q H+AET
Sbjct: 281 FGIAPCPFDSPVPKNLEIFTMTQYKSDFPFKVAFPAQSMDNVLAEWLGKNDVPQMHIAET 340

Query: 301 EKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPF 360
           EK+AHVTFFFNGG E  F+LE R L+DSPKVATYDLKPEMS             S K+PF
Sbjct: 341 EKYAHVTFFFNGGTEAQFNLEERGLVDSPKVATYDLKPEMSAAGVADKVAEAIASDKYPF 400

Query: 361 VMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQDE 420
           VM NFA PDMVGHTG YDAA K +E TDKAIG+I EAC+ NGY LFIT+DHGNAE+M  +
Sbjct: 401 VMCNFAPPDMVGHTGVYDAAVKGVEATDKAIGVILEACQKNGYALFITADHGNAEKMLSD 460

Query: 421 EG-NPHTAHTCNPVPFILASNK-YSFAESTKGALCDVAPTILDVIGLETPKEMTGLSLL 477
           +G +P TAHTC  VPF++ +++   FAE ++GALCDVAPT+L+ +GL+ PKEMTG SLL
Sbjct: 461 DGKSPFTAHTCAKVPFVMVNDQGKKFAEGSEGALCDVAPTVLEYLGLDIPKEMTGKSLL 519



>gi|384483579|gb|EIE75759.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Rhizopus delemar RA 99-880]
          Length = 521

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/480 (63%), Positives = 386/480 (80%), Gaps = 3/480 (0%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NAETPVMDKL++E+P+T++ AHGLAVGLP+GLMGNSEVGHLNIGAGRVVYQDIVRIDL +
Sbjct: 41  NAETPVMDKLEKEHPFTSIAAHGLAVGLPDGLMGNSEVGHLNIGAGRVVYQDIVRIDLTM 100

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K K+F +V+NI   F+RAK TNGR+HF+GLVSDGGVH HINHL+ LLE A++ G+P++Y+
Sbjct: 101 KKKEFGQVENIKNAFERAKSTNGRLHFMGLVSDGGVHGHINHLVSLLEAARDAGVPESYI 160

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT P+S+  Y++QL +++D L YGKIA + GRYYAMDRDKRWERI+IAF+ +T
Sbjct: 161 HFFGDGRDTAPKSAAGYMKQLLESLDKLQYGKIADVTGRYYAMDRDKRWERIQIAFDGMT 220

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQT 240
           +G GE++ DP+  I +R++ DETDEFLKPIIV++EG IKE DT+F F+FR+DRMR+I Q 
Sbjct: 221 QGKGEEASDPVKAIEDRYAADETDEFLKPIIVNKEGQIKEGDTIFCFNFRSDRMREITQA 280

Query: 241 FGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAET 300
            G+ P PF++ +P+N+ +  MT+YKS+FPF +AFP QSM+NVL+EW  K+ + Q H+AET
Sbjct: 281 LGIAPCPFDSPVPKNIEVFTMTQYKSDFPFKVAFPAQSMDNVLAEWLGKNDVPQMHIAET 340

Query: 301 EKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPF 360
           EK+AHVTFFFNGG E  F+LE R L+DSPKVATYDLKPEMS             S K+PF
Sbjct: 341 EKYAHVTFFFNGGTEAQFNLEDRGLVDSPKVATYDLKPEMSAAGVADKVAEAIASDKYPF 400

Query: 361 VMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQDE 420
           VM NFA PDMVGHTG Y+AA K +E TDKAIG I EAC+ +GY LFIT+DHGNAE+M  +
Sbjct: 401 VMCNFAPPDMVGHTGVYEAAVKGVETTDKAIGTILEACQKHGYALFITADHGNAEKMLSD 460

Query: 421 EG-NPHTAHTCNPVPFILASN--KYSFAESTKGALCDVAPTILDVIGLETPKEMTGLSLL 477
           +G +P TAHTC  VPF++ ++  K    ++  GALCDVAPT+LD +GL  PKEMTG SLL
Sbjct: 461 DGKSPFTAHTCAKVPFVMVNDQGKKFVKDADSGALCDVAPTVLDYLGLHIPKEMTGKSLL 520



>gi|511003312|gb|EPB84718.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Mucor
           circinelloides f. circinelloides 1006PhL]
          Length = 519

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/478 (63%), Positives = 374/478 (78%), Gaps = 1/478 (0%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NAETPVMDKL++E P+  + AHGL+VGLP+GLMGNSEVGHLNIGAGR+VYQDIVRIDLA+
Sbjct: 41  NAETPVMDKLEKEDPFVPIAAHGLSVGLPDGLMGNSEVGHLNIGAGRIVYQDIVRIDLAM 100

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN +F +++NI   F+RA   NGR+HF+GLVSDGGVH HI+HL+ LL  AK  G+P++YV
Sbjct: 101 KNNEFGQIENIKGAFERAINGNGRLHFMGLVSDGGVHGHIDHLVSLLTAAKAAGVPESYV 160

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT P+S+ KY++QL  AI  L YGKIA I GRYYAMDRDKRWERI++AF+ +T
Sbjct: 161 HFFGDGRDTAPKSAAKYMQQLVDAIKKLGYGKIADINGRYYAMDRDKRWERIQVAFDGMT 220

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQT 240
           +  GEK  DP+  I +R++  ETDEFLKPIIVDE G IKENDT+F F+FR+DRMR+I Q 
Sbjct: 221 QAKGEKVSDPVKAIEDRYAAGETDEFLKPIIVDEAGQIKENDTIFCFNFRSDRMREIAQA 280

Query: 241 FGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAET 300
           FG+ P PF++ +P+N+ +  MT+YK +FPF +AFP QSM+NVL+EW AK+ + Q H+AET
Sbjct: 281 FGIAPCPFDSPVPKNIELYTMTQYKGDFPFKIAFPAQSMDNVLAEWLAKNDVPQMHIAET 340

Query: 301 EKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPF 360
           EK+AHVTFFFNGG E  F LE R L+ SPKVATYDL+PEMS             S K+PF
Sbjct: 341 EKYAHVTFFFNGGSEAQFHLEERGLVPSPKVATYDLQPEMSAAGVAEKVAEALDSNKYPF 400

Query: 361 VMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQDE 420
           VM NFA PDMVGHTG Y+AA K +  TDKAIG++ EACK NGY LF+T+DHGNAE+M  +
Sbjct: 401 VMCNFAPPDMVGHTGVYEAAVKGVAATDKAIGVVLEACKKNGYALFVTADHGNAEKMIAD 460

Query: 421 EG-NPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGLSLL 477
           +G +P TAHTC  VPF++A +   F    +GALCDVAPTIL  +GL+ PKEMTG SLL
Sbjct: 461 DGKSPFTAHTCAKVPFVMADDDAKFKSDAEGALCDVAPTILAYMGLDIPKEMTGKSLL 518



>gi|409048330|gb|EKM57808.1| hypothetical protein PHACADRAFT_251664 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 521

 Score =  617 bits (1592), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 301/488 (61%), Positives = 370/488 (75%), Gaps = 10/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A T  MD + +++ + TL AHGLAVGL +GLMGNSEVGHLNIGAGRVV+QDIV+ID+++K
Sbjct: 32  ATTENMDTIAKDHSHRTLHAHGLAVGLSDGLMGNSEVGHLNIGAGRVVWQDIVKIDVSIK 91

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            ++F++ + I++   RAKE NGR+H LGLVSDGGVHSHINHL  LLETAK   +P  Y+H
Sbjct: 92  KRQFHKNEVILESCKRAKEGNGRLHLLGLVSDGGVHSHINHLKALLETAKEQSVPHVYIH 151

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           FFGDGRDT PRS+  Y + L + +    +G+IATI+GRYYAMDRDKRWER+KIA E L K
Sbjct: 152 FFGDGRDTAPRSAAGYAKDLLEFLKKEKFGQIATIVGRYYAMDRDKRWERVKIAVEGLVK 211

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQIVQT 240
           G GEK ED +  I ER+ KDETDEFLKPIIV+ +EG +K+ DTLFFF++R+DRMR+IV  
Sbjct: 212 GEGEKGEDVVKAIEERYKKDETDEFLKPIIVNGDEGRVKDGDTLFFFNYRSDRMREIVAL 271

Query: 241 FGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAET 300
           FG+P  P E  IP++LH++ M+RY  E+ FP+AFPPQ+M NVL+EWFAK  + Q H+AET
Sbjct: 272 FGLPDKPTEVDIPKDLHVSTMSRYNQEWSFPVAFPPQAMTNVLAEWFAKQGVKQAHIAET 331

Query: 301 EKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPF 360
           EK+AHVTFFFNGGVE+ F+ E R +I SPKVATYD  P+MS            +  +  F
Sbjct: 332 EKYAHVTFFFNGGVEKQFENEERHMIPSPKVATYDKDPKMSVKDVAKKVAEVVKKSEHEF 391

Query: 361 VMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD- 419
           VM NFA PDMVGHTG YDAA +AI  TD+A+GI+Y+AC+  GYIL ITSDHGNAEQM + 
Sbjct: 392 VMCNFAPPDMVGHTGVYDAAVEAINHTDEAVGIVYKACEEAGYILLITSDHGNAEQMINP 451

Query: 420 EEGNPHTAHTCNPVPFILASN--KYSFAESTK------GALCDVAPTILDVIGLETPKEM 471
           E GNPHTAHT NPVPFI+  +  K SFAE  K      GALCDVAPTILDV+GL  P+EM
Sbjct: 452 ETGNPHTAHTTNPVPFIMTGDPKKLSFAEDKKDGEEDEGALCDVAPTILDVMGLPKPEEM 511

Query: 472 TGLSLLKK 479
            G SLL K
Sbjct: 512 EGRSLLTK 519



>gi|403412140|emb|CCL98840.1| predicted protein [Fibroporia radiculosa]
          Length = 521

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 293/486 (60%), Positives = 369/486 (75%), Gaps = 10/486 (2%)

Query: 4   TPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNK 63
           T  MD + +++   TL AHGLAVGL +GLMGNSEVGHLNIGAGR+V+QDIV+ID+++K +
Sbjct: 34  TTNMDTIAKDHSVRTLNAHGLAVGLSDGLMGNSEVGHLNIGAGRIVWQDIVKIDVSIKKR 93

Query: 64  KFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFF 123
           +F++ + I++  +RAKE NGR+H LGLVSDGGVHSHI HL+ LLETAK  G+P  Y+HFF
Sbjct: 94  QFHKNEVILESCNRAKEGNGRLHLLGLVSDGGVHSHIRHLLALLETAKEAGVPHVYIHFF 153

Query: 124 GDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTKGV 183
           GDGRDT PRS+  Y ++L   I+   YGK+AT++GRYYAMDRDKRWER+K+A + L KG 
Sbjct: 154 GDGRDTAPRSAAGYAKELLDFIEKEKYGKVATVVGRYYAMDRDKRWERVKVAIDGLVKGE 213

Query: 184 GEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQIVQTFG 242
           GEK+ED ++ I ER+ KDETDEFLKPIIV+  EG IK++DTLFFF++R+DRMR+I   FG
Sbjct: 214 GEKAEDIVAVIEERYKKDETDEFLKPIIVNGAEGRIKDDDTLFFFNYRSDRMREIASVFG 273

Query: 243 VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETEK 302
           +P  P E  IP+NLHI+ M+RY +EFPFP+AFPPQ+M NVL+EW +K  I Q H+AETEK
Sbjct: 274 LPDKPMEVDIPKNLHISTMSRYNAEFPFPVAFPPQAMTNVLAEWLSKQGIKQAHIAETEK 333

Query: 303 FAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPFVM 362
           +AHVTFFFNGGVE+ F  E R +I SPKVATYD +P MS            + G   FVM
Sbjct: 334 YAHVTFFFNGGVEKQFSEEERHMIPSPKVATYDKQPNMSVQGVADKVAEVVKEGTHEFVM 393

Query: 363 NNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD-EE 421
            NFA PDMVGHTG YDAA +AI  TD A+G +Y+AC+  GYIL IT+DHGNAEQM + E 
Sbjct: 394 CNFAPPDMVGHTGIYDAAVEAITHTDAAVGTVYKACQEAGYILLITADHGNAEQMINPET 453

Query: 422 GNPHTAHTCNPVPFILASN--KYSFA------ESTKGALCDVAPTILDVIGLETPKEMTG 473
           G PHTAHT NPVPFI+  +  K SF+      +   GALCDVAPT+LD++GL  P +M+G
Sbjct: 454 GAPHTAHTTNPVPFIMTGDPKKLSFSVDKNDGDEEGGALCDVAPTVLDIMGLSKPDDMSG 513

Query: 474 LSLLKK 479
            SLL+K
Sbjct: 514 RSLLEK 519



>gi|328770253|gb|EGF80295.1| hypothetical protein BATDEDRAFT_11378 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 524

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 290/487 (59%), Positives = 360/487 (73%), Gaps = 9/487 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVM  L + YP+T + AHGLAVGLPEGLMGNSEVGHLNIGAGR+VYQDIVRI+L++
Sbjct: 37  NAQTPVMTHLAKTYPHTPIAAHGLAVGLPEGLMGNSEVGHLNIGAGRIVYQDIVRIELSI 96

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KNK  +    +V  F  A +  GR+H +GLVSDGGVHSH+NH I LL  AK+  +P+ ++
Sbjct: 97  KNKTLHTQKAVVDAFSHASQGTGRLHLVGLVSDGGVHSHMNHCISLLGAAKDAQVPETFI 156

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HF GDGRDT+PRS+  YL+QL      L YGK+AT++GRYYAMDRDKRWER++IA++AL 
Sbjct: 157 HFIGDGRDTSPRSAATYLDQLIATTTQLKYGKLATMVGRYYAMDRDKRWERVQIAYDALV 216

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV--DEEGIIKENDTLFFFDFRADRMRQIV 238
            GVGE + +P   ++ R++ D+TDEFLKPII+  D  G I+  D++  F++R+DRMR++ 
Sbjct: 217 HGVGEHALNPRDALQARYAADQTDEFLKPIILCPDLTGTIQSGDSVILFNYRSDRMRELS 276

Query: 239 QTFGVPPP---PFEAKI--PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
                      PFE+K   P  L+I  MT+YK++FPFP  FPPQ+M+NVL EW  K  IS
Sbjct: 277 LALMAKDATDMPFESKTPPPTGLYIASMTQYKADFPFPTIFPPQTMDNVLGEWLDKMSIS 336

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           QCHVAETEK+AHVTFFFNGG E  + LE R+LI SPKVATYDLKPEMS            
Sbjct: 337 QCHVAETEKYAHVTFFFNGGTEAQYALEDRELIASPKVATYDLKPEMSAIEVANKVAHVV 396

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            S K+PFVM NFA PDMVGHTG Y+ A   +E TD+ IGIIYEACK  GY LF+TSDHGN
Sbjct: 397 ESQKYPFVMCNFAPPDMVGHTGMYEKAILGVEATDRGIGIIYEACKRAGYTLFVTSDHGN 456

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFA--ESTKGALCDVAPTILDVIGLETPKEM 471
           AE+M  ++G PHTAHTCNPVPFI+ +NK  FA  ES  G+LCDVAPT+L+ +GLE P EM
Sbjct: 457 AEKMFGDDGQPHTAHTCNPVPFIMTTNKKQFAVCESDIGSLCDVAPTVLEFMGLEIPIEM 516

Query: 472 TGLSLLK 478
           TG S+LK
Sbjct: 517 TGKSILK 523



>gi|353235842|emb|CCA67848.1| probable phosphoglyceromutase [Piriformospora indica DSM 11827]
          Length = 515

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 290/482 (60%), Positives = 366/482 (75%), Gaps = 8/482 (1%)

Query: 4   TPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNK 63
           T  MDKL  EY Y T+ AHGLAVGL +GLMGNSEVGHLNIGAGR+V+QDIVRID +++ K
Sbjct: 33  TETMDKLANEYAYRTIAAHGLAVGLSDGLMGNSEVGHLNIGAGRIVWQDIVRIDQSIRKK 92

Query: 64  KFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFF 123
           +F++ + I      AK+ NGR+H LGLVSDGGVHSH  HL  LLETAK   +P+ YVHFF
Sbjct: 93  QFHKSEVIRASMQHAKDGNGRLHLLGLVSDGGVHSHNTHLYALLETAKEMEVPECYVHFF 152

Query: 124 GDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTKGV 183
           GDGRDT PRS+ KY E+L   I +L YG+++T++GRYYAMDRDKRWER+KIA + L  G 
Sbjct: 153 GDGRDTAPRSAKKYAEELLDFIKNLGYGEVSTVVGRYYAMDRDKRWERVKIAVDGLVSGE 212

Query: 184 GEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGI-IKENDTLFFFDFRADRMRQIVQTFG 242
           G++++D L  I E++ +++TDEFLKPII   EG  IKE DTLFFF++R+DRMR+IV  FG
Sbjct: 213 GQQTDDLLQLIEEKYKENQTDEFLKPIICGSEGSRIKEGDTLFFFNYRSDRMREIVSVFG 272

Query: 243 VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETEK 302
           + P P E  +P++LHIT M+RY +EFPFP+AFPPQ M +VL+EW +   + Q H+AETEK
Sbjct: 273 LEPKPMEVTVPKDLHITTMSRYNTEFPFPIAFPPQGMSDVLAEWISSKGLKQAHIAETEK 332

Query: 303 FAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPFVM 362
           +AHVTFFFNGGVE+ F+ E R LI+SPKVATYDL+P+MS            ++ ++ FVM
Sbjct: 333 YAHVTFFFNGGVEKQFEQEERFLINSPKVATYDLQPQMSAPEVAEKVAEVVKTKEYDFVM 392

Query: 363 NNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD-EE 421
            NFA PDMVGHTGK +AAT+AI  TDKA+  IY+ACK  GY+L IT+DHGNAEQM + + 
Sbjct: 393 CNFAPPDMVGHTGKLEAATEAISHTDKAVNTIYQACKEAGYVLAITADHGNAEQMINPDT 452

Query: 422 GNPHTAHTCNPVPFILA--SNKYSFAESTK----GALCDVAPTILDVIGLETPKEMTGLS 475
           G PHTAHT NPVPFI+   S ++SFAE  K    GALCDVAPT+L ++GL+ P +MTG S
Sbjct: 453 GAPHTAHTTNPVPFIIVSESKEFSFAEDPKDAEEGALCDVAPTVLAIMGLDQPADMTGRS 512

Query: 476 LL 477
           LL
Sbjct: 513 LL 514



>gi|389738271|gb|EIM79471.1| phosphoglycerate mutase [Stereum hirsutum FP-91666 SS1]
          Length = 537

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 295/500 (59%), Positives = 359/500 (71%), Gaps = 26/500 (5%)

Query: 4   TPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNK 63
           T  MD +  E+ Y TL AHG AVGL EGLMGNSEVGHLNIGAGRVV+QDIVRID+++K +
Sbjct: 34  TTNMDTIGAEHSYRTLAAHGTAVGLSEGLMGNSEVGHLNIGAGRVVWQDIVRIDVSIKKR 93

Query: 64  KFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFF 123
           +F++ + IV  F  AKETNGR+H LGLVSDGGVHSHINHL  LLETAK  G+P  YVHFF
Sbjct: 94  QFHKNETIVASFKHAKETNGRLHLLGLVSDGGVHSHINHLYALLETAKEIGVPHVYVHFF 153

Query: 124 GDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTKGV 183
           GDGRDT PRSS  Y + L   I+    G +AT +GRYYAMDRDKRWER+KIA + L KG 
Sbjct: 154 GDGRDTAPRSSATYAKDLLAFIEKEKIGTVATAVGRYYAMDRDKRWERVKIAVDGLVKGE 213

Query: 184 GEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQTFG 242
           GEKSED + +I E + +DETDEFLKPI++   E  IK++DTLFFF++R+DRMR+I   FG
Sbjct: 214 GEKSEDLVKSIEEAYKRDETDEFLKPIVLGGSESRIKDDDTLFFFNYRSDRMREIASVFG 273

Query: 243 VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETEK 302
           +P  P E  +P+NLHIT M+RY +EFPFP+AFPPQ+M NVL+EW  K  + Q H+AETEK
Sbjct: 274 LPDKPMEVDVPKNLHITTMSRYNAEFPFPVAFPPQAMTNVLAEWLGKKGVKQAHIAETEK 333

Query: 303 FAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPFVM 362
           +AHVTFFFNGGVE+ F+ E R +I SPKVATYD +P MS            ++    FVM
Sbjct: 334 YAHVTFFFNGGVEKQFENEERHMIASPKVATYDKQPSMSVQAVADKVAEVVKADTHEFVM 393

Query: 363 NNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD-EE 421
            NFA PDMVGHTG YDAA +AI  TD A+G +Y+AC+  GYIL IT+DHGNAEQM +   
Sbjct: 394 CNFAPPDMVGHTGIYDAAVEAIGHTDAAVGTVYKACQEAGYILLITADHGNAEQMINPAN 453

Query: 422 GNPHTAHTCNPVPFILASN--KYSFAEST----------------------KGALCDVAP 457
           GNPHTAHT NPVPFI+  +  K+ F E                        +GALCDVAP
Sbjct: 454 GNPHTAHTTNPVPFIMTGDPKKFKFTEDKTGGKAGKEGEKAKAKVVEEDEEEGALCDVAP 513

Query: 458 TILDVIGLETPKEMTGLSLL 477
           T+L ++GL+ P+EMTG SLL
Sbjct: 514 TVLALLGLDQPEEMTGRSLL 533



>gi|395335112|gb|EJF67488.1| cofactor-independent phosphoglycerate mutase [Dichomitus squalens
           LYAD-421 SS1]
          Length = 521

 Score =  605 bits (1559), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 295/486 (60%), Positives = 369/486 (75%), Gaps = 10/486 (2%)

Query: 4   TPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNK 63
           T  MD + +++ + TL AHGLAVGL +GLMGNSEVGHLNIGAGR+V+QDIVRID+A+K +
Sbjct: 34  TTNMDTIAKDHSHRTLHAHGLAVGLSDGLMGNSEVGHLNIGAGRIVWQDIVRIDVAIKKR 93

Query: 64  KFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFF 123
           +F++ +NI++ F+RAK  NGR+H LGLVSDGGVHSHI HL  LLETAK  G+ + Y+HFF
Sbjct: 94  QFHKNENILESFNRAKNGNGRLHLLGLVSDGGVHSHITHLYALLETAKEVGLKEVYIHFF 153

Query: 124 GDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTKGV 183
           GDGRDT PRS+  YL+ L   I+    G++ATI+GRYYAMDRDKRWERIKIA + L KG 
Sbjct: 154 GDGRDTAPRSAAGYLKDLLAFIEKEKVGEVATIVGRYYAMDRDKRWERIKIAVDGLVKGE 213

Query: 184 GEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQIVQTFG 242
           GE +EDP+  I E + KDETDEFLKPIIV+ + G IK+ DTLFFF++R+DRMR+IV  FG
Sbjct: 214 GENAEDPVKAIEEHYKKDETDEFLKPIIVNGDAGRIKDGDTLFFFNYRSDRMREIVSVFG 273

Query: 243 VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETEK 302
           +P  P E  +P++LHIT M+RY +EFPF +AFPPQ+M NVL+EW +K  + Q H+AETEK
Sbjct: 274 LPDKPTEVDVPKDLHITTMSRYNAEFPFKVAFPPQAMTNVLAEWLSKQGVKQAHIAETEK 333

Query: 303 FAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPFVM 362
           +AHVTFFFNGGVE+ F  E R +I SPKVATYD +P+MS            R+G   FVM
Sbjct: 334 YAHVTFFFNGGVEKQFADEERHMIPSPKVATYDKQPKMSVHGVAEKVAEVVRAGTHEFVM 393

Query: 363 NNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD-EE 421
            NFA PDMVGHTG Y+AA +AI  TD+A+GI+Y+AC+  GYIL IT+DHGNAEQM + E 
Sbjct: 394 CNFAPPDMVGHTGVYEAAVEAIGHTDEAVGIVYKACQEAGYILLITADHGNAEQMINPET 453

Query: 422 GNPHTAHTCNPVPFILASN--KYSFA------ESTKGALCDVAPTILDVIGLETPKEMTG 473
           G PHTAHT NPVPFI+  +  K+ F       E  +GAL DVAPT+LD++GL  P+EMTG
Sbjct: 454 GAPHTAHTTNPVPFIMTGDPKKFKFTEDKKDGEEEEGALADVAPTVLDILGLPKPEEMTG 513

Query: 474 LSLLKK 479
            SLL K
Sbjct: 514 RSLLAK 519



>gi|449541525|gb|EMD32508.1| hypothetical protein CERSUDRAFT_118541 [Ceriporiopsis subvermispora
           B]
          Length = 542

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 296/509 (58%), Positives = 364/509 (71%), Gaps = 31/509 (6%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            ET  MD +   + Y TL AHGLAVGL +GLMGNSEVGHLNIGAGR+V+QDIV+ID+++K
Sbjct: 32  GETKNMDSIAETHSYRTLAAHGLAVGLSDGLMGNSEVGHLNIGAGRIVWQDIVKIDVSIK 91

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            ++F++ D IV    RAK+ NGR+H LGLVSDGGVHSHI+HL  LLETAK  G+P  Y+H
Sbjct: 92  KRQFHKSDKIVDSCKRAKDGNGRLHLLGLVSDGGVHSHIHHLYALLETAKEIGVPHVYIH 151

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           FFGDGRDT PRS+  Y + L + ++   YG+IAT++GRYYAMDRDKRWER+KIA + L K
Sbjct: 152 FFGDGRDTAPRSAAGYAKDLLEFLEKEKYGQIATVVGRYYAMDRDKRWERVKIAVDGLVK 211

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQTF 241
           G GEK++D +  I E + KDETDEFLKPII+ EEG IK+ DTLFFF++R+DRMR+I   F
Sbjct: 212 GEGEKADDVVKAIEEHYKKDETDEFLKPIILSEEGRIKDGDTLFFFNYRSDRMREITTVF 271

Query: 242 GVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETE 301
           G+P  P E  +P++LHIT M+RY +EFPFP+AFPP  M NVL+EW A   + Q HVAETE
Sbjct: 272 GLPDKPMEVDVPKDLHITTMSRYNAEFPFPVAFPPLPMTNVLAEWLATQGVKQAHVAETE 331

Query: 302 KFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPFV 361
           K+AHVTFFFNGGVE+ F+ E R +I SPKV TYD +PEMS            + G++ FV
Sbjct: 332 KYAHVTFFFNGGVEKQFENEERFMIPSPKVPTYDKQPEMSVQGVADKVAELVKKGEYDFV 391

Query: 362 MNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD-E 420
           M NFA PDMVGHTG YDAA +AI  TDKA+G +Y+AC+  GY+L IT+DHGNAEQM + E
Sbjct: 392 MCNFAPPDMVGHTGVYDAAVEAITATDKAVGTVYKACEEAGYVLLITADHGNAEQMINPE 451

Query: 421 EGNPHTAHTCNPVPFILASN--KYSFAESTK------GALCDVAPTILDVI--------- 463
            GNPHTAHT NPVPFI+  +  K  F    K      GALCDVAPTILD++         
Sbjct: 452 TGNPHTAHTTNPVPFIMTGDPKKLQFTVDKKDEDEEEGALCDVAPTILDLLVRGVLCYLC 511

Query: 464 -------------GLETPKEMTGLSLLKK 479
                        GL  P+EMTG SLL K
Sbjct: 512 DRVWLAEYASHVQGLPKPEEMTGRSLLAK 540



>gi|169767532|ref|XP_001818237.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus oryzae RIB40]
 gi|238484431|ref|XP_002373454.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus flavus NRRL3357]
 gi|9955875|dbj|BAB12237.1| phosphoglyceromutase [Aspergillus oryzae]
 gi|83766092|dbj|BAE56235.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220701504|gb|EED57842.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus flavus NRRL3357]
 gi|391871883|gb|EIT81032.1| phosphoglycerate mutase [Aspergillus oryzae 3.042]
          Length = 520

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 290/489 (59%), Positives = 363/489 (74%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP M        K    Y+ L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPFMSGFAEADSKTAQGYSELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  + N+VDN+V  F RAKE NGR+H LGLVSDGGVHS+I HLI LL+ AK   IP
Sbjct: 93  DQTLKKGELNKVDNVVASFKRAKEGNGRLHLLGLVSDGGVHSNITHLIGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT P+S+ KY++QL     ++  G+IAT++GRY+AMDRDKRW+R++IA 
Sbjct: 153 KVFIHFFGDGRDTEPKSATKYMQQLLDQTKEIGIGEIATVVGRYWAMDRDKRWDRVEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP+ TI ER+ KDETDEFLKPIIV  EE  +K++DTLFFF++R+DR+R
Sbjct: 213 KGIVSGEGEESSDPVKTINERYEKDETDEFLKPIIVGGEERRVKDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+HIT MT+YK+++ FP+AFPPQ M NVL+EW +K  
Sbjct: 273 EITQLLGDYDRSPKPDF--PYPKNIHITTMTQYKTDYTFPVAFPPQHMGNVLAEWLSKKD 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGG+E+ F  EVRD+I SPKVATYDL P+MS          
Sbjct: 331 VQQCHVAETEKYAHVTFFFNGGIEKQFAGEVRDMIPSPKVATYDLDPKMSAEAVGQKMAD 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               GKF FVMNNFA PDMVGHTGKY+AA + +  TDKAIG+IYEACK  GY+LFIT+DH
Sbjct: 391 RIAEGKFEFVMNNFAPPDMVGHTGKYEAAIQGVAATDKAIGVIYEACKKQGYVLFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M  E+G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMLTEKGTPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M+G +LL K
Sbjct: 511 MSGQNLLVK 519



>gi|390595192|gb|EIN04598.1| cofactor-independent phosphoglycerate mutase [Punctularia
           strigosozonata HHB-11173 SS5]
          Length = 527

 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 299/493 (60%), Positives = 374/493 (75%), Gaps = 16/493 (3%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +T  MD + +++ Y +L AHGLAVGL +GLMGNSEVGHLNIGAGR+V+QDIV+ID+++K
Sbjct: 32  GDTTNMDTIAKDHSYRSLAAHGLAVGLSDGLMGNSEVGHLNIGAGRIVWQDIVKIDVSIK 91

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            K+F++ +NI+     AKE NGR+HFLGLVSDGGVHSHI+HL  LLETAK + +P+ Y+H
Sbjct: 92  KKQFHKNENILASVKHAKEGNGRLHFLGLVSDGGVHSHIHHLHALLETAKENDVPEVYIH 151

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDD---LN-YGKIATIIGRYYAMDRDKRWERIKIAFE 177
           FFGDGRDT PRS+  Y + L   I+D   LN YGK+AT++GRYYAMDRDKRWER+K+A +
Sbjct: 152 FFGDGRDTAPRSAAGYAKDLLAFINDKDGLNGYGKLATVVGRYYAMDRDKRWERVKVAVD 211

Query: 178 ALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQ 236
            L  GVGE+SED + TI  R+ KDETDEFLKPII++ + G +KE DTLFFF++R+DRMR+
Sbjct: 212 GLINGVGEESEDVVKTIEARYEKDETDEFLKPIILNGDTGRVKEGDTLFFFNYRSDRMRE 271

Query: 237 IVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCH 296
           IV  FG P PP +  IP++LHIT M+RY  E+ FP+AFPPQ+M NVLSEW AK  + QCH
Sbjct: 272 IVTVFGFPDPPVDVPIPKDLHITTMSRYNPEWTFPVAFPPQAMTNVLSEWVAKQGLKQCH 331

Query: 297 VAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSG 356
           +AETEK+AHVTFFFNGGVE+ F+ E R +I SPKVATYD +PEMS            +SG
Sbjct: 332 IAETEKYAHVTFFFNGGVEKQFEHEERHMISSPKVATYDKQPEMSVQGVADKVAEVLKSG 391

Query: 357 KFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQ 416
           +  FVM NFA PDMVGHTG YDAA +AI  TDKA+G +Y A +  GY+L IT+DHGNAEQ
Sbjct: 392 EHDFVMCNFAPPDMVGHTGVYDAAVQAISATDKAVGTVYRAAQEAGYVLLITADHGNAEQ 451

Query: 417 MQD-EEGNPHTAHTCNPVPFILA---SNKYSFAESTK-------GALCDVAPTILDVIGL 465
           M + E G PHTAHT N VPFI+A     +++F E  K       GALCDVAPT+L ++GL
Sbjct: 452 MINPETGAPHTAHTTNKVPFIIAGVNGKEWTFEEEKKVGDEEEEGALCDVAPTVLHILGL 511

Query: 466 ETPKEMTGLSLLK 478
           E P+EMTG SLLK
Sbjct: 512 EKPEEMTGRSLLK 524



>gi|302675128|ref|XP_003027248.1| hypothetical protein SCHCODRAFT_70775 [Schizophyllum commune H4-8]
 gi|300100934|gb|EFI92345.1| hypothetical protein SCHCODRAFT_70775 [Schizophyllum commune H4-8]
          Length = 524

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 296/492 (60%), Positives = 361/492 (73%), Gaps = 15/492 (3%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +T  MD + +E+ +  L AHG AVGL EGLMGNSEVGHLNIGAGR+V+QDIVRID+A+K
Sbjct: 32  GDTTNMDTIAKEHFFRKLYAHGTAVGLSEGLMGNSEVGHLNIGAGRIVWQDIVRIDVAIK 91

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            ++F++   I+  F RAKE NGR+H LGLVSDGGVHSHINHL  LLETAK  G+P  YVH
Sbjct: 92  KREFHKNPAILDSFKRAKEGNGRLHLLGLVSDGGVHSHINHLFALLETAKEVGVPHTYVH 151

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           FFGDGRDT PRS+ KY +QL   +   NYG++ATI+GRYYAMDRDKRWERIKIA + LTK
Sbjct: 152 FFGDGRDTAPRSASKYAQQLLDFMKKENYGELATIVGRYYAMDRDKRWERIKIAVDGLTK 211

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQIVQT 240
           G GE S   + T+   + KD TDEFLKPIIVD +EG IK++DTLFFF++R+DRMR+IV  
Sbjct: 212 GEGEVSTAAIDTVEANYKKDVTDEFLKPIIVDGDEGRIKDHDTLFFFNYRSDRMREIVTV 271

Query: 241 FGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAET 300
           FG+P  P E  IP++LHIT M++Y  EF FP+AFPPQ M +VL+EW AK  + Q H+AET
Sbjct: 272 FGLPDKPIELDIPKDLHITTMSKYNPEFTFPVAFPPQKMTDVLAEWLAKQGVHQAHIAET 331

Query: 301 EKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPF 360
           EK+AHVTFFFNGGVE+ ++ E R +I SPKV TYD +PEMS             S K  F
Sbjct: 332 EKYAHVTFFFNGGVEKQYENEERFMIPSPKVPTYDKQPEMSVQSVADKVAEVVASQKHEF 391

Query: 361 VMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD- 419
           VM NFA PDMVGHTG YDAA KAI  TDKA+  +Y+AC+  GY+L +T+DHGNAEQM + 
Sbjct: 392 VMCNFAPPDMVGHTGVYDAAVKAIGATDKAVKTVYDACQKAGYVLLVTADHGNAEQMLNP 451

Query: 420 EEGNPHTAHTCNPVPFILASNKYSFAESTKG------------ALCDVAPTILDVIGLET 467
           + G PHTAHT N VPFI+A  K    E  +G            ALCDVAPT+LD++GL  
Sbjct: 452 DTGAPHTAHTTNKVPFIMAGEKKGI-EGVQGFKEDEELGEEGGALCDVAPTVLDLLGLPQ 510

Query: 468 PKEMTGLSLLKK 479
           P++MTG SLLKK
Sbjct: 511 PEDMTGRSLLKK 522



>gi|296420584|ref|XP_002839849.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636055|emb|CAZ84040.1| unnamed protein product [Tuber melanosporum]
          Length = 512

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 291/483 (60%), Positives = 359/483 (74%), Gaps = 4/483 (0%)

Query: 1   NAETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NAETPVMD  ++    YTTLEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 29  NAETPVMDSFRKNTDGYTTLEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 88

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K   F + +NI     RA+E NGR+H LGL+SDGGVHSH NHL  LL TAK  G+P  Y
Sbjct: 89  MKKGDFPKTENIKISMMRAREGNGRLHLLGLISDGGVHSHQNHLYSLLSTAKEFGVPHVY 148

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +H FGDGRDT+P+SS +YL++L   I +L+  K+ T++GRYYAMDRDKRWER+K+A E L
Sbjct: 149 IHMFGDGRDTDPKSSARYLQELLGRIKELDTVKVGTVVGRYYAMDRDKRWERVKVALEGL 208

Query: 180 TKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQIV 238
            +G GE SEDP++TI+ ++ + ETDEFLKPIIV  EE  IK+NDTLFFF++R+DR+R+I 
Sbjct: 209 VQGKGETSEDPVATIKAKYEQGETDEFLKPIIVSGEEARIKDNDTLFFFNYRSDRVREIT 268

Query: 239 QTFGVPPPPFEA-KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
           Q  GV   P      P N++IT MT+YK+++PF +AFPPQ M++VL+EW AK  I QCHV
Sbjct: 269 QLLGVDNSPLPGFPYPRNINITTMTQYKTDYPFNIAFPPQRMDDVLAEWLAKKGIKQCHV 328

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGK 357
           AETEK+AHVTFFFNGGVE  F+ E RD++ SPKVATYD  P MS              G 
Sbjct: 329 AETEKYAHVTFFFNGGVELRFENETRDMVPSPKVATYDQDPGMSCAAVAEKLSERIAEGN 388

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
           F F+MNNFA PDMVGHTG Y+AA +A+  TD AIG++YEACK +GYILFIT+DHGNAE+M
Sbjct: 389 FEFLMNNFAPPDMVGHTGVYNAAVQAVGHTDAAIGVVYEACKKHGYILFITADHGNAEEM 448

Query: 418 QDEEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKEMTGLSL 476
            +EEG P T+HT NPVPFI+A+    ++   K G L DVAPTIL  +GL+    MTG SL
Sbjct: 449 LNEEGTPKTSHTTNPVPFIMANAPKGWSLKKKDGVLGDVAPTILAAMGLDQSDHMTGQSL 508

Query: 477 LKK 479
           L K
Sbjct: 509 LVK 511



>gi|260794729|ref|XP_002592360.1| hypothetical protein BRAFLDRAFT_285351 [Branchiostoma floridae]
 gi|229277578|gb|EEN48371.1| hypothetical protein BRAFLDRAFT_285351 [Branchiostoma floridae]
          Length = 518

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 289/494 (58%), Positives = 361/494 (73%), Gaps = 15/494 (3%)

Query: 1   NAETPVMDKLKREY---PYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRID 57
           NA+TPVMD   ++     Y TL AHGL+VGLP+GLMGNSEVGHLNIGAGRVVYQDIVRI+
Sbjct: 25  NADTPVMDGFAKDEDKGKYLTLAAHGLSVGLPDGLMGNSEVGHLNIGAGRVVYQDIVRIN 84

Query: 58  LAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPK 117
           LA+  K  N+ +N+VK F+RAK  NGR+HFLGLVSDGGVH+HINHL  LLE AK H +P 
Sbjct: 85  LAMDTKAINQNENLVKAFERAKTGNGRLHFLGLVSDGGVHAHINHLFCLLEAAKEHKVPN 144

Query: 118 AYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFE 177
            YV FFGDGRDT+P S   +++Q+   +++L YGK+ T++GRYYAMDRDKRWERIK+A E
Sbjct: 145 CYVQFFGDGRDTSPTSGVGFVKQVLDKLEELQYGKLGTVVGRYYAMDRDKRWERIKLAHE 204

Query: 178 ALTKGVGEKS--EDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMR 235
            L +G+GEK+  +  L  ++ R+   ETDEFLKPII+D++  +++ DTL F DFRADRMR
Sbjct: 205 GLVQGIGEKATKDTLLDVVKARYEAGETDEFLKPIILDDDARVQDGDTLVFIDFRADRMR 264

Query: 236 QIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
           QI +TFG+ PP   + IP++L +  +T+YK EFPFP  FPPQ M+NVL+EW AK  + Q 
Sbjct: 265 QIAETFGIKPPFDVSVIPKDLGVFSLTQYKEEFPFPALFPPQKMDNVLAEWLAKKNVPQY 324

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX----- 350
           H AETEK+AHVTFFFNGG E  FD E R L+ SPKVATYDL+PEMS              
Sbjct: 325 HCAETEKYAHVTFFFNGGREVQFDKEERSLVPSPKVATYDLQPEMSCAGVADKASGLTFW 384

Query: 351 ----XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                    GK+PF+M NFA PDMVGHTGKY+ A  A   TD AIG I EAC+ +GY++ 
Sbjct: 385 IKMIETIEGGKYPFMMCNFAPPDMVGHTGKYEPAVIACAATDVAIGRINEACQKHGYVML 444

Query: 407 ITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAEST-KGALCDVAPTILDVIGL 465
           +T+DHGNAEQM DE G P TAHTCN VPF+++     F +     A+CDVAPT+LD++GL
Sbjct: 445 VTADHGNAEQMYDENGKPFTAHTCNRVPFVMSGGTAEFKKPEHNAAICDVAPTVLDLMGL 504

Query: 466 ETPKEMTGLSLLKK 479
           + P+EMTG SLLKK
Sbjct: 505 DIPEEMTGQSLLKK 518



>gi|170099924|ref|XP_001881180.1| phosphoglycerate mutase [Laccaria bicolor S238N-H82]
 gi|164643859|gb|EDR08110.1| phosphoglycerate mutase [Laccaria bicolor S238N-H82]
          Length = 528

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 299/495 (60%), Positives = 360/495 (72%), Gaps = 17/495 (3%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+T  MD +  ++ Y TL+AHG AVGL EGLMGNSEVGHLNIGAGR+V+QDIVRID+++K
Sbjct: 33  ADTTNMDSIAEKHSYRTLKAHGTAVGLSEGLMGNSEVGHLNIGAGRIVWQDIVRIDVSIK 92

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            ++F++   I+    RA E  GR+H LGLVSDGGVHSHINHL  LLETAK  G+P  YVH
Sbjct: 93  KRQFHKNPQILDSCKRAVEGTGRLHLLGLVSDGGVHSHINHLFALLETAKEQGVPHTYVH 152

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           F  DGRDT PRSS+KY +QL       NYG++AT++GRYYAMDRDKRWER+K+A + L  
Sbjct: 153 FLADGRDTAPRSSNKYAQQLLDFTKKENYGELATVVGRYYAMDRDKRWERVKVAIDGLVG 212

Query: 182 GVGEK-SEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQIVQ 239
           GVGEK  ED + TI   ++KD TDEFLKPIIV+ +EG IK+ DTLFFF++R+DRMR+IV 
Sbjct: 213 GVGEKVEEDVIKTIEANYAKDVTDEFLKPIIVNGDEGRIKDGDTLFFFNYRSDRMREIVS 272

Query: 240 TFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAE 299
            FG+P  P E  IP++L IT M+ Y SEFPFP+AFPPQ M NVL+EW AK  I Q H+AE
Sbjct: 273 VFGLPNKPMEVDIPKDLGITTMSTYNSEFPFPVAFPPQPMTNVLAEWLAKEGIKQAHIAE 332

Query: 300 TEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFP 359
           TEK+AHVTFFFNGGVE+ F  E R +I SPKVATYD +P+MS            + G+  
Sbjct: 333 TEKYAHVTFFFNGGVEKQFAHEERHMIPSPKVATYDKEPKMSVHSVAEKVAEVLKKGEDQ 392

Query: 360 FVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD 419
           FVM NFA PDMVGHTG YDAA  A+  TDKA+G +Y+A +  GYIL IT+DHGNAE+M+D
Sbjct: 393 FVMCNFAPPDMVGHTGVYDAAVVAVTETDKAVGTVYKAAEEAGYILLITADHGNAEKMKD 452

Query: 420 E-EGNPHTAHTCNPVPFILASNK--YSFAESTK------------GALCDVAPTILDVIG 464
              GNPHTAHT NPVPFI+  N     FAE               GALCDVAPTIL ++G
Sbjct: 453 PVTGNPHTAHTTNPVPFIMTGNPDILKFAEEKAETEKKEEDEEEGGALCDVAPTILAIMG 512

Query: 465 LETPKEMTGLSLLKK 479
           LE PKEMTG SLL K
Sbjct: 513 LEQPKEMTGRSLLAK 527



>gi|392570591|gb|EIW63763.1| cofactor-independent phosphoglycerate mutase [Trametes versicolor
           FP-101664 SS1]
          Length = 520

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 292/488 (59%), Positives = 365/488 (74%), Gaps = 10/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +T  MD + +++ Y TL AHG+AVGL EGLMGNSEVGHLNIGAGR+V+QDIV+ID+A+K
Sbjct: 32  GDTTNMDTIAKDHSYRTLAAHGIAVGLSEGLMGNSEVGHLNIGAGRIVWQDIVKIDVAIK 91

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            ++F++ + I++ F RAK+ NGR+H LGLVSDGGVHSHI HL  LLETAK  G+   ++H
Sbjct: 92  KRQFHKNEVILESFKRAKDGNGRLHLLGLVSDGGVHSHIRHLYALLETAKEVGLTDVFIH 151

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           FFGDGRDT PRS+  YL+ L   I+    G++AT++GRYYAMDRDKRWER+KIA + L K
Sbjct: 152 FFGDGRDTAPRSAAGYLKDLLAFIEKEKVGQVATVVGRYYAMDRDKRWERVKIAVDGLVK 211

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQT 240
           G GE SEDP+ TI E + KD TDEFLKPIIV  E+  I++ DTLFFF++R+DRMR+I   
Sbjct: 212 GEGEASEDPVKTIEECYKKDLTDEFLKPIIVGGEKTRIQDGDTLFFFNYRSDRMREIAAV 271

Query: 241 FGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAET 300
           FG+P  P E +IP++L+IT M+RY +EFPF +AFPPQ+M NVL+EW AK  + Q HVAET
Sbjct: 272 FGLPDKPMEVEIPKDLNITTMSRYNAEFPFHVAFPPQAMTNVLAEWLAKQGVKQAHVAET 331

Query: 301 EKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPF 360
           EK+AHVTFFFNGGVE+ FD E R +I SPKVATYDL+P+MS            R G+  F
Sbjct: 332 EKYAHVTFFFNGGVEKQFDNEERHMIPSPKVATYDLQPKMSVQGVADQVAALVRKGEHEF 391

Query: 361 VMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD- 419
           +M NFA PDMVGHTG YDAA +AI  TDKA+G +Y AC+  GY+L +T+DHGNAEQM + 
Sbjct: 392 IMCNFAPPDMVGHTGVYDAAVEAISHTDKAVGTVYRACEEAGYVLLVTADHGNAEQMINP 451

Query: 420 EEGNPHTAHTCNPVPFILA--SNKYSFA------ESTKGALCDVAPTILDVIGLETPKEM 471
             G PHTAHT NPVPFI+   S    FA      E  +GAL DVAPT+LD++GL  P+EM
Sbjct: 452 TTGAPHTAHTTNPVPFIMTGDSKTLKFAEDKKDGEEEEGALADVAPTVLDILGLPQPEEM 511

Query: 472 TGLSLLKK 479
           TG SLL K
Sbjct: 512 TGRSLLAK 519



>gi|58260376|ref|XP_567598.1| phosphoglycerate mutase [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134117433|ref|XP_772610.1| hypothetical protein CNBK3140 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255227|gb|EAL17963.1| hypothetical protein CNBK3140 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229679|gb|AAW46081.1| phosphoglycerate mutase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 532

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 285/484 (58%), Positives = 362/484 (74%), Gaps = 5/484 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           + +T  MD ++ ++ +  LEAHGLAVGL EGLMGNSEVGHLNIGAGR+V+QDIV+ID ++
Sbjct: 48  HGDTTHMDAIRDKHNFVELEAHGLAVGLKEGLMGNSEVGHLNIGAGRIVWQDIVKIDQSI 107

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F +   IV     AKET+GR+H LGL+SDGGVHSHI HL  LL  AK++GI   Y+
Sbjct: 108 KKDEFKDQPAIVDAMKHAKETSGRLHLLGLISDGGVHSHIQHLFALLRVAKSYGIANVYI 167

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT P+S+ KY++QLQ  I ++  G+I+T+IGRYYAMDRDKRW+RIKIA + L 
Sbjct: 168 HFFGDGRDTAPKSATKYIKQLQDYIKEVGVGEISTVIGRYYAMDRDKRWDRIKIAVDGLV 227

Query: 181 KGVGEKS--EDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQI 237
           KG GEK+  E  + T+ + + KD TDEF+KPII   E+  IK+ D+L+ F++R+DRMR++
Sbjct: 228 KGEGEKTDQEGLIKTVEDGYEKDVTDEFIKPIISGSEDSRIKKGDSLYLFNYRSDRMREL 287

Query: 238 VQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
            Q  G+P  P E  +PE+LHIT M+RY  EFPFP+AFPPQ+M NVL+EW AK  + QCH+
Sbjct: 288 AQVLGLPDKPMEVDVPEDLHITTMSRYNIEFPFPVAFPPQAMTNVLAEWLAKQGVKQCHI 347

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGK 357
           AETEK+AHVTFFFNGGVE+ F+ E R++I SPKVATYD +PEMS            +S K
Sbjct: 348 AETEKYAHVTFFFNGGVEKQFENEKREMIPSPKVATYDKQPEMSVQGVADKVAETVKSDK 407

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
           + FVM NFA PDMVGHTG YDAA KAI  TD A+  +Y+AC+  GY+L +T+DHGNAEQM
Sbjct: 408 YEFVMCNFAPPDMVGHTGDYDAAVKAITATDAAVKTVYDACEEAGYVLCVTADHGNAEQM 467

Query: 418 QD-EEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKEMTGLS 475
            D E GNPHTAHT N VPFI+  +K S   S + GAL DVAPTILD++GL  P+EM+G S
Sbjct: 468 LDPETGNPHTAHTTNHVPFIVTGDKGSLEVSEEPGALADVAPTILDILGLPKPEEMSGRS 527

Query: 476 LLKK 479
           LL K
Sbjct: 528 LLSK 531



>gi|321264207|ref|XP_003196821.1| phosphoglycerate mutase [Cryptococcus gattii WM276]
 gi|317463298|gb|ADV25034.1| Phosphoglycerate mutase, putative [Cryptococcus gattii WM276]
          Length = 532

 Score =  595 bits (1534), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 287/484 (59%), Positives = 360/484 (74%), Gaps = 5/484 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           + +T  MD ++ ++ +  LEAHGLAVGL EGLMGNSEVGHLNIGAGR+V+QDIV+ID ++
Sbjct: 48  HGDTTHMDAIRDKHNFVELEAHGLAVGLKEGLMGNSEVGHLNIGAGRIVWQDIVKIDQSI 107

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F +   I+     AKET+GR+H LGLVSDGGVHSHI HL  LL  AK++ IP  ++
Sbjct: 108 KKDEFKDQPAIIDAMKHAKETSGRLHLLGLVSDGGVHSHIQHLFALLRVAKSYEIPHVFI 167

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT P+S+ KY++QLQ  I ++  G+I+T+ GRYYAMDRDKRW+RIKIA   L 
Sbjct: 168 HFFGDGRDTAPKSATKYIKQLQDYIKEVGVGEISTVCGRYYAMDRDKRWDRIKIAVNGLV 227

Query: 181 KGVGEKS--EDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQI 237
           KG GEK+  E  + T+ + + KD TDEF+KPII   E+  IK+ D+L+ F++R+DRMR+I
Sbjct: 228 KGEGEKTDQEGLIKTVEDNYEKDVTDEFIKPIISGSEDSRIKKGDSLYMFNYRSDRMREI 287

Query: 238 VQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
           VQ  G+P  P E  +PE+LHIT M+RY  EFPFP+AFPPQ M NVL+EW AK  + QCH+
Sbjct: 288 VQVLGLPDKPMEVDVPEDLHITTMSRYNIEFPFPVAFPPQGMTNVLAEWLAKQGVKQCHI 347

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGK 357
           AETEK+AHVTFFFNGGVE+ F+ E R++I SPKVATYD KPEMS            +S K
Sbjct: 348 AETEKYAHVTFFFNGGVEKQFENEQREMIPSPKVATYDKKPEMSVQGVADKVAETVKSDK 407

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
           F FVM NFA PDMVGHTG YDAA KAI  TD A+  +Y+AC+  GY+L IT+DHGNAEQM
Sbjct: 408 FEFVMCNFAPPDMVGHTGDYDAAVKAITATDAAVKTVYDACEEAGYVLCITADHGNAEQM 467

Query: 418 QD-EEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKEMTGLS 475
            D + GNPHTAHT N VPFI+  NK S   S + GAL DVAPTILD++GL  P+EM+G S
Sbjct: 468 LDPKTGNPHTAHTTNHVPFIVTGNKGSLEVSDEPGALADVAPTILDILGLPKPEEMSGRS 527

Query: 476 LLKK 479
           L+ K
Sbjct: 528 LVAK 531



>gi|405119383|gb|AFR94156.1| phosphoglycerate mutase [Cryptococcus neoformans var. grubii H99]
          Length = 532

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 283/484 (58%), Positives = 360/484 (74%), Gaps = 5/484 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           + +T  MD ++ ++ +  LEAHGLAVGL EGLMGNSEVGHLNIGAGR+V+QDIV+ID ++
Sbjct: 48  HGDTTHMDAIRDKHNFVELEAHGLAVGLKEGLMGNSEVGHLNIGAGRIVWQDIVKIDQSI 107

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F +   IV     AKET+GR+H LGLVSDGGVHSHI HL  LL  AK++GI   Y+
Sbjct: 108 KKDEFKDQPAIVDAMKHAKETSGRLHLLGLVSDGGVHSHIQHLFALLRVAKSYGIANVYI 167

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT P+S+ KY++ LQ  I ++  G+I+T++GRYYAMDRDKRWERIK+A + L 
Sbjct: 168 HFFGDGRDTAPKSATKYIKMLQDYIKEVGVGEISTVVGRYYAMDRDKRWERIKVAVDGLV 227

Query: 181 KGVGEKS--EDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQI 237
           KG GEK+  E  + T+ + + KD TDEF+KPII   E+  IK+ D+L+ F++R+DRMR+I
Sbjct: 228 KGEGEKTDQEGLIKTVEDGYEKDVTDEFIKPIISGSEDSRIKKGDSLYLFNYRSDRMREI 287

Query: 238 VQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
            Q  G+P  P E  +PE+LHIT M+RY  EFPFP+AFPPQ M NVL+EW AK  + QCH+
Sbjct: 288 AQVLGLPDKPMEVDVPEDLHITTMSRYNIEFPFPVAFPPQGMTNVLAEWLAKQGVKQCHI 347

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGK 357
           AETEK+AHVTFFFNGGVE+ F+ E R++I SPKVATYD +PEMS            +S K
Sbjct: 348 AETEKYAHVTFFFNGGVEKQFENEKREMIPSPKVATYDKQPEMSVQGVADKVAETVKSDK 407

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
           + FVM NFA PDMVGHTG YDAA KAI  TD A+  +Y+AC+  GY+L +T+DHGNAEQM
Sbjct: 408 YEFVMCNFAPPDMVGHTGDYDAAVKAITATDAAVKTVYDACEEAGYVLCVTADHGNAEQM 467

Query: 418 QD-EEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKEMTGLS 475
            D + GNPHTAHT N VPFI+  +K S   S + G+L DVAPTILD++GL  P+EM+G S
Sbjct: 468 LDPKTGNPHTAHTTNHVPFIVTGDKGSLEVSDEPGSLADVAPTILDILGLPKPEEMSGRS 527

Query: 476 LLKK 479
           LL K
Sbjct: 528 LLSK 531



>gi|345568179|gb|EGX51079.1| hypothetical protein AOL_s00054g639 [Arthrobotrys oligospora ATCC
           24927]
          Length = 514

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 287/483 (59%), Positives = 360/483 (74%), Gaps = 4/483 (0%)

Query: 1   NAETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
            A TP MDK  ++ P +T L+A   AVGLPEGLMGNSEVGHLNIGAGRVV+QD+V+ID +
Sbjct: 31  QAVTPNMDKYYQDKPGFTELDASSTAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVKIDHS 90

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  +F + + IV  FD+A   NGR+HFLGLVSDGGVHS   HL  L++ AK  G+P+ Y
Sbjct: 91  IKQGEFPKTEQIVNVFDKAINGNGRLHFLGLVSDGGVHSKQEHLFELIKAAKVKGVPEVY 150

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +H FGDGRDT+P+S   YLE L   I D   GKI T++GRYYAMDRDKRWER+ IA + L
Sbjct: 151 IHMFGDGRDTDPKSGAGYLETLLGVIKDTGLGKIGTVVGRYYAMDRDKRWERLNIALDGL 210

Query: 180 TKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQIV 238
             G GE SEDP++TIR R+ K+ETDEFLKPIIV+ +E  IK+NDTLFFF++R+DR+R+I 
Sbjct: 211 VNGKGETSEDPVATIRSRYEKNETDEFLKPIIVNGDEARIKDNDTLFFFNYRSDRVREIT 270

Query: 239 QTFGVPPPPF-EAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
           Q  GV   P  +   P+++ IT MTRYK ++PFP+AFPPQ M +VL+EW +K  + QCHV
Sbjct: 271 QLLGVDNSPLPDFNYPKDISITTMTRYKGDYPFPVAFPPQRMGDVLAEWLSKKGVPQCHV 330

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGK 357
           AETEK+AHVTFFFNGGVE  F+ E R+L+ SPKVATYDLKPEMS              GK
Sbjct: 331 AETEKYAHVTFFFNGGVEIQFEGEDRELVSSPKVATYDLKPEMSAQEVADRLAEKIAEGK 390

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
           +PF+MNNFA PDMVGHTG  DAA +A+  TD+AIG ++EACKA+GY LFIT+DHGNAE+M
Sbjct: 391 YPFLMNNFAPPDMVGHTGVLDAAIEAVTHTDRAIGTVFEACKAHGYTLFITADHGNAEEM 450

Query: 418 QDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKEMTGLSL 476
            +EEG P T+HT N VPFI+ +    +    + G L DVAPTIL+ +GL+ P++MTG SL
Sbjct: 451 LNEEGKPKTSHTTNRVPFIMTNRPDGYGLNGSIGVLGDVAPTILEFMGLDIPEDMTGKSL 510

Query: 477 LKK 479
           LKK
Sbjct: 511 LKK 513



>gi|296815104|ref|XP_002847889.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Arthroderma otae CBS 113480]
 gi|238840914|gb|EEQ30576.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Arthroderma otae CBS 113480]
          Length = 520

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 280/487 (57%), Positives = 365/487 (74%), Gaps = 13/487 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM     E       YT ++A   AVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSGFAAEGSKTAQGYTEIDASSTAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +KN K N+V+NIVK F  AK+ NGR+H LGL+SDGGVHSHINHL  LL+ AK  G+P
Sbjct: 93  DQTLKNGKLNQVENIVKSFQTAKDGNGRLHLLGLISDGGVHSHINHLFGLLQVAKEMGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S+  Y+EQL +   +L  G++AT++GRYYAMDRDKRW+RI+IA 
Sbjct: 153 KVFIHFFGDGRDTDPKSAAGYMEQLLQKTKELGIGELATVVGRYYAMDRDKRWDRIEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S D + TI+ER+ K E DEFLKPIIV  ++  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVSGEGEESADAVKTIKERYGKSENDEFLKPIIVGGQDRRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ +T MTRYK+++PFP+AF PQ M NVL+EW +K +
Sbjct: 273 EITQLLGDIDRSPKPDF--PYPKNISLTTMTRYKTDYPFPVAFAPQHMGNVLAEWLSKKQ 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGGVE+ F+ E R++I SPKVATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGVEKQFEGEDREMIPSPKVATYDLDPKMSAQPVGEKLAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                K+ F+MNNFA PDMVGHTG Y+AA K +  TD AIG +YEACK +GYILF+T+DH
Sbjct: 391 RIADNKYEFLMNNFAPPDMVGHTGVYEAAIKGVAATDAAIGCVYEACKKHGYILFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G+P T+HT N VPF++A+    ++ + + G L DVAPT+LDV+G+E P+E
Sbjct: 451 GNAEEMKNADGSPKTSHTTNLVPFVMANAPEGWSLKKSGGVLGDVAPTVLDVMGIEKPEE 510

Query: 471 MTGLSLL 477
           M G SLL
Sbjct: 511 MDGSSLL 517



>gi|121705356|ref|XP_001270941.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus clavatus NRRL 1]
 gi|119399087|gb|EAW09515.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus clavatus NRRL 1]
          Length = 520

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 289/489 (59%), Positives = 364/489 (74%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP M        K    +T LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPYMSGFADPNSKTAQGFTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +KN + N+VDNIVK F RAKE NGR+H LGL+SDGGVHS+I HL+ LL+ AK   IP
Sbjct: 93  DQTLKNGELNKVDNIVKSFTRAKEGNGRLHLLGLISDGGVHSNITHLVGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
             ++HFFGDGRDT+P+S+ KY++ L   + ++  G+IAT++GRYYAMDRDKRW+R+++A 
Sbjct: 153 HVFIHFFGDGRDTDPKSAAKYMQDLLDHMKEIGTGEIATVVGRYYAMDRDKRWDRVEVAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP+ TI+ER+ K E DEFLKPIIV  ++  ++++DTLFFF++R+DR+R
Sbjct: 213 KGIVSGEGEESSDPVKTIKERYEKGENDEFLKPIIVGGKDRRVQDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MT+YK+++ FP+AFPPQ M NVL+EW +K  
Sbjct: 273 EITQLLGDFDRSPKPDF--PYPKNISITTMTQYKTDYTFPVAFPPQHMGNVLAEWLSKKD 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           ISQCHVAETEK+AHVTFFFNGG+E+ F  EVRD+I SPKVATYDL PEMS          
Sbjct: 331 ISQCHVAETEKYAHVTFFFNGGIEKQFPGEVRDMIPSPKVATYDLDPEMSAADVGKKMSE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                KF FVMNNFA PDMVGHTG Y+AA K +  TDKAIG IYEACK +GYILFITSDH
Sbjct: 391 RIAEDKFDFVMNNFAPPDMVGHTGVYEAAIKGVTATDKAIGEIYEACKKHGYILFITSDH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M +E+G P T+HT N VPF+LA+    ++ +  +G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMLNEKGTPKTSHTTNKVPFVLANAPEGWSLKKEEGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M+G SLL K
Sbjct: 511 MSGKSLLVK 519



>gi|67525203|ref|XP_660663.1| hypothetical protein AN3059.2 [Aspergillus nidulans FGSC A4]
 gi|40744454|gb|EAA63630.1| hypothetical protein AN3059.2 [Aspergillus nidulans FGSC A4]
 gi|259485994|tpe|CBF83484.1| TPA: hypothetical protein similar to cofactor-independent
           phosphoglycerate mutase (Eurofung) [Aspergillus nidulans
           FGSC A4]
          Length = 520

 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 286/488 (58%), Positives = 362/488 (74%), Gaps = 11/488 (2%)

Query: 2   AETPVMDKLKREYP-----YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP M     E       YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPFMSGFAEENSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  + N+V+NI   F RAK+ NGR+H LGLVSDGGVHS+I HLI LL+ AK   IP
Sbjct: 93  DQTLKKGELNKVENIAASFKRAKDGNGRLHLLGLVSDGGVHSNITHLIGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           + ++HFFGDGRDT+P+S+ KY++QL  A  ++  G+IAT++GRYYAMDRDKRW+R++IA 
Sbjct: 153 QVFIHFFGDGRDTDPKSAAKYMQQLLDATKEIGVGEIATVVGRYYAMDRDKRWDRVEIAI 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP+  I +R+++DETDEFLKPII   ++  ++++DTLFFF++R+DR+R
Sbjct: 213 KGILSGEGEESSDPVKAIEKRYTEDETDEFLKPIIFGGKDRRVQDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG---VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKI 292
           +I Q  G     P P +   P+N+HIT MT+YK+++ FP+AFPPQ M NVL+EW  K  +
Sbjct: 273 EITQLLGDYDRSPKP-DLPYPKNIHITTMTQYKTDYTFPVAFPPQHMGNVLAEWLGKKDV 331

Query: 293 SQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXX 352
            QCHVAETEK+AHVTFFFNGG+E+ F  EVRD+I SPKVATYDL+PEMS           
Sbjct: 332 QQCHVAETEKYAHVTFFFNGGIEKQFPGEVRDMIPSPKVATYDLEPEMSAEGVGKKVEER 391

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
              GKF FVMNNFA PDMVGHTG Y+AA K +  TDKAIGIIYEACK +GY LFIT+DHG
Sbjct: 392 IAEGKFEFVMNNFAPPDMVGHTGVYEAAIKGVAATDKAIGIIYEACKKHGYTLFITADHG 451

Query: 413 NAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKEM 471
           NAE+M +E+G P T+HT N VPFI+A+    ++     G L DVAPT+L  +G+E PKEM
Sbjct: 452 NAEEMLNEKGTPKTSHTTNRVPFIMANAPEGWSLRKQPGVLGDVAPTVLAAMGIEQPKEM 511

Query: 472 TGLSLLKK 479
           +G SLL K
Sbjct: 512 SGESLLVK 519



>gi|358368295|dbj|GAA84912.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus kawachii IFO 4308]
          Length = 520

 Score =  588 bits (1516), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 285/489 (58%), Positives = 359/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP M        K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPFMSGFAEADSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +VDNIV  F RAKE NGR+H LGLVSDGGVHS+I HLI LL+ AK   IP
Sbjct: 93  DQTLKKGELGKVDNIVASFKRAKEGNGRLHLLGLVSDGGVHSNITHLIGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           + ++HFFGDGRDT P+S+ KY++QL     ++  G+IAT++GRY+AMDRDKRW+R++IA 
Sbjct: 153 QVFIHFFGDGRDTEPKSATKYMQQLLDQAKEIGVGEIATVVGRYWAMDRDKRWDRVEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP+ TI ER+   ETDEFLKPIIV  ++  +++ DTLFFF++R+DR+R
Sbjct: 213 KGIVSGEGEESSDPVKTINERYENKETDEFLKPIIVGGKDRRVQDGDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+++HIT MTRYK+++ FP+AFPPQ M NVL+EW  K  
Sbjct: 273 EITQLLGDYDRSPKPEF--PYPKDIHITTMTRYKTDYTFPVAFPPQHMGNVLAEWLGKKD 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ F  EVRD+I SPKVATYDL+P+MS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQFPGEVRDMIPSPKVATYDLEPKMSAAAVGDKMAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               G F FVMNNFA PDMVGHTG Y+AA + +  TDKAIG+IYEACK +GYILFIT+DH
Sbjct: 391 RLGEGNFEFVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGVIYEACKKHGYILFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M  E+G P T+HT N VPF++A+    ++ +  +G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMLTEKGTPKTSHTTNKVPFVMANAPEGWSLKKEEGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M+G SLL K
Sbjct: 511 MSGRSLLVK 519



>gi|119492039|ref|XP_001263514.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Neosartorya fischeri NRRL 181]
 gi|119411674|gb|EAW21617.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Neosartorya fischeri NRRL 181]
          Length = 520

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/489 (58%), Positives = 362/489 (74%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKREYP-----YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP M     E       YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPYMSGFAEENSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +VDNIVK F RAKE NGR+H LGLVSDGGVHS+I HL+ LL+ AK   IP
Sbjct: 93  DQTLKKGELKKVDNIVKSFTRAKEGNGRLHLLGLVSDGGVHSNITHLVGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           + ++HFFGDGRDT+P+S+ KY++ L     ++  G+IAT++GRYYAMDRDKRW+R+++A 
Sbjct: 153 QIFIHFFGDGRDTDPKSATKYMQDLLDHTKEIGIGEIATVVGRYYAMDRDKRWDRVEVAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP+ TI+ER+ K E DEFLKPIIV  +E  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVCGEGEESSDPVKTIKERYEKGENDEFLKPIIVGGKERRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+HIT MT+YK+++ FP+AFPPQ M NVL+EW +K  
Sbjct: 273 EITQLLGDYDRSPKPDF--PYPKNIHITTMTQYKTDYTFPVAFPPQHMGNVLAEWLSKKD 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           I QCHVAETEK+AHVTFFFNGG+E+ F  EVRD+I SPKV TYD +PEMS          
Sbjct: 331 IQQCHVAETEKYAHVTFFFNGGIEKQFPGEVRDMIPSPKVPTYDHEPEMSAEAVGKKMAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               GKF F+MNNFA PDMVGHTG Y+AA K +  TDKAIG IYEACK +GY+LFIT+DH
Sbjct: 391 RIAEGKFEFIMNNFAPPDMVGHTGVYEAAIKGVAATDKAIGEIYEACKKHGYVLFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M +E+G P T+HT N VPF+LA+    ++ +  +G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMLNEKGTPKTSHTTNKVPFVLANAPEGWSLKKEEGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M+G SLL K
Sbjct: 511 MSGKSLLVK 519



>gi|295659988|ref|XP_002790551.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226281426|gb|EEH36992.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 521

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 287/490 (58%), Positives = 361/490 (73%), Gaps = 14/490 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP M        K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  ADTPTMSGFEEPNSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D A+K  + N+ +NIVK F RAK+ NGR+H LGLVSDGGVHSHINHL  LL+ AK   +P
Sbjct: 93  DQALKKGEMNKTENIVKSFRRAKDGNGRLHLLGLVSDGGVHSHINHLFGLLQVAKELQVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K Y+HFFGDGRDT+P+S+  Y++QL     +L  G++AT++GRYYAMDRDKRW+RI++A 
Sbjct: 153 KVYIHFFGDGRDTDPKSAAGYMQQLLDKTKELGVGEVATVVGRYYAMDRDKRWDRIEVAM 212

Query: 177 EALTKGV-GEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRM 234
           E L  G  GE+S DP++TI ER+ K E DEFLKPIIV  +E  I++NDTLFFF++R+DR+
Sbjct: 213 EGLVTGKEGEESTDPVNTIEERYEKGENDEFLKPIIVGGQERRIQDNDTLFFFNYRSDRV 272

Query: 235 RQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R+I Q  G     P P F    P+N+ IT MT+YK+E+ FP AFPPQ M NVL+EW +K 
Sbjct: 273 REITQLLGDVDRSPKPNF--PYPKNISITTMTQYKTEYNFPAAFPPQHMGNVLAEWLSKK 330

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + QCHVAETEK+AHVTFFFNGGVE+ F  E RD+I SPKVATYDL P+MS         
Sbjct: 331 GLKQCHVAETEKYAHVTFFFNGGVEKQFHGEERDMIPSPKVATYDLDPKMSAAPVAEKLA 390

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KF F+MNNFA PDMVGHTG Y+AA +A+  TDKAI  +Y+ACK NGY+LF+T+D
Sbjct: 391 ERISDNKFEFLMNNFAPPDMVGHTGVYEAAIQAVTATDKAIARVYQACKDNGYVLFVTAD 450

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M++ EG P T+HT N VPF++A+    ++ + + G L DVAPTIL  +G+E P+
Sbjct: 451 HGNAEEMKNAEGTPKTSHTTNKVPFVMANAPEGWSLKKSGGVLGDVAPTILAAMGIEQPE 510

Query: 470 EMTGLSLLKK 479
           EM+G SLL K
Sbjct: 511 EMSGTSLLIK 520



>gi|70999946|ref|XP_754690.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus fumigatus Af293]
 gi|66852327|gb|EAL92652.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus fumigatus Af293]
 gi|159127699|gb|EDP52814.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus fumigatus A1163]
          Length = 520

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/489 (58%), Positives = 361/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKREYP-----YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP M     E       YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPYMSGFAEENSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  + N+VDN+VK F RAKE NGR+H LGLVSDGGVHS+I HL+ LL+ AK   IP
Sbjct: 93  DQTLKKGELNKVDNVVKSFTRAKEGNGRLHLLGLVSDGGVHSNITHLVGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           + ++HFFGDGRDT+P+S+ KY++ L     ++  G+IAT++GRYYAMDRDKRW+R+++A 
Sbjct: 153 QVFIHFFGDGRDTDPKSAIKYMQDLLDHTKEIGIGEIATVVGRYYAMDRDKRWDRVEVAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP+ TI+ER+ K E DEFLKPIIV  +E  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVSGEGEESSDPVKTIKERYEKGENDEFLKPIIVGGKERRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MT+YK+++ FP+AFPPQ M NVL+EW +K  
Sbjct: 273 EITQLLGDYDRSPKPDF--PYPKNIQITTMTQYKTDYTFPVAFPPQHMGNVLAEWLSKKD 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           I QCHVAETEK+AHVTFFFNGG+E+ F  EVRD+I SPKV TYD +PEMS          
Sbjct: 331 IQQCHVAETEKYAHVTFFFNGGIEKQFPGEVRDMIPSPKVPTYDHEPEMSAEAVGKKMAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               GKF FVMNNFA PDMVGHTG Y+AA K +  TDKAIG IY+ACK +GYILFIT+DH
Sbjct: 391 RIAEGKFEFVMNNFAPPDMVGHTGVYEAAIKGVAATDKAIGEIYQACKKHGYILFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M  E+G P T+HT N VPF+LA+    ++ +  +G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMLTEKGTPKTSHTTNKVPFVLANAPEGWSLKKEEGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M+G SLL K
Sbjct: 511 MSGKSLLVK 519



>gi|258566247|ref|XP_002583868.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Uncinocarpus reesii 1704]
 gi|237907569|gb|EEP81970.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Uncinocarpus reesii 1704]
          Length = 520

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/487 (57%), Positives = 359/487 (73%), Gaps = 13/487 (2%)

Query: 2   AETPVMD-----KLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM      K      YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSSFADPKAGTAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  + N++ NIV  F RAK+ NGR+H LGLVSDGGVHSHINHL  LL+ AK   +P
Sbjct: 93  DQTLKKGELNQISNIVDSFKRAKDGNGRLHLLGLVSDGGVHSHINHLFGLLQVAKELQVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K Y+HFFGDGRDT+P+S   +++ L   + +L  G++AT++GRY+ MDRDKRW+R+++  
Sbjct: 153 KVYIHFFGDGRDTDPKSGAGHMQALLDKMKELGVGELATVVGRYFVMDRDKRWDRVEVGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE S DP+ TI+ER++  ETDEFLKPIIV  +E  +K+NDTLFFF++R+DR+R
Sbjct: 213 KGIVLGEGEASSDPVKTIKERYANGETDEFLKPIIVGGDERRVKDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           ++ Q  G     P P F    P+N+ IT MT+YK+++ FP+AFPPQ M NVL+EW +   
Sbjct: 273 EVTQLLGDYDRSPKPDF--PYPQNISITTMTQYKTDYTFPVAFPPQHMGNVLAEWLSVKG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGG+E+ FD EVRDLI SPKVATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGIEKQFDGEVRDLIPSPKVATYDLDPKMSAAPVGEKMAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                K+  VMNNFA PDMVGHTG Y+AA + +  TDKAIG I+EACK NGYILFIT+DH
Sbjct: 391 RIAEKKYDLVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGRIFEACKENGYILFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G+P T+HT N VPF++A+    ++ +   G L DVAPTILDV+G+E PKE
Sbjct: 451 GNAEEMKNSDGSPKTSHTTNKVPFVMANAPEGWSLKERDGILGDVAPTILDVMGIEQPKE 510

Query: 471 MTGLSLL 477
           M+G SLL
Sbjct: 511 MSGSSLL 517



>gi|402222936|gb|EJU03001.1| cofactor-independent phosphoglycerate mutase [Dacryopinax sp.
           DJM-731 SS1]
          Length = 516

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 292/484 (60%), Positives = 358/484 (73%), Gaps = 7/484 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            ++  MD+L ++Y Y  LEAHGLAVGL +GLMGNSEVGHLNIGAGR+V+QDIVRID A++
Sbjct: 32  GDSTTMDELAKKYNYRLLEAHGLAVGLNDGLMGNSEVGHLNIGAGRIVWQDIVRIDQAIR 91

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F+  DNIVK F  AK TNGR+H LGLVSDGGVHSHI HL  LLETAK   +P+ YVH
Sbjct: 92  KHDFHRDDNIVKSFQHAKNTNGRLHLLGLVSDGGVHSHIEHLFALLETAKEQQVPEVYVH 151

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           F GDGRDT+P S  K+L+ L         GK+ T++GRYYAMDRDKRWER+KIA +AL +
Sbjct: 152 FIGDGRDTDPHSGLKHLQHLLDFTKKEGVGKVVTVVGRYYAMDRDKRWERVKIAVDALVR 211

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQT 240
           G GEK++D L T +ER+ KDETDEFLKP+I    E  I++NDTLFFF++R+DRMR++V  
Sbjct: 212 GEGEKTDDLLKTYQERYDKDETDEFLKPMICGGSETRIQDNDTLFFFNYRSDRMRELVTM 271

Query: 241 FGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAET 300
           FG+P  P E  IP+NL+IT M+RY  E+ FP+AFPPQ M +VL+EW +K  + QCH+AET
Sbjct: 272 FGLPEKPIEIDIPKNLNITTMSRYNPEWTFPVAFPPQGMSDVLAEWLSKKGVKQCHIAET 331

Query: 301 EKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPF 360
           EK+AHVTFFFNGGVE+ F  E R +I SPKV TYD +PEMS            +S K+ F
Sbjct: 332 EKYAHVTFFFNGGVEKQFPGEDRFMIPSPKVPTYDQQPEMSVQEVADKVTEEVKSKKYEF 391

Query: 361 VMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD- 419
           VM NFA PDMVGHTGKY+AA KAI  TDKA+  IYEAC+  GYIL +T+DHGNAEQM + 
Sbjct: 392 VMCNFAPPDMVGHTGKYEAAVKAITATDKAVKTIYEACEEAGYILVVTADHGNAEQMINP 451

Query: 420 EEGNPHTAHTCNPVPFILASNKYSF-----AESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E G PHTAHT NPVP I+  +  +          +GALCDVAPT+LD++GL+ P EMTG 
Sbjct: 452 ETGEPHTAHTTNPVPLIITGSTGALRVEQEKAGEEGALCDVAPTVLDLLGLDIPPEMTGH 511

Query: 475 SLLK 478
           SLLK
Sbjct: 512 SLLK 515



>gi|145252196|ref|XP_001397611.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Aspergillus niger CBS 513.88]
 gi|134083156|emb|CAK48608.1| unnamed protein product [Aspergillus niger]
 gi|350633557|gb|EHA21922.1| hypothetical protein ASPNIDRAFT_210655 [Aspergillus niger ATCC
           1015]
          Length = 520

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 284/489 (58%), Positives = 359/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP M        K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPFMSGFAEADSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +VDNIV  F RAKE NGR+H LGLVSDGGVHS+I HL+ LL+ AK   IP
Sbjct: 93  DQTLKKGELGKVDNIVASFKRAKEGNGRLHLLGLVSDGGVHSNITHLVGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           + ++HFFGDGRDT P+S+ KY++QL     ++  G+IAT++GRY+AMDRDKRW+R++IA 
Sbjct: 153 QVFIHFFGDGRDTEPKSATKYMQQLLDQAKEIGVGEIATVVGRYWAMDRDKRWDRVEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP+ TI ER+   ETDEFLKPIIV  ++  +++ DTLFFF++R+DR+R
Sbjct: 213 KGIVTGEGEESSDPVKTINERYENKETDEFLKPIIVGGKDRRVQDGDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+++HIT MTRYK+++ FP+AFPPQ M NVL+EW  K  
Sbjct: 273 EITQLLGDYDRSPKPEF--PYPKDIHITTMTRYKTDYTFPVAFPPQHMGNVLAEWLGKKD 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ F  EVRD+I SPKVATYDL+P+MS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQFPGEVRDMIPSPKVATYDLEPKMSAAAVGDKMAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               G F FVMNNFA PDMVGHTG Y+AA + +  TDKAIG+IYEACK +GYILFIT+DH
Sbjct: 391 RLGEGNFEFVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGVIYEACKKHGYILFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M  E+G P T+HT N VPF++A+    ++ +  +G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMLTEKGTPKTSHTTNKVPFVMANAPEGWSLKKEEGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M+G SLL K
Sbjct: 511 MSGRSLLVK 519



>gi|393221924|gb|EJD07408.1| cofactor-independent phosphoglycerate mutase [Fomitiporia
           mediterranea MF3/22]
          Length = 522

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/475 (59%), Positives = 352/475 (74%), Gaps = 9/475 (1%)

Query: 4   TPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNK 63
           T  MD + +++ +  L AHG+AVGL EGLMGNSEVGHLNIGAGR+V+QDIVRID ++K +
Sbjct: 34  TTNMDTISKDHSHRQLCAHGIAVGLNEGLMGNSEVGHLNIGAGRIVWQDIVRIDQSIKKR 93

Query: 64  KFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFF 123
           +F++ D I+    RAKE NGR+H LGL+SDGGVHSHI HL  LLETAK  G+PK +VHFF
Sbjct: 94  QFHKTDQILDACKRAKEGNGRLHLLGLISDGGVHSHIRHLFALLETAKEQGVPKTFVHFF 153

Query: 124 GDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTKGV 183
           GDGRDT P SS  Y +QL++ ++   YG+ +TIIGRYYAMDRDKRWERIKIA + L +G 
Sbjct: 154 GDGRDTAPESSAGYAKQLKEFLEKEQYGEFSTIIGRYYAMDRDKRWERIKIAVDGLVRGE 213

Query: 184 GEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQTFGV 243
           GEK+EDP+  I +R+ K ETDEFLKPII+ +EG IK+ DTLFFF++R+DRMR+IV  FG+
Sbjct: 214 GEKAEDPVQAIEDRYKKGETDEFLKPIIISDEGRIKDGDTLFFFNYRSDRMREIVTVFGL 273

Query: 244 PPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETEKF 303
              P E  +P++L IT M+RY  +FPFP+AFPPQ+M +VL+E  +K    Q HVAETEK+
Sbjct: 274 DEKPLEVDVPKDLGITTMSRYNVDFPFPVAFPPQAMTDVLAETLSKQGAKQAHVAETEKY 333

Query: 304 AHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPFVMN 363
           AHVTFFFNGGVE+ F+ E R +I SPKV TYD +PEMS            +  +  F+M 
Sbjct: 334 AHVTFFFNGGVEKQFENEERHMIPSPKVPTYDKQPEMSVQGVADKVAELVKKKEHEFIMC 393

Query: 364 NFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD-EEG 422
           NFA PDMVGHTG Y+AA +AI  TD A+G +Y+AC+  GYIL IT+DHGNAEQM + E G
Sbjct: 394 NFAPPDMVGHTGVYEAAVEAITATDAAVGTVYKACQEAGYILLITADHGNAEQMINPETG 453

Query: 423 NPHTAHTCNPVPFILAS--NKYSFAESTK------GALCDVAPTILDVIGLETPK 469
            PHTAHT N VPFI+     KY F E  +      GALCDVAPTILD++GLE P+
Sbjct: 454 EPHTAHTTNKVPFIMTGEPEKYGFVEDKEGEDEEAGALCDVAPTILDLMGLEKPQ 508



>gi|315054193|ref|XP_003176471.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Arthroderma gypseum CBS 118893]
 gi|311338317|gb|EFQ97519.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Arthroderma gypseum CBS 118893]
          Length = 520

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 277/487 (56%), Positives = 366/487 (75%), Gaps = 13/487 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM    +E       YT ++A   AVGLP+GLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSGFAQEGSKTAQGYTEIDASSTAVGLPDGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  + N+V+NIVK F  AK+ NGR+H LGL+SDGGVHSHINHL  LL+ AK  G+P
Sbjct: 93  DQTLKKGQLNKVENIVKSFQNAKDGNGRLHLLGLISDGGVHSHINHLFGLLQVAKEMGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+SS +Y++QL K  ++L  G++AT++GRYYAMDRDKRW+RI+IA 
Sbjct: 153 KVFIHFFGDGRDTDPKSSAEYMQQLLKKTEELGVGELATVVGRYYAMDRDKRWDRIEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S D + TI+ER+ K E DEFLKPII   +E  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVCGEGEESSDAVKTIKERYDKGENDEFLKPIIFGGKERRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ +T MTRYK+++PFP+AF PQ M NVL+EW +K +
Sbjct: 273 EITQLLGDVDRSPKPDF--PYPKNISLTTMTRYKTDYPFPIAFAPQHMGNVLAEWLSKKQ 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGGVE+ F+ E R++I SPKVATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGVEKQFEGEDREMIPSPKVATYDLDPKMSAKPVGEKLAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                K+ F+MNNFA PDMVGHTG Y+AA + +  TD AIG +YEACK +GY+LF+T+DH
Sbjct: 391 RIADNKYEFLMNNFAPPDMVGHTGVYEAAIQGVAATDAAIGCVYEACKKHGYVLFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G+P T+HT N VPF++A+    ++ + + G L DVAPTILDV+G+E P+E
Sbjct: 451 GNAEEMKNADGSPKTSHTTNLVPFVMANAPEGWSLKKSGGVLGDVAPTILDVMGIEKPEE 510

Query: 471 MTGLSLL 477
           M G SLL
Sbjct: 511 MDGTSLL 517



>gi|386289720|gb|AFJ04711.1| PGM protein [Volvariella volvacea]
          Length = 536

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 292/502 (58%), Positives = 360/502 (71%), Gaps = 26/502 (5%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+T  MD + +E  Y  + A G +VGL EGLMGNSEVGHLNIGAGRVV+QDIVRID+A+K
Sbjct: 32  ADTTNMDTIAKEGAYRLISASGTSVGLSEGLMGNSEVGHLNIGAGRVVWQDIVRIDVAIK 91

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            ++ ++   I+K F+RAK+ NGR+H LGL+SDGGVHSHINHL  LLETAK  G+P  YVH
Sbjct: 92  KRQLHKNPTILKSFERAKQGNGRLHLLGLISDGGVHSHINHLFALLETAKEVGVPHTYVH 151

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           FFGDGRDT PRSS KY E+L   +    YG++ATI+GRYYAMDRDKRWER+K+A E L +
Sbjct: 152 FFGDGRDTAPRSSAKYCEELLDFLKKEEYGELATIVGRYYAMDRDKRWERVKVAVEGLVR 211

Query: 182 GVGEKS------EDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRM 234
           G GE +      +  +S I+  + KD TDEFLKPIIV+ + G IK+ DTLFFF++R+DRM
Sbjct: 212 GEGEATAAEEGQQGAISAIKANYDKDVTDEFLKPIIVNGDAGRIKDGDTLFFFNYRSDRM 271

Query: 235 RQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           R+I   FG+   P E  IP++L+IT MTRY +EFPFP+A+PP +M NVL+EW +K  I Q
Sbjct: 272 REIASLFGLDDKPIEIDIPKDLNITTMTRYNAEFPFPVAYPPLAMTNVLAEWLSKEGIKQ 331

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
            HVAETEK+AHVTFFFNGGVE+ F+ E R LI SPKVATYDL P+MS             
Sbjct: 332 AHVAETEKYAHVTFFFNGGVEKQFEGEQRYLIPSPKVATYDLDPKMSSHGVAKKVAEILD 391

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             +  FVM NFA PDMVGHTG Y+AA K +  TD+A+GIIY+A   NGY+L IT+DHGNA
Sbjct: 392 KQEDEFVMCNFAPPDMVGHTGVYEAAVKGVTATDEAVGIIYKAAIKNGYVLAITADHGNA 451

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFA------------------ESTKGALCDV 455
           EQM + E G PHTAHT NPVPFI+AS+K +F                   E    ALCDV
Sbjct: 452 EQMINPETGAPHTAHTTNPVPFIIASDKETFKFEEDKTDKDKTDAKEVEEEQDPPALCDV 511

Query: 456 APTILDVIGLETPKEMTGLSLL 477
           APTILD++GL  P+EM+G SLL
Sbjct: 512 APTILDILGLSKPEEMSGRSLL 533



>gi|225678774|gb|EEH17058.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Paracoccidioides brasiliensis Pb03]
          Length = 521

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/490 (58%), Positives = 360/490 (73%), Gaps = 14/490 (2%)

Query: 2   AETPVMDKLKR-----EYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP M   K         YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  ADTPTMSGFKEPNSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D A+K  + N+ +NIVK F RAK+ NGR+H LGLVSDGGVHSHINHL  LL+ AK   +P
Sbjct: 93  DQALKKGEMNKTENIVKSFRRAKDGNGRLHLLGLVSDGGVHSHINHLFGLLQVAKELQVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K Y+HFFGDGRDT+P+S+  Y++QL     +L  G++AT++GRYYAMDRDKRW+RI++A 
Sbjct: 153 KVYIHFFGDGRDTDPKSAAAYMQQLLDKTKELGVGEVATVVGRYYAMDRDKRWDRIEVAM 212

Query: 177 EALTKGV-GEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRM 234
           E L  G  GE+S DP++TI +R+ K E DEFLKPIIV  +E  I++NDTLFFF++R+DR+
Sbjct: 213 EGLVTGKEGEESTDPVNTIEKRYEKGENDEFLKPIIVGGQERRIQDNDTLFFFNYRSDRV 272

Query: 235 RQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R+I Q  G     P P F    P+N+ IT MT YK+E+ FP AFPPQ M NVL+EW +K 
Sbjct: 273 REITQLLGNVDRSPKPNF--PYPKNISITTMTMYKTEYNFPTAFPPQHMGNVLAEWLSKK 330

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + QCHVAETEK+AHVTFFFNGGVE+ F  E RD+I SPKVATYDL P+MS         
Sbjct: 331 GLKQCHVAETEKYAHVTFFFNGGVEKQFHGEERDMISSPKVATYDLDPKMSAAPVAEKLA 390

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KF F+MNNFA PDMVGHTG Y+AA +A+  TDKAI  +Y+ACK NGY+LF+T+D
Sbjct: 391 ERISDNKFEFLMNNFAPPDMVGHTGVYEAAIQAVTATDKAIARVYQACKDNGYVLFVTAD 450

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M++ EG P T+HT N VPF++A+    ++ + + G L DVAPTIL  +G+E P+
Sbjct: 451 HGNAEEMKNAEGTPKTSHTTNKVPFVMANAPEGWSLKKSGGVLGDVAPTILAAMGIEQPE 510

Query: 470 EMTGLSLLKK 479
           EM+G SLL K
Sbjct: 511 EMSGTSLLIK 520



>gi|225560727|gb|EEH09008.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ajellomyces capsulatus G186AR]
          Length = 521

 Score =  585 bits (1507), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 286/488 (58%), Positives = 359/488 (73%), Gaps = 14/488 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A  PVM        K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  ANAPVMSSFADSNSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +KN   N+ +NIVK F +AK+ NGR+H LGL+SDGGVHSHINHL  LL+ AK   IP
Sbjct: 93  DQTLKNGDMNKTENIVKTFQKAKDGNGRLHLLGLISDGGVHSHINHLFGLLQVAKEMKIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S+  Y++QL     +L  G++AT++GRY+AMDRDKRW+RI+IA 
Sbjct: 153 KVFIHFFGDGRDTDPKSAAGYMQQLLDKTKELGVGELATVVGRYFAMDRDKRWDRIEIAL 212

Query: 177 EAL-TKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRM 234
             L T G GE+S DP+ TI+ER+ K E DEFLKPII+  +E  I++NDTLFFF++R+DR+
Sbjct: 213 HGLVTGGGGEESTDPVQTIKERYQKGENDEFLKPIIIGGKERRIQDNDTLFFFNYRSDRV 272

Query: 235 RQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R+I Q  G     P P F    P+N+ IT MT+YK+++ FP+AFPPQ M NVL+EW  K 
Sbjct: 273 REITQLLGDVDRSPKPNF--PYPKNISITTMTQYKTDYKFPIAFPPQHMGNVLAEWLGKQ 330

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + QCH+AETEK+AHVTFFFNGGVE+ F  E R+LI SPKVATYDL P+MS         
Sbjct: 331 GLKQCHIAETEKYAHVTFFFNGGVEKQFLGEERELIPSPKVATYDLDPKMSAAPVADKLA 390

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KF F+MNNFA PDMVGHTG Y+AA +A+  TDKAIG ++EACK +GYILF+T+D
Sbjct: 391 ERISEKKFEFLMNNFAPPDMVGHTGVYEAAVEAVTATDKAIGRVFEACKQHGYILFVTAD 450

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M++ EG P T+HT N VPFI+A+    ++ E + G L DVAPTIL  +G+E PK
Sbjct: 451 HGNAEEMKNAEGTPKTSHTTNKVPFIMANAPEGWSLEKSGGVLGDVAPTILAAMGIEQPK 510

Query: 470 EMTGLSLL 477
           EMTG SLL
Sbjct: 511 EMTGHSLL 518



>gi|226293610|gb|EEH49030.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Paracoccidioides brasiliensis Pb18]
          Length = 521

 Score =  585 bits (1507), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 286/490 (58%), Positives = 360/490 (73%), Gaps = 14/490 (2%)

Query: 2   AETPVMDKLKR-----EYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP M   K         YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  ADTPTMSGFKEPNSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D A+K  + N+ +NIVK F RAK+ NGR+H LGLVSDGGVHSHINHL  LL+ AK   +P
Sbjct: 93  DQALKKGEMNKTENIVKSFRRAKDGNGRLHLLGLVSDGGVHSHINHLFGLLQVAKELQVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K Y+HFFGDGRDT+P+S+  Y++QL     +L  G++AT++GRYYAMDRDKRW+RI++A 
Sbjct: 153 KVYIHFFGDGRDTDPKSAAGYMQQLLDKTKELGVGEVATVVGRYYAMDRDKRWDRIEVAM 212

Query: 177 EALTKGV-GEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRM 234
           E L  G  GE+S DP++TI +R+ K E DEFLKPIIV  +E  I++NDTLFFF++R+DR+
Sbjct: 213 EGLVTGKEGEESTDPVNTIEKRYEKGENDEFLKPIIVGGQERRIQDNDTLFFFNYRSDRV 272

Query: 235 RQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R+I Q  G     P P F    P+N+ IT MT YK+E+ FP AFPPQ M NVL+EW +K 
Sbjct: 273 REITQLLGNVDRSPKPNF--PYPKNISITTMTMYKTEYNFPTAFPPQHMGNVLAEWLSKK 330

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + QCHVAETEK+AHVTFFFNGGVE+ F  E RD+I SPKVATYDL P+MS         
Sbjct: 331 GLKQCHVAETEKYAHVTFFFNGGVEKQFHGEERDMIPSPKVATYDLDPKMSAAPVAEKLA 390

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KF F+MNNFA PDMVGHTG Y+AA +A+  TDKAI  +Y+ACK NGY+LF+T+D
Sbjct: 391 ERISDNKFEFLMNNFAPPDMVGHTGVYEAAIQAVTATDKAIERVYQACKENGYVLFVTAD 450

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M++ EG P T+HT N VPF++A+    ++ + + G L DVAPTIL  +G+E P+
Sbjct: 451 HGNAEEMKNAEGTPKTSHTTNKVPFVMANAPEGWSLKKSGGVLGDVAPTILAAMGIEQPE 510

Query: 470 EMTGLSLLKK 479
           EM+G SLL K
Sbjct: 511 EMSGTSLLIK 520



>gi|494828283|gb|EON65124.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Coniosporium apollinis CBS 100218]
          Length = 520

 Score =  584 bits (1506), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 280/489 (57%), Positives = 359/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP MD    E       YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPWMDGFAEEGSEMAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           DL +K  + N+++NI K F RA +TNGR+H  GLVSDGGVHSHINHLI LL+ AK  G+P
Sbjct: 93  DLTIKKGEMNKIENITKSFQRAIDTNGRLHLCGLVSDGGVHSHINHLIALLKVAKEMGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S   +LE L     ++  G IAT++GRY+ MDRDKRW+R++I  
Sbjct: 153 KVFIHFFGDGRDTDPKSGAGHLETLIAQTKEIGVGDIATVVGRYFIMDRDKRWDRVEIGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             L  G GE+++DP+  ++ER+ K ETDEFLKPIIV  +E  I+++DT+FFF++R+DR+R
Sbjct: 213 RGLVLGEGEEADDPVVKVKERYEKGETDEFLKPIIVGGKERRIQDDDTVFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           ++ Q  G     P P F    P+N+ +T MT+Y +++ FP+AFPPQ M NVL+EW  K  
Sbjct: 273 EVTQLLGDFDRSPKPDF--PYPKNVQLTTMTQYNTKYTFPVAFPPQRMGNVLAEWLGKQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ F+ E RD+I SPKV TYDL+PEMS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQFENEERDMIPSPKVPTYDLEPEMSAMGVADKLCE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
             + GKF F+MNNFA PDMVGHTG Y+AA K +  TDKAIG +YE CK +GY+LFIT+DH
Sbjct: 391 RIKEGKFEFLMNNFAPPDMVGHTGVYEAAIKGVAETDKAIGKVYEQCKESGYVLFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M +EEG P T+HT N VPF++ +    ++ +   G L DVAPT+L+++GLE P+E
Sbjct: 451 GNAEEMLNEEGQPKTSHTTNKVPFVMVNAPKGWSLKKQDGVLGDVAPTLLEIMGLEQPEE 510

Query: 471 MTGLSLLKK 479
           MTG SLL K
Sbjct: 511 MTGHSLLVK 519



>gi|407918914|gb|EKG12174.1| Phosphoglycerate mutase 23-bisphosphoglycerate-independent
           [Macrophomina phaseolina MS6]
          Length = 520

 Score =  582 bits (1501), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 288/489 (58%), Positives = 365/489 (74%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKR-----EYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP+MD+ KR        YT +EA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPIMDEFKRPGSEITQGYTEIEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +V+NI   F RAK  +GR+HFLGLVSDGGVHSHINHL+ LL+ AK  G+P
Sbjct: 93  DQTIKKGELKDVENIQTSFQRAKNGSGRLHFLGLVSDGGVHSHINHLLALLKLAKEVGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S   +LE L K   ++  G+IAT++GRYYAMDRDKRW+RI+IA 
Sbjct: 153 KVFIHFFGDGRDTDPKSGAGHLENLLKQTKEIGLGEIATVVGRYYAMDRDKRWDRIEIAL 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + + +G GE SEDPL+T++ R+ + ETDEFLKPIIV  +E  IK++DT+FFF++R+DR+R
Sbjct: 213 KGIVQGEGEASEDPLATVKARYEQGETDEFLKPIIVGGDERRIKDDDTVFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+H+T MT+Y  ++ FP+AFPPQ M NVL+EW  K  
Sbjct: 273 EITQLLGDFDRSPKPDF--PYPKNIHLTNMTQYNPKYTFPVAFPPQKMGNVLAEWLGKQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           I+QCH+AETEK+AHVTFFFNGGVE+ F+ E RD+I SPKVATYDL+PEMS          
Sbjct: 331 ITQCHIAETEKYAHVTFFFNGGVEKQFENEHRDMIPSPKVATYDLQPEMSAMSVAEKVCE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
             + GK+ F+MNNFA PDMVGHTG Y+AA K +  TDKAIG IYE C  +GY LFIT+DH
Sbjct: 391 RIQEGKYEFIMNNFAPPDMVGHTGVYEAAIKGVAETDKAIGKIYEQCVKSGYTLFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M +EEG P T+HT N VPF++A+   +++ + T G L DVAPTIL  +GL  P+E
Sbjct: 451 GNAEEMLNEEGKPKTSHTTNKVPFVMANAPKNYSLKKTDGVLGDVAPTILATMGLPQPEE 510

Query: 471 MTGLSLLKK 479
           MT  SLL K
Sbjct: 511 MTSHSLLIK 519



>gi|426200857|gb|EKV50780.1| hypothetical protein AGABI2DRAFT_189140 [Agaricus bisporus var.
           bisporus H97]
          Length = 533

 Score =  582 bits (1500), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 286/488 (58%), Positives = 361/488 (73%), Gaps = 12/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+T  MD +  ++ + TL A G AVGL +GLMGNSEVGHLNIGAGR+V+QDIVRID+A+K
Sbjct: 33  ADTTNMDSIANDHSFRTLHASGTAVGLTDGLMGNSEVGHLNIGAGRIVWQDIVRIDVAIK 92

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            ++F++   +++ F+RAK+ NGR+H LGL+SDGGVHSHINHL  LLETAK  G+P  YVH
Sbjct: 93  KRQFHKNSVLLETFERAKKGNGRLHLLGLISDGGVHSHINHLFALLETAKEVGVPHTYVH 152

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           FFGDGRDT PRS+  YL+ L + +   +YG++ATI GRYYAMDRDKRWERIKIA E L  
Sbjct: 153 FFGDGRDTAPRSAAGYLKDLLEFMKKEDYGRLATIAGRYYAMDRDKRWERIKIAVEGLVN 212

Query: 182 GVGEKS---EDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQI 237
           GVGE S   +  ++T+ E + KD TDEFLKPIIV+ +EG IK+ DT+FFF++R+DRMR+I
Sbjct: 213 GVGEDSKGQDGAINTVEENYKKDVTDEFLKPIIVNGDEGRIKDGDTMFFFNYRSDRMREI 272

Query: 238 VQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
              FG      + KIP++L I  M+ YK  FPF +AFPPQ M+NVL+EW +K  + Q H+
Sbjct: 273 ATVFGQLEDVVDTKIPKDLEIATMSAYKVGFPFKVAFPPQKMDNVLAEWLSKQGLKQSHI 332

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGK 357
           AETEK+AHVTFFFNGGVE+ F+ E R +I SPKVATYD +P+MS            R G 
Sbjct: 333 AETEKYAHVTFFFNGGVEKQFEGEERHMIPSPKVATYDKEPKMSVLQVAEKVADVLRKGD 392

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
             FVM NFA PDMVGHTG YDAA +A+  TDKA+G +Y+A +A GYIL IT+DHGNAEQM
Sbjct: 393 HDFVMCNFAPPDMVGHTGVYDAAVEAVSATDKAVGEVYKAAEAAGYILLITADHGNAEQM 452

Query: 418 QD-EEGNPHTAHTCNPVPFILASN--KYSFAESTK-----GALCDVAPTILDVIGLETPK 469
           +D E G+P TAHT N VPFI++ +  +  F E  K     GALCDVAPTILD++G+  P+
Sbjct: 453 KDLENGSPFTAHTTNVVPFIMSGDPKQLKFKEDDKNDEEEGALCDVAPTILDLMGVPQPE 512

Query: 470 EMTGLSLL 477
           EMTG SLL
Sbjct: 513 EMTGRSLL 520



>gi|409084085|gb|EKM84442.1| hypothetical protein AGABI1DRAFT_110949 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 533

 Score =  582 bits (1499), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 287/488 (58%), Positives = 359/488 (73%), Gaps = 12/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+T  MD +  ++ + TL A G AVGL +GLMGNSEVGHLNIGAGR+V+QDIVRID+A+K
Sbjct: 33  ADTTNMDSIANDHSFRTLHASGTAVGLTDGLMGNSEVGHLNIGAGRIVWQDIVRIDVAIK 92

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            ++F++   +++ F+RAK+ NGR+H LGL+SDGGVHSHINHL  LLETAK  G+P  YVH
Sbjct: 93  KRQFHKNSVLLETFERAKKGNGRLHLLGLISDGGVHSHINHLFALLETAKEVGVPHTYVH 152

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           FFGDGRDT PRS+  YL+ L + +   +YG +ATI GRYYAMDRDKRWERIKIA E L  
Sbjct: 153 FFGDGRDTAPRSAAGYLKDLLEFMKKEDYGHLATIAGRYYAMDRDKRWERIKIAVEGLVN 212

Query: 182 GVGEKS---EDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQI 237
           GVGE S   +  ++T+ E + KD TDEFLKPIIV+ +EG IK+ DT+FFF++R+DRMR+I
Sbjct: 213 GVGEDSKGQDGAINTVEENYKKDVTDEFLKPIIVNGDEGRIKDGDTMFFFNYRSDRMREI 272

Query: 238 VQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
              FG      + KIP++L I  M+ YK  FPF +AFPPQ M+NVL+EW +K  + QCH+
Sbjct: 273 ATVFGQLEDVVDTKIPKDLEIATMSAYKVGFPFKVAFPPQKMDNVLAEWLSKQGLKQCHI 332

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGK 357
           AETEK+AHVTFFFNGGVE+ F+ E R +I SPKVATYD +P+MS            R G 
Sbjct: 333 AETEKYAHVTFFFNGGVEKQFEGEERHMIPSPKVATYDKEPKMSVLQVAEKVADVLRKGD 392

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
             FVM NFA PDMVGHTG YDAA +A+  TDKA+G +Y+A +A GYIL IT+DHGNAEQM
Sbjct: 393 HDFVMCNFAPPDMVGHTGVYDAAVEAVSATDKAVGEVYKAAEAAGYILLITADHGNAEQM 452

Query: 418 QD-EEGNPHTAHTCNPVPFILASN--KYSFAESTK-----GALCDVAPTILDVIGLETPK 469
           +D E G+P TAHT N VPFI++       F E  K     GALCDVAPTILD++G+  P+
Sbjct: 453 KDLENGSPFTAHTTNVVPFIMSGGPKGLKFKEDDKNDEEEGALCDVAPTILDLMGVPQPE 512

Query: 470 EMTGLSLL 477
           EMTG SLL
Sbjct: 513 EMTGRSLL 520



>gi|326474865|gb|EGD98874.1| phosphoglycerate mutase [Trichophyton tonsurans CBS 112818]
 gi|326477854|gb|EGE01864.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Trichophyton equinum CBS 127.97]
          Length = 520

 Score =  582 bits (1499), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/489 (56%), Positives = 362/489 (74%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM    +E       YT ++A   AVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSGFAQEGSKTAQGYTEIDASSTAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +V+NIVK F+ AK  NGR+H LGL+SDGGVHSHINHL  LL+ AK  G+P
Sbjct: 93  DQTLKKGQLGKVENIVKSFENAKNGNGRLHLLGLISDGGVHSHINHLFGLLQVAKEMGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S+  Y+EQL +   +L  G++AT++GRYYAMDRDKRW+RI+IA 
Sbjct: 153 KVFIHFFGDGRDTDPKSAAGYMEQLLQKTQELGVGELATVVGRYYAMDRDKRWDRIEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S D + TI+ER+ K E DEFLKPII   +E  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVTGEGEESNDAIKTIKERYEKGENDEFLKPIIFGGQERRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MTRYK+++ FP+AF PQ M NVL+EW +K +
Sbjct: 273 EITQLLGDVDRSPKPDF--PYPKNISITTMTRYKTDYTFPIAFAPQHMGNVLAEWLSKKQ 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGGVE+ F+ E R++I SPKVATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGVEKQFEGEDREMIPSPKVATYDLDPKMSAKPVGEKLAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               GK+ F+MNNFA PDMVGHTG Y+AA + +  TD AIG +YEACK +GYILF+T+DH
Sbjct: 391 RIADGKYEFLMNNFAPPDMVGHTGVYEAAIQGVAATDAAIGCVYEACKKHGYILFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G+P T+HT N VPF++A+    ++ + + G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMKNADGSPKTSHTTNFVPFVMANAPEGWSLKKSGGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M G SLL K
Sbjct: 511 MDGTSLLVK 519



>gi|485929591|gb|EOD52958.1| putative -bisphosphoglycerate-independent phosphoglycerate mutase
           protein [Neofusicoccum parvum UCRNP2]
          Length = 520

 Score =  581 bits (1498), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 285/489 (58%), Positives = 360/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKR-----EYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVMD+ KR        YT +EA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMDEFKRPGSEITQGYTEIEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +   V+NI K F RAK  NGR+HFLGLVSDGGVHSHINHL+ LL+ AK  G+P
Sbjct: 93  DQTIKKGELKNVENIQKSFSRAKNGNGRLHFLGLVSDGGVHSHINHLLALLKLAKEEGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S   +LE L K   ++  G++AT++GRYYAMDRDKRW+R+++A 
Sbjct: 153 KVFIHFFGDGRDTDPKSGAGHLENLIKQTKEIGLGEVATVVGRYYAMDRDKRWDRVEVAL 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + L +G GE S DPL+T++ R+ + ETDEFLKPIIV  +E  IK++DTLFFF++R+DR+R
Sbjct: 213 KGLVQGEGEASTDPLATVKARYEQGETDEFLKPIIVGGDESRIKDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           ++ Q  G     P P F    P+N  +T MT+Y  ++ FP+AFPPQ M NVL+EW  K  
Sbjct: 273 ELTQLLGDFDRSPKPDF--PYPKNTQLTNMTQYNPKYTFPVAFPPQKMGNVLAEWLGKQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGGVE+ F+ E RD+I SP+VATYDL+P MS          
Sbjct: 331 VKQCHIAETEKYAHVTFFFNGGVEKQFENEQRDMIPSPRVATYDLQPTMSAMGVAEKVCE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
             + G F F+MNNFA PDMVGHTG Y+AA K +  TDKAIG IYE C  +GY LFIT+DH
Sbjct: 391 RIQEGTFEFIMNNFAPPDMVGHTGVYEAAIKGVAETDKAIGKIYEQCVKSGYTLFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M +EEG P T+HT N VPF++A+   +F+ + T G L DVAPT+L  +GL  P+E
Sbjct: 451 GNAEEMLNEEGKPKTSHTVNKVPFVMANAPKNFSLKKTDGVLGDVAPTVLATMGLSQPEE 510

Query: 471 MTGLSLLKK 479
           MTG SLL K
Sbjct: 511 MTGASLLVK 519



>gi|470290034|ref|XP_004343043.1| cofactor-independent phosphoglycerate mutase [Capsaspora owczarzaki
           ATCC 30864]
 gi|320165924|gb|EFW42823.1| cofactor-independent phosphoglycerate mutase [Capsaspora owczarzaki
           ATCC 30864]
          Length = 517

 Score =  581 bits (1497), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 286/487 (58%), Positives = 358/487 (73%), Gaps = 10/487 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           +A+TPVM +L  EYP+  LEA GLAVGLP GLMGNSEVGH+N+GAGRVVYQDIVRI+L +
Sbjct: 30  HAKTPVMTRLATEYPHVPLEAAGLAVGLPAGLMGNSEVGHMNVGAGRVVYQDIVRIELDI 89

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +  +F E   +V  F+RAK+ NGR+H LGLVSDGGVHSHINHL   L  AK   + + +V
Sbjct: 90  ERGRFAENPRLVAAFNRAKQGNGRLHLLGLVSDGGVHSHINHLYAFLAAAKAANVAQTFV 149

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
            FF DGRDT+P S   ++E L   + +LNYGK+ATI+GRYYAMDRDKRWERIKIAF+ L 
Sbjct: 150 QFFADGRDTSPMSGVSFIESLLAKLRELNYGKLATIMGRYYAMDRDKRWERIKIAFDGLV 209

Query: 181 KGVGEK-SEDPL-STIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIV 238
            G GE  SED L   ++E ++ +ETDEFLKP+IV+E G+I++ DTL F +FR+DRMR+I 
Sbjct: 210 SGEGEHVSEDKLIERVKELYANNETDEFLKPLIVNEAGLIQDGDTLVFINFRSDRMREIA 269

Query: 239 QTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVA 298
           ++FGV  P    + P +LHIT MT+YK+E+PFP  FPPQS+ +VLSEW AK  I Q HVA
Sbjct: 270 ESFGVKAPFEPKRTPADLHITTMTQYKAEYPFPQLFPPQSLGDVLSEWLAKKSILQYHVA 329

Query: 299 ETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKF 358
           ETEK+AHVTFFFNGG E+ F+ E R ++ SPKVATYDL+PEM+             SGK+
Sbjct: 330 ETEKYAHVTFFFNGGREQSFEGEDRKVVPSPKVATYDLQPEMNADGVATEVVAGIESGKY 389

Query: 359 PFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQ 418
           PFV+ NFA PDMVGHTGK++ A K +E TD AIG I+EAC+ +GYILFIT+DHGNAE+M 
Sbjct: 390 PFVLCNFAPPDMVGHTGKFEQAVKGVEATDAAIGRIFEACEKHGYILFITADHGNAEKML 449

Query: 419 DEEGNPHTAHTCNPVPFILASNKYSFAES--------TKGALCDVAPTILDVIGLETPKE 470
           D +G  HTAHT NPVPFI+         +           ALCDVAPT+L+V+GL+TP E
Sbjct: 450 DGKGGAHTAHTTNPVPFIITDKSRKLLPNPPVGRDGPANFALCDVAPTVLNVMGLDTPAE 509

Query: 471 MTGLSLL 477
           MTG S+ 
Sbjct: 510 MTGHSVF 516



>gi|302501123|ref|XP_003012554.1| hypothetical protein ARB_01167 [Arthroderma benhamiae CBS 112371]
 gi|291176113|gb|EFE31914.1| hypothetical protein ARB_01167 [Arthroderma benhamiae CBS 112371]
          Length = 520

 Score =  581 bits (1497), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/489 (56%), Positives = 361/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM    +E       YT ++A   AVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSGFAQEGSKTAQGYTEIDASSTAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +V+NIVK F+ AK  NGR+H LGL+SDGGVHSHINHL  LL+ AK  G+P
Sbjct: 93  DQTLKKGQLGKVENIVKSFENAKNGNGRLHLLGLISDGGVHSHINHLFGLLQVAKEMGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S+  Y+EQL +   +L  G++AT++GRYYAMDRDKRW+RI+IA 
Sbjct: 153 KVFIHFFGDGRDTDPKSAAGYMEQLLQKTQELGVGELATVVGRYYAMDRDKRWDRIEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S D + TI+ER+ K E DEFLKPII   +E  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVTGEGEESHDAVKTIKERYEKGENDEFLKPIIFGGQERRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MTRYK+++ FP+AF PQ M NVL+EW +K +
Sbjct: 273 EITQLLGDVDRSPKPDF--PYPKNISITTMTRYKTDYTFPIAFAPQHMGNVLAEWLSKKQ 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGGVE+ F+ E R++I SPKVATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGVEKQFEGEDREMIPSPKVATYDLDPKMSAKPVGEKLAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               GK+ F+MNNFA PDMVGHTG Y+AA + +  TD AIG +YEACK +GYILF+T+DH
Sbjct: 391 RIADGKYEFLMNNFAPPDMVGHTGVYEAAIQGVAATDAAIGCVYEACKKHGYILFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G P T+HT N VPF++A+    ++ + + G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMKNADGTPKTSHTTNFVPFVMANAPEGWSLKKSGGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M G SLL K
Sbjct: 511 MDGTSLLVK 519



>gi|449304305|gb|EMD00313.1| hypothetical protein BAUCODRAFT_372880 [Baudoinia compniacensis
           UAMH 10762]
          Length = 520

 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 285/488 (58%), Positives = 353/488 (72%), Gaps = 13/488 (2%)

Query: 1   NAETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVR 55
           NAETP MD+      K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VR
Sbjct: 32  NAETPWMDEFAKPDSKITSGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVR 91

Query: 56  IDLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGI 115
           ID  +K  +FN+V+NIVK F  AKE NGR+H LGLVSDGGVHSHI HL  LL+ AK  G+
Sbjct: 92  IDQTIKKGEFNKVENIVKSFKHAKEGNGRLHLLGLVSDGGVHSHIKHLKELLKVAKEMGV 151

Query: 116 PKAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIA 175
           P  Y+HFFGDGRDT+P+S   +++ L     +   G++AT++GRYY MDRDKRW+R++I 
Sbjct: 152 PHVYIHFFGDGRDTDPKSGLGHMKDLLAFCKEQGIGEVATVVGRYYIMDRDKRWDRVEIG 211

Query: 176 FEALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRM 234
            + +  G GE S DP+ TI ER++KDETDEFLKPIIV   E  +K+NDTLFFF++R+DR+
Sbjct: 212 MKGVVTGEGEDSSDPVKTIEERYTKDETDEFLKPIIVGGSERRVKDNDTLFFFNYRSDRV 271

Query: 235 RQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R+I Q  G     P P F    P NL++T MTRYK+++ FP+AF PQ M+NVL++W AK 
Sbjct: 272 REITQLLGDQDRSPKPDF--PYPANLNVTTMTRYKTDYTFPIAFAPQVMDNVLADWLAKQ 329

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + Q H+AETEK+AHVTFFFNGG E  FD E RD+I SPKVATYDL+P+MS         
Sbjct: 330 SLKQSHIAETEKYAHVTFFFNGGREIQFDGEDRDMIPSPKVATYDLQPKMSAMAVAERMC 389

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
              + GK+ FVMNNFA PDMVGHTG Y AA +    TD AIG +YE CK  GY+LFITSD
Sbjct: 390 ERIKEGKYEFVMNNFAPPDMVGHTGVYKAAVEGCAETDAAIGKVYECCKEQGYVLFITSD 449

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M  EE  P T+HT N VPF++A+    ++ +   G L DVAPT+L+V+G+E PK
Sbjct: 450 HGNAEEMLTEEKTPKTSHTTNLVPFVMANAPQGWSLKKQDGVLGDVAPTVLEVMGVEQPK 509

Query: 470 EMTGLSLL 477
           EMTG SLL
Sbjct: 510 EMTGSSLL 517



>gi|156390511|ref|XP_001635314.1| predicted protein [Nematostella vectensis]
 gi|156222406|gb|EDO43251.1| predicted protein [Nematostella vectensis]
          Length = 515

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 286/487 (58%), Positives = 346/487 (71%), Gaps = 8/487 (1%)

Query: 1   NAETPVMDKLK--REYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDL 58
           + ETPVMD     +   YT+L+A GL+VGLP GLMGNSEVGHLNIGAGRVVYQDIVRI++
Sbjct: 29  HGETPVMDAFAEGKGCAYTSLDASGLSVGLPAGLMGNSEVGHLNIGAGRVVYQDIVRINM 88

Query: 59  AVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKA 118
             +   F+E + +    +RAK+ NGR H LGL+SDGGVHSHINHL  ++E  K  G+PK 
Sbjct: 89  TSEGHTFHENETLSAAAERAKKGNGRFHLLGLISDGGVHSHINHLFSMVEALKKLGVPKT 148

Query: 119 YVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           +V FF DGRDT P S   Y++Q+   + +LNYG +A I+GRYYAMDRDKRWER+KIA+EA
Sbjct: 149 FVQFFSDGRDTRPTSGVTYVQQVIDKLKELNYGSLAAIMGRYYAMDRDKRWERVKIAYEA 208

Query: 179 LTKGVGEKS--EDPLSTIRERFS----KDETDEFLKPIIVDEEGIIKENDTLFFFDFRAD 232
           L +G GE +  ++ +S I+ R+     K ETDEFLKPII+D+EG IK+ DT+ FFDFRAD
Sbjct: 209 LVQGKGEHTTLDNVISLIKSRYEAEGEKHETDEFLKPIIIDKEGQIKDGDTICFFDFRAD 268

Query: 233 RMRQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKI 292
           RMRQI +  GV PP     IP++L+   MT+YK EFPFP  FPP   +NVL+EW    K+
Sbjct: 269 RMRQINEAIGVKPPFETDVIPKDLYHITMTQYKKEFPFPCLFPPVVPKNVLAEWLDVQKV 328

Query: 293 SQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXX 352
            Q H AETEK+AHVTFFFNGGVE+ FDLE R L+ SPKV TYDL P MS           
Sbjct: 329 PQYHCAETEKYAHVTFFFNGGVEKKFDLEDRMLVPSPKVPTYDLLPPMSSQGVADEMCKA 388

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
             SGK+PFVM NFA PDMVGHTGKYDAA  A   TDKAIG IY+ C+   Y L +TSDHG
Sbjct: 389 IESGKYPFVMCNFAPPDMVGHTGKYDAAVIACTATDKAIGQIYQTCQKQNYTLMVTSDHG 448

Query: 413 NAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           NAEQM  E+G PHTAHT N VP+I+         +   ALCDV PT+LDV+GLE PKEMT
Sbjct: 449 NAEQMISEQGGPHTAHTTNRVPYIMTGGHKFRQFTHNAALCDVGPTVLDVMGLECPKEMT 508

Query: 473 GLSLLKK 479
           G SLL+K
Sbjct: 509 GTSLLQK 515



>gi|378732051|gb|EHY58510.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Exophiala dermatitidis NIH/UT8656]
          Length = 520

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/489 (56%), Positives = 359/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A TP MD  ++E       YT LEA GLAVGLP+GLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  ANTPFMDGFRKEGSETAQGYTELEASGLAVGLPDGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +KN + N+V N+VK F RA + NGR+H LGL+SDGGVHSHINHL  LLE AK   +P
Sbjct: 93  DQTIKNGEMNKVPNVVKSFQRAIDGNGRLHLLGLISDGGVHSHINHLFALLEVAKEMKVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S+  Y++QL   + +L  G++AT++GRYY MDRDKRW+R+++  
Sbjct: 153 KVFIHFFGDGRDTDPKSAAGYMQQLLDKLKELGTGELATVVGRYYIMDRDKRWDRVEVGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP++TI+ R+ K E DEFLKPIIV  +E  +K+ DTLFFF++R+DR+R
Sbjct: 213 KGVVLGEGEESTDPVATIKSRYEKGENDEFLKPIIVGGDERRVKDGDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           ++ Q  G     P P F    P+++ IT MT+YK+++ FP+AFPPQ M NVL+EW +K  
Sbjct: 273 EVTQLLGDYDRSPKPEF--PYPKDIQITTMTQYKTDYKFPVAFPPQHMGNVLAEWLSKKG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ ++ E R++I SPKVATYDL P MS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQYEGEDREMIPSPKVATYDLDPPMSAQKVADKLSE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                K+ F+MNNFA PDMVGHTG Y+AA KA   TD AIG +YE CK  GYILF+T+DH
Sbjct: 391 RISDHKYEFLMNNFAPPDMVGHTGVYEAAIKACTATDAAIGSVYETCKKEGYILFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M +EEG P T+HT N VPF++A+    ++ + T G L DVAPT+L  +GL+ P+E
Sbjct: 451 GNAEEMLNEEGTPKTSHTTNKVPFVMANAPEGWSLKKTDGVLGDVAPTVLAAMGLDQPEE 510

Query: 471 MTGLSLLKK 479
           M+G SLL K
Sbjct: 511 MSGKSLLIK 519



>gi|261204029|ref|XP_002629228.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ajellomyces dermatitidis SLH14081]
 gi|239587013|gb|EEQ69656.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ajellomyces dermatitidis SLH14081]
 gi|327355461|gb|EGE84318.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ajellomyces dermatitidis ATCC 18188]
          Length = 521

 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 280/487 (57%), Positives = 359/487 (73%), Gaps = 14/487 (2%)

Query: 5   PVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           PVM        K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRIDL 
Sbjct: 36  PVMSSFADSNSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDLT 95

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           ++  + N+ +NIVK F +AK+ NGR+H LGL+SDGGVHSHINHL  LL+ AK+  +PK +
Sbjct: 96  LRKGEMNKTENIVKSFQKAKDGNGRLHLLGLISDGGVHSHINHLFGLLQVAKDMQVPKVF 155

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S+  Y++QL     +L  G++AT++GRYYAMDRDKRW+R+++A   L
Sbjct: 156 IHFFGDGRDTDPKSATGYMQQLLDKTKELGVGELATVVGRYYAMDRDKRWDRVEVAMHGL 215

Query: 180 TKGV-GEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQI 237
             G  GE+S DP+ TI+ER+ K E DEFLKPII+  +E  I++NDTLFFF++R+DR+R+I
Sbjct: 216 VTGEGGEESTDPVKTIQERYEKGENDEFLKPIIIGGKERRIQDNDTLFFFNYRSDRVREI 275

Query: 238 VQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
            Q  G     P P F    P+++ IT MT+YK+++ FP+AFPPQ M NVL+EW  K  + 
Sbjct: 276 TQLLGDVDRSPKPNF--PYPKDISITTMTQYKTDYKFPIAFPPQHMGNVLAEWLGKQGLK 333

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           QCHVAETEK+AHVTFFFNGGVE+ F  E R+LI SP+VATYDL P+MS            
Sbjct: 334 QCHVAETEKYAHVTFFFNGGVEKHFPGEERELIPSPRVATYDLDPKMSAAPVADKLAERI 393

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
              KF F+MNNFA PDMVGHTG Y+A  +A+  TDKAIG ++EACK NGYILF+T+DHGN
Sbjct: 394 GEKKFEFLMNNFAPPDMVGHTGVYEATIEAVTATDKAIGRVFEACKQNGYILFVTADHGN 453

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKEMT 472
           AE+M++ EG P T+HT N VPFI+A+    ++ + + G L DVAPTIL  +G+E PKEMT
Sbjct: 454 AEEMKNAEGTPKTSHTTNKVPFIMANAPEGWSLKKSGGVLGDVAPTILAAMGIEQPKEMT 513

Query: 473 GLSLLKK 479
           G SLL K
Sbjct: 514 GQSLLVK 520



>gi|327308594|ref|XP_003238988.1| phosphoglycerate mutase [Trichophyton rubrum CBS 118892]
 gi|326459244|gb|EGD84697.1| phosphoglycerate mutase [Trichophyton rubrum CBS 118892]
          Length = 520

 Score =  578 bits (1491), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/489 (56%), Positives = 362/489 (74%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM    +E       YT ++A   AVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSGFAQEGSKTAQGYTEIDASSTAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +V+NIVK F+ AK  NGR+H LGL+SDGGVHSHINHL  LL+ AK+ G+P
Sbjct: 93  DQTLKKGQLGKVENIVKSFENAKNGNGRLHLLGLISDGGVHSHINHLFGLLQVAKDMGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S+  Y+E+L +   +L  G++AT++GRYYAMDRDKRW+RI++A 
Sbjct: 153 KVFIHFFGDGRDTDPKSAAGYMEKLLQKTQELGVGELATVVGRYYAMDRDKRWDRIEVAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S D + TI+ER+ K E DEFLKPII   +E  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVTGEGEESHDAVKTIKERYDKGENDEFLKPIIFGGQERRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+++ IT MTRYK+++ FP+AF PQ M NVL+EW +K +
Sbjct: 273 EITQLLGDVDRSPKPDF--PYPKSISITTMTRYKTDYTFPIAFAPQHMGNVLAEWLSKKQ 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGGVE+ F+ E R++I SPKVATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGVEKQFEGEDREMIPSPKVATYDLDPKMSAKPVGEKLAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               GK+ F+MNNFA PDMVGHTG Y+AA K +  TD AIG +YEACK +GYILF+T+DH
Sbjct: 391 RIADGKYEFLMNNFAPPDMVGHTGVYEAAIKGVAATDAAIGCVYEACKKHGYILFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G P T+HT N VPF++A+    ++ + + G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMKNADGTPKTSHTTNFVPFVMANAPEGWSLKKSGGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M G SLL K
Sbjct: 511 MDGTSLLVK 519



>gi|393233295|gb|EJD40868.1| phosphoglycerate mutase [Auricularia delicata TFB-10046 SS5]
          Length = 543

 Score =  577 bits (1487), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 277/508 (54%), Positives = 358/508 (70%), Gaps = 33/508 (6%)

Query: 4   TPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNK 63
           T  MD +  ++ +  L AHGLAVGL +GLMGNSEVGHLNIGAGR+V+QDIV+ID ++K +
Sbjct: 35  TTHMDAIAAKHSFRKLAAHGLAVGLSDGLMGNSEVGHLNIGAGRIVWQDIVKIDQSIKKR 94

Query: 64  KFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFF 123
           +F++ + I +    AK+TNGR+HF+GL+SDGGVHSHI HL  L+ETA+  G+P  ++HF 
Sbjct: 95  EFHKNEVIRESLQHAKDTNGRVHFIGLISDGGVHSHIKHLYALIETAREVGVPHVFIHFL 154

Query: 124 GDGRDTNPRSSDKYLEQL-------QKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           GDGRDT+P+S++KY+ QL        K   D    ++ATI+GRYYAMDRDKRWER+K+A 
Sbjct: 155 GDGRDTDPKSANKYMRQLVDFIAKDAKQFKDTTV-EVATIVGRYYAMDRDKRWERVKLAV 213

Query: 177 EALTKGVGEKSE-----------DPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLF 225
           + L  G G+  E           + +  I  R+ K+E DEFLKPI+V  +G IK+ DTLF
Sbjct: 214 DGLVLGEGKDIEVIEVAKDGNGDELVKIIEARYEKNEKDEFLKPIVVKGDGRIKDKDTLF 273

Query: 226 FFDFRADRMRQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSE 285
           FF++R+DRMR+IV  FG+ P P E ++P++LHIT M+RY  EFPF +AFPPQ M NVL+E
Sbjct: 274 FFNYRSDRMREIVSVFGLEPKPMEVQVPKDLHITTMSRYNIEFPFNIAFPPQGMTNVLAE 333

Query: 286 WFAKHKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXX 345
           W +K  + Q HVAETEK+AHVTFFFNGGVE+ F+ E R +I SPKVATYDL+P MS    
Sbjct: 334 WLSKQGVKQAHVAETEKYAHVTFFFNGGVEKQFEAEERHMIASPKVATYDLQPAMSAQGV 393

Query: 346 XXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYIL 405
                     G   FVM NFA PDMVGHTG +DAA +AI  TD A+  IY+AC+  GY+L
Sbjct: 394 ADKVAALLAEGTHEFVMCNFAPPDMVGHTGIFDAAVEAIGATDAAVKTIYDACEKAGYVL 453

Query: 406 FITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNK--YSFAESTK------------GA 451
            +T+DHGNAEQMQ+ EG PHTAHT NPVP I+  +K  +   E TK            GA
Sbjct: 454 VVTADHGNAEQMQNSEGTPHTAHTTNPVPLIVTGDKKRWGLKEDTKGLGVSDDVDAEVGA 513

Query: 452 LCDVAPTILDVIGLETPKEMTGLSLLKK 479
           LCDVAPTILD++GL+ PKEM+G SLL++
Sbjct: 514 LCDVAPTILDIMGLDVPKEMSGRSLLER 541



>gi|119195025|ref|XP_001248116.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (iPGM)
           [Coccidioides immitis RS]
 gi|392862644|gb|EAS36700.2| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Coccidioides immitis RS]
          Length = 520

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/487 (57%), Positives = 360/487 (73%), Gaps = 13/487 (2%)

Query: 2   AETPVMD-----KLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM      K K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSSFADPKAKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  + N+V +IV  F+RAK  NGR+H LGLVSDGGVHSHINHL+ LL+ AK   IP
Sbjct: 93  DQTLKKGELNKVQSIVNTFNRAKTGNGRLHLLGLVSDGGVHSHINHLVGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S   Y++QL  ++ ++  G++AT++GRY+AMDRDKRW+RI++A 
Sbjct: 153 KVFIHFFGDGRDTDPKSGAGYMQQLLDSMKEVGIGELATVVGRYFAMDRDKRWDRIEVAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE S+D +  I ER+ K ETDEFLKPII   +E  +K++DTLFFF++R+DR+R
Sbjct: 213 KGIVLGDGEASDDAVKAINERYEKGETDEFLKPIIFGGDERRVKDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MT+YK+++ FP+AFPPQ M NVL+EW +   
Sbjct: 273 EITQLLGDYDRSPKPDF--PYPKNIAITTMTQYKTDYTFPIAFPPQHMGNVLAEWLSVKG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGG+E+ F+ E RDLI SP+VATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGIEKQFEGEDRDLIPSPRVATYDLDPKMSAAPVGEKMAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                K+  VMNNFA PDMVGHTG Y+AA + +  TDKAIG I+E+CK NGYILFIT+DH
Sbjct: 391 RIAEKKYDLVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGRIFESCKENGYILFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G+P T+HT N VPF++A+    ++   K G L DVAPTILD +G+E PKE
Sbjct: 451 GNAEEMKNGDGSPKTSHTTNKVPFVMANAPEGWSLKEKDGILGDVAPTILDAMGIEQPKE 510

Query: 471 MTGLSLL 477
           M+G SLL
Sbjct: 511 MSGSSLL 517



>gi|302661880|ref|XP_003022601.1| hypothetical protein TRV_03258 [Trichophyton verrucosum HKI 0517]
 gi|291186557|gb|EFE41983.1| hypothetical protein TRV_03258 [Trichophyton verrucosum HKI 0517]
          Length = 520

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/489 (56%), Positives = 359/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM    +E       YT ++A   AVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSGFAQEGSKTAQGYTEIDASSTAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +V+NIVK F+ AK  NGR+H LGL+SDGGVHSHINHL  LL+ AK   +P
Sbjct: 93  DQTLKKGQLGKVENIVKSFENAKNGNGRLHLLGLISDGGVHSHINHLFGLLQVAKEMCVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S+  Y+EQL +   +L  G++AT++GRYYAMDRDKRW+RI+IA 
Sbjct: 153 KVFIHFFGDGRDTDPKSAAGYMEQLLQKTQELGVGELATVVGRYYAMDRDKRWDRIEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S D + TI+ER+ K E DEFLKPII   +E  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVTGEGEESHDAVKTIKERYEKGENDEFLKPIIFGGQERRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MTRYK+++ FP+AF PQ M NVL+EW +K  
Sbjct: 273 EITQLLGDVDRSPKPDF--PYPKNISITTMTRYKTDYTFPIAFAPQHMGNVLAEWLSKKH 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGGVE+ F+ E R++I SPKVATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGVEKQFEGEDREMIPSPKVATYDLDPKMSAKPVGEKLAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               GK+ F+MNNFA PDMVGHTG Y+AA + +  TD AIG +YEACK +GYILF+T+DH
Sbjct: 391 RIADGKYEFLMNNFAPPDMVGHTGVYEAAIQGVAATDAAIGCVYEACKKHGYILFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G P T+HT N VPF++A+    ++ + + G L DVAPT+L  +G+E P+E
Sbjct: 451 GNAEEMKNADGTPKTSHTTNFVPFVMANAPEGWSLKKSGGVLGDVAPTVLAAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           M G SLL K
Sbjct: 511 MDGTSLLVK 519



>gi|398389767|ref|XP_003848344.1| phosphoglycerate mutase 2 [Zymoseptoria tritici IPO323]
 gi|339468219|gb|EGP83320.1| phosphoglycerate mutase 2 [Zymoseptoria tritici IPO323]
          Length = 521

 Score =  575 bits (1481), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 284/491 (57%), Positives = 356/491 (72%), Gaps = 14/491 (2%)

Query: 1   NAETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVR 55
           NAETP MD+      K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VR
Sbjct: 32  NAETPWMDEFATVGSKITSGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVR 91

Query: 56  IDLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGI 115
           ID  +K  + N+V+NIVK F RAKE NGR+H  GLVSDGGVHSHINHL +LL+ AK  G+
Sbjct: 92  IDQTIKKGEMNKVENIVKSFTRAKEGNGRLHLCGLVSDGGVHSHINHLKNLLKVAKEIGV 151

Query: 116 PKAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIA 175
           P+ Y+HFFGDGRDT+P+S   +LE L     + + GK+ATI+GRYY MDRDKRWER+++ 
Sbjct: 152 PEVYIHFFGDGRDTDPKSGKGHLEDLLAFTKEQSIGKLATIVGRYYVMDRDKRWERVELG 211

Query: 176 FEALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRM 234
            + +  G GE+S DP++T + R+   E DEFLKPII++ +EG I + DT+FFF++R+DR+
Sbjct: 212 LKGMVTGEGEESSDPVATFQARYDAGENDEFLKPIIINGKEGRISDKDTVFFFNYRSDRV 271

Query: 235 RQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R++VQ  G     P P F    P ++H+T MTRYK++F  P+AF P SM+NVL++W  +H
Sbjct: 272 REVVQLLGDQDRSPRPDF--PYPSDIHLTTMTRYKTDFNLPIAFAPVSMDNVLADWLGQH 329

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXX 349
            + Q H+AETEKFAHVTFFFNGG E  +  E RDLI SPK VATYDL+P+MS        
Sbjct: 330 DVKQVHIAETEKFAHVTFFFNGGQETQYPGEERDLIPSPKGVATYDLEPKMSAMGVAEKM 389

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
                +G+  F+MNNFA PDMVGHTG YDAA  A   TDKAIG++YEACK +GY LFIT+
Sbjct: 390 AERIAAGEHEFIMNNFAPPDMVGHTGVYDAAVIACGETDKAIGVVYEACKKHGYTLFITA 449

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETP 468
           DHGNAE+M  EE  P T+HT N VPF++A+    ++ + T G L DVAPTIL  +GLE P
Sbjct: 450 DHGNAEEMLTEEKTPKTSHTTNKVPFVMANAPEGWSLKRTDGVLGDVAPTILACMGLEQP 509

Query: 469 KEMTGLSLLKK 479
           KEMTG SLL K
Sbjct: 510 KEMTGTSLLVK 520



>gi|336365174|gb|EGN93525.1| hypothetical protein SERLA73DRAFT_78418 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336377740|gb|EGO18900.1| hypothetical protein SERLADRAFT_374653 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 547

 Score =  575 bits (1481), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 290/513 (56%), Positives = 352/513 (68%), Gaps = 37/513 (7%)

Query: 2   AETPVMDKLKREYP-------YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIV 54
           A+T  MD L R          Y TL AHG+AVGL EGLMGNSEVGHLNIGAGR+V+QDIV
Sbjct: 34  ADTTHMDTLSRTNQNGDGSGGYRTLSAHGVAVGLSEGLMGNSEVGHLNIGAGRIVWQDIV 93

Query: 55  RIDLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHG 114
           RID+A+K + F++ + I+    RAKE NGR+H  GL+SDGGVHSHI+HL  LLETAK + 
Sbjct: 94  RIDVAIKKRLFHKNETILASIKRAKEGNGRLHLAGLISDGGVHSHISHLFALLETAKENE 153

Query: 115 IPKAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKI 174
           +P  Y+HFF DGRDT PRS+  Y  QLQ  ID   YG+IAT++GRYYAMDRDKRWER+K+
Sbjct: 154 VPHTYIHFFADGRDTAPRSATIYANQLQDFIDKEGYGQIATVVGRYYAMDRDKRWERVKV 213

Query: 175 AFEALTKGVGE---KSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFR 230
           A + L KG GE   K E  +  I ER+ KDETDEFLKPIIV+ ++G IKE+DTLFFF++R
Sbjct: 214 AVDGLIKGEGEALSKEEGLIDKIEERYKKDETDEFLKPIIVNGDDGRIKESDTLFFFNYR 273

Query: 231 ADRMRQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           +DRMR+I    G    P E  IP++LHI+ M+RY +EFPF +AFPPQ+M NVL+EW  K 
Sbjct: 274 SDRMREIATLLGKLDTPIELDIPKDLHISTMSRYNAEFPFTVAFPPQAMTNVLAEWLGKQ 333

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + Q H+AETEK+AHVTFFFNGGVE+ + LE R +I SPKVATYDL+P MS         
Sbjct: 334 GVKQSHIAETEKYAHVTFFFNGGVEKQYPLEERHMIPSPKVATYDLEPGMSVQNVADKVA 393

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
              ++G+  FVM NFA PDMVGHTG Y AA KAI  TD A+G I  ACK  GY+L IT+D
Sbjct: 394 EVLKNGENEFVMCNFAPPDMVGHTGDYQAAVKAITKTDAAVGTIAAACKETGYVLLITAD 453

Query: 411 HGNAEQMQDEE-GNPHTAHTCNPVPFILASN-------------------------KYSF 444
           HGNAEQM + E G PHTAHT N VPFI+                            K   
Sbjct: 454 HGNAEQMLNAETGAPHTAHTTNKVPFIMVGGTGLKFAEEGGKEEEGKEEGDKGIKEKAQE 513

Query: 445 AESTKGALCDVAPTILDVIGLETPKEMTGLSLL 477
            E  +GAL DVAPT+L ++GL  P+EMTG SLL
Sbjct: 514 EEEEEGALADVAPTVLAIMGLPQPEEMTGRSLL 546



>gi|303310775|ref|XP_003065399.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase family
           protein [Coccidioides posadasii C735 delta SOWgp]
 gi|240105061|gb|EER23254.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase family
           protein [Coccidioides posadasii C735 delta SOWgp]
          Length = 520

 Score =  574 bits (1480), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 278/487 (57%), Positives = 359/487 (73%), Gaps = 13/487 (2%)

Query: 2   AETPVMD-----KLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM      K K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSSFADPKAKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  + N+V +IV  F+RAK  NGR+H LGLVSDGGVHSHINHL+ LL+ AK   IP
Sbjct: 93  DQTLKKGELNKVQSIVNTFNRAKTGNGRLHLLGLVSDGGVHSHINHLVGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S   Y++QL  ++ ++  G++AT++GRY+AMDRDKRW+RI++A 
Sbjct: 153 KVFIHFFGDGRDTDPKSGAGYMQQLLDSMKEVGIGELATVVGRYFAMDRDKRWDRIEVAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE S+D +  I ER+ K ETDEFLKPII   +E  +K++DTLFFF++R+DR+R
Sbjct: 213 KGIVLGDGEASDDAVKAINERYEKGETDEFLKPIIFGGDERRVKDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MT+YK+++ FP+AFPPQ M NVL+EW +   
Sbjct: 273 EITQLLGDYDRSPKPDF--PYPKNIAITTMTQYKTDYTFPIAFPPQHMGNVLAEWLSVKG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGG+E+ F+ E RDLI SP+VATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGIEKQFEGEDRDLIPSPRVATYDLDPKMSAAPVGEKMAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                K+  VMNNFA PDMVGHTG Y+AA + +  TDKAIG I+E+CK NGYILFIT+DH
Sbjct: 391 RIAEKKYDLVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGRIFESCKENGYILFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G+P T+HT N VP ++A+    ++   K G L DVAPTILD +G+E PKE
Sbjct: 451 GNAEEMKNGDGSPKTSHTTNKVPLVMANAPEGWSLKEKDGILGDVAPTILDAMGIEQPKE 510

Query: 471 MTGLSLL 477
           M+G SLL
Sbjct: 511 MSGSSLL 517



>gi|320034728|gb|EFW16671.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Coccidioides posadasii str. Silveira]
          Length = 520

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 277/487 (56%), Positives = 359/487 (73%), Gaps = 13/487 (2%)

Query: 2   AETPVMD-----KLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM      K K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPVMSSFADPKAKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  + N+V +IV  F+RAK  NGR+H LGLVSDGGVHSHINHL+ LL+ AK   IP
Sbjct: 93  DQTLKKGELNKVQSIVNTFNRAKTGNGRLHLLGLVSDGGVHSHINHLVGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S   Y++QL  ++ ++  G++AT++GRY+AMDRDKRW+RI++A 
Sbjct: 153 KVFIHFFGDGRDTDPKSGAGYMQQLLDSMKEVGIGELATVVGRYFAMDRDKRWDRIEVAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE S+D +  I ER+ K ETDEFLKPII   +E  +K++DTLFFF++R+DR+R
Sbjct: 213 KGIVLGDGEASDDAVKAINERYEKGETDEFLKPIIFGGDERRVKDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MT+YK+++ FP+AFPPQ M NVL+EW +   
Sbjct: 273 EITQLLGDYDRSPKPDF--PYPKNIAITTMTQYKTDYTFPIAFPPQHMGNVLAEWLSVKG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGG+E+ F+ E RDLI SP+VATYDL P+MS          
Sbjct: 331 LKQCHIAETEKYAHVTFFFNGGIEKQFEGEDRDLIPSPRVATYDLDPKMSAAPVGEKMAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                K+  VMNNFA PDMVGHTG Y+AA + +  TDKAIG I+E+CK NGYILFIT+DH
Sbjct: 391 RIAEKKYDLVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGRIFESCKENGYILFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKE 470
           GNAE+M++ +G+P T+HT N VP ++A+    ++   K G L DVAPTI+D +G+E PKE
Sbjct: 451 GNAEEMKNGDGSPKTSHTTNKVPLVMANAPEGWSLKEKDGILGDVAPTIIDAMGIEQPKE 510

Query: 471 MTGLSLL 477
           M+G SLL
Sbjct: 511 MSGSSLL 517



>gi|453081006|gb|EMF09056.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Mycosphaerella populorum SO2202]
          Length = 522

 Score =  572 bits (1475), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 282/490 (57%), Positives = 354/490 (72%), Gaps = 14/490 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP MD+  +E       YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  AETPWMDEFAKEGSDKAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +KN + N+V+NIVK F RAKE NGR+HF GLVSDGGVHSHINHL  LL+ AK  G+P
Sbjct: 93  DQTIKNGELNKVENIVKSFTRAKEGNGRLHFAGLVSDGGVHSHINHLKALLKVAKEMGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           + Y+HFFGDGRDT+P+S   +LE L     +L  GK+ATI+GRYY MDRDKRWER++   
Sbjct: 153 EVYIHFFGDGRDTDPKSGKGHLEDLLAYTKELGVGKLATIVGRYYIMDRDKRWERVETGL 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMR 235
           + L  G GE+++DP++T ++R+   E DEFLKPII++ +E  IK++DT+F F++R+DR+R
Sbjct: 213 KGLVTGEGEETDDPVATFQKRYDAGENDEFLKPIIINGKEARIKDHDTVFVFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +  Q  G     P P F    P ++ +T MTRYK++F  P+AF PQ M+NVL++W ++  
Sbjct: 273 EFTQLLGDQDRSPRPDF--PYPSDIQVTTMTRYKTDFNLPIAFAPQVMDNVLADWLSQQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXX 350
             Q H+AETEKFAHVTFFFNGG E  +D E R+LIDSPK VATYD  P+MS         
Sbjct: 331 CKQTHIAETEKFAHVTFFFNGGQEVQYDNEDRELIDSPKSVATYDQAPKMSAMGVAERMA 390

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                GK+ FVMNNFA PDMVGHTG  DAA      TDKAIG++YEACK +GY LFITSD
Sbjct: 391 EKIGDGKYEFVMNNFAPPDMVGHTGVLDAAIIGCAETDKAIGVVYEACKKHGYTLFITSD 450

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M  EE  P T+HT N VPF++A+    F+ +   G L DVAPT+LD++GLE PK
Sbjct: 451 HGNAEEMLTEEKTPKTSHTTNKVPFVMANAPAGFSLKKQDGVLGDVAPTLLDLMGLEQPK 510

Query: 470 EMTGLSLLKK 479
           EMTG SLL++
Sbjct: 511 EMTGHSLLQR 520



>gi|240280728|gb|EER44232.1| phosphoglycerate mutase [Ajellomyces capsulatus H143]
 gi|325089015|gb|EGC42325.1| phosphoglycerate mutase [Ajellomyces capsulatus H88]
          Length = 521

 Score =  572 bits (1473), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 284/488 (58%), Positives = 358/488 (73%), Gaps = 14/488 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A  PVM        K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  ANAPVMSSFADSNSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +KN   N+ +NIVK F +AK+ NGR+H LGL+SDGGVHSHINHL  LL+ AK   IP
Sbjct: 93  DQTLKNGDMNKTENIVKTFQKAKDGNGRLHLLGLISDGGVHSHINHLFGLLQVAKEMKIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S+  Y++QL     +L  G++AT++GRY+AMDRDKRW+RI+IA 
Sbjct: 153 KVFIHFFGDGRDTDPKSAAGYMQQLLDKTKELGVGELATVVGRYFAMDRDKRWDRIEIAL 212

Query: 177 EALTKG-VGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRM 234
             L  G  GE+S DP+ TI+ER+ K E DEFLKPII+  +E  I++NDTLFFF++R+DR+
Sbjct: 213 HGLVTGEGGEESTDPVQTIKERYQKGENDEFLKPIIIGGKERRIQDNDTLFFFNYRSDRV 272

Query: 235 RQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R+I Q  G     P P F    P+N+ IT MT+YK+++ FP+AFPPQ M NVL+EW  K 
Sbjct: 273 REITQLLGDVDRSPKPNF--PYPQNISITTMTQYKTDYKFPIAFPPQHMGNVLAEWLGKQ 330

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + QCH+AETEK+AHVTFFFNGGVE+ F  E R+LI SPKVATYDL P+MS         
Sbjct: 331 GLKQCHIAETEKYAHVTFFFNGGVEKQFLGEERELIPSPKVATYDLDPKMSAAPVADKLA 390

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KF F+MNNFA PDMVGHTG Y+AA +A+  TDKAIG ++EACK +GYILF+T+D
Sbjct: 391 GRIGEKKFEFLMNNFAPPDMVGHTGVYEAAVEAVAATDKAIGRVFEACKQHGYILFVTAD 450

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M++ EG P T+HT N VPFI+A+    ++ + + G L DVAPTIL  +G+E PK
Sbjct: 451 HGNAEEMKNAEGTPKTSHTTNKVPFIMANAPEGWSLKKSGGVLGDVAPTILAAMGIEQPK 510

Query: 470 EMTGLSLL 477
           EMTG SLL
Sbjct: 511 EMTGHSLL 518



>gi|212543131|ref|XP_002151720.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Talaromyces marneffei ATCC 18224]
 gi|210066627|gb|EEA20720.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Talaromyces marneffei ATCC 18224]
          Length = 520

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/489 (57%), Positives = 353/489 (72%), Gaps = 13/489 (2%)

Query: 2   AETPVMD-----KLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM      K K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPVMSSFADPKSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           DL +KN K  EV+NI K F RA + NGR+H LGLVSDGGVHS   HL  LL+ AK+ G+P
Sbjct: 93  DLTLKNGKLGEVENIRKSFQRAVDGNGRLHLLGLVSDGGVHSQNKHLYGLLQVAKDMGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K  +HFFGDGRDT+P+S+ +Y+++L     +L  G++ T++GRYY MDRDKRW+R++I  
Sbjct: 153 KVIIHFFGDGRDTDPKSAARYMQELLDKTKELGIGEVGTVVGRYYVMDRDKRWDRVEIGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             +  G GE S DP+ TI ER++K E DEFLKPIIV  +E  + ++DTLFFF++R+DR+R
Sbjct: 213 RGIITGEGEASTDPVKTIEERYAKGENDEFLKPIIVGGKENRVHDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MT+YKS++PFP+AFPPQ M NVL+EW  K  
Sbjct: 273 EITQLLGGYDRSPIPDF--PYPKNIQITTMTQYKSDYPFPVAFPPQHMGNVLAEWLGKQN 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           ISQ H+AETEK+AHVTFFFNGG+E+ F  E RD+I SP+VATYDL+P+MS          
Sbjct: 331 ISQSHIAETEKYAHVTFFFNGGIEKQFPGEERDMIPSPRVATYDLQPKMSAWAVGERVAE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                KF  VMNNFA PDMVGHTG Y+AA + +  TD+AIG IYEACK +GYILFIT+DH
Sbjct: 391 RIAEEKFGLVMNNFAPPDMVGHTGVYEAAIQGVAETDRAIGHIYEACKKHGYILFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M +EE  P T+HT N VPF++A+    ++ +   G L DVAPTIL+ +G+E P+E
Sbjct: 451 GNAEEMLNEERKPKTSHTLNKVPFVMANAPEGWSLKKEGGVLGDVAPTILEAMGIEQPEE 510

Query: 471 MTGLSLLKK 479
           MT  SLL K
Sbjct: 511 MTCHSLLVK 519



>gi|255934446|ref|XP_002558402.1| Pc12g16040 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583021|emb|CAP81231.1| Pc12g16040 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 517

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/488 (56%), Positives = 352/488 (72%), Gaps = 12/488 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP M        K    +  L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 31  ADTPYMSGFAEPNSKTAQGFAELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 90

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +V ++VK F RAKE NGR+H LGLVSDGGVHS+I HL  LL+ AK+  IP
Sbjct: 91  DQTLKKGEMGKVPSVVKSFTRAKEGNGRLHLLGLVSDGGVHSNITHLFALLQVAKDMQIP 150

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           + Y+HFF DGRDT+P+S++K+++QL +   ++  G IAT++GRYY MDRDKRWER++I  
Sbjct: 151 EVYIHFFADGRDTDPKSAEKFMQQLLEKTQEIGTGAIATVVGRYYIMDRDKRWERVEIGL 210

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMR 235
           + L  G GE S DP+ TIRER+ K E DEFLKPIIV  +E  ++++DTLFFF++R+DR+R
Sbjct: 211 KGLVTGEGEDSSDPVQTIRERYEKGENDEFLKPIIVGGKERRVQDDDTLFFFNYRSDRVR 270

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ +T MT+YK+++ F +AFPPQ M NVL+EW  K  
Sbjct: 271 EITQLMGDYDRSPRPDF--PYPKNISLTTMTQYKTDYTFDVAFPPQHMGNVLAEWLGKKN 328

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGG+E+ F  EVRD+I SP+VATYDL P+MS          
Sbjct: 329 LQQCHIAETEKYAHVTFFFNGGIEKDFPGEVRDMIPSPRVATYDLDPKMSAAAVGAKMAE 388

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                KF FVMNNFA PDMVGHTG Y+AA + +  TDKAIG IYEACK N YILFIT+DH
Sbjct: 389 RLGENKFDFVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGEIYEACKKNNYILFITADH 448

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEM 471
           GNAE+M +E+G P T+HT N VPF++A+    ++    G L DVAPT+L  +G+E P+EM
Sbjct: 449 GNAEEMLNEKGTPKTSHTLNKVPFVMANAPEGWSLKKGGVLGDVAPTVLAAMGVEQPEEM 508

Query: 472 TGLSLLKK 479
           TG +LL K
Sbjct: 509 TGANLLVK 516



>gi|425768376|gb|EKV06901.1| Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Penicillium digitatum Pd1]
 gi|425770336|gb|EKV08809.1| Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Penicillium digitatum PHI26]
          Length = 517

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 272/488 (55%), Positives = 354/488 (72%), Gaps = 12/488 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP M        K    ++ LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 31  ADTPHMSGFAEPNSKTAQGFSELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 90

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  +  +V ++VK F RAKE NGR+H LGLVSDGGVHS+I HL  LL+ AK+  +P
Sbjct: 91  DQTLKKGEMGKVPSVVKSFTRAKEGNGRLHLLGLVSDGGVHSNITHLFALLQVAKDMQVP 150

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           + ++HFF DGRDT+P+S+DK+++Q+ +   ++  G +AT++GRYY MDRDKRWER+++  
Sbjct: 151 EVFIHFFADGRDTDPKSADKFMQQVLEKTQEIGIGAVATVVGRYYIMDRDKRWERVEVGM 210

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + L  G GE S DP+ TI+ER+ K E DEFLKPIIV  +E  +++NDTLFFF++R+DR+R
Sbjct: 211 KGLVTGEGEDSSDPVQTIKERYEKKENDEFLKPIIVGGKERRVQDNDTLFFFNYRSDRVR 270

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ +T MT+YK+++ F +AFPPQ M NVL+EW AK  
Sbjct: 271 EITQLLGDHDRSPRPDF--PYPKNISLTTMTQYKTDYTFDVAFPPQHMGNVLAEWLAKKN 328

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCH+AETEK+AHVTFFFNGG+E+ F  EVRD+I SP+VATYDL P+MS          
Sbjct: 329 LQQCHIAETEKYAHVTFFFNGGIEKDFPGEVRDMIPSPRVATYDLDPKMSAAAVGAKMAE 388

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                KF FVMNNFA PDMVGHTG Y+AA + +  TDKAIG IYEACK N Y+LFIT+DH
Sbjct: 389 RLGEQKFDFVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGEIYEACKKNNYVLFITADH 448

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEM 471
           GNAE+M +E+G P T+HT N VPF++A+    ++    G L DVAPT+L  +G+E P+EM
Sbjct: 449 GNAEEMLNEKGTPKTSHTLNKVPFVMANAPEGWSLKKGGVLGDVAPTVLAAMGVEQPEEM 508

Query: 472 TGLSLLKK 479
           TG +LL K
Sbjct: 509 TGTNLLIK 516



>gi|452978128|gb|EME77892.1| hypothetical protein MYCFIDRAFT_57412 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 521

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 277/491 (56%), Positives = 358/491 (72%), Gaps = 14/491 (2%)

Query: 1   NAETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVR 55
           NAETP MD+  ++       YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VR
Sbjct: 32  NAETPWMDEFAKKDSKYAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVR 91

Query: 56  IDLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGI 115
           ID  +K  + N+V+N+VK F RAKE NGR+H  GLVSDGGVHSHINHL  LL+ AK  G+
Sbjct: 92  IDQTIKKGEMNKVENVVKSFKRAKEGNGRLHLCGLVSDGGVHSHINHLKSLLKVAKEIGV 151

Query: 116 PKAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIA 175
           P+ Y+HFFGDGRDT+P+S   +LE L     +   GK+ATI+GRYY MDRDKRW+R++I 
Sbjct: 152 PEVYIHFFGDGRDTDPKSGKGHLEDLLAFTKEQGIGKLATIVGRYYVMDRDKRWDRVEIG 211

Query: 176 FEALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRM 234
            + +  G GE+++DP++T ++R+   E DEFLKPIIV+ +   +K+NDTLFFF++R+DR+
Sbjct: 212 MKGMVTGEGEETDDPVATFQKRYDAGEHDEFLKPIIVNGKHARVKDNDTLFFFNYRSDRV 271

Query: 235 RQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R++ Q  G     P P F    P+N+ IT MTRYK++F  P+AF PQ M+NVL++W ++ 
Sbjct: 272 REVTQLLGDQDRSPKPDF--PYPKNIQITTMTRYKTDFNLPVAFAPQVMDNVLADWLSQK 329

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXX 349
              Q H+AETEK+AHVTFFFNGGVE  FD E R+LIDSPK VATYD  P+MS        
Sbjct: 330 GCKQSHIAETEKYAHVTFFFNGGVEVQFDGEDRELIDSPKSVATYDQAPKMSAMGVAERM 389

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
                 GK+ FVMNNFA PDMVGHTG YDAA + +  TDKAIG++YEACK +GY LF+TS
Sbjct: 390 AERIADGKYEFVMNNFAPPDMVGHTGVYDAAVQGVAETDKAIGVVYEACKKHGYTLFVTS 449

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILASN-KYSFAESTKGALCDVAPTILDVIGLETP 468
           DHGNAE+M  +E  P T+HT N VPF++A+  + +  +   G L DVAPT+LD++G+E P
Sbjct: 450 DHGNAEEMLTDEKTPKTSHTTNRVPFVMANAPEGTSLKKDIGVLGDVAPTLLDLMGIEQP 509

Query: 469 KEMTGLSLLKK 479
           KEM+G SLL +
Sbjct: 510 KEMSGHSLLTR 520



>gi|154278251|ref|XP_001539942.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ajellomyces capsulatus NAm1]
 gi|150413527|gb|EDN08910.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ajellomyces capsulatus NAm1]
          Length = 541

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 285/508 (56%), Positives = 357/508 (70%), Gaps = 34/508 (6%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A  PVM        K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRI
Sbjct: 33  ANAPVMSSFADSNSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +KN   N+ +NIVK F +AK+ NGR+H LGL+SDGGVHSHINHL  LL+ AK   IP
Sbjct: 93  DQTLKNGDMNKTENIVKTFQKAKDGNGRLHLLGLISDGGVHSHINHLFGLLQVAKEMKIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S+  Y++QL     +L  G++AT++GRY+AMDRDKRW+RI+IA 
Sbjct: 153 KVFIHFFGDGRDTDPKSAAGYMQQLLDKTKELGVGELATVVGRYFAMDRDKRWDRIEIAL 212

Query: 177 EALTKGVG-EKSEDPLSTIRERFSKDETDEFLKPIIVDE-----EGII------------ 218
             L  G G E+S DP+ TI ER+ K E DEFLKPII+       +G I            
Sbjct: 213 HGLVTGEGGEESTDPVQTINERYKKGENDEFLKPIIIGGKERRIQGTIHASPTPAVFHIC 272

Query: 219 ----KENDTLFFFDFRADRMRQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPF 270
               K+NDTLFFF++R+DR+R+I Q  G     P P F    P+N+ IT MT+YK+++ F
Sbjct: 273 LPRSKDNDTLFFFNYRSDRVREITQLLGDVDRSPKPNF--PYPKNISITTMTQYKTDYKF 330

Query: 271 PLAFPPQSMENVLSEWFAKHKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK 330
           P+AFPPQ M NVL+EW  K  + QCH+AETEK+AHVTFFFNGGVE+ F  E R+LI SPK
Sbjct: 331 PIAFPPQHMGNVLAEWLGKQGLKQCHIAETEKYAHVTFFFNGGVEKQFLGEERELIPSPK 390

Query: 331 VATYDLKPEMSXXXXXXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKA 390
           VATYDL P+MS               KF F+MNNFA PDMVGHTG Y+AA +A+  TDKA
Sbjct: 391 VATYDLDPKMSAAPVADKLAERICENKFEFLMNNFAPPDMVGHTGVYEAAVEAVTATDKA 450

Query: 391 IGIIYEACKANGYILFITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTK 449
           IG ++EACK +GYILF+T+DHGNAE+M++ EG P T+HT N VPFI+A+    ++ + + 
Sbjct: 451 IGRVFEACKQHGYILFVTADHGNAEEMKNAEGTPKTSHTTNKVPFIMANAPEGWSLKKSG 510

Query: 450 GALCDVAPTILDVIGLETPKEMTGLSLL 477
           G L DVAPTIL  +G+E PKEMTG SLL
Sbjct: 511 GVLGDVAPTILAAMGVEQPKEMTGHSLL 538



>gi|396482897|ref|XP_003841574.1| similar to phosphoglycerate mutase [Leptosphaeria maculans JN3]
 gi|312218149|emb|CBX98095.1| similar to phosphoglycerate mutase [Leptosphaeria maculans JN3]
          Length = 520

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 277/489 (56%), Positives = 355/489 (72%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKR-----EYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP MD+  R        YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  ADTPTMDEFARPGSKTAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
              +KN K  +V  I K F RA + NGR+HF GLVSDGGVHSH++HLI LL+ AK  G+P
Sbjct: 93  AQTIKNGKLKDVATIKKSFQRAIDGNGRLHFCGLVSDGGVHSHMDHLIELLKVAKAQGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           KAY+HFFGDGRDT+P+S+  Y++ L KA  D+  G IAT++GRYY MDRDKRW+R++I  
Sbjct: 153 KAYIHFFGDGRDTDPKSAVGYMDTLLKATKDIGLGDIATVVGRYYIMDRDKRWDRVEIGL 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP++TI+ER+SKDE DEFLKPIIV  +E  I++NDT+FFF++R+DR+R
Sbjct: 213 KGMVTGEGEESSDPVATIKERYSKDENDEFLKPIIVGGQERRIQDNDTVFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           ++ Q  G     P P F    P+N+ IT MT Y  ++ F +AF PQ M +VL+E   K  
Sbjct: 273 EVTQLLGDVDRSPKPDF--PYPKNIDITTMTSYNPKYTFNIAFEPQRMNDVLAETLGKQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ F+ E R+++ SPKVATYDL+P MS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQFENEEREMVPSPKVATYDLQPAMSAMAVADKLCE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
             ++GKF F+MNNFA PDMVGHTG Y AA +A   TD+AI  +Y+ CK +GY+LF+T+DH
Sbjct: 391 RIQTGKFEFLMNNFAPPDMVGHTGVYKAAIEACTETDRAIKKVYDQCKESGYVLFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M  EEG P T+HT N VPF++A+   S++ + T G L DVAPTIL  +GL+ P+ 
Sbjct: 451 GNAEEMLTEEGTPKTSHTTNKVPFVMANAPDSWSLKKTDGVLGDVAPTILATMGLQQPEA 510

Query: 471 MTGLSLLKK 479
           M G SLL+K
Sbjct: 511 MDGHSLLQK 519



>gi|392574802|gb|EIW67937.1| hypothetical protein TREMEDRAFT_72064 [Tremella mesenterica DSM
           1558]
          Length = 528

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 274/484 (56%), Positives = 350/484 (72%), Gaps = 5/484 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           + +T  MD ++ ++ +  LEAHGLAVGL EGLMGNSEVGHLNIGAGR+V+QDIV+ID  +
Sbjct: 44  HGDTTNMDAIRDKHNFVELEAHGLAVGLKEGLMGNSEVGHLNIGAGRIVWQDIVKIDQCI 103

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F++   IV    RA     R+H LGL+SDGGVHSHI H+  LL  AK H I   Y+
Sbjct: 104 KKDEFSKQPAIVDTMKRAASHGSRLHLLGLISDGGVHSHITHVFALLRCAKAHNIEHVYI 163

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT PRS+ KY+++LQ  I ++  G+I+T++GRY+AMDRDKRW+R+KIA + L 
Sbjct: 164 HFFGDGRDTAPRSATKYIQELQDYIKEVGVGEISTVVGRYFAMDRDKRWDRVKIAVDGLI 223

Query: 181 KGVGEKSE--DPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQI 237
            G G+K E  D + T+   + KD TDEF+KPII   E+  IK+ DTLF F++R+DRMR++
Sbjct: 224 SGEGDKVEADDLVKTVEAGYEKDVTDEFIKPIISGSEDSRIKKGDTLFMFNYRSDRMREL 283

Query: 238 VQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
               G+P  P E  +P++LHIT MTRY  +F FP+AFPP SM NVL+EW  K  + QCH+
Sbjct: 284 TTVLGLPDKPMEVTVPDDLHITTMTRYNPDFTFPVAFPPHSMANVLAEWLGKQGVKQCHI 343

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGK 357
           AETEK+AHVTFFFNGGVE+ F LE R +I SPKVATYD +PEMS            ++G+
Sbjct: 344 AETEKYAHVTFFFNGGVEKTFPLEERHMIPSPKVATYDKQPEMSVQGVADKVAEVIKTGE 403

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
           + FVM NFA PDMVGHTG Y+AA +AI  TDKA+  +Y+AC+  GY+L IT+DHGNAEQM
Sbjct: 404 YEFVMCNFAPPDMVGHTGVYEAAVEAIGATDKAVKTVYDACEEAGYVLCITADHGNAEQM 463

Query: 418 QD-EEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKEMTGLS 475
            D E GNPHTAHT N VPFI+  +K S   S + GAL DVAPT+L ++GL  P+EMTG S
Sbjct: 464 LDPETGNPHTAHTTNHVPFIVTGDKGSLEVSPEPGALADVAPTVLAILGLPQPEEMTGRS 523

Query: 476 LLKK 479
           LL K
Sbjct: 524 LLAK 527



>gi|189194371|ref|XP_001933524.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187979088|gb|EDU45714.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 520

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 276/489 (56%), Positives = 359/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP MD+  ++       YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  ADTPTMDEFAKDGSKTAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
              +KN K  +VD I K F RA + NGR+HF GLVSDGGVHSH++HLI LL+ AK+ G+P
Sbjct: 93  GQTIKNGKLKDVDTIKKSFQRAIDGNGRLHFCGLVSDGGVHSHMDHLIALLKVAKDQGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           KAY+HFFGDGRDT+P+S+  Y+E L KA  ++  G+IAT++GRYY MDRDKRW+R++I  
Sbjct: 153 KAYIHFFGDGRDTDPKSAVGYMETLLKATKEIGLGEIATVVGRYYIMDRDKRWDRVEIGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + L  G GE+S DP++TI+ER++KDE DEFLKPIIV  +E  I+++DT+FFF++R+DR+R
Sbjct: 213 KGLVTGEGEESNDPVATIKERYAKDENDEFLKPIIVGGKERRIQDDDTVFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ IT MT Y  ++ F +AF PQ M +VL+E   K  
Sbjct: 273 EITQLLGDVDRSPKPDF--PYPKNIDITTMTSYNPKYTFNIAFEPQRMTDVLAETLGKQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ F+ E R+++ SPKVATYDL+P+MS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQFENEEREMVPSPKVATYDLEPKMSAMAVAEKLCE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
             R+GKF F+MNNFA PDMVGHTG Y AA +A   TDKAI  +Y+ CK +GY++F+T+DH
Sbjct: 391 RIRTGKFEFLMNNFAPPDMVGHTGVYKAAIEACTETDKAIKRVYDQCKESGYVMFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M  EEG P T+HT N VPF++A+    ++ + T G L DVAPT+L  +GL+ P++
Sbjct: 451 GNAEEMLTEEGTPKTSHTTNKVPFVMANAPEGWSLKKTDGVLGDVAPTLLATMGLQQPED 510

Query: 471 MTGLSLLKK 479
           M G SLL K
Sbjct: 511 MDGHSLLIK 519



>gi|242785754|ref|XP_002480661.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Talaromyces stipitatus ATCC 10500]
 gi|218720808|gb|EED20227.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Talaromyces stipitatus ATCC 10500]
          Length = 520

 Score =  568 bits (1465), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 280/489 (57%), Positives = 354/489 (72%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM        K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPVMSSFADPNAKVAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +KN K  E++NI K F RAK+ NGR+H LGLVSDGGVHS   HL  LL+ AK+ G+P
Sbjct: 93  DQTLKNGKLGEIENIRKSFQRAKDGNGRLHLLGLVSDGGVHSKNQHLYGLLQVAKDIGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K  +HFFGDGRDT+P+SS KY+++L     +L  G++ T++GRYYAMDRDKRW+R++IA 
Sbjct: 153 KVIIHFFGDGRDTDPKSSTKYMQELLDKTKELGIGEVGTVVGRYYAMDRDKRWDRVEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE S D + TI ER++K E DEFLKPIIV  +E  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVTGEGEDSSDLVKTIEERYAKGENDEFLKPIIVGGKENRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+++HIT MT+YK+++ FP+AFPPQ M NVL+EW  K  
Sbjct: 273 EITQLLGGYDRSPNPDF--PYPKDIHITTMTQYKTDYTFPIAFPPQHMGNVLAEWLGKKN 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           ++Q H+AETEK+AHVTFFFNGG+E+ F  E RD+I SP+VATYDL+P+MS          
Sbjct: 331 VTQSHIAETEKYAHVTFFFNGGIEKQFPGEERDMIPSPRVATYDLEPKMSAWAVGEKVVE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                KF FVMNNFA PDMVGHTG Y+AA + +  TD+AIG IYEACK +GYILFIT+DH
Sbjct: 391 RLGENKFEFVMNNFAPPDMVGHTGVYEAAIQGVAETDRAIGHIYEACKKHGYILFITADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M +E+  P T+HT N VPF++A+    ++ +   G L DVAPTIL  +G+E P E
Sbjct: 451 GNAEEMLNEQRKPKTSHTTNKVPFVMANAPEGWSLKKEGGVLGDVAPTILAAMGIEQPGE 510

Query: 471 MTGLSLLKK 479
           MT  SLL K
Sbjct: 511 MTCHSLLIK 519



>gi|330918849|ref|XP_003298365.1| hypothetical protein PTT_09083 [Pyrenophora teres f. teres 0-1]
 gi|311328445|gb|EFQ93543.1| hypothetical protein PTT_09083 [Pyrenophora teres f. teres 0-1]
          Length = 520

 Score =  568 bits (1463), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 275/489 (56%), Positives = 359/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP MD+  +E       YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  ADTPTMDEFAKEGSKTAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
              +KN K  +V+ I K F RA + NGR+HF GLVSDGGVHSH++HLI LL+ AK+ G+P
Sbjct: 93  GQTIKNGKLKDVETIKKSFQRAIDGNGRLHFCGLVSDGGVHSHMDHLIALLKVAKDQGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           KAY+HFFGDGRDT+P+S+  Y+E L KA  ++  G+IAT++GRYY MDRDKRW+R++I  
Sbjct: 153 KAYIHFFGDGRDTDPKSAVGYMETLLKATKEIGLGEIATVVGRYYIMDRDKRWDRVEIGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + L  G GE+S DP++TI+ER++KDE DEFLKPIIV  +E  I+++DT+FFF++R+DR+R
Sbjct: 213 KGLVTGEGEESSDPVATIKERYAKDENDEFLKPIIVGGKERRIQDDDTVFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+ +T MT Y  ++ F +AF PQ M +VL+E   K  
Sbjct: 273 EITQLLGDVDRSPKPDF--PYPKNIDLTTMTSYNPKYTFNVAFEPQRMTDVLAETLGKQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ F+ E R+++ SPKVATYDL+P+MS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQFENEEREMVPSPKVATYDLEPKMSAMAVADKLCE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
             R+GKF F+MNNFA PDMVGHTG Y AA +A   TDKAI  +Y+ CK +GY++F+T+DH
Sbjct: 391 RIRTGKFEFLMNNFAPPDMVGHTGVYKAAIEACTETDKAIKRVYDQCKESGYVMFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M  EEG P T+HT N VPF++A+    ++ + T G L DVAPT+L  +GL+ P++
Sbjct: 451 GNAEEMLTEEGTPKTSHTTNKVPFVMANAPEGWSLKKTDGVLGDVAPTLLATMGLQQPED 510

Query: 471 MTGLSLLKK 479
           M G SLL K
Sbjct: 511 MDGHSLLIK 519



>gi|452004480|gb|EMD96936.1| hypothetical protein COCHEDRAFT_1163165 [Bipolaris maydis C5]
 gi|477586722|gb|ENI03806.1| hypothetical protein COCC4DRAFT_51646 [Bipolaris maydis ATCC 48331]
          Length = 520

 Score =  568 bits (1463), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 276/489 (56%), Positives = 357/489 (73%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP MD+  R+       YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  ADTPTMDEFARQGSKTAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
              +KN K  +V+NI K F RA + NGR+HF GLVSDGGVHSH++HLI LL+ AK  G+P
Sbjct: 93  GQTIKNDKLKDVENIKKSFQRAIDGNGRLHFCGLVSDGGVHSHMDHLIALLKVAKQQGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           KAY+HFFGDGRDT+P+S+  Y+E L KA  ++  G+IAT++GRYY MDRDKRW+R+++  
Sbjct: 153 KAYIHFFGDGRDTDPKSAVGYMETLLKATKEIGLGEIATVVGRYYIMDRDKRWDRVELGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + L  G GE S DP++TI+ER+ K E DEFLKPIIV  +E  I+++DT+FFF++R+DR+R
Sbjct: 213 KGLVTGEGEDSSDPVATIKERYEKGENDEFLKPIIVGGKERRIQDDDTVFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+H+T MT Y  ++ F +AF PQ M +VL+E   K  
Sbjct: 273 EITQLLGDFDRSPKPDF--PYPKNIHLTTMTSYNPKYTFNIAFEPQRMMDVLAETLGKQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ F+ E R+++ SPKVATYDL+P+MS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQFENEEREMVPSPKVATYDLEPKMSAMAVADKLCE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
             R+GKF F+MNNFA PDMVGHTG Y AA +A   TDKAI  +Y+ CK +GY+LF+T+DH
Sbjct: 391 RIRTGKFEFLMNNFAPPDMVGHTGVYKAAIEACTETDKAIKKVYDQCKESGYVLFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M  EEG P T+HT N VPF++A+    ++ + T G L DVAPT+L V+GL+ P++
Sbjct: 451 GNAEEMLTEEGTPKTSHTTNKVPFVMANAPEGWSLKKTDGVLGDVAPTVLAVMGLQQPED 510

Query: 471 MTGLSLLKK 479
           M   SLL K
Sbjct: 511 MDCNSLLVK 519



>gi|169625021|ref|XP_001805915.1| hypothetical protein SNOG_15777 [Phaeosphaeria nodorum SN15]
 gi|111055752|gb|EAT76872.1| hypothetical protein SNOG_15777 [Phaeosphaeria nodorum SN15]
          Length = 520

 Score =  568 bits (1463), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/487 (56%), Positives = 353/487 (72%), Gaps = 9/487 (1%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP MD       K    +T LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  ADTPTMDGFMKDGSKTAQGFTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
              +K  K  +V+ + K F RA + NGR+HF GLVSDGGVHSH++HLI  L+ AK  G+P
Sbjct: 93  AQTIKEGKLKDVETVKKSFQRAIDGNGRLHFCGLVSDGGVHSHMDHLIEFLKVAKQQGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           KAY+HFF DGRDT+P+S+  Y+E L KA  ++  G IAT++GRYY MDRDKRW+R++I  
Sbjct: 153 KAYIHFFADGRDTDPKSAAGYMETLLKATKEIGLGDIATVVGRYYIMDRDKRWDRVEIGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + L  G GE+S DP++TI+ER+SKDE DEFLKPIIV  +E  I+++DTLFFF++R+DR+R
Sbjct: 213 KGLVTGEGEESSDPVATIKERYSKDENDEFLKPIIVGGKERRIQDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG--VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           +I Q  G     P  +   P+N+ +T MT Y  ++ FP+AFPPQ M++VL+E   K  + 
Sbjct: 273 EITQLLGDVDRSPKADFPYPKNMSLTTMTSYNPKYTFPVAFPPQRMDDVLAETLGKQGVK 332

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           QCHVAETEK+AHVTFFFNGGVE+ F+ E R+++ SPKVATYDL+P MS            
Sbjct: 333 QCHVAETEKYAHVTFFFNGGVEKQFENEEREMVPSPKVATYDLQPTMSAMAVADKLCERI 392

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
           ++GKF F+MNNFA PDMVGHTG Y AA +    TDKAI  +YE CK +GY+LF+T+DHGN
Sbjct: 393 QTGKFEFLMNNFAPPDMVGHTGVYKAAIEGCTETDKAIKRVYEQCKESGYVLFVTADHGN 452

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKEMT 472
           AE+M  EEG P T+HT N VPF++A+   S++ + T G L DVAPT+L V+GL+ P+ M 
Sbjct: 453 AEEMLTEEGTPKTSHTTNKVPFVMANAPESWSLKKTDGVLGDVAPTVLAVMGLQQPEAMD 512

Query: 473 GLSLLKK 479
           G SLL K
Sbjct: 513 GHSLLVK 519



>gi|482813056|gb|EOA89760.1| hypothetical protein SETTUDRAFT_167546 [Setosphaeria turcica Et28A]
          Length = 520

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 275/489 (56%), Positives = 356/489 (72%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP MD+  RE       YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  ADTPTMDEFAREGSSTAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
              +KN K  +V+NI K F RA + NGR+HF GLVSDGGVHSH++HLI LL+ AK  G+P
Sbjct: 93  GQTIKNNKLKDVENIKKSFQRAIDGNGRLHFCGLVSDGGVHSHMDHLIALLKVAKEQGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           +AY+HFFGDGRDT+P+S+  Y+E L KA  ++  G+I T++GRYY MDRDKRW+R+++  
Sbjct: 153 EAYIHFFGDGRDTDPKSAVGYMETLLKATKEIGLGEIGTVVGRYYIMDRDKRWDRVELGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + L  G GE S DP++TI+ER+ K E DEFLKPIIV  +E  I++NDT+FFF++R+DR+R
Sbjct: 213 KGLVTGEGEDSSDPVATIKERYEKGENDEFLKPIIVGGKERRIQDNDTVFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+H+T MT Y  ++ F +AF PQ M +VL+E   K  
Sbjct: 273 EITQLLGDVDRSPKPDF--PYPKNIHLTTMTSYNPKYTFNIAFEPQRMTDVLAETLGKQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ F+ E R+++ SPKVATYDL+P+MS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQFENEEREMVPSPKVATYDLEPKMSAMAVADKLCE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
             ++GKF F+MNNFA PDMVGHTG Y+AA +A   TDKAI  +Y+ CK +GY+LF+T+DH
Sbjct: 391 RIQTGKFEFLMNNFAPPDMVGHTGVYNAAIEACTETDKAIKKVYDQCKESGYVLFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKE 470
           GNAE+M  EEG P T+HT N VPF++A+    ++   K G L DVAPT+L V+GL+ P++
Sbjct: 451 GNAEEMLTEEGTPKTSHTTNKVPFVMANAPQGWSLKKKDGVLGDVAPTVLAVMGLQQPED 510

Query: 471 MTGLSLLKK 479
           M   SLL K
Sbjct: 511 MDCHSLLIK 519



>gi|299754778|ref|XP_001828187.2| phosphoglycerate mutase [Coprinopsis cinerea okayama7#130]
 gi|298410919|gb|EAU93538.2| phosphoglycerate mutase [Coprinopsis cinerea okayama7#130]
          Length = 560

 Score =  565 bits (1455), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 288/515 (55%), Positives = 359/515 (69%), Gaps = 37/515 (7%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            ET  MD + +++ Y TL A G AVGL EGLMGNSEVGHLN+GAGRVV+QDIVRID+A+K
Sbjct: 45  GETHFMDTIAKDHSYRTLRASGTAVGLSEGLMGNSEVGHLNVGAGRVVWQDIVRIDVAIK 104

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            K+F+E   I++   RAKE  GR+HFLGL+SDGGVHSHI HL  LLETAK  G+P+ Y+H
Sbjct: 105 KKQFHENPTILEACKRAKEGTGRLHFLGLISDGGVHSHITHLFALLETAKEQGVPEVYIH 164

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           FFGDGRDT PRS+ KY++QL +  D+   G++ATIIGRYYAMDRDKRWERIK+A   LT 
Sbjct: 165 FFGDGRDTAPRSATKYIQQLGEFTDEHKVGELATIIGRYYAMDRDKRWERIKLAVLGLTT 224

Query: 182 GVGEKS-------------EDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFF 227
           G  E+              +  ++ + E + KD TDEFLKPI+V+ E+G +++ DTLFFF
Sbjct: 225 GKPEEEGKSFESVQKEEGWKGAVTVVDENYKKDVTDEFLKPIVVNGEKGRVRDGDTLFFF 284

Query: 228 DFRADRMRQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWF 287
           ++R+DRMR+I   FG         +P++L I  M++YK EFPF +AFPPQ+M NVL+EW 
Sbjct: 285 NYRSDRMREISSVFGGLEEIEGLTVPKDLGIFTMSQYKKEFPFKVAFPPQAMTNVLAEWL 344

Query: 288 AKHKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXX 347
           AK  + Q HVAETEK+AHVTFFFNGGVE+ F+ E R +I SPKVATYDL P+MS      
Sbjct: 345 AKKGLRQAHVAETEKYAHVTFFFNGGVEKQFEGEDRFMIPSPKVATYDLDPKMSVHGVAE 404

Query: 348 XXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFI 407
                    ++ FVM NFA PDMVGHTG YDAA  AI  TDKA+G IY+A + NGYIL I
Sbjct: 405 KVAELLDKNEYDFVMCNFAPPDMVGHTGVYDAAVTAITETDKAVGTIYKAAEKNGYILLI 464

Query: 408 TSDHGNAEQMQD-EEGNPHTAHTCNPVPFILASN-----------KYS-----------F 444
           T+DHGNAEQM+D + GNPHTAHT NPVPFI+  N           K++            
Sbjct: 465 TADHGNAEQMKDPKTGNPHTAHTTNPVPFIMTGNPKGEKGDAKTLKFADLPEAKPAGEDE 524

Query: 445 AESTKGALCDVAPTILDVIGLETPKEMTGLSLLKK 479
           AE    AL DVAPTILDV+GL+ P++M+G SLL K
Sbjct: 525 AEDDSPALADVAPTILDVMGLDKPEDMSGKSLLAK 559



>gi|451855436|gb|EMD68728.1| hypothetical protein COCSADRAFT_33605 [Bipolaris sorokiniana
           ND90Pr]
          Length = 520

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 275/489 (56%), Positives = 356/489 (72%), Gaps = 13/489 (2%)

Query: 2   AETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           A+TP MD+  R+       YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  ADTPTMDEFARQGSKTAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
              +KN K  +V NI K F RA + NGR+HF GLVSDGGVHSH++HLI LL+ AK  G+P
Sbjct: 93  GQTIKNDKLKDVGNIKKSFQRAIDGNGRLHFCGLVSDGGVHSHMDHLIALLKVAKQQGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           KAY+HFFGDGRDT+P+S+  Y+E L KA  ++  G+IAT++GRYY MDRDKRW+R+++  
Sbjct: 153 KAYIHFFGDGRDTDPKSAVGYMETLLKATKEIGLGEIATVVGRYYIMDRDKRWDRVELGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + L  G GE S DP++TI+ER+ K E DEFLKPIIV  +E  I+++DT+FFF++R+DR+R
Sbjct: 213 KGLVTGEGEDSSDPVATIKERYEKGENDEFLKPIIVGGKERRIQDDDTVFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+++T MT Y  ++ F +AF PQ M +VL+E   K  
Sbjct: 273 EITQLLGDVDRSPKPDF--PYPKNVNLTTMTSYNPKYTFNVAFEPQRMTDVLAETLGKQG 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + QCHVAETEK+AHVTFFFNGGVE+ F+ E R+++ SPKVATYDL+P+MS          
Sbjct: 331 VKQCHVAETEKYAHVTFFFNGGVEKQFENEEREMVPSPKVATYDLEPKMSAMAVADKLCE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
             R+GKF F+MNNFA PDMVGHTG Y AA +A   TDKAI  +Y+ CK +GY+LF+T+DH
Sbjct: 391 RIRTGKFEFLMNNFAPPDMVGHTGVYKAAIEACTETDKAIKKVYDQCKESGYVLFVTADH 450

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKE 470
           GNAE+M  EEG P T+HT N VPF++A+    ++ + T G L DVAPT+L V+GL+ P++
Sbjct: 451 GNAEEMLTEEGTPKTSHTTNKVPFVMANAPEGWSLKKTDGVLGDVAPTVLAVMGLQQPED 510

Query: 471 MTGLSLLKK 479
           M   SLL K
Sbjct: 511 MDCNSLLVK 519



>gi|452838016|gb|EME39957.1| hypothetical protein DOTSEDRAFT_178830 [Dothistroma septosporum
           NZE10]
          Length = 521

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 271/491 (55%), Positives = 353/491 (71%), Gaps = 14/491 (2%)

Query: 1   NAETPVMDKLKRE-----YPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVR 55
           NAETP MD+  ++       YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VR
Sbjct: 32  NAETPWMDEFAKDGSKITQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVR 91

Query: 56  IDLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGI 115
           ID  +K  + N+V+N+VK F RAK+ NGR+H  GLVSDGGVHSHINHL  LL+ AK  G+
Sbjct: 92  IDQTIKQGELNKVENVVKSFKRAKDGNGRLHLCGLVSDGGVHSHINHLKALLKVAKEIGV 151

Query: 116 PKAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIA 175
            + Y+HFFGDGRDT+P+S   +LE L     +   G++ATI+GRYY MDRDKRW+R++I 
Sbjct: 152 TEVYIHFFGDGRDTDPKSGKGHLEDLLAFCKEQGIGQLATIVGRYYIMDRDKRWDRVEIG 211

Query: 176 FEALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRM 234
            + L  G GE+++DP+ T + R+ K E DEFLKPII++ +E  I++NDT+FFF++R+DR+
Sbjct: 212 LKGLVTGEGEETDDPVKTFQSRYDKGENDEFLKPIIINGKEARIQDNDTVFFFNYRSDRV 271

Query: 235 RQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R++ Q  G     P P F    P+++ +T MTRYK++F  P+AF PQ M+NVL++W ++ 
Sbjct: 272 REVAQLLGDQDRSPKPDF--PYPKDISLTTMTRYKTDFDLPVAFAPQVMDNVLADWLSQK 329

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXX 349
              Q H+AETEK+AHVTFFFNGGVE  FD E R+LI SPK VATYD  P+MS        
Sbjct: 330 GCKQSHIAETEKYAHVTFFFNGGVEVQFDGEDRELIPSPKSVATYDEAPKMSAMAVGEKM 389

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
                  K+ F+MNNFA PDMVGHTG Y AA + +  TDKAIG++YEACK +GY LFITS
Sbjct: 390 AERIAEDKYEFIMNNFAPPDMVGHTGVYKAAVEGVSETDKAIGVVYEACKKHGYTLFITS 449

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETP 468
           DHGNAE+M  EE  P T+HT N VPF++A+     + +   G L DVAPT+LD++G+E P
Sbjct: 450 DHGNAEEMLTEEKTPKTSHTTNKVPFVMANAPEGLSLKKQDGVLGDVAPTVLDIMGIEQP 509

Query: 469 KEMTGLSLLKK 479
           + MTG SLL++
Sbjct: 510 EAMTGHSLLQR 520



>gi|115384730|ref|XP_001208912.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Aspergillus terreus NIH2624]
 gi|114196604|gb|EAU38304.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Aspergillus terreus NIH2624]
          Length = 509

 Score =  558 bits (1439), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 277/490 (56%), Positives = 351/490 (71%), Gaps = 26/490 (5%)

Query: 2   AETPVMD-----KLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETP M      K +    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPYMSGFADPKSETAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +K  + N+VDN+V  F RAKE NGR+H LGLVSDGGVHS+I HLI LL+ AK   IP
Sbjct: 93  DQTLKKGELNKVDNVVASFKRAKEGNGRLHLLGLVSDGGVHSNITHLIGLLKVAKEMEIP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
             ++HFFGDGRDT+P+S+ KY++ L  A  ++  G+IAT++GRY+AMDRDKRW+R++I  
Sbjct: 153 HVFIHFFGDGRDTDPKSAAKYMQDLLDATKEIGTGEIATVVGRYFAMDRDKRWDRVEIGM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE+S DP+ TI+ER+ K ETDEFLKPIIV  ++  ++++DTLFFF++R+DR+R
Sbjct: 213 KGVVVGEGEESSDPVKTIKERYEKGETDEFLKPIIVGGKDRRVQDDDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+N+HIT MT+YK+++ FP+AFPPQ M NVL+EW +K  
Sbjct: 273 EITQLLGDYDRSPKPDF--PYPKNIHITTMTQYKTDYTFPVAFPPQHMGNVLAEWLSKKD 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           I QCHVAETEK+AH            F  EVRD+I SPKVATYDL P+MS          
Sbjct: 331 IQQCHVAETEKYAH------------FPGEVRDMIPSPKVATYDLDPKMSAAGVGQKMAE 378

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
               GKF FVMNNFA PDMVGHTG Y AA + +  TDKAIG +YEACK +GY LFIT+DH
Sbjct: 379 RIAEGKFEFVMNNFAPPDMVGHTGVYKAAIEGVTATDKAIGEVYEACKKHGYTLFITADH 438

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIGLETPK 469
           GNAE+M +E+G P T+HT N VPFI+A+    +S  +  +G L DVAPT+L  +G+E P+
Sbjct: 439 GNAEEMLNEKGTPKTSHTTNKVPFIMANAPKGWSLKKGDEGVLGDVAPTVLAAMGIEQPE 498

Query: 470 EMTGLSLLKK 479
           EM+G SLL K
Sbjct: 499 EMSGKSLLVK 508



>gi|312083081|ref|XP_003143712.1| independent phosphoglycerate mutase isoform 2 [Loa loa]
 gi|307761124|gb|EFO20358.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Loa
           loa]
          Length = 515

 Score =  558 bits (1439), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 281/489 (57%), Positives = 350/489 (71%), Gaps = 13/489 (2%)

Query: 1   NAETPVMDKLK--REYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDL 58
           NA+TPVMD+L     +P   ++AHGL VGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI+L
Sbjct: 29  NAKTPVMDELCALNSHP---IQAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINL 85

Query: 59  AVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKA 118
           AVKNK   E  ++ +  +RA + NGR+H  GLVSDGGVHSHI+HL  L+   K   +P  
Sbjct: 86  AVKNKTLVENKHLKEAAERAIKGNGRMHLCGLVSDGGVHSHIDHLFALIMALKQLKVPHL 145

Query: 119 YVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           ++ FFGDGRDT+P S   +L+QL   ++   YG+IATI+GRYYAMDRDKRWERI++ ++A
Sbjct: 146 FIQFFGDGRDTSPTSGVGFLQQLIDFVNKEQYGEIATIVGRYYAMDRDKRWERIRVCYDA 205

Query: 179 LTKGVGEKS--EDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQ 236
           L  GVGEK+  +  +  I+ R++KDETDEFLKPII+ +EG  K+ DTL FFD+RADRMR+
Sbjct: 206 LIGGVGEKTSTDKAIDVIKGRYAKDETDEFLKPIILSDEGRTKDGDTLIFFDYRADRMRE 265

Query: 237 IVQTFGV---PPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+        + K P+N+ +  MT+YK+EF FP  FPP+S +NVL+EW + + ++
Sbjct: 266 ITECMGMERYKDLNSDIKHPKNMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVNGVT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGGVE+ F  E R L+ SPKVATYDL+P MS            
Sbjct: 326 QFHCAETEKYAHVTFFFNGGVEKQFANEERCLVMSPKVATYDLEPPMSSAAVADKMVEQL 385

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
              K PFVM NFA PDMVGHTG YDAA KA+E TD AIG IYEACK N YIL +T+DHGN
Sbjct: 386 HMKKHPFVMCNFAPPDMVGHTGVYDAAVKAVEATDIAIGRIYEACKKNDYILMVTADHGN 445

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKG---ALCDVAPTILDVIGLETPKE 470
           AE+M   +G+ HTAHTCN VPF  +S KY F +       ALCDVAPT+L V+GL  P E
Sbjct: 446 AEKMMAPDGSKHTAHTCNLVPFTCSSMKYKFLDKLPDRDMALCDVAPTVLKVMGLPLPSE 505

Query: 471 MTGLSLLKK 479
           MTG  LL +
Sbjct: 506 MTGQPLLNE 514



>gi|402590388|gb|EJW84318.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Wuchereria bancrofti]
          Length = 515

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 279/487 (57%), Positives = 352/487 (72%), Gaps = 13/487 (2%)

Query: 1   NAETPVMDKL--KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDL 58
           NA+TPVMD+L     +P   ++AHGL VGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI+L
Sbjct: 29  NAKTPVMDELCAMNSHP---IQAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINL 85

Query: 59  AVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKA 118
           AVKNK   E  ++ +  +RA + NGR+H  GLVSDGGVHSHI+HL  L+ + K   +PK 
Sbjct: 86  AVKNKTLVENKHLKEAAERAIKGNGRMHLCGLVSDGGVHSHIDHLFALITSLKQLKVPKL 145

Query: 119 YVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           Y+ FFGDGRDT+P S   +L+QL   ++   YG+I+TI+GRYYAMDRDKRWERI++ ++A
Sbjct: 146 YIQFFGDGRDTSPTSGVGFLQQLIDFVNKEQYGEISTIVGRYYAMDRDKRWERIRVCYDA 205

Query: 179 LTKGVGEKS--EDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQ 236
           L  GVGEK+  +  +  I+ R++KDETDEFLKPII+ +EG  K+ DTL FFD+RADRMR+
Sbjct: 206 LIGGVGEKATVDKAIDVIKGRYAKDETDEFLKPIILSDEGRTKDGDTLIFFDYRADRMRE 265

Query: 237 IVQTFGVPPPP---FEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+        + K P+N+ +  MT+YK+EF FP  FPP+S +NVL+EW + + ++
Sbjct: 266 ITECMGMERYKDLNSDIKHPKNMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVNGLT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGGVE+ F  E R L+ SPKVATYDL+P MS            
Sbjct: 326 QFHCAETEKYAHVTFFFNGGVEKQFANEERCLVVSPKVATYDLEPPMSSAAVADKVIEQL 385

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
              K PFVM NFA PDMVGHTG Y+AA KA+E TD AIG IYEACK N YIL +T+DHGN
Sbjct: 386 HIKKHPFVMCNFAPPDMVGHTGVYEAAVKAVEATDIAIGRIYEACKKNDYILMVTADHGN 445

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAEST---KGALCDVAPTILDVIGLETPKE 470
           AE+M   +G+ HTAHTCN VPF  +S KY F +     + ALCDVAPT+L V+G+  P E
Sbjct: 446 AEKMMAPDGSKHTAHTCNLVPFTCSSVKYKFMDKLPDREMALCDVAPTVLKVMGVPLPSE 505

Query: 471 MTGLSLL 477
           MTG  L+
Sbjct: 506 MTGQPLV 512



>gi|37681504|gb|AAQ97626.1| independent phosphoglycerate mutase isoform 1 [Brugia malayi]
          Length = 515

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 279/487 (57%), Positives = 350/487 (71%), Gaps = 13/487 (2%)

Query: 1   NAETPVMDKL--KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDL 58
           NA+TPVMD+L     +P   ++AHGL VGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI+L
Sbjct: 29  NAKTPVMDELCVMNSHP---IQAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINL 85

Query: 59  AVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKA 118
           AVKNK   E  ++ +  +RA + NGR+H  GLVSDGGVHSHI+HL  L+   K   +PK 
Sbjct: 86  AVKNKTLVENKHLKEAAERAIKGNGRMHLCGLVSDGGVHSHIDHLFALITALKQLKVPKL 145

Query: 119 YVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           Y+ FFGDGRDT+P S   +L+QL   ++   YG+I+TI+GRYYAMDRDKRWERI++ ++A
Sbjct: 146 YIQFFGDGRDTSPTSGVGFLQQLIDFVNKEQYGEISTIVGRYYAMDRDKRWERIRVCYDA 205

Query: 179 LTKGVGEKS--EDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQ 236
           L  GVGEK+  +  +  I+ R++KDETDEFLKPII+ +EG  K+ DTL FFD+RADRMR+
Sbjct: 206 LIGGVGEKTTIDKAIDVIKGRYAKDETDEFLKPIILSDEGRTKDGDTLIFFDYRADRMRE 265

Query: 237 IVQTFGVPPPP---FEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+          K P+N+ +  MT+YK+EF FP  FPP+S +NVL+EW + + ++
Sbjct: 266 ITECMGMERYKDLNSNIKHPKNMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVNGLT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGGVE+ F  E R L+ SPKVATYDL+P MS            
Sbjct: 326 QFHCAETEKYAHVTFFFNGGVEKQFANEERCLVVSPKVATYDLEPPMSSAAVADKVIEQL 385

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
              K PFVM NFA PDMVGHTG Y+AA KA+E TD AIG IYEACK N YIL +T+DHGN
Sbjct: 386 HMKKHPFVMCNFAPPDMVGHTGVYEAAVKAVEATDIAIGRIYEACKKNDYILMVTADHGN 445

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAEST---KGALCDVAPTILDVIGLETPKE 470
           AE+M   +G+ HTAHTCN VPF  +S KY F +     + ALCDVAPT+L V+G+  P E
Sbjct: 446 AEKMMAPDGSKHTAHTCNLVPFTCSSMKYKFMDKLPDREMALCDVAPTVLKVMGVPLPSE 505

Query: 471 MTGLSLL 477
           MTG  L+
Sbjct: 506 MTGQPLV 512



>gi|430814274|emb|CCJ28479.1| unnamed protein product, partial [Pneumocystis jirovecii]
          Length = 1420

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/480 (56%), Positives = 336/480 (70%), Gaps = 11/480 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TP MD L ++Y +  LEAHG AVGL EGLMGNSEVGHLNIGAGRVV+QD VRID  +K
Sbjct: 30  AKTPTMDYLMQKYCWMELEAHGNAVGLLEGLMGNSEVGHLNIGAGRVVWQDSVRIDYVMK 89

Query: 62  NKKFNEVDNIVKCFDRAKET---NGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKA 118
              F     +   +   K T       + L  VSDGGVHSHI+HL HLLE AK  G+   
Sbjct: 90  KDSF-----MSGWYFSLKSTYIYTNDFNMLYKVSDGGVHSHISHLFHLLEVAKKVGLKDV 144

Query: 119 YVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           Y+HFF DGRDT+P SS  Y++QL   I+DL  G++AT++GRYYAMDRDKRWERI IA EA
Sbjct: 145 YIHFFSDGRDTSPVSSIIYMQQLLNKIEDLGIGELATVMGRYYAMDRDKRWERITIALEA 204

Query: 179 LTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIV 238
           +  G GE   D +  I ER  K+ETDEFLKPIIV+++G + + DTLFFF++R+DR+RQI 
Sbjct: 205 IVYGKGEVDSDVIRVINERHQKNETDEFLKPIIVNKKGCVSDGDTLFFFNYRSDRVRQIT 264

Query: 239 QTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVA 298
           Q  G+       KIP+NL IT MTRYK ++PF +AF PQ M NVL+EW +K  + Q H+A
Sbjct: 265 QVLGIDSTLTPVKIPKNLSITTMTRYKEDYPFSVAFSPQEMTNVLAEWLSKKNVLQSHIA 324

Query: 299 ETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKF 358
           ETEK+AHVTFFFNGG+E  F  E RD+I SPKV+TYD  P+MS               K+
Sbjct: 325 ETEKYAHVTFFFNGGLERQFPGEYRDMIPSPKVSTYDKDPKMSVYGVAEKVSERISENKY 384

Query: 359 PFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQ 418
           PFV+ N A PDMVGHTG YDAA +A+E TD AI IIY+ACK  GY   IT+DHGNAE M 
Sbjct: 385 PFVICNLAPPDMVGHTGVYDAAIEAVEHTDNAIRIIYDACKKEGY---ITADHGNAEVMI 441

Query: 419 DEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGLSLLK 478
           D+  NP T+HTCN VPFIL S KY+  +   GALCDVAPTIL ++G+E P+EM+G+  L+
Sbjct: 442 DKNNNPLTSHTCNHVPFILCSEKYTLQKEVVGALCDVAPTILALMGIEIPEEMSGVPRLR 501



>gi|308465595|ref|XP_003095056.1| hypothetical protein CRE_24737 [Caenorhabditis remanei]
 gi|308246171|gb|EFO90123.1| hypothetical protein CRE_24737 [Caenorhabditis remanei]
          Length = 521

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/488 (56%), Positives = 355/488 (72%), Gaps = 10/488 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMDKL     +  +EAHGL VGLPEGLMGNSEVGHLNIGAGRV+YQDIVRI+LAV
Sbjct: 34  NAQTPVMDKLCSG-NWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAV 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN +    +N+V   +RAK  NGR+H  GLVSDGGVHSHI+H+  L++  K  G+P+ Y+
Sbjct: 93  KNNQLVNNENLVDACNRAKNGNGRLHLAGLVSDGGVHSHIDHMFALIKAIKELGVPELYL 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDD-LNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           HF+GDGRDT+P S   +LEQ  + ++  + YGK+AT++GRYYAMDRDKRWERI +A+EA+
Sbjct: 153 HFYGDGRDTSPNSGVGFLEQTLEYLEKTVGYGKLATVVGRYYAMDRDKRWERINVAYEAM 212

Query: 180 TKGVGEKSEDP--LSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQ 236
             GVGE S++   +  +R+R++ DETDEFLKPII+  E+G ++ +DTL FFD+RADRMR+
Sbjct: 213 IGGVGETSDETGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTLVFFDYRADRMRE 272

Query: 237 IVQTFGVPP-PPFEAKI--PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+       +K+  P N+ +  MT+YK+EFPF   FPP S +NVL+EW A+ K+S
Sbjct: 273 ISEVMGMERYKDCNSKLAHPSNVQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVS 332

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGG+E+ F+ E R L+ SPKVATYDL+PEMS            
Sbjct: 333 QFHCAETEKYAHVTFFFNGGLEKQFEGEERSLVPSPKVATYDLQPEMSAAGVADKMLEQI 392

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G  PF+M NFA PDMVGHTG Y+AA KA E TD AIG IYEA + +GY L +T+DHGN
Sbjct: 393 EAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDVAIGRIYEATQKHGYSLMVTADHGN 452

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKG--ALCDVAPTILDVIGLETPKEM 471
           AE+M+  +G  HTAHTC  VP  L+   + F +      ALCDVAPT+L ++GL  P EM
Sbjct: 453 AEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEM 512

Query: 472 TGLSLLKK 479
           TG S+++K
Sbjct: 513 TGASIVQK 520



>gi|171679573|ref|XP_001904733.1| hypothetical protein [Podospora anserina S mat+]
 gi|170939412|emb|CAP64640.1| unnamed protein product [Podospora anserina S mat+]
          Length = 519

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 284/490 (57%), Positives = 345/490 (70%), Gaps = 19/490 (3%)

Query: 2   AETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+  R    +T L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 32  AETPVMDEFSRSATGFTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 91

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  K  E D I K  + AK +NGR+H  GLVS GGVH+   HL  LLE AK +GIPK Y+
Sbjct: 92  KQGKLAENDVIKKVMEAAKNSNGRLHLCGLVSHGGVHAKQTHLYALLEAAKQYGIPKVYI 151

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   YLE+L   I +L  G+IATI+GRYYAMDRDKRWER++IA + L 
Sbjct: 152 HFFGDGRDTDPKSGAGYLEELLAKIKELGIGEIATIVGRYYAMDRDKRWERVEIALKGLV 211

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE+S DP+ TI+ER+ K E DEFLKPIIV  +E  IK+ D +FFF++R+DR+RQI Q
Sbjct: 212 LGEGEESTDPVKTIKERYDKGENDEFLKPIIVGGQESRIKDGDNVFFFNYRSDRVRQITQ 271

Query: 240 TFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
             G      +P  P+       +++  MT+YK ++PF +AF PQ M NVL+EW  K  + 
Sbjct: 272 VLGDVDRSVLPDFPY-----PKINLVTMTQYKVDYPFEVAFKPQHMGNVLAEWLGKQGVK 326

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXX 348
           Q HVAETEK+AHVTFFFNGGVE+ F LEVR    DL+ S K VATYD  PEMS       
Sbjct: 327 QVHVAETEKYAHVTFFFNGGVEKVFPLEVRDESQDLVPSNKSVATYDQAPEMSADGVAEQ 386

Query: 349 XXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFIT 408
                  G+FPFVMNNFA PDMVGHTG Y+AA      TDKAIG IYE CK NGYILFIT
Sbjct: 387 VVKRLGEGEFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKIYEGCKKNGYILFIT 446

Query: 409 SDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLET 467
           SDHGNAE+M+  +G P T+HT N VPFI+A+    ++ +  +G L DVAPT+L  +GL  
Sbjct: 447 SDHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKEEGVLGDVAPTVLAAMGLPI 506

Query: 468 PKEMTGLSLL 477
           P+EMTG SLL
Sbjct: 507 PEEMTGRSLL 516



>gi|268568084|ref|XP_002640154.1| Hypothetical protein CBG12654 [Caenorhabditis briggsae]
          Length = 538

 Score =  555 bits (1430), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 274/488 (56%), Positives = 354/488 (72%), Gaps = 10/488 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMDKL     +  +EAHGL VGLPEGLMGNSEVGHLNIGAGRV+YQDIVRI+LAV
Sbjct: 51  NAQTPVMDKLCSG-NWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAV 109

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN +    +N+V   +RAK  NGR+H  GLVSDGGVHSHI+H+  L++  K  G+P+ Y+
Sbjct: 110 KNNQLVANENLVDACNRAKNGNGRLHLAGLVSDGGVHSHIDHMFALIKAIKELGVPELYL 169

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAID-DLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           HF+GDGRDT+P S   +L+Q    ++ D+ YGK+AT++GRYYAMDRDKRWERI +A+EA+
Sbjct: 170 HFYGDGRDTSPNSGIGFLQQTLDFLEKDVGYGKLATVVGRYYAMDRDKRWERINVAYEAM 229

Query: 180 TKGVGEKSEDP--LSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQ 236
             GVGE S++   +  +R+R++ DETDEFLKPII+  E+G ++ +DTL FFD+RADRMR+
Sbjct: 230 IGGVGENSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTLVFFDYRADRMRE 289

Query: 237 IVQTFGVPP-PPFEAKI--PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+       +K+  P N+ +  MT+YK+EFPF   FPP S +NVL+EW A+ K+S
Sbjct: 290 ISEVMGMERYKDCNSKLTHPSNVQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVS 349

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGG+E+ F+ E R L+ SPKVATYDL+PEMS            
Sbjct: 350 QFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMVEQI 409

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G  PF+M NFA PDMVGHTG Y+AA KA E TD AIG IYEA +  GY L +T+DHGN
Sbjct: 410 EAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDVAIGRIYEATQKYGYSLMVTADHGN 469

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKG--ALCDVAPTILDVIGLETPKEM 471
           AE+M+  +G  HTAHTC  VP  L+   + F +      ALCDVAPT+L ++GL  P EM
Sbjct: 470 AEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEM 529

Query: 472 TGLSLLKK 479
           TG S+++K
Sbjct: 530 TGASIVQK 537



>gi|32564249|ref|NP_871851.1| Protein F57B10.3, isoform b [Caenorhabditis elegans]
 gi|351063314|emb|CCD71472.1| Protein F57B10.3, isoform b [Caenorhabditis elegans]
          Length = 521

 Score =  555 bits (1430), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 275/488 (56%), Positives = 354/488 (72%), Gaps = 10/488 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMDKL     +  +EAHGL VGLPEGLMGNSEVGHLNIGAGRV+YQDIVRI+LAV
Sbjct: 34  NAQTPVMDKLCSG-NWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAV 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN KF   +++V   DRAK  NGR+H  GLVSDGGVHSHI+H+  L++  K  G+P+ Y+
Sbjct: 93  KNNKFVTNESLVDACDRAKNGNGRLHLAGLVSDGGVHSHIDHMFALVKAIKELGVPELYL 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLN-YGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           HF+GDGRDT+P S   +LEQ  + ++    YGK+AT++GRYYAMDRD RWERI +A+EA+
Sbjct: 153 HFYGDGRDTSPNSGVGFLEQTLEFLEKTTGYGKLATVVGRYYAMDRDNRWERINVAYEAM 212

Query: 180 TKGVGEKSEDP--LSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQ 236
             GVGE S++   +  +R+R++ DETDEFLKPII+  E+G ++ +DT+ FFD+RADRMR+
Sbjct: 213 IGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTIIFFDYRADRMRE 272

Query: 237 IVQTFGVPP-PPFEAKI--PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I    G+       +K+  P NL +  MT+YK+EFPF   FPP S +NVL+EW A+ K+S
Sbjct: 273 ISAAMGMDRYKDCNSKLAHPSNLQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVS 332

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGG+E+ F+ E R L+ SPKVATYDL+PEMS            
Sbjct: 333 QFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMIEQL 392

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G  PF+M NFA PDMVGHTG Y+AA KA E TD AIG IYEA + +GY L +T+DHGN
Sbjct: 393 EAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGN 452

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKG--ALCDVAPTILDVIGLETPKEM 471
           AE+M+  +G  HTAHTC  VP  L+   + F +      ALCDVAPT+L ++GL  P EM
Sbjct: 453 AEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEM 512

Query: 472 TGLSLLKK 479
           TG+S+++K
Sbjct: 513 TGVSIVQK 520



>gi|17507741|ref|NP_491896.1| Protein F57B10.3, isoform a [Caenorhabditis elegans]
 gi|46577911|gb|AAT01444.1| cofactor-independent phosphoglycerate mutase [Caenorhabditis
           elegans]
 gi|351063313|emb|CCD71471.1| Protein F57B10.3, isoform a [Caenorhabditis elegans]
          Length = 539

 Score =  555 bits (1429), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 275/488 (56%), Positives = 354/488 (72%), Gaps = 10/488 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMDKL     +  +EAHGL VGLPEGLMGNSEVGHLNIGAGRV+YQDIVRI+LAV
Sbjct: 52  NAQTPVMDKLCSG-NWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAV 110

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN KF   +++V   DRAK  NGR+H  GLVSDGGVHSHI+H+  L++  K  G+P+ Y+
Sbjct: 111 KNNKFVTNESLVDACDRAKNGNGRLHLAGLVSDGGVHSHIDHMFALVKAIKELGVPELYL 170

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLN-YGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           HF+GDGRDT+P S   +LEQ  + ++    YGK+AT++GRYYAMDRD RWERI +A+EA+
Sbjct: 171 HFYGDGRDTSPNSGVGFLEQTLEFLEKTTGYGKLATVVGRYYAMDRDNRWERINVAYEAM 230

Query: 180 TKGVGEKSEDP--LSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQ 236
             GVGE S++   +  +R+R++ DETDEFLKPII+  E+G ++ +DT+ FFD+RADRMR+
Sbjct: 231 IGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTIIFFDYRADRMRE 290

Query: 237 IVQTFGVPP-PPFEAKI--PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I    G+       +K+  P NL +  MT+YK+EFPF   FPP S +NVL+EW A+ K+S
Sbjct: 291 ISAAMGMDRYKDCNSKLAHPSNLQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVS 350

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGG+E+ F+ E R L+ SPKVATYDL+PEMS            
Sbjct: 351 QFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMIEQL 410

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G  PF+M NFA PDMVGHTG Y+AA KA E TD AIG IYEA + +GY L +T+DHGN
Sbjct: 411 EAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGN 470

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKG--ALCDVAPTILDVIGLETPKEM 471
           AE+M+  +G  HTAHTC  VP  L+   + F +      ALCDVAPT+L ++GL  P EM
Sbjct: 471 AEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEM 530

Query: 472 TGLSLLKK 479
           TG+S+++K
Sbjct: 531 TGVSIVQK 538



>gi|160369917|gb|ABX38807.1| independent phosphoglycerate mutase isoform 1 [Wuchereria
           bancrofti]
          Length = 515

 Score =  555 bits (1429), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 278/487 (57%), Positives = 351/487 (72%), Gaps = 13/487 (2%)

Query: 1   NAETPVMDKL--KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDL 58
           NA+TP MD+L     +P   ++AHGL VGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI+L
Sbjct: 29  NAKTPEMDELCAMNSHP---IQAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINL 85

Query: 59  AVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKA 118
           AVKNK   E  ++ +  +RA + NGR+H  GLVSDGGVHSHI+HL  L+ + K   +PK 
Sbjct: 86  AVKNKTLVENKHLKEAAERAIKGNGRMHLCGLVSDGGVHSHIDHLFALITSLKQLKVPKL 145

Query: 119 YVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           Y+ FFGDGRDT+P S   +L+QL   ++   YG+I+TI+GRYYAMDRDKRWERI++ ++A
Sbjct: 146 YIQFFGDGRDTSPTSGVGFLQQLIDFVNKEQYGEISTIVGRYYAMDRDKRWERIRVCYDA 205

Query: 179 LTKGVGEKS--EDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQ 236
           L  GVGEK+  +  +  I+ R++KDETDEFLKPII+ +EG  K+ DTL FFD+RADRMR+
Sbjct: 206 LIGGVGEKATVDKAIDVIKGRYAKDETDEFLKPIILSDEGRTKDGDTLIFFDYRADRMRE 265

Query: 237 IVQTFGVPPPP---FEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+        + K P+N+ +  MT+YK+EF FP  FPP+S +NVL+EW + + ++
Sbjct: 266 ITECMGMERYKDLNSDIKHPKNMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVNGLT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGGVE+ F  E R L+ SPKVATYDL+P MS            
Sbjct: 326 QFHCAETEKYAHVTFFFNGGVEKQFANEERCLVVSPKVATYDLEPPMSSAAVADKVIEQL 385

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
              K PFVM NFA PDMVGHTG Y+AA KA+E TD AIG IYEACK N YIL +T+DHGN
Sbjct: 386 HIKKHPFVMCNFAPPDMVGHTGVYEAAVKAVEATDIAIGRIYEACKKNDYILMVTADHGN 445

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAEST---KGALCDVAPTILDVIGLETPKE 470
           AE+M   +G+ HTAHTCN VPF  +S KY F +     + ALCDVAPT+L V+G+  P E
Sbjct: 446 AEKMMAPDGSKHTAHTCNLVPFTCSSVKYKFMDKLPDREMALCDVAPTVLKVMGVPLPSE 505

Query: 471 MTGLSLL 477
           MTG  L+
Sbjct: 506 MTGQPLV 512



>gi|309360191|emb|CAP31601.2| Protein CBG12654 [Caenorhabditis briggsae]
          Length = 521

 Score =  555 bits (1429), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 274/488 (56%), Positives = 354/488 (72%), Gaps = 10/488 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMDKL     +  +EAHGL VGLPEGLMGNSEVGHLNIGAGRV+YQDIVRI+LAV
Sbjct: 34  NAQTPVMDKLCSG-NWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAV 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN +    +N+V   +RAK  NGR+H  GLVSDGGVHSHI+H+  L++  K  G+P+ Y+
Sbjct: 93  KNNQLVANENLVDACNRAKNGNGRLHLAGLVSDGGVHSHIDHMFALIKAIKELGVPELYL 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAID-DLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           HF+GDGRDT+P S   +L+Q    ++ D+ YGK+AT++GRYYAMDRDKRWERI +A+EA+
Sbjct: 153 HFYGDGRDTSPNSGIGFLQQTLDFLEKDVGYGKLATVVGRYYAMDRDKRWERINVAYEAM 212

Query: 180 TKGVGEKSEDP--LSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQ 236
             GVGE S++   +  +R+R++ DETDEFLKPII+  E+G ++ +DTL FFD+RADRMR+
Sbjct: 213 IGGVGENSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTLVFFDYRADRMRE 272

Query: 237 IVQTFGVPP-PPFEAKI--PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+       +K+  P N+ +  MT+YK+EFPF   FPP S +NVL+EW A+ K+S
Sbjct: 273 ISEVMGMERYKDCNSKLTHPSNVQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVS 332

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGG+E+ F+ E R L+ SPKVATYDL+PEMS            
Sbjct: 333 QFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMVEQI 392

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G  PF+M NFA PDMVGHTG Y+AA KA E TD AIG IYEA +  GY L +T+DHGN
Sbjct: 393 EAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDVAIGRIYEATQKYGYSLMVTADHGN 452

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKG--ALCDVAPTILDVIGLETPKEM 471
           AE+M+  +G  HTAHTC  VP  L+   + F +      ALCDVAPT+L ++GL  P EM
Sbjct: 453 AEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEM 512

Query: 472 TGLSLLKK 479
           TG S+++K
Sbjct: 513 TGASIVQK 520



>gi|327494424|gb|AEA91534.1| 2,3-diphosphoglycerate-independent phosphoglycerate mutase
           [Dirofilaria immitis]
          Length = 515

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 278/483 (57%), Positives = 347/483 (71%), Gaps = 13/483 (2%)

Query: 1   NAETPVMDKLK--REYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDL 58
           NA+TP+MD+L     +P   +EAHGL VGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI+L
Sbjct: 29  NAKTPIMDELCALNSHP---IEAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINL 85

Query: 59  AVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKA 118
           AVKNK   E  ++ +  +RA + NGRIH  GLVSDGGVHSHI+HL  L+   K   +P+ 
Sbjct: 86  AVKNKTLVENKHLKEAAERAIKGNGRIHLCGLVSDGGVHSHIDHLFALVTALKQLKVPQL 145

Query: 119 YVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           ++HFFGDGRDT+P S   +LEQL   ++   YG IATI+GRYYAMDRDKRWERI++ ++A
Sbjct: 146 FIHFFGDGRDTSPTSGVGFLEQLIDFVNKEQYGVIATIVGRYYAMDRDKRWERIRVCYDA 205

Query: 179 LTKGVGEKS--EDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQ 236
           L  GVGEK+  +  +  I+ R++KDETDEFLKPII+ +EG  K+ DTL FFD+RADRMR+
Sbjct: 206 LIAGVGEKATIDKAVDVIKSRYAKDETDEFLKPIILSDEGRTKDGDTLIFFDYRADRMRE 265

Query: 237 IVQTFGV---PPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+        + K P+N+ +  MT+YK+EF FP  FPP+S +NVL+EW + + ++
Sbjct: 266 ITECMGMERYKDLKSDIKHPKNMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVNGVT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGGVE+ F+ E R L+ SPKVATYDL P MS            
Sbjct: 326 QFHCAETEKYAHVTFFFNGGVEKQFENEERCLVASPKVATYDLDPPMSSAGVADKMIEQL 385

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
                 FVM NFA PDMVGHTG Y+AA KA+E TD AIG IYEACK N YIL +T+DHGN
Sbjct: 386 DRKAHAFVMCNFAPPDMVGHTGVYEAAVKAVEATDIAIGRIYEACKKNDYILMVTADHGN 445

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAEST---KGALCDVAPTILDVIGLETPKE 470
           AE+M   +G+ HTAHTCN VPF  +S K+ F +     + ALCDVAPT+L V+GL  P E
Sbjct: 446 AEKMMAPDGSKHTAHTCNLVPFTCSSMKFKFMDKLPDREMALCDVAPTVLKVMGLPLPPE 505

Query: 471 MTG 473
           MTG
Sbjct: 506 MTG 508



>gi|361128751|gb|EHL00678.1| putative 2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase [Glarea lozoyensis 74030]
 gi|512198137|gb|EPE26972.1| 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase,
           substrate-binding [Glarea lozoyensis ATCC 20868]
          Length = 520

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 278/488 (56%), Positives = 347/488 (71%), Gaps = 10/488 (2%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD   K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 32  AETPVMDAFAKNADGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 91

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN + N+ + I+K F+ AK  NGR+H  GL+SDGGVH+  +HL  LL+ AK  G+PK ++
Sbjct: 92  KNNELNKNEVIMKVFNDAKSGNGRLHLCGLISDGGVHAKQDHLYALLKLAKEVGVPKVFI 151

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y++ L   I  +  G+IA++ GRYYAMDRDKRWER+++   AL 
Sbjct: 152 HFFGDGRDTDPKSGAGYMQGLLDQIKQIGIGEIASVTGRYYAMDRDKRWERVEVGLNALC 211

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE+S DP+ TI+ER+ K E DEFLKPII+  +E  I E D +FFF++R+DR+R+I Q
Sbjct: 212 IGDGEESSDPVKTIKERYEKGENDEFLKPIIIGGKEARISEGDQVFFFNYRSDRVREITQ 271

Query: 240 TFG-VPPPPFEA-KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
             G     P E    P+N+ +T MT+YK ++PFP+AF PQ M NVL+E   +  + Q HV
Sbjct: 272 LLGDADRSPLEDFAYPKNITLTTMTQYKLDYPFPIAFKPQHMGNVLAETLGEQGVEQVHV 331

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXXXX 352
           AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS           
Sbjct: 332 AETEKYAHVTFFFNGGVEKSFPLETRDESQDLVPSNKSVATYDLAPEMSAMGVAKQVSKR 391

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
              GKFPFVMNNFA PDMVGHTG Y+AA   +  TDK IG IYE CK  GY+LFITSDHG
Sbjct: 392 IAEGKFPFVMNNFAPPDMVGHTGVYEAAIVGVATTDKGIGEIYETCKKEGYLLFITSDHG 451

Query: 413 NAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKEM 471
           NAE+M+ E+G P T+HT N VPF++A+    ++ + T G L DVAPTIL+ +GL+ P+EM
Sbjct: 452 NAEEMKFEDGKPKTSHTTNKVPFVMANAPKGWSLKKTDGVLGDVAPTILEAMGLKQPEEM 511

Query: 472 TGLSLLKK 479
           TG SLL K
Sbjct: 512 TGKSLLVK 519



>gi|341882822|gb|EGT38757.1| hypothetical protein CAEBREN_04340 [Caenorhabditis brenneri]
          Length = 521

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 273/488 (55%), Positives = 355/488 (72%), Gaps = 10/488 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMDKL     +  +EAHGL VGLPEGLMGNSEVGHLNIGAGRV+YQDIVRI+LAV
Sbjct: 34  NAQTPVMDKLCSG-NWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAV 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN +    +N+V   +RAK  NGR+H  GLVSDGGVHSHI+H+  L++  K  G+P+ Y+
Sbjct: 93  KNNQLVNNENLVDACNRAKNGNGRLHLAGLVSDGGVHSHIDHMFALIKAIKELGVPELYL 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDD-LNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           HF+GDGRDT+P S   +L+Q    ++  + YGK+AT++GRYYAMDRDKRWERI +A+EA+
Sbjct: 153 HFYGDGRDTSPNSGIGFLQQTLDFLEKTVGYGKLATVVGRYYAMDRDKRWERINVAYEAM 212

Query: 180 TKGVGEKSEDP--LSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQ 236
             GVGE S++   +  +R+R++ DETDEFLKPII+  E+G ++ +DTL FFD+RADRMR+
Sbjct: 213 IGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTLVFFDYRADRMRE 272

Query: 237 IVQTFGVPP-PPFEAKI--PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+       +K+  P N+ +  MT+YK+EFPF   FPP S +NVL+EW A+ K+S
Sbjct: 273 ISEVMGMERYKDCNSKLSHPSNVQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVS 332

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGG+E+ F+ E R L+ SPKVATYDL+PEMS            
Sbjct: 333 QFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMVEQI 392

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G  PF+M NFA PDMVGHTG Y+AA KA E TD AIG IYEA + +GY L +T+DHGN
Sbjct: 393 EAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGN 452

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKG--ALCDVAPTILDVIGLETPKEM 471
           AE+M+  +G  HTAHTC  VP  L+   + F +      ALCDVAPT+L ++GL  P EM
Sbjct: 453 AEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEM 512

Query: 472 TGLSLLKK 479
           TG+S+++K
Sbjct: 513 TGVSIVQK 520



>gi|341885151|gb|EGT41086.1| hypothetical protein CAEBREN_09913 [Caenorhabditis brenneri]
          Length = 521

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 273/488 (55%), Positives = 354/488 (72%), Gaps = 10/488 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMDKL     +  +EAHGL VGLPEGLMGNSEVGHLNIGAGRV+YQDIVRI+LAV
Sbjct: 34  NAQTPVMDKLCSG-NWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAV 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN +    +N+V   +RAK  NGR+H  GLVSDGGVHSHI+H+  L+   K  G+P+ Y+
Sbjct: 93  KNNQLVNNENLVDACNRAKNGNGRLHLAGLVSDGGVHSHIDHMFALINAIKELGVPELYL 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDD-LNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           HF+GDGRDT+P S   +L+Q    ++  + YGK+AT++GRYYAMDRDKRWERI +A+EA+
Sbjct: 153 HFYGDGRDTSPNSGIGFLQQTLDFLEKTVGYGKLATVVGRYYAMDRDKRWERINVAYEAM 212

Query: 180 TKGVGEKSEDP--LSTIRERFSKDETDEFLKPIIVD-EEGIIKENDTLFFFDFRADRMRQ 236
             GVGE S++   +  +R+R++ DETDEFLKPII+  E+G ++ +DTL FFD+RADRMR+
Sbjct: 213 IGGVGETSDEAGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTLVFFDYRADRMRE 272

Query: 237 IVQTFGVPP-PPFEAKI--PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+       +K+  P N+ +  MT+YK+EFPF   FPP S +NVL+EW A+ K+S
Sbjct: 273 ISEVMGMERYKDCNSKLSHPSNVQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVS 332

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGG+E+ F+ E R L+ SPKVATYDL+PEMS            
Sbjct: 333 QFHCAETEKYAHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMVEQI 392

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G  PF+M NFA PDMVGHTG Y+AA KA E TD AIG IYEA + +GY L +T+DHGN
Sbjct: 393 EAGTHPFIMCNFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGN 452

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKG--ALCDVAPTILDVIGLETPKEM 471
           AE+M+  +G  HTAHTC  VP  L+   + F +      ALCDVAPT+L ++GL  P EM
Sbjct: 453 AEKMKAPDGGKHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEM 512

Query: 472 TGLSLLKK 479
           TG+S+++K
Sbjct: 513 TGVSIVQK 520



>gi|347841204|emb|CCD55776.1| similar to phosphoglycerate mutase [Botryotinia fuckeliana T4]
          Length = 533

 Score =  552 bits (1422), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 275/492 (55%), Positives = 350/492 (71%), Gaps = 15/492 (3%)

Query: 1   NAETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NAETPVMD        YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAETPVMDAFANNADGYTKLEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  + N+ + ++K F+ AK+ NGR+H  GL+SDGGVH+  +HL  LL+ AK   IP  Y
Sbjct: 92  IKKGELNKNEVVMKAFNAAKDGNGRLHLCGLISDGGVHAKQDHLYALLKVAKELEIPHVY 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+E L + I ++  G++AT++GR+YAMDRDKRW+R+++A   L
Sbjct: 152 IHFFGDGRDTDPKSGAGYMEALLEKIKEIGIGEVATVVGRFYAMDRDKRWDRVEVALSGL 211

Query: 180 TKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIV 238
             G GE+S DP+ TI+ER+   E DEFLKPII+  +E  I++ND +FFF++R+DR+R+I 
Sbjct: 212 CNGEGEESSDPVKTIKERYENGENDEFLKPIILGGKEARIQDNDQVFFFNYRSDRVREIT 271

Query: 239 QTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           Q  G     P P F    P+N+ +T MT+YK ++PF +AF PQ M NVL+E      ++Q
Sbjct: 272 QLLGDVDRSPKPDF--AYPKNITLTTMTQYKLDYPFEIAFKPQHMGNVLAETLGAQGVNQ 329

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXX 349
            HVAETEK+AHVTFFFNGGVE+ F LEVR    DL+ S K VATYD  PEMS        
Sbjct: 330 VHVAETEKYAHVTFFFNGGVEKVFPLEVRDESQDLVPSNKSVATYDKAPEMSAAGVAKQM 389

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
                 GKF FVMNNFA PDMVGHTG Y+AA   +  TDKAIG IYE CK  GY+LFITS
Sbjct: 390 SKRISEGKFEFVMNNFAPPDMVGHTGVYEAAVIGVAATDKAIGEIYETCKKEGYVLFITS 449

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIGLET 467
           DHGNAE+M+  +G P T+HT N VPFI+A+    +S  ++ +G L DVAPTIL+V+GL+ 
Sbjct: 450 DHGNAEEMKFADGKPKTSHTTNKVPFIMANAPQGWSLKQTDEGVLGDVAPTILEVMGLKQ 509

Query: 468 PKEMTGLSLLKK 479
           P+EMTG SLL K
Sbjct: 510 PEEMTGSSLLVK 521



>gi|472237248|gb|EMR82153.1| putative -bisphosphoglycerate-independent phosphoglycerate mutase
           protein [Botryotinia fuckeliana BcDW1]
          Length = 522

 Score =  551 bits (1421), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 275/492 (55%), Positives = 350/492 (71%), Gaps = 15/492 (3%)

Query: 1   NAETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NAETPVMD        YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAETPVMDAFANNADGYTKLEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  + N+ + ++K F+ AK+ NGR+H  GL+SDGGVH+  +HL  LL+ AK   IP  Y
Sbjct: 92  IKKGELNKNEVVMKAFNAAKDGNGRLHLCGLISDGGVHAKQDHLYALLKVAKELEIPHVY 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+E L + I ++  G++AT++GR+YAMDRDKRW+R+++A   L
Sbjct: 152 IHFFGDGRDTDPKSGAGYMEALLEKIKEIGIGEVATVVGRFYAMDRDKRWDRVEVALSGL 211

Query: 180 TKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIV 238
             G GE+S DP+ TI+ER+   E DEFLKPII+  +E  I++ND +FFF++R+DR+R+I 
Sbjct: 212 CNGEGEESSDPVKTIKERYENGENDEFLKPIILGGKEARIQDNDQVFFFNYRSDRVREIT 271

Query: 239 QTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           Q  G     P P F    P+N+ +T MT+YK ++PF +AF PQ M NVL+E      ++Q
Sbjct: 272 QLLGDVDRSPKPDF--AYPKNITLTTMTQYKLDYPFEIAFKPQHMGNVLAETLGAQGVNQ 329

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXX 349
            HVAETEK+AHVTFFFNGGVE+ F LEVR    DL+ S K VATYD  PEMS        
Sbjct: 330 VHVAETEKYAHVTFFFNGGVEKVFPLEVRDESQDLVPSNKSVATYDKAPEMSAAGVAKQM 389

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
                 GKF FVMNNFA PDMVGHTG Y+AA   +  TDKAIG IYE CK  GY+LFITS
Sbjct: 390 SKRISEGKFEFVMNNFAPPDMVGHTGVYEAAVIGVAATDKAIGEIYETCKKEGYVLFITS 449

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIGLET 467
           DHGNAE+M+  +G P T+HT N VPFI+A+    +S  ++ +G L DVAPTIL+V+GL+ 
Sbjct: 450 DHGNAEEMKFADGKPKTSHTTNKVPFIMANAPQGWSLKQTDEGVLGDVAPTILEVMGLKQ 509

Query: 468 PKEMTGLSLLKK 479
           P+EMTG SLL K
Sbjct: 510 PEEMTGSSLLVK 521



>gi|54303719|gb|AAV33247.1| independent phosphoglycerate mutase [Onchocerca volvulus]
          Length = 515

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 275/483 (56%), Positives = 347/483 (71%), Gaps = 13/483 (2%)

Query: 1   NAETPVMDKLK--REYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDL 58
           NA+TPVMD+L     +P   +EAHGL VGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI+L
Sbjct: 29  NAKTPVMDELCALNSHP---IEAHGLHVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRINL 85

Query: 59  AVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKA 118
           AVKNK   E  ++ +  +RA + NGRIH  GLVSDGGVHSHI+HL  L+   K   +P+ 
Sbjct: 86  AVKNKTLVENKHLKEAAERAIKGNGRIHLCGLVSDGGVHSHIDHLFALITALKQLKVPQL 145

Query: 119 YVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           Y+HFFGDGRDT+P S   +L+QL   ++   YG+IATI+GRYYAMDRDKRWERI++ ++A
Sbjct: 146 YIHFFGDGRDTSPTSGVGFLQQLIDFVNKEQYGEIATIVGRYYAMDRDKRWERIRVCYDA 205

Query: 179 LTKGVGEKS--EDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQ 236
           L  GVGEK+  +  +  I+ R++KDETDEFLKPII+ ++G  K+ DTL FFD+RADRMR+
Sbjct: 206 LIAGVGEKTTIDKAIDVIKGRYAKDETDEFLKPIILSDKGRTKDGDTLIFFDYRADRMRE 265

Query: 237 IVQTFGV---PPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +  G+        + K P+++ +  MT+YK+EF FP  FPP+S +NVL+EW +   ++
Sbjct: 266 ITECMGMERYKDLKSDIKHPKDMQVIGMTQYKAEFTFPALFPPESHKNVLAEWLSVKGLT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGGVE+ F+ E R L+ SPKVATYDL+P MS            
Sbjct: 326 QFHCAETEKYAHVTFFFNGGVEKQFENEERCLVPSPKVATYDLEPAMSSAGVADKMIEQL 385

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
                 F+M NFA PDMVGHTG Y+AA KA+E TD AIG IYEACK N Y+L +T+DHGN
Sbjct: 386 NRKAHAFIMCNFAPPDMVGHTGVYEAAVKAVEATDIAIGRIYEACKKNDYVLMVTADHGN 445

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAEST---KGALCDVAPTILDVIGLETPKE 470
           AE+M   +G  HTAHTCN VPF  +S K+ F +     + ALCDVAPT+L V+GL  P E
Sbjct: 446 AEKMIAPDGGKHTAHTCNLVPFTCSSLKFKFMDKLPDREMALCDVAPTVLKVLGLPLPSE 505

Query: 471 MTG 473
           MTG
Sbjct: 506 MTG 508



>gi|156042436|ref|XP_001587775.1| hypothetical protein SS1G_11015 [Sclerotinia sclerotiorum 1980]
 gi|154695402|gb|EDN95140.1| hypothetical protein SS1G_11015 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 522

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 278/492 (56%), Positives = 348/492 (70%), Gaps = 15/492 (3%)

Query: 1   NAETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NAETPVMD        YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAETPVMDAFANNADGYTKLEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  + N+ + + K F  AK+ NGR+H  GL+SDGGVH+  +HL  LL+ AK   IP  Y
Sbjct: 92  IKKGELNKNEVVFKAFKAAKDGNGRLHLCGLISDGGVHAKQDHLYALLKVAKELEIPHVY 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+E L + I ++  G+IAT++GRYYAMDRDKRW+R+++A   L
Sbjct: 152 IHFFGDGRDTDPKSGAGYMEALLEKIKEIGIGEIATVVGRYYAMDRDKRWDRVEVALNGL 211

Query: 180 TKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIV 238
             G GE+S DP+ TI+ER+ K E DEFLKPIIV  +E  I++ND +FFF++R+DR+R+I 
Sbjct: 212 CIGEGEESSDPVKTIKERYEKGENDEFLKPIIVGGKEARIQDNDQVFFFNYRSDRVREIT 271

Query: 239 QTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              G     P P F    P+N+ +T MT+YK ++PF +AF PQ M NVL+E      ++Q
Sbjct: 272 LLLGDVDRSPKPDF--AYPKNITLTTMTQYKLDYPFEIAFKPQHMGNVLAETLGAQGVNQ 329

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXX 349
            HVAETEK+AHVTFFFNGGVE+ F LEVR    DL+ S K VATYD  PEMS        
Sbjct: 330 VHVAETEKYAHVTFFFNGGVEKVFPLEVRDESQDLVPSNKSVATYDQAPEMSAAGVAKQT 389

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
                 GKF FVMNNFA PDMVGHTG Y+AA   +  TDKAIG IYE CK  GY+LFITS
Sbjct: 390 SKRISEGKFEFVMNNFAPPDMVGHTGVYEAAVIGVAATDKAIGEIYETCKKEGYVLFITS 449

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIGLET 467
           DHGNAE+M+  +G P T+HT N VPFI+A+    +S  ++ +G L DVAPTIL+V+GL+ 
Sbjct: 450 DHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPQGWSLKQTDEGVLGDVAPTILEVMGLKQ 509

Query: 468 PKEMTGLSLLKK 479
           P+EMTG SLL K
Sbjct: 510 PEEMTGTSLLVK 521



>gi|340966619|gb|EGS22126.1| phosphoglycerate mutase-like protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 519

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 278/490 (56%), Positives = 345/490 (70%), Gaps = 15/490 (3%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           A TPVMD+  K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID ++
Sbjct: 32  ANTPVMDEFSKSATGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSI 91

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F+  D I +  + AK  NGR+H  GLVS GGVHS   HL  LL  AK +G+P  Y+
Sbjct: 92  KKGEFSSNDVIKQVMESAKSGNGRLHLCGLVSHGGVHSKQTHLYALLRAAKEYGVPNVYI 151

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+E+L   I ++  G+IAT++GRYYAMDRDKRWERI+IA   + 
Sbjct: 152 HFFGDGRDTDPKSGAGYMEELLATIQEIGVGEIATVVGRYYAMDRDKRWERIEIAMRGMI 211

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE S+DP+ T+ ER+ + ETDEFLKPIIV  +E  IK+ D +FFF++R+DR+RQI Q
Sbjct: 212 LGEGEASQDPVKTVNERYEQGETDEFLKPIIVGGDERRIKDGDNVFFFNYRSDRVRQITQ 271

Query: 240 TFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
             G     P P F       +++  MT+YK+E+PF +AF PQ M+NVL+EW  K  + Q 
Sbjct: 272 LLGDVDRSPRPDFPYP---KINLVTMTQYKAEYPFEVAFKPQVMDNVLAEWLGKQGVEQV 328

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXX 350
           HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K V TYD  PEMS         
Sbjct: 329 HVAETEKYAHVTFFFNGGVEKVFPLETRDQSQDLVPSNKSVPTYDKAPEMSADGVAKQVC 388

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                G+FPFVMNNFA PDMVGHTG Y+AA   +E TDKAIG IYEACK +GYILFIT+D
Sbjct: 389 KRLGEGRFPFVMNNFAPPDMVGHTGVYEAAILGVEATDKAIGKIYEACKEHGYILFITAD 448

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M+  +G+P T+HT N VPFI+A+    ++ +   G L DVAPT+L+ +GL  P 
Sbjct: 449 HGNAEEMKFPDGSPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTVLEAMGLPVPA 508

Query: 470 EMTGLSLLKK 479
           EMTG SLL K
Sbjct: 509 EMTGKSLLVK 518



>gi|367031902|ref|XP_003665234.1| hypothetical protein MYCTH_2315941 [Myceliophthora thermophila ATCC
           42464]
 gi|347012505|gb|AEO59989.1| hypothetical protein MYCTH_2315941 [Myceliophthora thermophila ATCC
           42464]
          Length = 519

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 277/490 (56%), Positives = 345/490 (70%), Gaps = 15/490 (3%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+  K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID +V
Sbjct: 32  AETPVMDEFSKSATGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSV 91

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F+  D + K  + +K TNGR+H  GLVS GGVHS   HL  LL  AK  G+PK ++
Sbjct: 92  KKGEFSSNDVVKKVLEASKNTNGRLHLCGLVSHGGVHSKQTHLYALLRAAKEVGVPKVFI 151

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+E+L   I+++  G+IAT++GRYYAMDRDKRWER ++A + + 
Sbjct: 152 HFFGDGRDTDPKSGAGYMEELLSTINEIGTGQIATVVGRYYAMDRDKRWERNEVALQGMV 211

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE+S+DP+ T+RER+ K ETDEFLKPIIV  +E  IK+ D +FFF++R+DR+RQI Q
Sbjct: 212 LGEGEQSDDPVKTVRERYEKGETDEFLKPIIVGGDEARIKDGDNVFFFNYRSDRVRQITQ 271

Query: 240 TFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
             G     P P F       +++  MT+YK ++PF +AF PQ M NVL+EW  K  + Q 
Sbjct: 272 LLGDVDRSPLPDFPYP---KVNLVTMTQYKLDYPFEIAFKPQHMGNVLAEWLGKQGVEQV 328

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXX 350
           HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K V TYD  PEMS         
Sbjct: 329 HVAETEKYAHVTFFFNGGVEKVFPLETRDESQDLVPSNKSVPTYDKAPEMSADGVAEQVC 388

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                G+FPFVMNNFA PDMVGHTG Y+AA      TDKAIG IYE+CK NGYILFIT+D
Sbjct: 389 KRLSEGRFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKIYESCKKNGYILFITAD 448

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +GL  P+
Sbjct: 449 HGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTVLTAMGLPVPE 508

Query: 470 EMTGLSLLKK 479
           EMTG +LL K
Sbjct: 509 EMTGTNLLVK 518



>gi|440640357|gb|ELR10276.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Geomyces destructans 20631-21]
          Length = 522

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 273/492 (55%), Positives = 350/492 (71%), Gaps = 15/492 (3%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA TPVMD L K    +  LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NANTPVMDDLYKYADGFIGLEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           ++N + ++ + I+K F  AK   GR+H  GL+SDGGVH+  +HL  LL+ AK  GIP   
Sbjct: 92  IRNNELDKNEIIMKTFQNAKNGTGRLHLCGLISDGGVHAKQDHLYALLKVAKEVGIPHVC 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y++QL     ++  G+IAT++GRYYAMDRDKRW+R+++A + +
Sbjct: 152 IHFFGDGRDTDPKSGAGYMQQLVDKTKEIGIGEIATVVGRYYAMDRDKRWDRVEVALKGM 211

Query: 180 TKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIV 238
             G GE S DP++T++ER+SKDE DEFLKPIIV  +E  I++ND +FFF++R+DR+R+I 
Sbjct: 212 VLGEGEDSSDPVATVKERYSKDENDEFLKPIIVGGKERRIQDNDEVFFFNYRSDRVREIT 271

Query: 239 QTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           Q  G     P P F    P+N+ +T MT+YK ++PF +AF PQ M NVL+E  A   + Q
Sbjct: 272 QLLGDVDRSPKPDF--AYPKNIRLTTMTQYKLDYPFTIAFKPQHMGNVLAETLAAQGVKQ 329

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXX 349
            H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS        
Sbjct: 330 VHIAETEKYAHVTFFFNGGVEKVFPLEERDESQDLVPSNKAVATYDLAPEMSAAGVAKQV 389

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
               +  ++PF+MNNFA PDMVGHTG Y+AA K +E TDKAIG IYE CK   Y+LFITS
Sbjct: 390 SKRIQEQEYPFIMNNFAPPDMVGHTGVYEAALKGVEATDKAIGEIYETCKKENYVLFITS 449

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIGLET 467
           DHGNAE+M+  +G P T+HT N VPFI+A+    +S   +  G L DV+PTIL+V+GL  
Sbjct: 450 DHGNAEEMKFADGKPKTSHTTNKVPFIMANAPKGWSLKATEDGVLGDVSPTILEVMGLSQ 509

Query: 468 PKEMTGLSLLKK 479
           P+EMTG SLL K
Sbjct: 510 PEEMTGHSLLVK 521



>gi|391336466|ref|XP_003742601.1| PREDICTED: 2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase-like [Metaseiulus occidentalis]
          Length = 513

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 265/489 (54%), Positives = 343/489 (70%), Gaps = 10/489 (2%)

Query: 1   NAETPVMDKLKREYP--YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDL 58
           NA  PVM    +  P  Y TL+A GLAVGLP+G+MGNSEVGHLNIGAGRV++QDIVRI+ 
Sbjct: 25  NATAPVMSGFAKAGPENYLTLDASGLAVGLPDGMMGNSEVGHLNIGAGRVLFQDIVRINK 84

Query: 59  AVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKA 118
            V  K+ +E     +  +RAK  NGR+H +GLVSDGGVH+HI+HL  LL+ A+  G+P  
Sbjct: 85  DVSAKRMHENKYFAEACNRAKGKNGRLHLMGLVSDGGVHAHIDHLFALLDGAQKLGVPNV 144

Query: 119 YVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           YVHFFGDGRDT P S+  Y++Q+   +    +GK+++I+GRYYAMDRDKRWERI+IAFE 
Sbjct: 145 YVHFFGDGRDTRPTSATTYIKQVIDRLASTGFGKLSSIVGRYYAMDRDKRWERIQIAFEG 204

Query: 179 LTKGVGEKS--EDPLSTIRERF-----SKDETDEFLKPIIVDEEGIIKENDTLFFFDFRA 231
           L +G GEK+  E+ +S +  R+     S+ +TDEFLKPII++EEG+IK+ DT+ FF++R+
Sbjct: 205 LVQGKGEKTSLENVISLVEGRYNAADVSQKQTDEFLKPIIINEEGLIKDGDTVVFFNYRS 264

Query: 232 DRMRQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           DR RQ+ Q  G  PP   + IP+++ +  MT+YK EF F + +PP    NVL+EW AK  
Sbjct: 265 DRARQLSQALGEKPPFETSVIPKDIELFTMTQYKKEFNFKMLYPPVVPSNVLAEWLAKKS 324

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + Q H AETEK+AHVTFFFNGG E+ F+ E R ++ SPKVATYDL+PEM+          
Sbjct: 325 VKQFHCAETEKYAHVTFFFNGGQEKNFEGEERCMVPSPKVATYDLQPEMNCQGVADELCK 384

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
              SG + F M NFA PDMVGHTGKYDAA  A   TDKAIG + E CK N  +L +T+DH
Sbjct: 385 AIESGTYAFTMCNFAPPDMVGHTGKYDAAVIACTATDKAIGQVAECCKKNNVVLLVTADH 444

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAEST-KGALCDVAPTILDVIGLETPKE 470
           GNAE M DE GNP T HT N VPF++      FA+ T   ALCDVAPT+LD++  E P++
Sbjct: 445 GNAELMMDEAGNPITQHTTNRVPFVMQGGSRKFAKPTHNAALCDVAPTVLDLLNFEKPED 504

Query: 471 MTGLSLLKK 479
           M G+SLL+K
Sbjct: 505 MGGVSLLQK 513



>gi|429850774|gb|ELA26014.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Colletotrichum gloeosporioides Nara gc5]
          Length = 598

 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 274/496 (55%), Positives = 350/496 (70%), Gaps = 21/496 (4%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA TPVMD   K    Y  L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 106 NANTPVMDDFAKSSTGYCELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 165

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +KN +  +   I K F+ AK  NGR+H  GLVS GGVHS   HL +LL+ AK +G+P+ Y
Sbjct: 166 IKNGQLPDNAVIKKTFESAKNGNGRLHLCGLVSHGGVHSKQEHLYNLLKAAKQYGVPEVY 225

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+E+L K   ++  GKIAT++GRYYAMDRDKRWER+++A + +
Sbjct: 226 IHFFGDGRDTDPKSGAGYMEELVKTAKEIGIGKIATVVGRYYAMDRDKRWERVELALKGM 285

Query: 180 TKGVGEKSEDPLSTIRERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE+S DP++T++ER+++    + DEFL PIIV  +EG IK++DT+FFF++R+DR+R
Sbjct: 286 ILGEGEESTDPVATVKERYARGGDKDKDEFLTPIIVGGQEGRIKDDDTVFFFNYRSDRVR 345

Query: 236 QIVQTFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAK 289
           QI Q  G      +P  P+    P+   +  MT+YK+++PF +AF PQ M NVL+EW  K
Sbjct: 346 QITQLLGDVDRSVLPDFPY----PKINKLVTMTQYKTDYPFEIAFEPQRMGNVLAEWLGK 401

Query: 290 HKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXX 344
            ++ Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS   
Sbjct: 402 QQVEQVHIAETEKYAHVTFFFNGGVEKVFALETRDEKQDLVPSNKSVATYDKAPEMSADG 461

Query: 345 XXXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYI 404
                       KFPFVMNNFA PDMVGHTG Y+AA   +E TDKAIG IYEACK  GYI
Sbjct: 462 VANQVAKRLGEQKFPFVMNNFAPPDMVGHTGVYEAAIVGVEATDKAIGKIYEACKKEGYI 521

Query: 405 LFITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVI 463
           LFIT+DHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +
Sbjct: 522 LFITADHGNAEEMKFADGKPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTVLAAM 581

Query: 464 GLETPKEMTGLSLLKK 479
           GL  P+EMTG +LL K
Sbjct: 582 GLPQPEEMTGANLLTK 597



>gi|196015137|ref|XP_002117426.1| hypothetical protein TRIADDRAFT_32533 [Trichoplax adhaerens]
 gi|190579955|gb|EDV20042.1| hypothetical protein TRIADDRAFT_32533 [Trichoplax adhaerens]
          Length = 513

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 264/486 (54%), Positives = 344/486 (70%), Gaps = 9/486 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMDKL++EY + TLEA GLAVGLP G+MGNSEVGH  IG+GR ++QD+V+I+L++
Sbjct: 30  NAQTPVMDKLQKEYAFHTLEASGLAVGLPAGVMGNSEVGHTTIGSGRAMFQDLVKINLSI 89

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +        ++     RAK  NGR+HFLGLVSDGGVHSHI+HL+  L  AK++G+PK+++
Sbjct: 90  QEDTLKSNKSLTDAMARAKNGNGRLHFLGLVSDGGVHSHIDHLLQFLRIAKDYGVPKSFI 149

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
            FF DGRDT+P S   +++++   I ++NYG +AT++GRYYAMDRDKR++RI+IA+E L 
Sbjct: 150 QFFSDGRDTSPTSGVTFVQKVLNYISEMNYGSLATVVGRYYAMDRDKRYDRIQIAYEGLV 209

Query: 181 KGVGEKSEDPLST--IRERF----SKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRM 234
           K VGE +     T  +  R+    S+ +TDEF+ PII D EG I   DTL F DFRADRM
Sbjct: 210 KVVGELTSPGSITEVMTNRYNAEGSQRQTDEFMTPIISDPEGRISNGDTLVFIDFRADRM 269

Query: 235 RQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           RQI + FG+ P      +P +LH+  MT+YK +FPFP+ FPP   +NV++EW +K ++SQ
Sbjct: 270 RQISEAFGMQPQFSTDVVPTDLHVATMTQYKKQFPFPVLFPPTPPDNVIAEWLSKKELSQ 329

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
            HVAETEK+AHVTFFFNGG E  F +E R ++ SPKVATYDLKPEM+             
Sbjct: 330 MHVAETEKYAHVTFFFNGGREMQFSMEDRIMVPSPKVATYDLKPEMNAEGVADEVIRAIE 389

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           SGK+PFVM NFA PDMVGHTG YDAA  A  VTD  IG I+EAC+ + Y L IT+DHGNA
Sbjct: 390 SGKYPFVMCNFAPPDMVGHTGVYDAAVIACTVTDFNIGRIFEACEKHDYALMITADHGNA 449

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMTG 473
           E+M  E G+P TAHT   VP I+   KY   + T  A L DVAPT+L ++GL+ P EM+G
Sbjct: 450 EKMVTENGSPFTAHTLYRVPLIMTRGKYK--DITHDANLSDVAPTVLRIMGLDVPPEMSG 507

Query: 474 LSLLKK 479
            SLL +
Sbjct: 508 QSLLAE 513



>gi|500259136|gb|EOO01975.1| putative -bisphosphoglycerate-independent phosphoglycerate mutase
           protein [Togninia minima UCRPA7]
          Length = 520

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 272/490 (55%), Positives = 346/490 (70%), Gaps = 15/490 (3%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           A+TPVMD+  K    +T LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 33  AKTPVMDEFSKSATGFTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           KN + ++ D I K  + AK  NGR+H  GL+S GGVHS   HL  LL+ AK  G+PK ++
Sbjct: 93  KNGELSKNDVIKKTLESAKNGNGRLHLAGLISHGGVHSKQEHLYALLKAAKEAGVPKVFI 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+++L   I ++  G++AT++GRYYAMDRDKRW+R+++A + L 
Sbjct: 153 HFFGDGRDTDPKSGAGYMQELLDTIKEIGIGQLATVVGRYYAMDRDKRWDRVELALKGLV 212

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE+S DP++T++ER+ K E DEFLKPIIV  +E  IK++DT+FFF++R+DR+RQI Q
Sbjct: 213 LGEGEESTDPVATVKERYEKGENDEFLKPIIVGGDEARIKDDDTVFFFNYRSDRVRQITQ 272

Query: 240 TFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
             G     P P F       +++  MT+YK ++PF +AF PQ M NVL+EW  K  + Q 
Sbjct: 273 LLGGVDRSPKPDFPYP---KINLVTMTQYKLDYPFEIAFKPQHMGNVLAEWLGKQNVEQV 329

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXX 350
           H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS         
Sbjct: 330 HIAETEKYAHVTFFFNGGVEKVFPLETRDEKQDLVPSNKSVATYDKAPEMSADGVANQVA 389

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KFPFVMNNFA PDMVGHTG Y+AA    E TDKAIG I+EACK  GYILFIT+D
Sbjct: 390 KRLAEHKFPFVMNNFAPPDMVGHTGVYEAAIVGCEATDKAIGKIWEACKKEGYILFITAD 449

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +GL  P+
Sbjct: 450 HGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKVGGVLGDVAPTVLAAMGLSQPE 509

Query: 470 EMTGLSLLKK 479
           EMTG SLL K
Sbjct: 510 EMTGESLLVK 519



>gi|116203495|ref|XP_001227558.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88175759|gb|EAQ83227.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 519

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 276/490 (56%), Positives = 340/490 (69%), Gaps = 15/490 (3%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+L K    +T L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  V
Sbjct: 32  AETPVMDELSKSATGFTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTV 91

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +    D I K  D AK  NGR+H  GLVS GGVH+   HL  LL  AK  G+PK ++
Sbjct: 92  KKGELGNNDVIKKVLDAAKNGNGRLHLCGLVSHGGVHAKQTHLYALLRAAKEAGVPKVFI 151

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+E+L   I ++  G+IAT++GRYYAMDRDKRWER ++A + L 
Sbjct: 152 HFFGDGRDTDPKSGAAYMEELLSTIKEIGIGQIATVVGRYYAMDRDKRWERNELALKGLV 211

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE S+DP+ T++ER+ K ETDEFLKPII+  +EG IK+ D +FFF++R+DR+RQI Q
Sbjct: 212 LGEGENSDDPVKTVKERYEKGETDEFLKPIIIGGDEGRIKDGDNVFFFNYRSDRVRQITQ 271

Query: 240 TFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
             G     P P F       +++  MT+YK ++PF +AF PQ M NVL+EW  K  + Q 
Sbjct: 272 LLGDVDRSPRPDFPYP---KINLVTMTQYKLDYPFEIAFKPQHMGNVLAEWLGKQNVEQV 328

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXX 350
           H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS         
Sbjct: 329 HIAETEKYAHVTFFFNGGVEKVFPLETRDESQDLVPSNKSVATYDLAPEMSADGVADQVC 388

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KFPFVMNNFA PDMVGHTG Y+AA      TDKAIG IYE CK +GYILFIT+D
Sbjct: 389 KRMSEQKFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKIYEGCKKDGYILFITAD 448

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M+  +G P T+HT N VPFI+A+    ++     G L DVAPTIL  +GL  P+
Sbjct: 449 HGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLRKEDGVLGDVAPTILTAMGLPVPE 508

Query: 470 EMTGLSLLKK 479
           EMTG +LL +
Sbjct: 509 EMTGSNLLTR 518



>gi|239608752|gb|EEQ85739.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ajellomyces dermatitidis ER-3]
          Length = 485

 Score =  542 bits (1397), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 259/446 (58%), Positives = 332/446 (74%), Gaps = 13/446 (2%)

Query: 5   PVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           PVM        K    YT L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRIDL 
Sbjct: 36  PVMSSFADSNSKTAQGYTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDLT 95

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           ++  + N+ +NIVK F +AK+ NGR+H LGL+SDGGVHSHINHL  LL+ AK+  +PK +
Sbjct: 96  LRKGEMNKTENIVKSFQKAKDGNGRLHLLGLISDGGVHSHINHLFGLLQVAKDMQVPKVF 155

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S+  Y++QL     +L  G++AT++GRYYAMDRDKRW+R+++A   L
Sbjct: 156 IHFFGDGRDTDPKSATGYMQQLLDKTKELGVGELATVVGRYYAMDRDKRWDRVEVAMHGL 215

Query: 180 TKGV-GEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQI 237
             G  GE+S DP+ TI+ER+ K E DEFLKPII+  +E  I++NDTLFFF++R+DR+R+I
Sbjct: 216 VTGEGGEESTDPVKTIQERYEKGENDEFLKPIIIGGKERRIQDNDTLFFFNYRSDRVREI 275

Query: 238 VQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
            Q  G     P P F    P+++ IT MT+YK+++ FP+AFPPQ M NVL+EW  K  + 
Sbjct: 276 TQLLGDVDRSPKPNF--PYPKDISITTMTQYKTDYKFPIAFPPQHMGNVLAEWLGKQGLK 333

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           QCHVAETEK+AHVTFFFNGGVE+ F  E R+LI SP+VATYDL P+MS            
Sbjct: 334 QCHVAETEKYAHVTFFFNGGVEKHFPGEERELIPSPRVATYDLDPKMSAAPVADKLAERI 393

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
              KF F+MNNFA PDMVGHTG Y+A  +A+  TDKAIG ++EACK NGYILF+T+DHGN
Sbjct: 394 GEKKFEFLMNNFAPPDMVGHTGVYEATIEAVTATDKAIGRVFEACKQNGYILFVTADHGN 453

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILAS 439
           AE+M++ EG P T+HT N VPFI+A+
Sbjct: 454 AEEMKNAEGTPKTSHTTNKVPFIMAN 479



>gi|340370710|ref|XP_003383889.1| PREDICTED: 2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase-like [Amphimedon queenslandica]
          Length = 514

 Score =  541 bits (1393), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 269/486 (55%), Positives = 343/486 (70%), Gaps = 8/486 (1%)

Query: 1   NAETPVMDKLKR-EYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NAETPVMD L++ E  + TL+A GL+VGLP+GLMGNSEVGH  IG GRV YQDIV I+L+
Sbjct: 29  NAETPVMDALEKVEGEFLTLDASGLSVGLPDGLMGNSEVGHYTIGTGRVSYQDIVAINLS 88

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           + N+       +++ F++AK  NGR+HFLGLVSDGGVHSHI+HL  LL+ AK   +PK++
Sbjct: 89  IANESIYTKPVLLEAFEKAKTGNGRVHFLGLVSDGGVHSHIDHLEALLKAAKKDNVPKSF 148

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           VHFF DGRDT+P S   Y+ +L + + +L YG +AT+ GRYYAMDRDKR+ERIKIA+E +
Sbjct: 149 VHFFSDGRDTSPTSGVTYVRRLLQYLKELGYGSLATLAGRYYAMDRDKRYERIKIAYEGM 208

Query: 180 T--KGVGEKSEDPLSTIRERFSKD----ETDEFLKPIIVDEEGIIKENDTLFFFDFRADR 233
           T  KGV  +++  ++ + ER++ D    +TDEF+KP+I+D EG IK+ DTL F DFRADR
Sbjct: 209 TQRKGVEVETDKLINLMEERYNADGDAKQTDEFMKPVILDTEGQIKDGDTLIFIDFRADR 268

Query: 234 MRQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           MRQIV+ FG+ P      IP+N+ +  MT YK EFPFP+ FPP   +N L+EW +   + 
Sbjct: 269 MRQIVEAFGIKPQFETETIPKNISVYTMTEYKKEFPFPVIFPPTVPKNSLAEWLSLKGLK 328

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGG+E+ FD E R ++ SPKV TYDLKPEMS            
Sbjct: 329 QFHCAETEKYAHVTFFFNGGLEKAFDGEERCMVPSPKVPTYDLKPEMSAEGVGEAMVEAI 388

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
           +S K+ FVM NFA PDMVGHTG+Y+ A  A   TDKAIG I  AC+  GY+L IT+DHGN
Sbjct: 389 KSDKYSFVMCNFAPPDMVGHTGQYEPAVVACAATDKAIGAIQRACEEKGYVLLITADHGN 448

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMT 472
           AE+M DEEG P T HT   VPF L  N   F   T  A L DVAPT+L ++GL+ P EMT
Sbjct: 449 AERMIDEEGKPVTKHTTFRVPFCLHGNGLKFLSPTHNASLADVAPTVLQIMGLDVPPEMT 508

Query: 473 GLSLLK 478
           G  L++
Sbjct: 509 GHKLVE 514



>gi|291235963|ref|XP_002737918.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii]
          Length = 510

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 271/491 (55%), Positives = 347/491 (70%), Gaps = 17/491 (3%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           +AETPVMDKL  E    TL A G +VGLP+GLMGNSEVGH+ IG GR++YQDIVRI+ ++
Sbjct: 25  HAETPVMDKLFEENA-VTLNASGFSVGLPDGLMGNSEVGHMTIGIGRIIYQDIVRINKSI 83

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
             K       +V   ++AK+ NGR+HFLGLVSDGGVHSHI+HL  LL+ AK  G+P+ +V
Sbjct: 84  TEKTIFSNKALVDACNQAKQGNGRLHFLGLVSDGGVHSHIDHLFTLLDAAKEQGVPECFV 143

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
            +F DGRDT P S   ++EQL   +  +NYGK+AT++GRYYAMDRDKR+ERIKIA++ L 
Sbjct: 144 QYFADGRDTRPSSGVTFVEQLLNKMKSINYGKLATVVGRYYAMDRDKRYERIKIAYDGLC 203

Query: 181 KGVGEKS--EDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIV 238
           +G+GEK+  +  +  I++R+  +ETDEFLKPIIV EEG +++ DT+ F DFRADRMR+IV
Sbjct: 204 QGLGEKTTQDQVIEVIKKRYEANETDEFLKPIIVSEEGRVRDGDTMIFIDFRADRMREIV 263

Query: 239 QTFGVPPPPFEAKI-PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
           + FG+    F+ ++ P+N  +T MT YK  +PFP  FPPQ   NVL EW A  K+ Q H 
Sbjct: 264 EAFGI-QRNFDTEVAPKN--VTVMTEYKGGWPFPQLFPPQVPTNVLGEWLAHKKVPQFHC 320

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXX---------X 348
           AETEK+AHVTFFFNGG E+ F+LE R ++ SPKV TYD  PEMS                
Sbjct: 321 AETEKYAHVTFFFNGGREDAFELEDRCMVPSPKVPTYDTLPEMSSAGVADKVRNSFFFFS 380

Query: 349 XXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFIT 408
                 SGK+PFVM NFA PDMVGHTG+Y+ A KA   TD AIG IY+AC+ +GY+L IT
Sbjct: 381 MVEAIGSGKYPFVMCNFAPPDMVGHTGQYEPAVKACTATDIAIGRIYDACEKHGYVLLIT 440

Query: 409 SDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETP 468
           SDHGNAE+M  E+G PHTAHT   VPFI+ +  + F +     L DVAPT+LD++GL+ P
Sbjct: 441 SDHGNAEKMFSEKGGPHTAHTTARVPFIM-TGSHKFIKLDDPGLADVAPTVLDLMGLDIP 499

Query: 469 KEMTGLSLLKK 479
            +MTG SLLKK
Sbjct: 500 ADMTGKSLLKK 510



>gi|380494148|emb|CCF33370.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Colletotrichum higginsianum]
          Length = 586

 Score =  540 bits (1390), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 275/495 (55%), Positives = 346/495 (69%), Gaps = 19/495 (3%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NAETPVMD   + +  Y  LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 94  NAETPVMDAFAQSKTGYCELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 153

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  K  E D I K F+ AK  NGR+H  GLVS GGVHS   HL +LL+ AK  G+PK +
Sbjct: 154 IKEGKLPENDVIKKTFEGAKNGNGRLHLCGLVSHGGVHSKQIHLYNLLKAAKQFGVPKVF 213

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRD +P+S   Y+E+L K   ++  G+IAT++GRYYAMDRDKRWER++IA + +
Sbjct: 214 IHFFGDGRDVDPKSGADYMEELVKTAGEIGIGEIATVVGRYYAMDRDKRWERVQIALDGM 273

Query: 180 TKGVGEKSEDPLSTIRERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE+S DP+ T+RER+++    + DEFL PIIV  +EG IK++DT+FFF++R+DR+R
Sbjct: 274 INGKGEESTDPVKTVRERYARGGDKDKDEFLSPIIVGGDEGRIKDDDTVFFFNYRSDRVR 333

Query: 236 QIVQTFG-----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           QI Q  G     V P   +   P+  ++  MT+YK ++PF +AF PQ M NVL+EW  K 
Sbjct: 334 QITQLLGDVDRSVLP---DFNYPKIKNLVTMTQYKVDYPFEIAFKPQHMGNVLAEWLGKQ 390

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXX 345
            + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS    
Sbjct: 391 GVEQVHIAETEKYAHVTFFFNGGVEKVFALETRDEKQDLVPSNKSVATYDKAPEMSADGV 450

Query: 346 XXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYIL 405
                      KFPFVMNNFA PDMVGHTG Y+AA   +E TDKAIG IY ACK  GY+L
Sbjct: 451 ADQVAKRLAEQKFPFVMNNFAPPDMVGHTGVYEAAIVGVEATDKAIGKIYNACKEQGYVL 510

Query: 406 FITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIG 464
           FIT+DHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +G
Sbjct: 511 FITADHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKDGGVLGDVAPTVLAAMG 570

Query: 465 LETPKEMTGLSLLKK 479
           L  P+EMTG +LL K
Sbjct: 571 LPQPEEMTGNNLLTK 585



>gi|336467550|gb|EGO55714.1| hypothetical protein NEUTE1DRAFT_117878 [Neurospora tetrasperma
           FGSC 2508]
 gi|350287798|gb|EGZ69034.1| putative phosphoglyceromutase [Neurospora tetrasperma FGSC 2509]
          Length = 519

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 274/492 (55%), Positives = 344/492 (69%), Gaps = 19/492 (3%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+L K    ++ LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 32  AETPVMDELSKSATGFSELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 91

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  + ++ + I   F+RAK  NGR+H  GLVS GGVHS   HL  LL+ AK  G+PK ++
Sbjct: 92  KKGELSQNEVIKATFERAKNGNGRLHLCGLVSHGGVHSKQTHLYALLKAAKEAGVPKVFI 151

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+++L   I ++  G++AT++GRYYAMDRDKRWER+++A + + 
Sbjct: 152 HFFGDGRDTDPKSGAGYMQELLDTIKEIGIGELATVVGRYYAMDRDKRWERVEVALKGMI 211

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE+S DP+ TI+ER+ K E DEFLKPIIV  +E  IKE+DT+FFF++R+DR+RQI Q
Sbjct: 212 LGEGEESTDPVKTIKERYEKGENDEFLKPIIVGGDERRIKEDDTVFFFNYRSDRVRQITQ 271

Query: 240 TFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
             G      +P  PF      N+ +  MT+YK ++PF +AF PQ M+NVL+EW  K  + 
Sbjct: 272 LLGGVDRSPLPDFPF-----PNIKLVTMTQYKLDYPFEVAFKPQQMDNVLAEWLGKQGVK 326

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXX 348
           Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS       
Sbjct: 327 QVHIAETEKYAHVTFFFNGGVEKVFPLETRDESQDLVPSNKSVATYDKAPEMSADGVANQ 386

Query: 349 XXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFIT 408
                   +FPFVMNNFA PDMVGHTG Y+AA      TDKAIG I E CK  GYILFIT
Sbjct: 387 VVKRLGEQEFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKILEGCKKEGYILFIT 446

Query: 409 SDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLET 467
           SDHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPTIL  +GL  
Sbjct: 447 SDHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTILAAMGLPQ 506

Query: 468 PKEMTGLSLLKK 479
           P EMTG +LL K
Sbjct: 507 PAEMTGQNLLVK 518



>gi|85094513|ref|XP_959896.1| hypothetical protein NCU02252 [Neurospora crassa OR74A]
 gi|28921353|gb|EAA30660.1| hypothetical protein NCU02252 [Neurospora crassa OR74A]
 gi|40804637|emb|CAF05897.1| probable phosphoglyceromutase [Neurospora crassa]
          Length = 519

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 273/492 (55%), Positives = 344/492 (69%), Gaps = 19/492 (3%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+L K    ++ LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 32  AETPVMDELSKSATGFSELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 91

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  + ++ + I   F+RAK  NGR+H  GLVS GGVHS   HL  LL+ AK  G+PK ++
Sbjct: 92  KKGELSQNEVIKATFERAKNGNGRLHLCGLVSHGGVHSKQTHLYALLKAAKEAGVPKVFI 151

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+++L   I ++  G++AT++GRYYAMDRDKRWER+++A + + 
Sbjct: 152 HFFGDGRDTDPKSGAGYMQELLDTIKEIGIGELATVVGRYYAMDRDKRWERVEVALKGMI 211

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE+S DP+ TI+ER+ K E DEFLKPI+V  +E  IKE+DT+FFF++R+DR+RQI Q
Sbjct: 212 LGEGEESTDPVKTIKERYEKGENDEFLKPIVVGGDERRIKEDDTVFFFNYRSDRVRQITQ 271

Query: 240 TFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
             G      +P  PF      N+ +  MT+YK ++PF +AF PQ M+NVL+EW  K  + 
Sbjct: 272 LMGGVDRSPLPDFPF-----PNIKLVTMTQYKLDYPFDVAFKPQQMDNVLAEWLGKQGVK 326

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXX 348
           Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS       
Sbjct: 327 QVHIAETEKYAHVTFFFNGGVEKVFPLETRDESQDLVPSNKSVATYDKAPEMSADGVANQ 386

Query: 349 XXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFIT 408
                   +FPFVMNNFA PDMVGHTG Y+AA      TDKAIG I E CK  GYILFIT
Sbjct: 387 VVKRLGEQEFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKILEGCKKEGYILFIT 446

Query: 409 SDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLET 467
           SDHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPTIL  +GL  
Sbjct: 447 SDHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTILAAMGLPQ 506

Query: 468 PKEMTGLSLLKK 479
           P EMTG +LL K
Sbjct: 507 PAEMTGQNLLVK 518



>gi|406862032|gb|EKD15084.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 521

 Score =  538 bits (1387), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 271/488 (55%), Positives = 343/488 (70%), Gaps = 10/488 (2%)

Query: 2   AETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETP MD  ++    +T LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 33  AETPFMDAFQKNTDGFTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  + N+ + I+K F+ AKE NGR+H  GL+SDGGVH+  +HL  LL+ AK  GIP  Y+
Sbjct: 93  KKNELNKNEVIMKAFNAAKEGNGRLHLAGLISDGGVHAKQDHLYALLKLAKEIGIPHVYI 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y++ L   I ++  G++AT++GRYYAMDRDKRW+R+++A  AL 
Sbjct: 153 HFFGDGRDTDPKSGAGYMQGLLDKIKEIGIGEVATVVGRYYAMDRDKRWDRVEVALNALC 212

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE S DP+  I+ R+ K E DEFLKPII+  +E  I E D +FFF++R+DR+R+I Q
Sbjct: 213 VGDGETSTDPVEAIKGRYEKGENDEFLKPIILGGKEARIGEGDQVFFFNYRSDRVREITQ 272

Query: 240 TFG-VPPPPFEA-KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
             G     P E    P+N+ +T MT+YK ++PF +AF PQ M NVL+E      + Q HV
Sbjct: 273 LLGDYDRSPLEDFAYPKNITLTTMTQYKLDYPFQIAFKPQHMGNVLAETLGSQGVKQVHV 332

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXXXX 352
           AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS           
Sbjct: 333 AETEKYAHVTFFFNGGVEKVFPLETRDESQDLVPSNKSVATYDKAPEMSAAGVAKQMSKR 392

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
            + G+F F+MNNFA PDMVGHTG Y+AA   +  TDKAIG IYE CK  GYILFITSDHG
Sbjct: 393 IKEGQFEFIMNNFAPPDMVGHTGDYEAAIIGVAATDKAIGAIYETCKEEGYILFITSDHG 452

Query: 413 NAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPKEM 471
           NAE+M+ E+G P T+HT N VPFI+A+    ++ +   G L DVAPTIL+ +GL+ P+EM
Sbjct: 453 NAEEMKFEDGKPKTSHTTNKVPFIMANAPKGWSLKKNDGVLGDVAPTILEAMGLKQPEEM 512

Query: 472 TGLSLLKK 479
           TG SLL K
Sbjct: 513 TGHSLLIK 520



>gi|389640855|ref|XP_003718060.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Magnaporthe oryzae 70-15]
 gi|351640613|gb|EHA48476.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Magnaporthe oryzae 70-15]
          Length = 520

 Score =  538 bits (1386), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 273/490 (55%), Positives = 343/490 (70%), Gaps = 15/490 (3%)

Query: 2   AETPVMDKLKR-EYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+  R +  Y  LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID ++
Sbjct: 33  AETPVMDEFARSKTGYVELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F++ + I +  + AK  NGR+H  GLVS GGVHS   HL  LL+ AK   +PK ++
Sbjct: 93  KTGEFSKNEVITQVIEAAKSGNGRLHLCGLVSHGGVHSKQEHLYSLLKAAKEAQVPKVFI 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+E+L +   ++  G+IAT++GRYYAMDRDKRWER+++A + L 
Sbjct: 153 HFFGDGRDTDPKSGVGYMEELLEKTKEIGIGQIATVVGRYYAMDRDKRWERVELAMKGLV 212

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE SEDP+ T++ER+ K E DEFLKPI+V  +EG IK+ D +FFF++R+DR+RQI Q
Sbjct: 213 LGEGEASEDPVKTVKERYEKGENDEFLKPIVVGGDEGRIKDGDNVFFFNYRSDRVRQITQ 272

Query: 240 TFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
             G     P P F       + +  MTRYK ++PF +AF PQ M NVL+EW  K  + Q 
Sbjct: 273 LLGDVDRSPRPDFPYP---KIKLATMTRYKLDYPFDVAFEPQKMGNVLAEWLGKQNVPQV 329

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXX 350
           HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS         
Sbjct: 330 HVAETEKYAHVTFFFNGGVEKAFALEERDESQDLVPSNKSVATYDKAPEMSADGVADQVA 389

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KFPFVMNNFA PDMVGHTG Y+AA      TDKAIG IYEACKA+ Y+LFIT+D
Sbjct: 390 KRLGEQKFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKIYEACKAHNYVLFITAD 449

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +GL  P+
Sbjct: 450 HGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKPVGGVLGDVAPTVLACMGLPQPE 509

Query: 470 EMTGLSLLKK 479
           EMTG +LL K
Sbjct: 510 EMTGENLLVK 519



>gi|336273262|ref|XP_003351386.1| hypothetical protein SMAC_03693 [Sordaria macrospora k-hell]
 gi|380092907|emb|CCC09660.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 519

 Score =  538 bits (1386), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 273/492 (55%), Positives = 343/492 (69%), Gaps = 19/492 (3%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+L K    +T L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 32  AETPVMDELSKSATGFTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 91

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +  + D I   F+RAK  NGR+H  GL+S GGVH+   HL  LL  AK  G+PK Y+
Sbjct: 92  KKGELGQNDVIKSTFERAKNGNGRLHLCGLISHGGVHAKQTHLYALLRAAKEAGVPKIYI 151

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+++L   I ++  G++AT++GRYYAMDRDKRWER+++A + L 
Sbjct: 152 HFFGDGRDTDPKSGAGYMQELLDTIKEIGIGELATVVGRYYAMDRDKRWERVEVALKGLY 211

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE+S DP+ TI+ER+ K E DEFLKPII+  +E  IKE+DT+FFF++R+DR+RQI Q
Sbjct: 212 LGEGEESTDPVKTIKERYEKGENDEFLKPIIIGGDERRIKEDDTVFFFNYRSDRVRQITQ 271

Query: 240 TFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
             G      +P  PF      N+ +  MT+YK ++PF +AF PQ M NVL+EW  K  + 
Sbjct: 272 LMGDVDRSPLPDFPF-----PNIKLVTMTQYKLDYPFEIAFKPQHMGNVLAEWLGKQGVK 326

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXX 348
           Q H+AETEK+AHVTFFFNGGVE+ F LEVR    DL+ S K VATYD  PEMS       
Sbjct: 327 QVHIAETEKYAHVTFFFNGGVEKVFPLEVRDETQDLVPSNKSVATYDKAPEMSADGVANQ 386

Query: 349 XXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFIT 408
                   +FPFVMNNFA PDMVGHTG Y+AA      TDKAIG I E CK  GYILFIT
Sbjct: 387 VVKRLGEQEFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKILEGCKKEGYILFIT 446

Query: 409 SDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLET 467
           +DHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +GL  
Sbjct: 447 ADHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTVLAAMGLPQ 506

Query: 468 PKEMTGLSLLKK 479
           P+EMTG +LL K
Sbjct: 507 PEEMTGQNLLVK 518



>gi|402080288|gb|EJT75433.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 520

 Score =  538 bits (1386), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 274/490 (55%), Positives = 347/490 (70%), Gaps = 15/490 (3%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD   + +  YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID ++
Sbjct: 33  AETPVMDAFAQSKTGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F++ + I K  D AK+ NGR+H  GLVS GGVHS   HL  LL+ AK  GIPK ++
Sbjct: 93  KTGEFSKNNVIKKTLDAAKDGNGRLHLCGLVSHGGVHSKQEHLYSLLKAAKETGIPKVFI 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+E+L +   ++  G+IAT++GRYYAMDRDKRWER+++A + + 
Sbjct: 153 HFFGDGRDTDPKSGLGYMEELLEKAKEIGVGEIATVVGRYYAMDRDKRWERVELAMKGMI 212

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE ++DP+  ++ER+ K E DEFLKPI+V  +E  IK++D +FFF++R+DR+RQI Q
Sbjct: 213 LGEGETADDPVKAVKERYEKGENDEFLKPIVVGGDERRIKDDDIVFFFNYRSDRVRQITQ 272

Query: 240 TFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
             G     P P F  K P+ + +  MT+YK ++PF +AF PQ M NVL+EW  K K+ Q 
Sbjct: 273 LLGDVDRSPRPDF--KYPK-IKLVTMTQYKLDYPFEIAFRPQHMGNVLAEWLGKQKVEQV 329

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXX 350
           HVAETEK+AHVTFFFNGGVE+ F+LE R    DL+ S K VATYD  PEMS         
Sbjct: 330 HVAETEKYAHVTFFFNGGVEKAFELETRDENQDLVPSNKSVATYDEAPEMSADGVADQVA 389

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KFPFVMNNFA PDMVGHTG Y+AA      TDKAIG IY ACK   YILFIT+D
Sbjct: 390 KRLGEQKFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKIYGACKKENYILFITAD 449

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M+  +G P T+HT N VPFI+A+    ++ ++  G L DVAPT+L  +GL  P+
Sbjct: 450 HGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKTADGVLGDVAPTVLAAMGLPQPE 509

Query: 470 EMTGLSLLKK 479
           EMTG SLL K
Sbjct: 510 EMTGKSLLVK 519



>gi|310791993|gb|EFQ27520.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Glomerella graminicola M1.001]
          Length = 524

 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 273/494 (55%), Positives = 346/494 (70%), Gaps = 17/494 (3%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA+TPVMD   + +  Y  LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAKTPVMDAFAQSKTGYCELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  KF E D I K F+ A++ NGR+H  GLVS GGVH+   HL +LL+ AK +G+PK Y
Sbjct: 92  IKEGKFAENDVIKKTFEGARDGNGRLHLCGLVSHGGVHAKQVHLYNLLKAAKQYGVPKVY 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRD +P+S   Y+E+L K   ++  G+IAT++GRYYAMDRDKRWER++IA + +
Sbjct: 152 IHFFGDGRDVDPKSGADYMEELIKTAGEIGTGEIATVVGRYYAMDRDKRWERVQIALDGM 211

Query: 180 TKGVGEKSEDPLSTIRERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE+S DP+ T+RER+++    + DEFL PIIV  +E  IK++DT+FFF++R+DR+R
Sbjct: 212 INGKGEESSDPVKTVRERYARGGDKDKDEFLTPIIVGGDERRIKDDDTVFFFNYRSDRVR 271

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           QI Q  G       P F    P+   +  MT+YK ++PF +AF PQ M NVL+EW  K  
Sbjct: 272 QITQLLGDVDRSVLPDF--NYPKIRTLVTMTQYKVDYPFEVAFKPQHMGNVLAEWLGKQG 329

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXX 346
           + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS     
Sbjct: 330 VEQVHIAETEKYAHVTFFFNGGVEKVFALETRDESQDLVPSNKAVATYDKAPEMSADGVA 389

Query: 347 XXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                     KFPFVMNNFA PDMVGHTG Y+AA   +E TDKAIG IY+ACK   YILF
Sbjct: 390 NQVAKRLGEQKFPFVMNNFAPPDMVGHTGVYEAAIVGVEATDKAIGKIYDACKKQNYILF 449

Query: 407 ITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGL 465
           IT+DHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +GL
Sbjct: 450 ITADHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKDGGVLGDVAPTVLAAMGL 509

Query: 466 ETPKEMTGLSLLKK 479
             P+EMTG +LL K
Sbjct: 510 PQPEEMTGTNLLTK 523



>gi|154300406|ref|XP_001550619.1| hypothetical protein BC1G_11392 [Botryotinia fuckeliana B05.10]
          Length = 529

 Score =  536 bits (1382), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 271/492 (55%), Positives = 344/492 (69%), Gaps = 19/492 (3%)

Query: 1   NAETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NAETPVMD        YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAETPVMDAFANNADGYTKLEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  + N+ + ++K F+ AK+ NGR+H  GL+SDGGVH+  +HL  LL+ AK   IP  Y
Sbjct: 92  IKKGELNKNEVVMKAFNAAKDGNGRLHLCGLISDGGVHAKQDHLYALLKVAKELEIPHVY 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+E L + I ++  G++AT++GR+YAMDRDKRW+R+++A   L
Sbjct: 152 IHFFGDGRDTDPKSGAGYMEALLEKIKEIGIGEVATVVGRFYAMDRDKRWDRVEVALSGL 211

Query: 180 TKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIV 238
             G GE+S DP+ TI+ER+   E DEFLKPII+  +E  I+     F  ++R+DR+R+I 
Sbjct: 212 CNGEGEESSDPVKTIKERYENGENDEFLKPIILGGKEARIQG----FLLNYRSDRVREIT 267

Query: 239 QTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           Q  G     P P F    P+N+ +T MT+YK ++PF +AF PQ M NVL+E      ++Q
Sbjct: 268 QLLGDVDRSPKPDF--AYPKNITLTTMTQYKLDYPFEIAFKPQHMGNVLAETLGAQGVNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXX 349
            HVAETEK+AHVTFFFNGGVE+ F LEVR    DL+ S K VATYD  PEMS        
Sbjct: 326 VHVAETEKYAHVTFFFNGGVEKVFPLEVRDESQDLVPSNKSVATYDKAPEMSAAGVAKQM 385

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
                 GKF FVMNNFA PDMVGHTG Y+AA   +  TDKAIG IYE CK  GY+LFITS
Sbjct: 386 SKRISEGKFEFVMNNFAPPDMVGHTGVYEAAVIGVAATDKAIGEIYETCKKEGYVLFITS 445

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIGLET 467
           DHGNAE+M+  +G P T+HT N VPFI+A+    +S  ++ +G L DVAPTIL+V+GL+ 
Sbjct: 446 DHGNAEEMKFADGKPKTSHTTNKVPFIMANAPQGWSLKQTDEGVLGDVAPTILEVMGLKQ 505

Query: 468 PKEMTGLSLLKK 479
           P+EMTG SLL K
Sbjct: 506 PEEMTGSSLLVK 517



>gi|392598131|gb|EIW87453.1| cofactor-independent phosphoglycerate mutase [Coniophora puteana
           RWD-64-598 SS2]
          Length = 539

 Score =  536 bits (1382), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 274/507 (54%), Positives = 345/507 (68%), Gaps = 30/507 (5%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A +P M +L  E+PY TL AHG AVGLP+GLMGNSEVGHLNIGAGR+V+Q IVRIDL++K
Sbjct: 30  ANSPNMTRLSEEFPYRTLAAHGNAVGLPDGLMGNSEVGHLNIGAGRIVWQSIVRIDLSIK 89

Query: 62  NKK-----------FNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETA 110
           N K           F   + I     RA + NGR+H LGL+SDGGVHS+I H+  LL+ A
Sbjct: 90  NDKLGKKPGKDVESFKNNEGIQAAVQRAAKGNGRLHLLGLISDGGVHSNIEHVYALLDVA 149

Query: 111 KNHGIPKAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWE 170
           +  G+   YVHFFGDGRDT  ++   +L+ LQK   D  YG +AT+ GRYYAMDRDKRWE
Sbjct: 150 REAGVKDTYVHFFGDGRDTGEKTGLGFLKSLQKHFADNKYGTLATVSGRYYAMDRDKRWE 209

Query: 171 RIKIAFEALTKGVGEKSEDPLSTIRERFSKDE---------TDEFLKPIIVDEEGIIKEN 221
           RI +A +AL  G GE+S+D + +   R++  E         +DEF+KP ++++EG IK++
Sbjct: 210 RITLAMKALINGEGEQSDDIVKSFETRYANSEKEGAKGEDYSDEFIKPTVLNKEGTIKDD 269

Query: 222 DTLFFFDFRADRMRQIVQTFG-VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSME 280
           DTLFFF+FRADRMRQI   FG V     E KIP+NL IT MT YK+EFPF +AF P SM 
Sbjct: 270 DTLFFFNFRADRMRQITTIFGQVEDHIPEVKIPKNLDITTMTPYKAEFPFHVAFRPHSMA 329

Query: 281 NVLSEWFAKHKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEM 340
           NVL++W ++  + Q H+AETEK+AHVTFFFNGGVE+ F  E R +I SPKV TY  +P M
Sbjct: 330 NVLADWLSQKGVKQSHIAETEKYAHVTFFFNGGVEKQFAGEERHMIPSPKVPTYRDQPPM 389

Query: 341 SXXXXXXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKA 400
           S            ++    FVM NFA PDMVGHTG   AA  AI+ TDKA+ I++EAC+ 
Sbjct: 390 SAVEVAQKVATVVQADTHEFVMCNFAPPDMVGHTGDLAAAKVAIDATDKAVQIVWEACEK 449

Query: 401 NGYILFITSDHGNAEQMQD-EEGNPHTAHTCNPVPFILAS--NKYSFAE------STKGA 451
            GY+L IT+DHGNAEQM++ E G PHTAHT NPVPFI+A    KYS A+        +GA
Sbjct: 450 AGYVLLITADHGNAEQMKNPETGEPHTAHTTNPVPFIMAGADKKYSLAKDGEGEEEKEGA 509

Query: 452 LCDVAPTILDVIGLETPKEMTGLSLLK 478
           L DVAPT+L ++G+  P EM G SLLK
Sbjct: 510 LADVAPTVLALMGISQPDEMNGHSLLK 536



>gi|475670905|gb|EMT68258.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Fusarium oxysporum f. sp. cubense race 4]
          Length = 525

 Score =  536 bits (1382), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 271/495 (54%), Positives = 345/495 (69%), Gaps = 18/495 (3%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA+TPVMD L K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAKTPVMDALYKDSKGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +KN +  + D I K F      NGR+H  GLVS GGVH+   HL  LL+ AK +G+PK +
Sbjct: 92  IKNGQLGQNDVIKKTFQSVAAGNGRLHLCGLVSHGGVHAKQTHLYALLKAAKEYGVPKVF 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+++L     ++  G+I+T++GRY+AMDRDKRW+R+++A + L
Sbjct: 152 IHFFGDGRDTDPKSGAGYMQELVDTAKEIGIGEISTVVGRYFAMDRDKRWDRLEVALKGL 211

Query: 180 TKGVGEKSEDPLSTIRERFSKD---ETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE SEDP++T++ R+ +    + DEFL PIIV  +E  IK++DT+FFF++R+DR+R
Sbjct: 212 VLGEGEASEDPVATVKARYERGGDFDRDEFLTPIIVGGDERRIKDDDTVFFFNYRSDRVR 271

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           QI Q  G     P P F  K P+   +  MT+YK ++PF +AF PQ M NVL+EW  K  
Sbjct: 272 QITQLLGDVDRSPLPDF--KYPKIKPLVTMTQYKGDYPFEVAFKPQHMGNVLAEWLGKQN 329

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXX 346
           + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS     
Sbjct: 330 VEQVHIAETEKYAHVTFFFNGGVEKVFPLETRDQSQDLVPSNKSVATYDLAPEMSADGVA 389

Query: 347 XXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                     KFPFVMNNFA PDMVGHTG YDAA    E TDKAIG I EACK  GY+LF
Sbjct: 390 DQVVKRLGEQKFPFVMNNFAPPDMVGHTGVYDAAVIGCEATDKAIGKILEACKKEGYVLF 449

Query: 407 ITSDHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIG 464
           IT+DHGNAE+M+  +G P T+HT N VP ++A+    +S  ++ +G L DVAPT+L  +G
Sbjct: 450 ITADHGNAEEMKFPDGKPKTSHTTNKVPLLMANYPEGWSLKKTDEGVLGDVAPTVLAAMG 509

Query: 465 LETPKEMTGLSLLKK 479
           L  P+EMTG SLL+K
Sbjct: 510 LPQPEEMTGKSLLQK 524



>gi|320588325|gb|EFX00794.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Grosmannia clavigera kw1407]
          Length = 522

 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 271/489 (55%), Positives = 340/489 (69%), Gaps = 11/489 (2%)

Query: 2   AETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           A+TPVMD  +     YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRIDL++
Sbjct: 33  ADTPVMDAFRASSTGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDLSI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K   F +   I K  + AK  NGR+H  GLVS GGVHS   HL  +L  AK  G+P+ Y+
Sbjct: 93  KQNTFADNAMIHKTLEAAKNGNGRLHLCGLVSHGGVHSKQEHLYAILRAAKAAGVPEVYI 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   YL++L +   ++  G++ATI+GRYYAMDRDKRWER ++A + L 
Sbjct: 153 HFFGDGRDTDPKSGAGYLKELLETAKEIGTGELATIVGRYYAMDRDKRWERNELALKGLI 212

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE S DP++TI ER++K E DEFLKPIIV   E  IK+ D +FFF++R+DR+RQI Q
Sbjct: 213 LGEGEASTDPVATIEERYAKGENDEFLKPIIVGGAERRIKDKDVVFFFNYRSDRVRQITQ 272

Query: 240 TFG-VPPPPF-EAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
             G V   P  +   P+++ +  MT+YK+++PF +AF PQ M NVL+EW  K  + Q H+
Sbjct: 273 LLGDVDRSPLADFPFPKDITLVTMTQYKADYPFEIAFAPQHMGNVLAEWLGKEGVKQVHI 332

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXXXX 352
           AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS           
Sbjct: 333 AETEKYAHVTFFFNGGVEKVFPLETRDETQDLVPSNKAVATYDKAPEMSAAGVAKQVAKR 392

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
               +FPFVMNNFA PDMVGHTG Y+AA   +  TDKAIG IYEACK   Y+LFIT+DHG
Sbjct: 393 LAEHEFPFVMNNFAPPDMVGHTGVYEAAIVGVATTDKAIGEIYEACKRENYVLFITADHG 452

Query: 413 NAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIGLETPKE 470
           NAE+M+  +G P T+HT N VPF++A+    +S     +G L DVAPT+L  +GL  P+E
Sbjct: 453 NAEEMKFPDGKPKTSHTTNKVPFVMANAPAGWSLRTDVEGVLGDVAPTVLAAMGLSQPEE 512

Query: 471 MTGLSLLKK 479
           MTG SLL K
Sbjct: 513 MTGKSLLVK 521



>gi|408396407|gb|EKJ75565.1| hypothetical protein FPSE_04208 [Fusarium pseudograminearum CS3096]
          Length = 525

 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 272/495 (54%), Positives = 345/495 (69%), Gaps = 18/495 (3%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA+TPVMD L K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAKTPVMDALYKDSKGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +KN + ++ D I K F  A   NGR+H  GLVS GGVH+   HL  LL+ AK +G+PK  
Sbjct: 92  IKNGELSQNDVIKKTFQSAAAGNGRLHLCGLVSHGGVHAKQTHLYALLKAAKEYGVPKVI 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+++L   I ++  G+I T++GRY+AMDRDKRW+R++IA + L
Sbjct: 152 IHFFGDGRDTDPKSGAGYMQELVDNIKEIGIGEIGTVVGRYFAMDRDKRWDRLEIALKGL 211

Query: 180 TKGVGEKSEDPLSTIRERFSKD---ETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE SEDP++T++ R+ +      DEFL PIIV  ++  IK++DT+FFF++R+DR+R
Sbjct: 212 ILGEGEASEDPVATVKARYEQGGDMNKDEFLTPIIVGGDDRRIKDDDTVFFFNYRSDRVR 271

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           QI Q  G     P P F+   P+   +  MT+YK ++PF +AF PQ M NVL+EW  K  
Sbjct: 272 QITQLLGDVDRSPLPDFQ--YPKIKPLVTMTQYKGDYPFEIAFKPQHMGNVLAEWLGKQN 329

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXX 346
           + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS     
Sbjct: 330 VEQVHIAETEKYAHVTFFFNGGVEKVFPLETRDQSQDLVPSNKSVATYDLAPEMSADGVA 389

Query: 347 XXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                     KFPFVMNNFA PDMVGHTG YDAA    E TDKAIG I E CK  GY+LF
Sbjct: 390 DQVVKRLGEQKFPFVMNNFAPPDMVGHTGVYDAAVIGCEATDKAIGKILEGCKKAGYVLF 449

Query: 407 ITSDHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIG 464
           IT+DHGNAE+M+  +G P T+HT N VP ++A+    +S  ++T+G L DVAPT+L  +G
Sbjct: 450 ITADHGNAEEMKFADGKPKTSHTTNKVPLLMANYPEGWSLKDTTEGVLGDVAPTVLAAMG 509

Query: 465 LETPKEMTGLSLLKK 479
           L  P+EMTG SLL+K
Sbjct: 510 LPQPEEMTGKSLLQK 524



>gi|367047883|ref|XP_003654321.1| hypothetical protein THITE_2117229 [Thielavia terrestris NRRL 8126]
 gi|347001584|gb|AEO67985.1| hypothetical protein THITE_2117229 [Thielavia terrestris NRRL 8126]
          Length = 519

 Score =  536 bits (1380), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 274/490 (55%), Positives = 338/490 (68%), Gaps = 15/490 (3%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           A+TPVMD+  K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 32  ADTPVMDEFSKSPTGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 91

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F   D I K  +  K  NGR+H  GL+S GGVHS   HL  LLE AK +G+P  Y+
Sbjct: 92  KKGEFASNDVIKKVMEAVKNGNGRLHLCGLISHGGVHSKQTHLYALLEAAKQYGVPNVYI 151

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+E+L     ++  G++AT++GRYYAMDRDKRWER +IA + L 
Sbjct: 152 HFFGDGRDTDPKSGAGYMEELLSKTKEIGVGQLATVVGRYYAMDRDKRWERNEIALKGLV 211

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE+S+DP+ T++ER+ K ETDEFLKPIIV  +E  IK+ D +FFF++R+DR+RQI Q
Sbjct: 212 LGEGEQSDDPVKTVKERYEKGETDEFLKPIIVGGDERRIKDGDNVFFFNYRSDRVRQITQ 271

Query: 240 TFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
             G     P P F       +++  MT+YK ++PF +AF PQ M NVL+EW  K  + Q 
Sbjct: 272 LLGDVDRSPKPDFPYP---KINLVTMTQYKLDYPFEIAFKPQHMGNVLAEWLGKQGVEQV 328

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXX 350
           HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K V TYD  PEMS         
Sbjct: 329 HVAETEKYAHVTFFFNGGVEKVFPLETRDESQDLVPSNKSVPTYDKAPEMSADGVANQVC 388

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 +FPFVMNNFA PDMVGHTG Y+AA      TDKAIG IYEACK  GYILFIT+D
Sbjct: 389 KRLAEQRFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKIYEACKKEGYILFITAD 448

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L+ +GL  P 
Sbjct: 449 HGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKEGGVLGDVAPTVLEAMGLPVPP 508

Query: 470 EMTGLSLLKK 479
           EMTG SLL K
Sbjct: 509 EMTGTSLLVK 518



>gi|358385935|gb|EHK23531.1| hypothetical protein TRIVIDRAFT_74022 [Trichoderma virens Gv29-8]
          Length = 530

 Score =  535 bits (1378), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 271/495 (54%), Positives = 346/495 (69%), Gaps = 21/495 (4%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+L K E  +T L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID ++
Sbjct: 33  AETPVMDELSKSETGFTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F++ + + K  + A   NGR+H  GLVS GGVHS   HL  +L+ AK + +PK ++
Sbjct: 93  KKDEFSDNETLKKTLESAASGNGRLHLCGLVSHGGVHSKQTHLYAILKAAKKYKVPKVFI 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+++L   I +L  G+IAT++GRYYAMDRDKRWER+++A + L 
Sbjct: 153 HFFGDGRDTDPKSGGGYMQELVDFIKELGLGQIATVVGRYYAMDRDKRWERVEVALKGLV 212

Query: 181 KGVGEKSEDPLSTIRERF---SKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQ 236
            G GE +EDP++T++ R+    K+  DEF  PIIV  +EG IK++DT+FFF++R+DR RQ
Sbjct: 213 LGEGEATEDPVATVKARYELEGKENRDEFFTPIIVGGDEGRIKDDDTVFFFNYRSDRARQ 272

Query: 237 IVQTFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           I Q  G      +P  P+    P+   +  MTRYK+++PF +AF PQ M+NVL+EW  K 
Sbjct: 273 ITQVLGDVDRSVLPDFPY----PKISKLVTMTRYKTDYPFDVAFEPQKMDNVLAEWLGKQ 328

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXX 345
            + Q HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS    
Sbjct: 329 NVEQVHVAETEKYAHVTFFFNGGVEKVFPLETRDQDQDLVPSNKSVATYDQAPEMSADGV 388

Query: 346 XXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYIL 405
                      KFPFVMNNFA PDMVGHTG Y+AA      TDKAIG I +ACK  GYIL
Sbjct: 389 ADQVVKRLAEQKFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKILDACKKEGYIL 448

Query: 406 FITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIG 464
           FIT+DHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPTIL  +G
Sbjct: 449 FITADHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKQGGVLGDVAPTILAAMG 508

Query: 465 LETPKEMTGLSLLKK 479
           L  P+EMTG SLL K
Sbjct: 509 LPQPEEMTGESLLAK 523



>gi|477516377|gb|ENH68658.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Fusarium oxysporum f. sp. cubense race 1]
          Length = 525

 Score =  535 bits (1377), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 271/495 (54%), Positives = 343/495 (69%), Gaps = 18/495 (3%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA+TPVMD L K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAKTPVMDALYKDSKGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +KN +  + D I K F      NGR+H  GLVS GGVH+   HL  LL+ AK +G+PK +
Sbjct: 92  IKNGQLGQNDVIKKTFQSVAAGNGRLHLCGLVSHGGVHAKQTHLYALLKAAKEYGVPKVF 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+++L     ++  G+I T++GRY+AMDRDKRW+R++IA + L
Sbjct: 152 IHFFGDGRDTDPKSGAGYMQELVDTAKEIGIGEIGTVVGRYFAMDRDKRWDRLEIALKGL 211

Query: 180 TKGVGEKSEDPLSTIRERFSKD---ETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE SEDP++T++ R+ +    + DEFL PIIV  +E  IK++DT+FFF++R+DR+R
Sbjct: 212 VLGEGEASEDPVATVKARYERGGDFDRDEFLTPIIVGGDERRIKDDDTVFFFNYRSDRVR 271

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           QI Q  G     P P F  K P+   +  MT+YK ++PF +AF PQ M NVL+EW  K  
Sbjct: 272 QITQLLGDVDRSPLPDF--KYPKIKPLVTMTQYKGDYPFEVAFKPQHMGNVLAEWLGKQN 329

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXX 346
           + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS     
Sbjct: 330 VEQVHIAETEKYAHVTFFFNGGVEKVFPLETRDQSQDLVPSNKSVATYDLAPEMSADGVA 389

Query: 347 XXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                     KFPFVMNNFA PDMVGHTG YDAA    E TDKAIG I E CK  GY+LF
Sbjct: 390 DQVVKRLGEQKFPFVMNNFAPPDMVGHTGVYDAAVIGCEATDKAIGKILEGCKKEGYVLF 449

Query: 407 ITSDHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIG 464
           IT+DHGNAE+M+  +G P T+HT N VP ++A+    +S  ++ +G L DVAPT+L  +G
Sbjct: 450 ITADHGNAEEMKFPDGKPKTSHTTNKVPLLMANYPEGWSLKKTDEGVLGDVAPTVLAAMG 509

Query: 465 LETPKEMTGLSLLKK 479
           L  P+EMTG SLL+K
Sbjct: 510 LPQPEEMTGKSLLQK 524



>gi|46123355|ref|XP_386231.1| hypothetical protein FG06055.1 [Fusarium graminearum PH-1]
          Length = 525

 Score =  535 bits (1377), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 272/495 (54%), Positives = 345/495 (69%), Gaps = 18/495 (3%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA+TPVMD L K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAKTPVMDALYKDSKGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +KN + ++ D I K F  A   NGR+H  GLVS GGVH+   HL  LL+ AK +G+PK  
Sbjct: 92  IKNGELSQNDVIKKTFQSAAGGNGRLHLCGLVSHGGVHAKQTHLYALLKAAKEYGVPKVI 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+++L   I ++  G+I T++GRY+AMDRDKRW+R++IA + L
Sbjct: 152 IHFFGDGRDTDPKSGAGYMQELVDNIKEIGVGEIGTVVGRYFAMDRDKRWDRLEIALKGL 211

Query: 180 TKGVGEKSEDPLSTIRERFSKD---ETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE SEDP++T++ R+ +      DEFL PIIV  ++  IK++DT+FFF++R+DR+R
Sbjct: 212 ILGEGEASEDPVATVKARYEQGGDMNKDEFLTPIIVGGDDRRIKDDDTVFFFNYRSDRVR 271

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           QI Q  G     P P F+   P+   +  MT+YK ++PF +AF PQ M NVL+EW  K  
Sbjct: 272 QITQLLGDVDRSPLPDFQ--YPKIKPLVTMTQYKVDYPFEIAFKPQHMGNVLAEWLGKQN 329

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXX 346
           + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS     
Sbjct: 330 VEQVHIAETEKYAHVTFFFNGGVEKVFPLETRDQSQDLVPSNKSVATYDLAPEMSADGVA 389

Query: 347 XXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                     KFPFVMNNFA PDMVGHTG YDAA    E TDKAIG I E CK  GY+LF
Sbjct: 390 DQVVKRLGEQKFPFVMNNFAPPDMVGHTGVYDAAVIGCEATDKAIGKILEGCKKAGYVLF 449

Query: 407 ITSDHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIG 464
           IT+DHGNAE+M+  +G P T+HT N VP ++A+    +S  ++T+G L DVAPT+L  +G
Sbjct: 450 ITADHGNAEEMKFADGKPKTSHTTNKVPLLMANYPEGWSLKKTTEGVLGDVAPTVLAAMG 509

Query: 465 LETPKEMTGLSLLKK 479
           L  P+EMTG SLL+K
Sbjct: 510 LPQPEEMTGKSLLEK 524



>gi|477524721|gb|ENH76652.1| phosphoglycerate -bisphosphoglycerate-independent [Colletotrichum
           orbiculare MAFF 240422]
          Length = 524

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 271/496 (54%), Positives = 340/496 (68%), Gaps = 21/496 (4%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA TPVMD   K    Y  L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NANTPVMDDFAKSATGYCELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  +      I K F+ AK  NGR+H  GLVS GGVHS   HL HLL+ AK +G+P  Y
Sbjct: 92  IKQGELPNNAVIKKTFESAKNGNGRLHLCGLVSHGGVHSKQEHLYHLLKAAKQYGVPNVY 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+E+L K   ++  G+IAT++GRYYAMDRDKRW R+++A + +
Sbjct: 152 IHFFGDGRDTDPKSGAAYMEELVKTAKEIGLGEIATVVGRYYAMDRDKRWGRVELALKGM 211

Query: 180 TKGVGEKSEDPLSTIRERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE S DP+ T++ER+++    + DEFL PIIV   E  IK+NDT+FFF++R+DR+R
Sbjct: 212 ILGEGEDSTDPVQTVKERYARGGDKDKDEFLSPIIVGGSERRIKDNDTVFFFNYRSDRVR 271

Query: 236 QIVQTFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAK 289
           QI Q  G      +P  P+    P+   +  MT+YK+++PF +AF PQ M NVL+EW  K
Sbjct: 272 QITQLLGDVDRSVLPDFPY----PKLDKLVTMTQYKTDYPFEIAFEPQRMGNVLAEWLGK 327

Query: 290 HKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXX 344
             + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS   
Sbjct: 328 QSVEQVHIAETEKYAHVTFFFNGGVEKVFALETRDEKQDLVPSNKSVATYDKAPEMSADG 387

Query: 345 XXXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYI 404
                       KFPFVMNNFA PDMVGHTG Y+AA   +E TDKAIG IYEACK   YI
Sbjct: 388 VANQVAKRLAEQKFPFVMNNFAPPDMVGHTGVYEAAIVGVEATDKAIGKIYEACKKENYI 447

Query: 405 LFITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVI 463
           LFIT+DHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +
Sbjct: 448 LFITADHGNAEEMKFADGKPKTSHTTNKVPFIMANAPEGWSLKKDGGVLGDVAPTVLAAM 507

Query: 464 GLETPKEMTGLSLLKK 479
           GL  P+EMTG +LL K
Sbjct: 508 GLPQPEEMTGANLLTK 523



>gi|340518957|gb|EGR49197.1| phosphoglycerate mutase [Trichoderma reesei QM6a]
          Length = 533

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 274/497 (55%), Positives = 346/497 (69%), Gaps = 23/497 (4%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+L K E  +T LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID ++
Sbjct: 33  AETPVMDELSKSETGFTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F+  + I K F+ A   NGR+H  GLVS GGVHS   HL  LL+ AK + +PK ++
Sbjct: 93  KKGEFDSNETIKKTFEGAASGNGRLHLCGLVSHGGVHSKQEHLYALLKAAKKYNVPKVFI 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+++L   I +L  G+IAT++GRYYAMDRDKRWER+++A + L 
Sbjct: 153 HFFGDGRDTDPKSGAGYMQELVDFIKELGLGQIATVVGRYYAMDRDKRWERVEVALKGLV 212

Query: 181 KGVGEKSEDPLSTIRERFSKD---ETDEFLKPIIV-DEEGIIK--ENDTLFFFDFRADRM 234
            G GE SEDP++T++ R+  D     DEFL PIIV  +E  IK  ++DT+FFF++R+DR 
Sbjct: 213 LGEGEASEDPVATVKARYETDGNNNRDEFLTPIIVGGDESRIKGTDDDTVFFFNYRSDRA 272

Query: 235 RQIVQTFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFA 288
           RQI Q  G      +P  P+    P+   +  MTRYK+++PF +AF PQ M+NVL+EW  
Sbjct: 273 RQITQLLGDVDRSVLPDFPY----PKIKKLVTMTRYKTDYPFDVAFEPQKMDNVLAEWLG 328

Query: 289 KHKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXX 343
           K  + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS  
Sbjct: 329 KQGVEQVHIAETEKYAHVTFFFNGGVEKVFPLETRDQDQDLVPSNKSVATYDQAPEMSAD 388

Query: 344 XXXXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGY 403
                        +FPFVMNNFA PDMVGHTG Y+AA      TDKAIG I EACK  GY
Sbjct: 389 GVADQVVKRLGEQRFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKILEACKKEGY 448

Query: 404 ILFITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDV 462
           ILFIT+DHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPTIL  
Sbjct: 449 ILFITADHGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKKQGGVLGDVAPTILAA 508

Query: 463 IGLETPKEMTGLSLLKK 479
           +GL  P++MTG SLL+K
Sbjct: 509 MGLPQPEDMTGESLLEK 525



>gi|471564776|gb|EMR65591.1| putative -bisphosphoglycerate-independent phosphoglycerate mutase
           protein [Eutypa lata UCREL1]
          Length = 521

 Score =  531 bits (1368), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 271/490 (55%), Positives = 338/490 (68%), Gaps = 16/490 (3%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA TPVMD+  K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID+ 
Sbjct: 32  NANTPVMDEFAKSTTGYTQLEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDMT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  +F     I K  + AK  NGR+H  GLVS GGVHS   HL  LL+ AK  GIPK +
Sbjct: 92  IKKGEFASTPIIKKTLEAAKNGNGRLHLCGLVSHGGVHSKQEHLYALLKAAKAAGIPKVF 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+E+L     ++  G+IAT++GRYYAMDRDKRWER+++A + +
Sbjct: 152 IHFFGDGRDTDPKSGAGYMEELIGKTKEIGIGEIATVVGRYYAMDRDKRWERVELALKGI 211

Query: 180 TKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIV 238
             G GE+S DP+ TI+ER+ K E DEFLKPI+V  +EG I++ D +FFF++R+DR RQI 
Sbjct: 212 VLGEGEESSDPVKTIKERYEKGENDEFLKPIVVGGKEGRIQDGDEVFFFNYRSDRARQIT 271

Query: 239 QTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           Q  G     P P F       +++  MT+YK ++P+ +AF PQ M NVL+EW  K ++ Q
Sbjct: 272 QLLGGADRSPRPDFPYP---KINLVTMTQYKGDYPYEIAFEPQRMGNVLAEWLGKQEVKQ 328

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXX 349
            H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS        
Sbjct: 329 VHIAETEKYAHVTFFFNGGVEKVFALEARDESQDLVPSNKSVATYDKAPEMSAAGVAKQV 388

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
                  +FPFVMNNFA PDMVGHTG Y+AA K +E TD AI +I EAC+  GY+LFITS
Sbjct: 389 AKRLGEQQFPFVMNNFAPPDMVGHTGVYEAALKGVEATDAAISVIREACEKEGYVLFITS 448

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILASN--KYSFAESTKGALCDVAPTILDVIGLET 467
           DHGNAE+M+  +G P T+HT N VPF++ +    +S      G L DVAPTILD +GL  
Sbjct: 449 DHGNAEEMKFPDGKPKTSHTTNKVPFVMYNQPAGWSLKTGEDGVLGDVAPTILDAMGLPK 508

Query: 468 PKEMTGLSLL 477
           P EMTG SLL
Sbjct: 509 PDEMTGSSLL 518



>gi|399171882|emb|CCE27109.1| probable phosphoglyceromutase [Claviceps purpurea 20.1]
          Length = 530

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 271/494 (54%), Positives = 342/494 (69%), Gaps = 17/494 (3%)

Query: 1   NAETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           N +TPVMD+L +    +T LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NGKTPVMDELSKNTDGFTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  + ++   I K F+ A   NGR+H  GLVS GGVH+  +HL  LL  AK + +PK +
Sbjct: 92  IKKGELSQNATIKKTFESAAAGNGRLHLCGLVSHGGVHAKQDHLYALLRAAKEYKVPKVF 151

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+++L   + +L  GKIAT++GRYYAMDRDKRWER++IA + +
Sbjct: 152 IHFFGDGRDTDPKSGAGYMQELVDYLKELGIGKIATVVGRYYAMDRDKRWERVEIALKGM 211

Query: 180 TKGVGEKSEDPLSTIRERF---SKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE SEDP++T++  +      + DEFL PIIV  +EG IK++DT+FFF++R+DR R
Sbjct: 212 CHGEGEASEDPVATVKAHYELGGDKDRDEFLLPIIVGGDEGRIKDDDTVFFFNYRSDRAR 271

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           QI Q  G       P F  K P+   +  MT YK+++PF +AF PQ M NVL+EW  K  
Sbjct: 272 QITQLLGDVDRSVLPDF--KYPKISKLVTMTTYKTDYPFEVAFAPQHMGNVLAEWLGKQN 329

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXX 346
           ++Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS     
Sbjct: 330 VAQVHIAETEKYAHVTFFFNGGVEKVFPLETRDQEQDLVPSNKTVATYDKAPEMSADGVA 389

Query: 347 XXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                     +FPFVMNNFA PDMVGHTG Y+AA    E TDKAIG I E+CK  GYILF
Sbjct: 390 DQVCKRLAEQQFPFVMNNFAPPDMVGHTGVYEAAIVGCEATDKAIGKILESCKKEGYILF 449

Query: 407 ITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGL 465
           ITSDHGNAE+M+ E+G P T+HT N VPFI+A+    ++ +   G L DVAPTIL  +GL
Sbjct: 450 ITSDHGNAEEMKFEDGKPKTSHTTNKVPFIMANAPKGWSLKQADGVLGDVAPTILSAMGL 509

Query: 466 ETPKEMTGLSLLKK 479
             P+EMTG SLL K
Sbjct: 510 PQPEEMTGKSLLDK 523



>gi|241617737|ref|XP_002408207.1| phosphoglycerate mutase, putative [Ixodes scapularis]
 gi|215502938|gb|EEC12432.1| phosphoglycerate mutase, putative [Ixodes scapularis]
          Length = 510

 Score =  528 bits (1361), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 267/487 (54%), Positives = 342/487 (70%), Gaps = 9/487 (1%)

Query: 1   NAETPVMDKLKREY-PYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA+TPVMD L      Y TL+A GL+VGLP+GLMGNSEVGHLNIGAGRV+YQDIVRI++ 
Sbjct: 25  NAKTPVMDGLAAAPDQYLTLDASGLSVGLPDGLMGNSEVGHLNIGAGRVIYQDIVRINMD 84

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           VK     + +N V+  +RAK   GR+H LGLVSDGGVH+HI H+  LLE AK H +P+ +
Sbjct: 85  VKTGDIKKNENFVEACNRAKSKTGRLHLLGLVSDGGVHAHIEHIFALLEGAKEHKVPRTF 144

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           + FFGDGRDT+P S  KY +Q+   I +L YG +AT+IGRYYAMDRDKR ERIKIAFE L
Sbjct: 145 IQFFGDGRDTSPTSGAKYAQQVLDKIAELKYGSLATVIGRYYAMDRDKRDERIKIAFEGL 204

Query: 180 TKGVGEK--SEDPLSTIRERFS----KDETDEFLKPIIVDEEGIIKENDTLFFFDFRADR 233
            +G+G K  ++D +  ++  ++    K +TDEF  PII + +G I++ DT+ F +FRADR
Sbjct: 205 VQGIGTKCDAKDLVKHMQSLYNAPDDKRQTDEFFMPIITELDGRIRDGDTIVFCNFRADR 264

Query: 234 MRQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
            RQ+ +  G+ P    A IP+++ I CMT+YK E+PF L +PP   +NVL+EW A+ K +
Sbjct: 265 ARQLSEALGIKPNFETAVIPKDIKIYCMTQYKKEYPFALLYPPTVPKNVLAEWLAEKKHT 324

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H AETEK+AHVTFFFNGG E+ F  E R ++ SPKVATYDL PEMS            
Sbjct: 325 QFHCAETEKYAHVTFFFNGGQEKAFAEEERCMVPSPKVATYDLLPEMSSKGVADEMVKVV 384

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
           ++ K PFVM NFA PDMVGHTG Y+AA KA+E TD AIG I +AC  NGY++ +T+DHGN
Sbjct: 385 QAKKHPFVMCNFAPPDMVGHTGVYEAAVKAVEATDVAIGRIRDACVENGYVMLVTADHGN 444

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILAS-NKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           AE M+  +G P TAHT N VPF +   +K++  E    ALCDVAPTIL ++ +  P EMT
Sbjct: 445 AEVMKTADGKPVTAHTTNRVPFCMVGPHKFAKPEHNP-ALCDVAPTILALMNIPQPAEMT 503

Query: 473 GLSLLKK 479
           G SLL K
Sbjct: 504 GKSLLAK 510



>gi|358394544|gb|EHK43937.1| hypothetical protein TRIATDRAFT_300311 [Trichoderma atroviride IMI
           206040]
          Length = 531

 Score =  528 bits (1360), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 273/495 (55%), Positives = 342/495 (69%), Gaps = 21/495 (4%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+L K E  +T L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 33  AETPVMDELSKSETGFTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K ++F   + + K  +     NGR+H  GLVS GGVHS   HL  +L+ AK + +PK ++
Sbjct: 93  KKEEFASNEVLKKTLEGVVSGNGRLHLCGLVSHGGVHSKQEHLYAILKAAKQYKVPKVFI 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+E+L   I +L  G+IAT++GRYYAMDRDKRWER++IA + L 
Sbjct: 153 HFFGDGRDTDPKSGAAYMEELVDFIKELGLGEIATVVGRYYAMDRDKRWERVEIALKGLV 212

Query: 181 KGVGEKSEDPLSTIRERF---SKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQ 236
            G GE SEDP++T++  +    K+  DEFL PIIV  +E  IK++DT+FFF++R+DR RQ
Sbjct: 213 LGEGEASEDPVATVKALYETDGKNNRDEFLLPIIVGGDERRIKDDDTVFFFNYRSDRARQ 272

Query: 237 IVQTFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           I Q  G      +P  P+    P+   +  MTRYK+++PF +AF PQ M+NVL+EW  K 
Sbjct: 273 ITQLLGDVDRSVLPDFPY----PKINKLVTMTRYKTDYPFDVAFEPQKMDNVLAEWLGKQ 328

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXX 345
            + Q HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS    
Sbjct: 329 NVEQVHVAETEKYAHVTFFFNGGVEKVFHLETRDQDQDLVPSNKAVATYDQAPEMSADGV 388

Query: 346 XXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYIL 405
                      KFPFVMNNFA PDMVGHTG Y+AA      TDKAIG I +ACK  GYIL
Sbjct: 389 ADQVAKRLAEQKFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKILDACKKEGYIL 448

Query: 406 FITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIG 464
           FITSDHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPTIL  +G
Sbjct: 449 FITSDHGNAEEMKFADGKPKTSHTTNKVPFIMANAPEGWSLKKQDGVLGDVAPTILAAMG 508

Query: 465 LETPKEMTGLSLLKK 479
           L  P+EMTG SLL K
Sbjct: 509 LPQPEEMTGESLLAK 523



>gi|342876395|gb|EGU78017.1| hypothetical protein FOXB_11494 [Fusarium oxysporum Fo5176]
          Length = 532

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 270/502 (53%), Positives = 343/502 (68%), Gaps = 25/502 (4%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA+TP+MD L K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 32  NAKTPIMDALYKDSKGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 91

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGV-------HSHINHLIHLLETAKN 112
           +KN +  + D I K F      NGR+H  GLVS GGV       H+   HL  LL+ AK 
Sbjct: 92  IKNGQLGQNDVIKKTFQNVAAGNGRLHLCGLVSHGGVQSLTPQQHAKQTHLYALLKAAKE 151

Query: 113 HGIPKAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERI 172
           +G+PK ++HFFGDGRDT+P+S   Y+++L     ++  G+I T++GRY+AMDRDKRW+R+
Sbjct: 152 YGLPKVFIHFFGDGRDTDPKSGAGYMQELVDTAKEIGIGEIGTVVGRYFAMDRDKRWDRL 211

Query: 173 KIAFEALTKGVGEKSEDPLSTIRERFSKD---ETDEFLKPIIV-DEEGIIKENDTLFFFD 228
           +IA + L  G GE SEDP++T++ R+ +    + DEFL PIIV  +E  IK++DT+FFF+
Sbjct: 212 EIALKGLVLGEGEASEDPVATVKARYERGGDFDRDEFLTPIIVGGDERRIKDDDTVFFFN 271

Query: 229 FRADRMRQIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLS 284
           +R+DR+RQI Q  G     P P F  K P+   +  MT+YK ++PF +AF PQ M NVL+
Sbjct: 272 YRSDRVRQITQLLGDVDRSPLPDF--KYPKIKPLVTMTQYKGDYPFEVAFKPQHMGNVLA 329

Query: 285 EWFAKHKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPE 339
           EW  K  + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PE
Sbjct: 330 EWLGKQNVEQVHIAETEKYAHVTFFFNGGVEKVFPLETRDQSQDLVPSNKSVATYDLAPE 389

Query: 340 MSXXXXXXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACK 399
           MS               KFPFVMNNFA PDMVGHTG YDAA    E TDKAIG I E CK
Sbjct: 390 MSADGVADQVVKRLGEQKFPFVMNNFAPPDMVGHTGVYDAAVIGCEATDKAIGKILEGCK 449

Query: 400 ANGYILFITSDHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAESTKGALCDVAP 457
             GY+LFIT+DHGNAE+M+  +G P T+HT N VP ++A+    +S  ++ +G L DVAP
Sbjct: 450 KEGYVLFITADHGNAEEMKFPDGKPKTSHTTNKVPLLMANYPEGWSLKKTDEGVLGDVAP 509

Query: 458 TILDVIGLETPKEMTGLSLLKK 479
           T+L  +GL  P+EMTG SLL+K
Sbjct: 510 TVLAAMGLPQPEEMTGKSLLQK 531



>gi|400601936|gb|EJP69561.1| putative phosphoglyceromutase [Beauveria bassiana ARSEF 2860]
          Length = 533

 Score =  526 bits (1356), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 267/496 (53%), Positives = 344/496 (69%), Gaps = 21/496 (4%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA+TPVMD+L K    YT LEA  LAVGLPEGLMGNSEVGHLN+GAGRVV+QD+VRID  
Sbjct: 35  NAKTPVMDELYKSATGYTELEASSLAVGLPEGLMGNSEVGHLNLGAGRVVWQDVVRIDQT 94

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  + N+   I K F+ A + NGR+H  GLVS GGVHS   HL  LL  AK + + + +
Sbjct: 95  IKKDELNDNAVIKKTFEGAAKGNGRLHLCGLVSHGGVHSKQTHLYALLRAAKKYEVKEVF 154

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFFGDGRDT+P+S   Y+++L   + ++  G+IAT++GRYYAMDRDKRW+R+++A + L
Sbjct: 155 IHFFGDGRDTDPKSGAGYMQELVDYLKEVGIGQIATVVGRYYAMDRDKRWDRVEVALKGL 214

Query: 180 TKGVGEKSEDPLSTIRERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GE+S+DP++T++ R+ K    + DEFL PIIV  +   IK++DT+FFF++R+DR R
Sbjct: 215 CLGEGEESDDPVATLKGRYEKGGSKDKDEFLTPIIVGGDNARIKDDDTVFFFNYRSDRAR 274

Query: 236 QIVQTFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAK 289
           QI Q  G      +P  P+    P+   +  MT YK+++PF +AF PQ M+NVL+EW  K
Sbjct: 275 QITQLLGDVDRSVLPDFPY----PKINKLVTMTMYKTDYPFDVAFEPQRMDNVLAEWLGK 330

Query: 290 HKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXX 344
             + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS   
Sbjct: 331 QNVEQVHIAETEKYAHVTFFFNGGVEKVFPLEERDQSQDLVPSNKAVATYDLAPEMSADG 390

Query: 345 XXXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYI 404
                      G+FPFVMNNFA PDMVGHTG YDAA    E TDK IG I E CK NGYI
Sbjct: 391 VADQVVKRMGEGRFPFVMNNFAPPDMVGHTGVYDAAIIGCEATDKGIGKILEGCKKNGYI 450

Query: 405 LFITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVI 463
           LF+T+DHGNAE+M+  +G P T+HT N VPF++A+    ++   + G L DVAPTIL  +
Sbjct: 451 LFVTADHGNAEEMKFADGKPKTSHTTNKVPFLMANAPEGWSLRKSGGVLGDVAPTILAAM 510

Query: 464 GLETPKEMTGLSLLKK 479
           GL  P+EMTG SLL K
Sbjct: 511 GLPQPEEMTGESLLDK 526



>gi|322700211|gb|EFY91967.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Metarhizium acridum CQMa 102]
          Length = 575

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 270/491 (54%), Positives = 341/491 (69%), Gaps = 13/491 (2%)

Query: 2   AETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           A+TPVMD+L      +T L+A  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 78  AKTPVMDELSNNAGGFTELDASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 137

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  + ++ + I K F  A   NGR+H  GLVS GGVHS   HL  LL  AK + +PK ++
Sbjct: 138 KKGELDDNEVIKKTFQGAAAGNGRLHLCGLVSHGGVHSKQEHLYALLRAAKKYQVPKVFI 197

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+++L   + ++  G+IAT++GRY+AMDRDKRWER++IA + + 
Sbjct: 198 HFFGDGRDTDPKSGAGYMQELVDYLKEVGIGQIATVVGRYFAMDRDKRWERVEIALKGMC 257

Query: 181 KGVGEKSEDPLSTIRERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQ 236
            G GE SEDP++T++ R+ +    + DEFL PIIV  +E  IK++DT+FFF++R+DR+RQ
Sbjct: 258 HGEGEASEDPVATVKARYERGGEKDRDEFLTPIIVGGDEARIKDDDTVFFFNYRSDRVRQ 317

Query: 237 IVQTFG-VPPPPFEA-KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           I Q  G V     E  K P+   +  MT YK+++PF +AF PQ M+NVL+EW AK  + Q
Sbjct: 318 ITQLLGDVDRSVLEDFKYPKINKLVTMTTYKTDYPFEVAFEPQRMDNVLAEWLAKQNVEQ 377

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXX 349
            HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS        
Sbjct: 378 VHVAETEKYAHVTFFFNGGVEKVFPLETRDQDQDLVPSNKSVATYDLAPEMSADGVADQV 437

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
                  KFPFVMNNFA PDMVGHTG Y+AA    E TDKAIG I E CK  GYILFIT+
Sbjct: 438 VKRLGEQKFPFVMNNFAPPDMVGHTGVYEAAITGCEATDKAIGKILEGCKKEGYILFITA 497

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETP 468
           DHGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPTIL  +GL  P
Sbjct: 498 DHGNAEEMKFADGKPKTSHTTNKVPFIMANAPEGWSLKKQGGVLGDVAPTILAAMGLPQP 557

Query: 469 KEMTGLSLLKK 479
            EMTG SLL K
Sbjct: 558 DEMTGESLLDK 568



>gi|302916525|ref|XP_003052073.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256733012|gb|EEU46360.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 524

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 269/493 (54%), Positives = 345/493 (69%), Gaps = 17/493 (3%)

Query: 2   AETPVMDKLKREY-PYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           A+TPVMD+L ++   +T LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 33  AQTPVMDELSKDSNGFTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQNI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F++ D I + F+ A   NGR+H  GLVS GGVHS   HL  LL+ AK + +PK ++
Sbjct: 93  KTGEFSKNDVIKRTFESAAAGNGRLHLCGLVSHGGVHSKQTHLYALLKAAKEYNVPKVFI 152

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+++L   + +L  G+I T++GRY+AMDRDKRW+R++IA + L 
Sbjct: 153 HFFGDGRDTDPKSGADYMQELVDTMKELEIGEIGTVVGRYFAMDRDKRWDRLEIALKGLC 212

Query: 181 KGVGEKSEDPLSTIRERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQ 236
            G GE SEDP++T+R R+ +    + DEFL PIIV  +E  IK++DT+FFF++R+DR+RQ
Sbjct: 213 HGEGEASEDPVATVRARYERGGDKDRDEFLTPIIVGGDERRIKDDDTVFFFNYRSDRVRQ 272

Query: 237 IVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKI 292
           I Q  G       P FE   P+   +  MT+YK ++PF +AF PQ M NVL+EW  K  +
Sbjct: 273 ITQLLGDVDRSVLPDFE--YPKINPLVTMTQYKGDYPFEVAFKPQHMGNVLAEWLGKQGV 330

Query: 293 SQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXX 347
            Q HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K V TYD  PEMS      
Sbjct: 331 KQVHVAETEKYAHVTFFFNGGVEKVFALETRDQSQDLVPSNKSVPTYDHAPEMSAAGVAD 390

Query: 348 XXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFI 407
                    +FPFVMNNFA PDMVGHTG Y+AA    E TDKAIG I EACK  GYILFI
Sbjct: 391 QVVKRLGEQEFPFVMNNFAPPDMVGHTGVYEAAIIGCEATDKAIGKILEACKKEGYILFI 450

Query: 408 TSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLE 466
           T+DHGNAE+M+  +G P T+HT N VPFI+A+    ++ +  +G L DVAPT+L  +GL 
Sbjct: 451 TADHGNAEEMKFPDGKPKTSHTTNKVPFIMANYPEGWSLQDNEGVLGDVAPTVLAAMGLP 510

Query: 467 TPKEMTGLSLLKK 479
            P+EMTG SLL+K
Sbjct: 511 QPEEMTGKSLLQK 523



>gi|449017153|dbj|BAM80555.1| phosphoglycerate mutase [Cyanidioschyzon merolae strain 10D]
          Length = 512

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 268/483 (55%), Positives = 336/483 (69%), Gaps = 9/483 (1%)

Query: 2   AETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           A+TPVMD+   +   +  L+A GLAVGLPEG+MGNSEVGHL IG+GR  YQD+VRIDLAV
Sbjct: 31  ADTPVMDEFYSKRRNFAELDASGLAVGLPEGVMGNSEVGHLTIGSGRPQYQDLVRIDLAV 90

Query: 61  KNKKFNEVDNIVKCFDRAKE-TNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           K     + + +++  DRAK  +NGR+H LGLVSDGGVHSH  HL  LLE  K+  +P+ Y
Sbjct: 91  KEGSLAKNETLLEAIDRAKTVSNGRMHLLGLVSDGGVHSHERHLHKLLEILKDANVPEVY 150

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLN-YGKIATIIGRYYAMDRDKRWERIKIAFEA 178
           VH F DGRDT+P S   ++E+L K +  L  + ++AT  GRYYAMDRDKRW+RI +A   
Sbjct: 151 VHAFTDGRDTDPHSGKGFIEKLLKHMRQLGEHMQLATCTGRYYAMDRDKRWDRIDLALRG 210

Query: 179 LTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIV 238
           L  G GE++ D L TI++R+   ETDEFLKPIIV ++G I   DTL FFDFR+DRMR+IV
Sbjct: 211 LVNGDGEETADVLDTIQKRYDGGETDEFLKPIIVCKKGCITSKDTLLFFDFRSDRMREIV 270

Query: 239 QTFGVPPPPFEAKI--PENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCH 296
           QT G  P P+E K+  P++L I CM++Y   FPFP+ FPP  M+NVL+EW   H + Q H
Sbjct: 271 QTLG-QPAPYETKVQVPKDLGIFCMSQYDIRFPFPVLFPPVEMKNVLAEWIGNHDLFQFH 329

Query: 297 VAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSG 356
            AETEK+AHVTFFFNGGVE+ +  E R LI SPKV TYDL+P+MS            +SG
Sbjct: 330 TAETEKYAHVTFFFNGGVEKAYKGEDRKLIPSPKVPTYDLEPKMSMYQVGEALIEAMKSG 389

Query: 357 KFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQ 416
           K+ F+M N A PDMVGHTG Y+A  +A    DK IG I+++C+  GY+L +T+DHGNAE 
Sbjct: 390 KYAFIMCNLAAPDMVGHTGVYEATVEACTHCDKVIGQIWKSCQELGYVLCVTADHGNAEC 449

Query: 417 MQDEEGNPHTAHTCNPVPFILA--SNKYSFA-ESTKGALCDVAPTILDVIGLETPKEMTG 473
           M  E+G P T+HT N VPFILA    K  F  ES+KG L DVAPTIL V+GL  PKEM G
Sbjct: 450 MLTEDGRPITSHTTNFVPFILADPDGKLHFKEESSKGTLADVAPTILSVMGLPIPKEMKG 509

Query: 474 LSL 476
             L
Sbjct: 510 RVL 512



>gi|346326764|gb|EGX96360.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Cordyceps militaris CM01]
          Length = 533

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 266/496 (53%), Positives = 342/496 (68%), Gaps = 21/496 (4%)

Query: 1   NAETPVMDKL-KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLA 59
           NA+TPVMD+L K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID  
Sbjct: 35  NAKTPVMDELYKSATGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQT 94

Query: 60  VKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAY 119
           +K  +  +   I K F+ A E+NGR+H  GLVS GGVHS   HL  LL  AK + + + +
Sbjct: 95  IKKDELKDNAVIKKTFESAAESNGRLHLCGLVSHGGVHSKQTHLYALLRAAKKYHVKEVF 154

Query: 120 VHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
           +HFF DGRDT+P+S   Y+++L   + ++  G+IAT++GRYYAMDRDKRWER++IA + L
Sbjct: 155 IHFFADGRDTDPKSGAGYMQELVDYLKEVGIGQIATVVGRYYAMDRDKRWERLEIALKGL 214

Query: 180 TKGVGEKSEDPLSTIRERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
             G GEKS+DP++T++ R+ K    + DEFL PIIV  + G IK++DT+FFF++R+DR+R
Sbjct: 215 CLGEGEKSDDPVATLKARYEKGGSKDKDEFLTPIIVGGDNGRIKDDDTVFFFNYRSDRVR 274

Query: 236 QIVQTFG------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAK 289
           QI Q  G      +P  P+    P    +  MT+YK+++PF +AF PQ M+NVL+EW  K
Sbjct: 275 QITQLLGDVDRSVLPDFPY----PAIKELVTMTKYKTDYPFEVAFEPQRMDNVLAEWLGK 330

Query: 290 HKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXX 344
             + Q H+AETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS   
Sbjct: 331 QNVEQVHIAETEKYAHVTFFFNGGVEKAFLLEERDQSQDLVPSNKLVATYDLAPEMSADG 390

Query: 345 XXXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYI 404
                       +FPFVMNNFA PDMVGHTG YDAA    E TD+ IG I E C+ + YI
Sbjct: 391 VADQVVKRLGEDRFPFVMNNFAPPDMVGHTGDYDAAIIGCEATDQGIGKILEGCRKHNYI 450

Query: 405 LFITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVI 463
           LFIT+DHGNAE+M+  +G P T+HT N VP ++A+    ++   + G L DVAPTIL  +
Sbjct: 451 LFITADHGNAEEMKFADGKPKTSHTTNKVPLLMANAPEGWSLRKSGGVLGDVAPTILAAM 510

Query: 464 GLETPKEMTGLSLLKK 479
           GL  P+EMTG SLL K
Sbjct: 511 GLPQPEEMTGESLLAK 526



>gi|512186599|gb|EPE02389.1| bisphosphoglycerate-independent phosphoglycerate mutase [Ophiostoma
           piceae UAMH 11346]
          Length = 485

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 263/476 (55%), Positives = 324/476 (68%), Gaps = 14/476 (2%)

Query: 16  YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNKKFNEVDNIVKCF 75
           +T LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID AVKN +F   + I    
Sbjct: 11  FTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQAVKNNEFASNEVISNTL 70

Query: 76  DRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFFGDGRDTNPRSSD 135
             AK   GR+H  GLVS GGVH+   HL  +L  AK   +P+ Y+HFFGDGRDT+P+S  
Sbjct: 71  QAAKNGTGRLHLCGLVSHGGVHAKQEHLYSILRAAKAAAVPEVYIHFFGDGRDTDPKSGA 130

Query: 136 KYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTKGVGEKSEDPLSTIR 195
            YL++L + I ++  G+IATI+GRYYAMDRDKRWER ++A + +  G GE S DPL T  
Sbjct: 131 GYLKELLENIKEIGTGEIATIVGRYYAMDRDKRWERNELALKGMILGEGEASADPLKTFE 190

Query: 196 ERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQTFG----VPPPPFEA 250
            R++  E DEFLKPIIV   +  IK+ D +FFF++R+DR+RQI Q  G     P P F  
Sbjct: 191 ARYAAGENDEFLKPIIVGGAQRRIKDKDVVFFFNYRSDRVRQITQLLGGVDRSPLPDF-- 248

Query: 251 KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETEKFAHVTFFF 310
             P+++ +  MT+YK+++PF +AF PQ M NVL+EW  K  + Q H+AETEK+AHVTFFF
Sbjct: 249 PFPKDITLVTMTQYKADYPFAIAFKPQHMGNVLAEWLGKEGVEQVHIAETEKYAHVTFFF 308

Query: 311 NGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXXXXXRSGKFPFVMNNF 365
           NGGVE+ F LE R    DL+ S K VATYD  PEMS                FPFVM NF
Sbjct: 309 NGGVEKVFPLETRDESQDLVPSNKAVATYDKAPEMSAAGVAKQVAKRLGDRAFPFVMTNF 368

Query: 366 ANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQDEEGNPH 425
           A PDMVGHTG Y+AA      TDK IG IYEACK   YILFIT+DHGNAE+M+  +G P 
Sbjct: 369 APPDMVGHTGVYEAAIVGCAATDKGIGEIYEACKKENYILFITADHGNAEEMKFADGKPK 428

Query: 426 TAHTCNPVPFILAS--NKYSFAESTKGALCDVAPTILDVIGLETPKEMTGLSLLKK 479
           T+HT N VPFI+A+    +S  +S +G L DVAPTIL  +GL  P+EMTG SLL K
Sbjct: 429 TSHTTNKVPFIMANAPAGWSLKQSDEGVLGDVAPTILAAMGLPQPEEMTGKSLLVK 484



>gi|440475184|gb|ELQ43885.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Magnaporthe oryzae Y34]
 gi|440487113|gb|ELQ66919.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Magnaporthe oryzae P131]
          Length = 528

 Score =  512 bits (1318), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 263/485 (54%), Positives = 331/485 (68%), Gaps = 27/485 (5%)

Query: 2   AETPVMDKLKR-EYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           AETPVMD+  R +  Y  LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD+VRID ++
Sbjct: 33  AETPVMDEFARSKTGYVELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDVVRIDQSI 92

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K  +F++ + I +  +  K  NGR+H  GLVS GGV             AK   +PK ++
Sbjct: 93  KTGEFSKNEVITQVIEAVKSGNGRLHLCGLVSHGGV------------AAKEAQVPKVFI 140

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P+S   Y+E+L +   ++  G+IAT++GRYYAMDRDKRWER+++A + L 
Sbjct: 141 HFFGDGRDTDPKSGVGYMEELLEKTKEIGIGQIATVVGRYYAMDRDKRWERVELAMKGLV 200

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQ 239
            G GE SEDP+ T++ER+ K E DEFLKPI+V  +EG IK+ D +FFF++R+DR+RQI Q
Sbjct: 201 LGEGEASEDPVKTVKERYEKGENDEFLKPIVVGGDEGRIKDGDNVFFFNYRSDRVRQITQ 260

Query: 240 TFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
             G     P P F       + +  MTRYK ++PF +AF PQ M NVL+EW  K  + Q 
Sbjct: 261 LLGDVDRSPRPDFPYP---KIKLATMTRYKLDYPFDVAFEPQKMGNVLAEWLGKQNVPQV 317

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXXXXXXX 350
           HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYD  PEMS         
Sbjct: 318 HVAETEKYAHVTFFFNGGVEKAFALEERDESQDLVPSNKSVATYDKAPEMSADGVADQVA 377

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 KFPFVMNNFA PDMVGHTG Y+AA      TDKAIG IYEACKA+ Y+LFIT+D
Sbjct: 378 KRLGEQKFPFVMNNFAPPDMVGHTGVYEAAIVGCAATDKAIGKIYEACKAHNYVLFITAD 437

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M+  +G P T+HT N VPFI+A+    ++ +   G L DVAPT+L  +GL  P+
Sbjct: 438 HGNAEEMKFPDGKPKTSHTTNKVPFIMANAPEGWSLKPVGGVLGDVAPTVLACMGLPQPE 497

Query: 470 EMTGL 474
           EMT L
Sbjct: 498 EMTAL 502



>gi|322708166|gb|EFY99743.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (iPGM)
           [Metarhizium anisopliae ARSEF 23]
          Length = 579

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 265/495 (53%), Positives = 337/495 (68%), Gaps = 17/495 (3%)

Query: 2   AETPVMDKLKREYP-YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           A+TPVMD+L      +T L+A  LAVGLP+GLMGNSEVGHLNIGAGRVV+QD+VRID  +
Sbjct: 78  AKTPVMDELSNNAEGFTELDASSLAVGLPDGLMGNSEVGHLNIGAGRVVWQDVVRIDQTI 137

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGV----HSHINHLIHLLETAKNHGIP 116
           K  + ++   I K F  A   NGR+H  GLVS GGV    HS   HL  LL  AK + +P
Sbjct: 138 KKGELDDNQVIKKTFQGAAAGNGRLHLCGLVSHGGVRPVQHSKQEHLYALLRAAKKYQVP 197

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K ++HFFGDGRDT+P+S   Y+++L   + ++  G+IAT++GRY+AMDRDKRWER++IA 
Sbjct: 198 KVFIHFFGDGRDTDPKSGAGYMQELVDYLKEVGIGQIATVVGRYFAMDRDKRWERVEIAL 257

Query: 177 EALTKGVGEKSEDPLSTIRERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRAD 232
           + +  G GE SEDP++T++ R+ +    + DEFL PIIV  +E  IK++DT+FFF++R+D
Sbjct: 258 KGMCHGEGEASEDPVATVKARYERGGNKDKDEFLTPIIVGGDEARIKDDDTVFFFNYRSD 317

Query: 233 RMRQIVQTFG-VPPPPFEA-KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           R+RQI Q  G V     E  K P+   +  MT YK+++PF +AF PQ M NVL+EW  K 
Sbjct: 318 RVRQITQLLGDVDRSVLEDFKYPKINKLVTMTTYKTDYPFEVAFEPQRMGNVLAEWLGKQ 377

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVR----DLIDSPK-VATYDLKPEMSXXXX 345
            + Q HVAETEK+AHVTFFFNGGVE+ F LE R    DL+ S K VATYDL PEMS    
Sbjct: 378 NVEQVHVAETEKYAHVTFFFNGGVEKVFPLETRDQDQDLVPSNKSVATYDLAPEMSADGV 437

Query: 346 XXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYIL 405
                      +FPFVMNNFA PDMVGHTG Y+AA    E TDKAIG I E CK  GYIL
Sbjct: 438 ADQVVKRLGEQQFPFVMNNFAPPDMVGHTGVYEAAIVGCEATDKAIGKILEGCKKEGYIL 497

Query: 406 FITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFA-ESTKGALCDVAPTILDVIG 464
           F+T+DHGNAE+M+  +G P T+HT N VPFI+ +    ++ +   G L DVAPTIL  +G
Sbjct: 498 FVTADHGNAEEMKFADGKPKTSHTTNKVPFIMTNAPEGWSLKKQGGVLGDVAPTILAAMG 557

Query: 465 LETPKEMTGLSLLKK 479
           L  P EMTG SLL K
Sbjct: 558 LPQPDEMTGESLLDK 572



>gi|242785760|ref|XP_002480662.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Talaromyces stipitatus ATCC 10500]
 gi|218720809|gb|EED20228.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Talaromyces stipitatus ATCC 10500]
          Length = 451

 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 247/421 (58%), Positives = 309/421 (73%), Gaps = 12/421 (2%)

Query: 2   AETPVMDKL-----KREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRI 56
           AETPVM        K    YT LEA  LAVGLPEGLMGNSEVGHLNIGAGRVV+QD VRI
Sbjct: 33  AETPVMSSFADPNAKVAQGYTELEASSLAVGLPEGLMGNSEVGHLNIGAGRVVWQDSVRI 92

Query: 57  DLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIP 116
           D  +KN K  E++NI K F RAK+ NGR+H LGLVSDGGVHS   HL  LL+ AK+ G+P
Sbjct: 93  DQTLKNGKLGEIENIRKSFQRAKDGNGRLHLLGLVSDGGVHSKNQHLYGLLQVAKDIGVP 152

Query: 117 KAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAF 176
           K  +HFFGDGRDT+P+SS KY+++L     +L  G++ T++GRYYAMDRDKRW+R++IA 
Sbjct: 153 KVIIHFFGDGRDTDPKSSTKYMQELLDKTKELGIGEVGTVVGRYYAMDRDKRWDRVEIAM 212

Query: 177 EALTKGVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMR 235
           + +  G GE S D + TI ER++K E DEFLKPIIV  +E  +++NDTLFFF++R+DR+R
Sbjct: 213 KGIVTGEGEDSSDLVKTIEERYAKGENDEFLKPIIVGGKENRVQDNDTLFFFNYRSDRVR 272

Query: 236 QIVQTFG----VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHK 291
           +I Q  G     P P F    P+++HIT MT+YK+++ FP+AFPPQ M NVL+EW  K  
Sbjct: 273 EITQLLGGYDRSPNPDF--PYPKDIHITTMTQYKTDYTFPIAFPPQHMGNVLAEWLGKKN 330

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           ++Q H+AETEK+AHVTFFFNGG+E+ F  E RD+I SP+VATYDL+P+MS          
Sbjct: 331 VTQSHIAETEKYAHVTFFFNGGIEKQFPGEERDMIPSPRVATYDLEPKMSAWAVGEKVVE 390

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                KF FVMNNFA PDMVGHTG Y+AA + +  TD+AIG IYEACK +GYILFIT+DH
Sbjct: 391 RLGENKFEFVMNNFAPPDMVGHTGVYEAAIQGVAETDRAIGHIYEACKKHGYILFITADH 450

Query: 412 G 412
           G
Sbjct: 451 G 451



>gi|346973721|gb|EGY17173.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Verticillium dahliae VdLs.17]
          Length = 522

 Score =  503 bits (1294), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 261/498 (52%), Positives = 335/498 (67%), Gaps = 40/498 (8%)

Query: 16  YTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNKKFNEVDNIVKCF 75
           +  LEA   AVGLP+GLMGNSEVGHLNIGAGRVV+QD+VRID  + +  F     +    
Sbjct: 11  FVELEASSNAVGLPKGLMGNSEVGHLNIGAGRVVWQDVVRIDANIDDGTFASNAVLKDMM 70

Query: 76  DRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFFGDGRDTNPRSSD 135
           + AK  NGR+H  GLVS GGVH+  +HL  +L+ AK + +PK ++HFFGDGRDT+P+S  
Sbjct: 71  EGAKSGNGRLHLCGLVSHGGVHAKQDHLYAILKAAKQYEVPKVFIHFFGDGRDTDPKSGA 130

Query: 136 KYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTKGVGEKSEDPLSTIR 195
            Y+E+L   + ++  G+IAT++GRYYAMDRDKRWERI+IA + +  G GE+S DP+ TI+
Sbjct: 131 AYMEELIGQLQEIGIGEIATVVGRYYAMDRDKRWERIEIALKGMILGEGEESTDPVQTIK 190

Query: 196 ERFSK---DETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQTFG------VPP 245
           +R++K    + DEFL PIIV  +E  IK++DT+FFF++R+DR+RQI Q  G      +P 
Sbjct: 191 DRYAKGGSKDKDEFLTPIIVGGQESRIKDDDTVFFFNYRSDRVRQITQVLGNVDRSVLPD 250

Query: 246 PPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETEKFAH 305
            P+    P    +  MTRYK+++PF +AF PQ M NVL+EW  K K+ Q HVAETEK+AH
Sbjct: 251 FPY----PNIKPLVTMTRYKTDYPFTVAFEPQHMGNVLAEWIGKQKVKQVHVAETEKYAH 306

Query: 306 VTFFFNGGVEEPFDLEV---RDLIDSPK-VATYDLKPEMSXXXXXXXXX----------- 350
           VTFFFNGGVE+ FDLEV   RDL+ S K VATYD  PEMS                    
Sbjct: 307 VTFFFNGGVEKVFDLEVRDERDLVPSVKSVATYDEAPEMSAAGVAKRVADRIAGEDQVDK 366

Query: 351 -XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
               ++ K+PFVMNNFA PDMVGHTG Y+ A  A + TD  I  IYEACKA+GYILFITS
Sbjct: 367 DTREKTEKYPFVMNNFAPPDMVGHTGNYEKAIIACKATDDGIKTIYEACKAHGYILFITS 426

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILAS--NKYSFAEST--------KGALCDVAPTI 459
           DHGNAE+M+ E+G P T+HT N VPFI+A+  N +S  +          +  L DVAPT+
Sbjct: 427 DHGNAEEMKFEDGKPKTSHTTNKVPFIMANAPNGWSLTDRVELKDGKVREPVLGDVAPTV 486

Query: 460 LDVIGLETPKEMTGLSLL 477
           L  +GL  P EMTG SLL
Sbjct: 487 LQAMGLPIPDEMTGQSLL 504



>gi|443920547|gb|ELU40450.1| phosphoglycerate mutase [Rhizoctonia solani AG-1 IA]
          Length = 1280

 Score =  498 bits (1282), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 259/494 (52%), Positives = 332/494 (67%), Gaps = 38/494 (7%)

Query: 2    AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
             +T  MD + +++   TL+AHGLAVGL +GLMGNSEVGHLNIGAGR+V+QDIVRID+++K
Sbjct: 790  GDTTNMDTIAKDHSARTLQAHGLAVGLSDGLMGNSEVGHLNIGAGRIVWQDIVRIDVSIK 849

Query: 62   NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             ++F++   I++    AK+T+GR+H LGLVSDGGVHSHINHL  LLETAK  G+PK  +H
Sbjct: 850  KREFHKNKTILESLKHAKDTSGRLHLLGLVSDGGVHSHINHLKALLETAKEIGVPKTIIH 909

Query: 122  FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F GDGRDT PRSS KYL+ L + I    YG+I TI+GRYY         R+K+A + L  
Sbjct: 910  FVGDGRDTAPRSSSKYLKDLLEFIQKEQYGEIGTIVGRYY---------RVKVAIDGLVS 960

Query: 182  GVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQT 240
            G GE + DP++TI ER+ KDETDEFLKPIIV  EE  IK+ DT+FFF++R+DRMR+IV  
Sbjct: 961  GEGESTSDPVATIEERYKKDETDEFLKPIIVGGEETRIKDKDTIFFFNYRSDRMREIVSV 1020

Query: 241  FGVPPPPFEAKIPENLHIT-CMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCH--- 296
            FG+P  P E  +P++L  + C+     +F + +     +   +      +H+I       
Sbjct: 1021 FGLPDKPMEVTVPKDLVSSLCLA---IDFDYDVGTAHYNHVKIQCRISLQHRIPSASNDQ 1077

Query: 297  ----------VAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXX 346
                      V ETEK+AHVTFFFNGGVE+ F+ E R+LI SPKVATYD +PEMS     
Sbjct: 1078 RLGRMSPLMLVLETEKYAHVTFFFNGGVEKQFEQEERELIPSPKVATYDKQPEMSAQGVA 1137

Query: 347  XXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                     GK+ FVM NFA PDMVGHTG Y+AA +AI  TDKA+  +Y+AC+  GY+L 
Sbjct: 1138 DKVAETVAGGKYDFVMCNFAPPDMVGHTGVYEAAVQAITATDKAVKTVYDACQKAGYVLA 1197

Query: 407  ITSDHGNAEQM-QDEEGNPHTAHTCNPVPFILASN--KYSFA--------ESTKGALCDV 455
            IT+DHGNAEQM   E GNPHTAHT NPVPFI+  +  KY           E  KGAL DV
Sbjct: 1198 ITADHGNAEQMINPETGNPHTAHTTNPVPFIITGDPSKYGLVGDEEDGEDEEGKGALADV 1257

Query: 456  APTILDVIGLETPK 469
            APTILD++GL+ P+
Sbjct: 1258 APTILDLMGLDKPE 1271



>gi|449687754|ref|XP_002157859.2| PREDICTED: 2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase-like, partial [Hydra magnipapillata]
          Length = 438

 Score =  489 bits (1258), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/436 (56%), Positives = 312/436 (71%), Gaps = 7/436 (1%)

Query: 48  VVYQDIVRIDLAVKNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLL 107
           ++++DIVRI++A+K +        +   + AKE +GRIH+LGLVSDGGVHSHI+HL+ LL
Sbjct: 2   ILFKDIVRINMAIKQRTLLNNQAFLDACNYAKEGSGRIHYLGLVSDGGVHSHIDHLLGLL 61

Query: 108 ETAKNHGIPKAYVHFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDK 167
           E  K   +PK +VHFF DGRDT P S+  YL+Q+Q  I++L YG IAT++GRYYAMDRDK
Sbjct: 62  ELTKLLDVPKCFVHFFADGRDTRPTSAVNYLKQVQDKIEELQYGSIATVMGRYYAMDRDK 121

Query: 168 RWERIKIAFEALTKGVGEK--SEDPLSTIRERFSKD----ETDEFLKPIIVDEEGIIKEN 221
           R ERIKIA+E LT+G+G+K  +++ +  I+ R+  +    +TDEFLKPII++E+G+I++ 
Sbjct: 122 RHERIKIAYEGLTQGIGQKVTAQNVIEVIQSRYDANGEERQTDEFLKPIILNEDGVIRDG 181

Query: 222 DTLFFFDFRADRMRQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMEN 281
           D+L F DFR+DRMRQIV+ F V      A +P+NL ITCMT YK EF  P+ F P + +N
Sbjct: 182 DSLIFIDFRSDRMRQIVEAFAVQRHFETAFVPKNLKITCMTEYKKEFGLPVLFSPDTPKN 241

Query: 282 VLSEWFAKHKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMS 341
           VL+E  + HKI Q H AETEK+AHVTFFFNGGVE+ F+LE R L+ SPKVATYDLKPEMS
Sbjct: 242 VLAEVLSSHKIKQYHCAETEKYAHVTFFFNGGVEKAFELEERKLVPSPKVATYDLKPEMS 301

Query: 342 XXXXXXXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKAN 401
                        S +FPFVM NFA PDMVGHTG Y+   KA EVTDKAIG I  AC  +
Sbjct: 302 AHEVGQVMVEAISSEEFPFVMCNFAPPDMVGHTGVYEPTIKACEVTDKAIGAIQSACLEH 361

Query: 402 GYILFITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILD 461
           GY L +TSDHGNAEQM  E+G PHTAHT N VPF +   K+   +    ALCDVA T+L 
Sbjct: 362 GYTLMVTSDHGNAEQMFSEQGGPHTAHTTNRVPFCVVGRKFRKIDHN-AALCDVAVTVLQ 420

Query: 462 VIGLETPKEMTGLSLL 477
            +G+E PKEMTG +LL
Sbjct: 421 EMGIEQPKEMTGQALL 436



>gi|401882184|gb|EJT46453.1| phosphoglycerate mutase [Trichosporon asahii var. asahii CBS 2479]
 gi|406701368|gb|EKD04515.1| phosphoglycerate mutase [Trichosporon asahii var. asahii CBS 8904]
          Length = 469

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/441 (53%), Positives = 302/441 (68%), Gaps = 18/441 (4%)

Query: 4   TPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNK 63
           T  MD ++ ++ +  L+A GLAVGL EGLMGNSEVG L+                   N 
Sbjct: 44  TTNMDHIRDKHNFAKLDASGLAVGLKEGLMGNSEVGTLSA---------------LTSND 88

Query: 64  KFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFF 123
            F     IV C   AK+TNGR+H +GL+SDGGVHSHINHLI L+  AK  G+P  Y+H F
Sbjct: 89  DFKNQPAIVDCLKHAKDTNGRLHLMGLLSDGGVHSHINHLIALIRAAKEQGVPHVYIHAF 148

Query: 124 GDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTKGV 183
           GDGRDT P+S+ KY++QLQ AI ++  G++ T +GRYYAMDRDKRW+R+K+A +AL KG 
Sbjct: 149 GDGRDTAPKSATKYVKQLQDAIKEIGCGELVTFVGRYYAMDRDKRWDRVKVAVDALVKGD 208

Query: 184 GEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQTFG 242
           G K++DP+  I + ++KDETDEF+KP+I  D+   +K+NDT+F F++R+DRMR+IV  F 
Sbjct: 209 GTKADDPVKAIEDCYAKDETDEFIKPLIFGDDSTRVKDNDTIFTFNYRSDRMREIVSLFA 268

Query: 243 VPPP-PFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETE 301
            P   P E  IP  L+IT M+RY  E+  P+AFPP SM+NVL+EW AK  +SQ HVAETE
Sbjct: 269 FPDDLPIEVDIPNGLYITTMSRYNPEWTLPVAFPPVSMDNVLAEWLAKEGVSQAHVAETE 328

Query: 302 KFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPFV 361
           K+AHVTFFFNGGVE+ +  E R +I SPKVATYD +PEMS            +  KF FV
Sbjct: 329 KYAHVTFFFNGGVEKQYAGEERFMIPSPKVATYDKQPEMSAQGVADKVAELIKEDKFDFV 388

Query: 362 MNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD-E 420
           M NFA PDMVGHTG YDAA KAI  TD A+  IY+AC+  GY+L IT+DHGNAEQM D +
Sbjct: 389 MCNFAPPDMVGHTGVYDAAVKAITATDAAVKTIYDACEEKGYVLCITADHGNAEQMIDLK 448

Query: 421 EGNPHTAHTCNPVPFILASNK 441
            G PHTAHT       LA+ +
Sbjct: 449 TGQPHTAHTTKMTGHSLATKE 469



>gi|116753488|ref|YP_842606.1| phosphoglyceromutase [Methanosaeta thermophila PT]
 gi|500014647|ref|WP_011695365.1| phosphoglyceromutase [Methanosaeta thermophila]
 gi|116664939|gb|ABK13966.1| phosphoglycerate mutase [Methanosaeta thermophila PT]
          Length = 505

 Score =  482 bits (1240), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/481 (48%), Positives = 315/481 (65%), Gaps = 3/481 (0%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            A  P +D+LK +YP+T+L A GL VGLP G MGNSEVGHLN+GAGR+VYQD  RI LA+
Sbjct: 25  GAHKPNLDRLKSQYPHTSLGASGLDVGLPRGQMGNSEVGHLNLGAGRIVYQDYTRISLAI 84

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +  +  +   +V    +A+++   +H +GL+SDGGVHSHI HL  LL+ AK  G  K YV
Sbjct: 85  EQDRLKDAKQLVDAMVKARDSGRNLHLMGLLSDGGVHSHITHLFALLDMAKELGAKKVYV 144

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H   DGRD  PRS+  Y+ QL++ +  +  G+IATI GRYYAMDRDKRW+R + A+ A+T
Sbjct: 145 HPILDGRDVPPRSALTYVTQLEEKLTRIGIGRIATISGRYYAMDRDKRWDRTEAAYRAMT 204

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQT 240
           +G+G  +   +  +R  + + ETDEFL P ++D  G+++E D++ FF+FR DR RQI + 
Sbjct: 205 EGLGIHAATAVEAVRLGYDRGETDEFLTPTVIDPNGLVREGDSIIFFNFRPDRARQITRA 264

Query: 241 FGVPP-PPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAE 299
           F  P    FE +      + CMT+Y      P+AFPP+ ++  L E  +K  ++Q  +AE
Sbjct: 265 FVQPDFNEFERRYLRPFFV-CMTQYDESIDAPVAFPPEYLKETLGEILSKAGLTQLRIAE 323

Query: 300 TEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFP 359
           TEK+AHVT+FFNGG EEPF  E R LI SPK+ TYDLKPEMS            +SGK+ 
Sbjct: 324 TEKYAHVTYFFNGGREEPFPGEDRILIPSPKIPTYDLKPEMSAPEVTSTVVERIKSGKYD 383

Query: 360 FVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD 419
            V+ N+ANPDMVGHTG Y+AA +A+E  D+ +G++ +   +   I  IT+DHGNAE+M D
Sbjct: 384 VVIMNYANPDMVGHTGIYEAAVRAVEAVDRGVGMVVDEVLSRRGIALITADHGNAEKMVD 443

Query: 420 EE-GNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGLSLLK 478
              G PHTAHT N VPFIL            G L DVAPTIL ++G+E P+ M+G SL+K
Sbjct: 444 RSTGEPHTAHTTNRVPFILVGCDRGIVLRDDGILADVAPTILALLGIEKPESMSGRSLIK 503

Query: 479 K 479
           K
Sbjct: 504 K 504



>gi|470316583|gb|EMR08329.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Pneumocystis murina B123]
          Length = 451

 Score =  481 bits (1238), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 225/373 (60%), Positives = 277/373 (74%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P+M  L ++Y    L+AHG AVGL EGLMGNSEVGHLNIGAGR+V+QD+VRID  VK
Sbjct: 32  ANIPIMSSLMKKYSSMELKAHGNAVGLTEGLMGNSEVGHLNIGAGRIVWQDLVRIDKTVK 91

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           NK F +V+ IV   +R+K  NGR H LGLVSDGGVHSHINHL HLLETAK  G+ + Y+H
Sbjct: 92  NKGFIQVEAIVSSMERSKAGNGRFHILGLVSDGGVHSHINHLFHLLETAKEIGLKEVYIH 151

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
           FF DGRDT+P SS KY+EQL   I DL  G++ATI+GRYYAMDRDKRWERI IA E +  
Sbjct: 152 FFSDGRDTSPLSSIKYVEQLMNKIKDLGIGELATIVGRYYAMDRDKRWERITIALEGIIY 211

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQTF 241
           G+GE+  D ++ I  R+ K+ETDEFLKPIIV+++G I + DTLFFF++R+DR+RQI Q  
Sbjct: 212 GIGEEDSDVINVINRRYQKNETDEFLKPIIVNKKGCISDGDTLFFFNYRSDRVRQITQVL 271

Query: 242 GVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAETE 301
           GV       +IP+NL IT MT+YK ++PFP+AFPPQ M+NVL+EW +K  I Q HVAETE
Sbjct: 272 GVDSTLTSLQIPKNLSITTMTQYKVDYPFPVAFPPQKMDNVLAEWLSKKGILQSHVAETE 331

Query: 302 KFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPFV 361
           K+AHVTFFFNGGVE+ F+ E RD++ SPKV+TYD  P+MS               K+PF+
Sbjct: 332 KYAHVTFFFNGGVEKQFEGEQRDMVPSPKVSTYDKDPKMSVDGVAQKISERITENKYPFI 391

Query: 362 MNNFANPDMVGHT 374
           M N A PDMVGH 
Sbjct: 392 MCNLAPPDMVGHV 404



>gi|153003134|ref|YP_001377459.1| phosphoglyceromutase [Anaeromyxobacter sp. Fw109-5]
 gi|500744357|ref|WP_011984581.1| phosphoglyceromutase [Anaeromyxobacter sp. Fw109-5]
 gi|152026707|gb|ABS24475.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Anaeromyxobacter sp. Fw109-5]
          Length = 516

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 240/495 (48%), Positives = 321/495 (64%), Gaps = 24/495 (4%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP MD L RE+P+T +E  GL+VGLPEG MGNSEVGH N+GAGR+VYQD+VRI+ AV+
Sbjct: 29  AGTPNMDALVREFPHTAIETSGLSVGLPEGQMGNSEVGHTNLGAGRIVYQDLVRINRAVE 88

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + D ++    RAKE+ G +H +GL+SDGGVHSH  HL  L E A+  G+P+ +VH
Sbjct: 89  DGSFFKNDALLMACRRAKESGGALHLMGLLSDGGVHSHEEHLFALAELARREGVPRTFVH 148

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P+S  +Y+ +L+K + D  +GK+AT+ GRYYAMDRDKRW+R+++A+ AL K
Sbjct: 149 AFMDGRDTPPKSGLEYMAKLEKVLRDKGHGKVATVSGRYYAMDRDKRWDRVEVAYRALVK 208

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIV-----DEEGIIKENDTLFFFDFRADRMRQ 236
           G G+++   ++ +   + +DETDEF+KP +V        G +++ D + FF+FRADR R+
Sbjct: 209 GEGQRAPGGVAAMEAAYGRDETDEFVKPTVVVNGDGKPVGPVRDGDAVLFFNFRADRARE 268

Query: 237 IVQTFG---------VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWF 287
           I +             P P   A +       CMT Y   FP P+A+ PQ +  +  E  
Sbjct: 269 ITRALTDEGFKDFDRGPAPRLSAYV-------CMTEYDKTFPHPVAYAPQDLTEIFPEIV 321

Query: 288 AKHKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXX 346
           A+  + Q   AETEK+AHVTFFFNGG E  F  E R L+ SP+ V TYD KPEMS     
Sbjct: 322 ARAGLKQLRCAETEKYAHVTFFFNGGRETVFPGEDRILVPSPRDVKTYDQKPEMSAREVT 381

Query: 347 XXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                   +G+  FV+ NFANPDMVGHTG  DAA KA++V D+ +G +++A KA    + 
Sbjct: 382 DKLVQAIGTGQHGFVLVNFANPDMVGHTGLLDAAVKAVKVVDECVGRLWQAAKAQRMAML 441

Query: 407 ITSDHGNAEQMQD-EEGNPHTAHTCNPVPFILASNKYSFAE-STKGALCDVAPTILDVIG 464
           +T+DHGN E M D + G PHTAHT NPVPFILA   +  A+   KG L DVAPT L V+G
Sbjct: 442 VTADHGNCEMMTDPQTGQPHTAHTLNPVPFILADPDFRGAKLRAKGVLADVAPTALQVMG 501

Query: 465 LETPKEMTGLSLLKK 479
           L  PKEM GL LL++
Sbjct: 502 LPQPKEMKGLGLLQR 516



>gi|490175827|ref|WP_004074457.1| phosphoglyceromutase [Desulfobacter postgatei]
 gi|389402596|gb|EIM64818.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfobacter postgatei 2ac9]
          Length = 521

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/484 (49%), Positives = 319/484 (65%), Gaps = 7/484 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP +D+L  EYP TTL+  G AVGLP+G MGNSEVGH+NIGAGR+V QD VRI+ A++
Sbjct: 31  ANTPFLDRLIDEYPNTTLKCCGEAVGLPDGTMGNSEVGHMNIGAGRIVAQDFVRINTAIR 90

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F     +V   D+ K+ +  +H LGL+SDGGVHSHINHL  L++ AKN GI + Y+H
Sbjct: 91  DNSFYSTPALVSVMDKVKKRDKNLHLLGLLSDGGVHSHINHLFALIKMAKNKGITRVYIH 150

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
              DGRDT+P S  K+L+QL + I D++ GK+AT+ GR++AMDRD RWER++ A+E  T+
Sbjct: 151 PIMDGRDTSPTSGIKFLKQLDEKIQDIDTGKVATMTGRFWAMDRDTRWERVQRAYELYTE 210

Query: 182 GVG--EKSEDPLSTIRERFSKDETDEFLKPIIV--DEEGIIKENDTLFFFDFRADRMRQI 237
           G+G    ++ P+  I+  + ++ETDEF+KP+      EG I++ D L FF+FRADR ++I
Sbjct: 211 GIGVDASNQSPVQAIQAAYDREETDEFIKPVYFCPGNEGKIEQGDGLIFFNFRADRAKEI 270

Query: 238 VQTFGVPP-PPFE-AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
            + F       FE    P      CMT+Y   F  P AF P+ ++ +  +  +++KISQ 
Sbjct: 271 TRAFTEKTFDGFERTTCPSLCDFVCMTQYDEHFDLPAAFAPEHLDKIFGQILSENKISQL 330

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXXR 354
            +AETEK+AHVT+FFNGG E  FD E R LI SP+ V TYD KPEMS            R
Sbjct: 331 RIAETEKYAHVTYFFNGGDEAVFDGEARILIPSPRDVETYDQKPEMSADKVADKACEQIR 390

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           SGKF FV+ NFAN DMVGHTG +DAA KA E  D+ +  + EA    G   FIT+DHGN+
Sbjct: 391 SGKFQFVVLNFANMDMVGHTGIFDAAVKACETVDRCVEKVVEAIWETGGTAFITADHGNS 450

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           EQM  ++G+PHTAHT NPV FI+A+          G L D+APTIL+V+G+  P EMTG 
Sbjct: 451 EQMLAQDGSPHTAHTLNPVRFIVAAKPALAISLLDGKLGDIAPTILNVLGIAQPLEMTGQ 510

Query: 475 SLLK 478
            L++
Sbjct: 511 CLIQ 514



>gi|220932416|ref|YP_002509324.1| phosphoglyceromutase [Halothermothrix orenii H 168]
 gi|501771819|ref|WP_012636512.1| phosphoglyceromutase [Halothermothrix orenii]
 gi|254799499|sp|B8CYG0.1|GPMI_HALOH RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|219993726|gb|ACL70329.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Halothermothrix orenii H 168]
          Length = 512

 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 238/486 (48%), Positives = 314/486 (64%), Gaps = 8/486 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            A TP +DK   EYP T L+A G AVGLPEG MGNSEVGHLN+GAGR+VYQD  RI+ A+
Sbjct: 28  QAHTPNLDKFFEEYPDTVLDASGEAVGLPEGQMGNSEVGHLNLGAGRIVYQDYTRINKAI 87

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +     E D +       K+ N  +H +GL+SDGGVHSHINHL  LLE A+   I K YV
Sbjct: 88  EEGTLPENDALKNAIQHVKDNNSALHLMGLLSDGGVHSHINHLFGLLEMARVKNIEKVYV 147

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H   DGRDT PRS++KYL QL++ + +L  G+IAT+ GRYY MDRD RW+R K +++AL 
Sbjct: 148 HPILDGRDTPPRSAEKYLNQLEEKLAELGIGEIATVSGRYYTMDRDNRWDRTKKSYDALV 207

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQ 236
            G G ++ D +S +++ ++ D++DEF+ P ++ +     G IK+ND + F++FRADR RQ
Sbjct: 208 LGEGLEASDAISALKQSYAADKSDEFVIPTVIKKNGQPVGTIKDNDAVIFYNFRADRARQ 267

Query: 237 IVQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I +   +     FE  A+ PENL+  CM  Y  EF  P+AFPP  ++N   E  +K    
Sbjct: 268 ITKALALEEFDEFERPAEHPENLYYVCMAEYDEEFNLPVAFPPLEIKNGFGEILSKEGFK 327

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q  +AETEK+AHVTFFFNGGVE+ +  E R L+ SPKVATYD KPEMS            
Sbjct: 328 QLRIAETEKYAHVTFFFNGGVEKKYPGEDRVLVPSPKVATYDEKPEMSAYEVTDKLLEKL 387

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
              K+  ++ NFANPDMVGHTG  DAA KA+E  D+ +G I       G  + +T+DHGN
Sbjct: 388 DEDKYDVIILNFANPDMVGHTGFMDAAVKAVEAVDECLGKIIPRIVDMGGQVLLTADHGN 447

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           +E+M+D EG PHTAHT N VP I             G L D+APT+L+++GL+TP+EMTG
Sbjct: 448 SEKMKDSEGKPHTAHTTNQVPLIYIGGPEGVG-VKPGKLADIAPTMLEILGLDTPEEMTG 506

Query: 474 LSLLKK 479
            SLL +
Sbjct: 507 QSLLTR 512



>gi|390351694|ref|XP_796254.3| PREDICTED: 2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase-like [Strongylocentrotus purpuratus]
          Length = 464

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 241/485 (49%), Positives = 308/485 (63%), Gaps = 52/485 (10%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMD+L+  + + +L+A G AVGLPEGLMGNSEVGHL IGAGR +YQ IV+IDLA+
Sbjct: 25  NAKTPVMDELQTSHQFISLDASGHAVGLPEGLMGNSEVGHLTIGAGRAMYQSIVKIDLAI 84

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K +        +    RAK  NGR+H LGLVSDGGVHSHINHL  LL   K   +P+ +V
Sbjct: 85  KERTLFVQKAYLNACQRAKAGNGRMHLLGLVSDGGVHSHINHLFALLGGMKEACVPQTFV 144

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           HFFGDGRDT+P S+ KYL+Q Q  + +L YG +AT++GRYYAMDRDKR ERIK+AFE L 
Sbjct: 145 HFFGDGRDTSPTSAVKYLKQTQDYLAELQYGSLATVMGRYYAMDRDKRDERIKVAFEGLV 204

Query: 181 KGVGEKS--EDPLSTIRERFSKD----ETDEFLKPIIVDEEGIIKENDTLFFFDFRADRM 234
           +G+GE +  E+ +  ++ R+ K+    +TDEFL PIIVD+EG I++ DTL F DFRADRM
Sbjct: 205 QGIGEATTKENVIQLVQSRYDKEGSERQTDEFLTPIIVDKEGCIRDGDTLMFIDFRADRM 264

Query: 235 RQIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           RQIV+   +      + +P+N+ +TCMT YK  F  P+ FPP+  +NVL+EW +   I Q
Sbjct: 265 RQIVEAIAIERKFETSVVPKNISVTCMTEYKESFNLPVIFPPEKAKNVLAEWLSAKGIPQ 324

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
            H AETEK+AHVTFFFNGGVE+ FD E R L+ SP+VATYDLKPEMS            +
Sbjct: 325 YHCAETEKYAHVTFFFNGGVEKQFDGEDRKLVPSPRVATYDLKPEMSVQGVADEVAATVK 384

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           S ++PFVM N A PDMVGHTG Y+A  KA E T                           
Sbjct: 385 SKRYPFVMCNLAPPDMVGHTGVYEATIKACEAT--------------------------- 417

Query: 415 EQMQDEEGNPHTAHTCNPVPF-ILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
                             VPF +  S K     S   +L DVAPT+L ++G + P +MTG
Sbjct: 418 ------------------VPFSMFNSGKKYIEPSHNASLQDVAPTVLKLMGHDIPADMTG 459

Query: 474 LSLLK 478
            SL++
Sbjct: 460 HSLVQ 464



>gi|220915378|ref|YP_002490682.1| phosphoglyceromutase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|501741694|ref|WP_012631678.1| phosphoglyceromutase [Anaeromyxobacter dehalogenans]
 gi|219953232|gb|ACL63616.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 516

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 237/486 (48%), Positives = 310/486 (63%), Gaps = 10/486 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP MD L+RE+P+  LE  GL+VGLPEG MGNSEVGH N+GAGR+VYQD+VRI+ AV+
Sbjct: 29  AGTPNMDALQREFPHAALETSGLSVGLPEGQMGNSEVGHTNLGAGRIVYQDLVRINRAVE 88

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + D ++    RA+E  G +H LGLVSDGGVHSH+ HL   LE A+  G+ +AYVH
Sbjct: 89  DGSFYKNDALLLACRRAREAGGALHLLGLVSDGGVHSHVEHLHACLELARREGVARAYVH 148

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P+S   YL  +++ +    YGK+AT+ GRY+AMDRDKRW+R+  A+ AL  
Sbjct: 149 AFMDGRDTPPKSGLDYLAAVERRLAATGYGKVATVTGRYWAMDRDKRWDRVAQAYAALVS 208

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIV-----DEEGIIKENDTLFFFDFRADRMRQ 236
           G G K+    + +   +++ ETDEF+KP +V        G I++ D + FF+FRADR R+
Sbjct: 209 GEGFKAASGTAAMEAAYARGETDEFVKPTVVVNGDGKPVGAIRDGDAILFFNFRADRARE 268

Query: 237 IVQTFGVPP-PPFEAK-IPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           I + F       FE K +P      CMT+Y   F  P+A+ PQ +  +  E  A+  + Q
Sbjct: 269 ITRAFTQDGFHDFERKAVPRLSAYVCMTQYDETFTLPVAYAPQDLTEIFPEIVARAGLRQ 328

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXX 353
              AETEK+AHVTFFFNGG E  F  E R L+ SP+ V TYD KPEMS            
Sbjct: 329 LRTAETEKYAHVTFFFNGGRETVFQNEDRILVPSPRDVKTYDEKPEMSAREVTDKLVQAL 388

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G++ F + N+ANPDMVGHTG  DAA KA+ V D+ +G +++A +  G  + +T+DHGN
Sbjct: 389 GTGQYGFTLVNYANPDMVGHTGLLDAAVKAVRVVDECVGRLWQAARKQGMAMLVTADHGN 448

Query: 414 AEQMQDE-EGNPHTAHTCNPVPFILASNKYSFAE-STKGALCDVAPTILDVIGLETPKEM 471
            E M D   G PHTAHT NPVPFILA      A+   KG L DVAPT L V+GL  PKEM
Sbjct: 449 CEMMTDPVTGQPHTAHTLNPVPFILADPDLRGAKLREKGVLADVAPTALQVMGLPQPKEM 508

Query: 472 TGLSLL 477
            GL L+
Sbjct: 509 KGLGLV 514



>gi|308273470|emb|CBX30072.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [uncultured Desulfobacterium sp.]
          Length = 515

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 235/486 (48%), Positives = 315/486 (64%), Gaps = 8/486 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP +D +K+EYP T+L+  G AVGLPEG+MGNSEVGHLNIGAGRVVYQD++RID A++
Sbjct: 30  ANTPFLDSIKKEYPSTSLKCSGEAVGLPEGIMGNSEVGHLNIGAGRVVYQDLLRIDKAIR 89

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +K   + + + +    A+E    +HF+GL+SDGGVHS INHL  LL+ AK  G+   Y+H
Sbjct: 90  DKSLLKNEALCRIMKNAEENKAALHFIGLLSDGGVHSQINHLFALLDMAKASGLKNIYIH 149

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
              DGRDT P S  KY++QLQ  ID+   GK+A++ GRY+AMDRD RW R++ A+   T 
Sbjct: 150 AILDGRDTAPDSGIKYMQQLQDYIDEKGVGKVASVCGRYFAMDRDNRWNRVEKAYRLYTN 209

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDE-----EGIIKENDTLFFFDFRADRMRQ 236
           G G K ++P+  I++ + K+ETDEF+KPII+ +     EGIIK+ND + FF+FR+DR R+
Sbjct: 210 GEGTKEKNPVDAIKKAYLKNETDEFVKPIIITDKDENPEGIIKDNDAVVFFNFRSDRARE 269

Query: 237 IVQTFGVPPPPFEAK--IPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           I +    P   F ++   P+     CMT+Y  +F  PLAFPP  + ++L E  +K  + Q
Sbjct: 270 ITRALTDPDFTFFSRSFFPKLTGFVCMTQYDEKFTLPLAFPPVHLTDILGEVISKKGLKQ 329

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXX 353
             +AETEK+AHVT+F NGG E PF LE R LI SP+ V TYD KPEMS            
Sbjct: 330 LRIAETEKYAHVTYFLNGGEENPFPLEERCLIPSPREVPTYDKKPEMSARLVTAELLSRL 389

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
           +S  + F+  NFAN DMVGHTG  +AA  A E  D  +  I  A K    +L IT+DHGN
Sbjct: 390 QSTHYDFIALNFANMDMVGHTGVIEAAIFACETIDSCVSQIASAVKKQNGVLLITADHGN 449

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           AE M DE  +  T+HT NPVP IL  +     +   G L D+APTIL+++ +E P  MTG
Sbjct: 450 AETMLDEHKHVQTSHTLNPVPLILVDDSRKKVKLRNGVLGDIAPTILEIMEIEKPALMTG 509

Query: 474 LSLLKK 479
            SL++K
Sbjct: 510 ESLIEK 515



>gi|489636174|ref|WP_003540614.1| phosphoglyceromutase [Desulfotomaculum nigrificans]
 gi|323533349|gb|EGB23216.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Desulfotomaculum nigrificans DSM 574]
          Length = 517

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/490 (48%), Positives = 306/490 (62%), Gaps = 16/490 (3%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            AETP + K    YPYT LE  GLAVGLPEG MGNSEVGHLN+GAGRVVYQ++ RI  ++
Sbjct: 29  QAETPNIKKFMANYPYTALECSGLAVGLPEGQMGNSEVGHLNMGAGRVVYQELTRITKSI 88

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K+  F     +VK   +AKE N  +H +GL+SDGGVHSHI H+   L  A   G+   Y 
Sbjct: 89  KDGDFFSNPELVKAAQKAKENNAALHIMGLLSDGGVHSHIKHIFAALRLAARQGLTGVYF 148

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRD  P S+ +Y+  L   + +L  G++AT+ GRYYAMDRD+RWER + A+ A+ 
Sbjct: 149 HAFLDGRDVPPASAKEYMRALLAKMKELGVGQVATVSGRYYAMDRDRRWERTEQAYRAMV 208

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE-----GIIKENDTLFFFDFRADRMR 235
              G ++  P+  I   + + ETDEF+KP ++ +E       I + D++ F +FR DR R
Sbjct: 209 YAEGLQANSPVEAIDAAYERGETDEFVKPTVITDEHKQPVARIADGDSVIFINFRPDRAR 268

Query: 236 QIVQTF------GVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAK 289
           QI + F      G    P   ++    H  CMT Y      P+AFPP  + N L EW +K
Sbjct: 269 QITRAFVDDDFTGFNRGPGRPRV----HFVCMTVYDKTIEAPVAFPPHQLVNTLGEWLSK 324

Query: 290 HKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXX 349
             + Q  +AETEK+AHVTFFFNGGVE P   E R LI SPKVATYDLKPEMS        
Sbjct: 325 QGLKQLRLAETEKYAHVTFFFNGGVEPPNPNEERILIPSPKVATYDLKPEMSANEITDAF 384

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
               + G F  ++ NFANPDMVGHTG  +A   AIE  DK +G I  A       + IT+
Sbjct: 385 LANLQKGTFDVIITNFANPDMVGHTGDLEATKSAIETVDKCLGRIAPAMLEKSGTVIITA 444

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETP 468
           DHGNAE+M+D+ G P+TAHT +PVPF+L S++Y  A+  + G+L D+APT+LD++GL  P
Sbjct: 445 DHGNAEKMRDDHGGPYTAHTTDPVPFVLVSDRYKGAKLREGGSLPDIAPTMLDILGLPKP 504

Query: 469 KEMTGLSLLK 478
            EMTG SLLK
Sbjct: 505 PEMTGESLLK 514



>gi|333922364|ref|YP_004495944.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfotomaculum carboxydivorans CO-1-SRB]
 gi|503575363|ref|WP_013809439.1| phosphoglyceromutase [Desulfotomaculum carboxydivorans]
 gi|333747925|gb|AEF93032.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfotomaculum carboxydivorans CO-1-SRB]
          Length = 517

 Score =  468 bits (1205), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 236/490 (48%), Positives = 305/490 (62%), Gaps = 16/490 (3%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            AETP + K    YPYT LE  GLAVGLPEG MGNSEVGHLN+GAGRVVYQ++ RI  ++
Sbjct: 29  QAETPNIKKFMANYPYTALECSGLAVGLPEGQMGNSEVGHLNMGAGRVVYQELTRITKSI 88

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K+  F     +VK   +AKE N  +H +GL+SDGGVHSHI H+   L  A   G+   Y 
Sbjct: 89  KDGDFFSNPELVKAAQKAKENNAALHIMGLLSDGGVHSHIKHIFAALRLAARQGLTGVYF 148

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRD  P S+  Y+  L   + +L  G++AT+ GRYYAMDRD+RWER + A+ A+ 
Sbjct: 149 HAFLDGRDVPPASAKGYMRALLAKMKELGVGQVATVSGRYYAMDRDRRWERTEQAYRAMV 208

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE-----GIIKENDTLFFFDFRADRMR 235
              G ++  P+  I   + + ETDEF+KP ++ +E       I + D++ F +FR DR R
Sbjct: 209 YAEGLQANSPVEAIDVAYERGETDEFVKPTVITDEHKQPVARIADGDSVIFINFRPDRAR 268

Query: 236 QIVQTF------GVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAK 289
           QI + F      G    P   ++    H  CMT Y      P+AFPP  + N L EW +K
Sbjct: 269 QITRAFVDDDFTGFNRGPGRPRV----HFVCMTVYDKTIEAPVAFPPHQLVNTLGEWLSK 324

Query: 290 HKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXX 349
             + Q  +AETEK+AHVTFFFNGGVE P   E R LI SPKVATYDLKPEMS        
Sbjct: 325 QGLKQLRLAETEKYAHVTFFFNGGVEPPNPNEERILIPSPKVATYDLKPEMSANEITDAF 384

Query: 350 XXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITS 409
               + G F  ++ NFANPDMVGHTG  +A   AIE  DK +G I  A       + IT+
Sbjct: 385 LANLQKGTFDVIITNFANPDMVGHTGDLEATKSAIETVDKCLGRIVPAMLEKSGTVIITA 444

Query: 410 DHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETP 468
           DHGNAE+M+D+ G P+TAHT +PVPF+L S++Y  A+  + G+L D+APT+LD++GL  P
Sbjct: 445 DHGNAEKMRDDHGGPYTAHTTDPVPFVLVSDRYKGAKLREGGSLPDIAPTMLDILGLPKP 504

Query: 469 KEMTGLSLLK 478
            EMTG SLLK
Sbjct: 505 PEMTGESLLK 514



>gi|197120666|ref|YP_002132617.1| phosphoglyceromutase [Anaeromyxobacter sp. K]
 gi|501516387|ref|WP_012524324.1| phosphoglyceromutase [Anaeromyxobacter sp. K]
 gi|196170515|gb|ACG71488.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Anaeromyxobacter sp. K]
          Length = 516

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 236/486 (48%), Positives = 310/486 (63%), Gaps = 10/486 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP MD L+RE+P+  LE  GL+VGLPEG MGNSEVGH N+GAGR+VYQD+VRI+ AV+
Sbjct: 29  AGTPNMDALQREFPHAALETSGLSVGLPEGQMGNSEVGHTNLGAGRIVYQDLVRINRAVE 88

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + D ++    RA+E  G +H LGLVSDGGVHSH+ HL   LE A+  G+ +AYVH
Sbjct: 89  DGSFYKNDALLLACRRAREAGGALHLLGLVSDGGVHSHVEHLHACLELARREGVARAYVH 148

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P+S   YL  +++ +    YGK+AT+ GRY+AMDRDKRW+R+  A+ AL  
Sbjct: 149 AFMDGRDTPPKSGLDYLAAVERRLAATGYGKVATVTGRYWAMDRDKRWDRVAQAYAALVS 208

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIV-----DEEGIIKENDTLFFFDFRADRMRQ 236
           G G K+    + +   +++ ETDEF+KP +V        G I++ D + FF+FRADR R+
Sbjct: 209 GEGFKAASGTAAMEAAYARGETDEFVKPTVVVNGDGKPVGAIRDGDAILFFNFRADRARE 268

Query: 237 IVQTFGVPP-PPFEAK-IPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           I + F       FE K +P      CMT+Y   F  P+A+ PQ +  +  E  A+  + Q
Sbjct: 269 ITRAFTQEGFHDFERKAVPRLSAYVCMTQYDETFTLPVAYAPQDLTEIFPEIVARAGLRQ 328

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXX 353
              AETEK+AHVTFFFNGG E  +  E R L+ SP+ V TYD KPEMS            
Sbjct: 329 LRTAETEKYAHVTFFFNGGRETVYQNEDRILVPSPRDVKTYDEKPEMSAREVTDKLVQAL 388

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G++ F + N+ANPDMVGHTG  DAA KA+ V D+ +G +++A +  G  + +T+DHGN
Sbjct: 389 GTGQYGFTLVNYANPDMVGHTGLLDAAVKAVRVVDECVGRLWQAARKQGMAMLVTADHGN 448

Query: 414 AEQMQDE-EGNPHTAHTCNPVPFILASNKYSFAE-STKGALCDVAPTILDVIGLETPKEM 471
            E M D   G PHTAHT NPVPFILA      A+   KG L DVAPT L V+GL  PKEM
Sbjct: 449 CELMTDPVTGQPHTAHTLNPVPFILADPDLRGAKLREKGVLADVAPTALQVMGLPQPKEM 508

Query: 472 TGLSLL 477
            GL L+
Sbjct: 509 KGLGLV 514



>gi|435854765|ref|YP_007316084.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Halobacteroides halobius DSM 5150]
 gi|505140603|ref|WP_015327705.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Halobacteroides halobius]
 gi|433671176|gb|AGB41991.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Halobacteroides halobius DSM 5150]
          Length = 511

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 235/479 (49%), Positives = 306/479 (63%), Gaps = 3/479 (0%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP  DKL  EYP TT+EA G AVGLP+G MGNSEVGH+N+GAGRVVYQD  RI++AV+
Sbjct: 29  ANTPNFDKLSNEYPSTTVEASGKAVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRINMAVR 88

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           N +  + + I K  ++ K     +H +GL+SDGGVHSHINHL  LLE A+  GI   YVH
Sbjct: 89  NNELVDNEAIAKAIEKVKNQGTALHLVGLLSDGGVHSHINHLFGLLEMAERVGIEDVYVH 148

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
              DGRDT P+S+ KY+EQL+  + +L  G+IATI GRYY MDRD  WER + A+ A+  
Sbjct: 149 AILDGRDTPPQSAKKYVEQLEDKMKELGVGQIATIGGRYYYMDRDNNWERTEKAYNAMCL 208

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQTF 241
             G +++  L  I   + +D TDEF+ P ++ +   + E+D++ FF+FRADR RQ+ +  
Sbjct: 209 AEGNRAKSALEAIEASYQEDVTDEFVIPTVITDNSEVAEDDSIIFFNFRADRARQLTRAL 268

Query: 242 G-VPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVAET 300
                  F+     N H+ CMT Y      P+AFPP  +EN+ S+  A + + Q   AET
Sbjct: 269 NDTDFNGFDRSSYSNAHLVCMTEYDETIDAPVAFPPVELENIFSQVLADNDLKQLRTAET 328

Query: 301 EKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGKFPF 360
           EK+AHVTFFFNGG EE F  E R+LI SP VATYD KPEMS                +  
Sbjct: 329 EKYAHVTFFFNGGKEEAFKGEDRELISSPDVATYDQKPEMSAYEVTDNLVEKIAEQDYDV 388

Query: 361 VMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQMQD- 419
           V+ N+ANPDMVGHTG +DA  +A+EV D+ +G   +A    G    IT+DHGN EQM D 
Sbjct: 389 VVLNYANPDMVGHTGDFDAEVEALEVVDECLGKTVDAILEQGGSALITADHGNGEQMVDY 448

Query: 420 EEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKEMTGLSLL 477
           E G P TAHT NPVPFI  + K+  A+  K G L D APT+L+++GLE P+EMTG  L+
Sbjct: 449 ETGEPFTAHTTNPVPFIYVNPKHKDAKLIKDGKLADFAPTMLNLLGLEVPEEMTGQQLI 507



>gi|83589134|ref|YP_429143.1| phosphoglyceromutase [Moorella thermoacetica ATCC 39073]
 gi|499711075|ref|WP_011391809.1| phosphoglyceromutase [Moorella thermoacetica]
 gi|123525149|sp|Q2RLT9.1|GPMI_MOOTA RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|83572048|gb|ABC18600.1| phosphoglycerate mutase [Moorella thermoacetica ATCC 39073]
          Length = 513

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 238/483 (49%), Positives = 311/483 (64%), Gaps = 12/483 (2%)

Query: 5   PVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVKNKK 64
           P   +L   YP+T L A G AVGLP G MGNSEVGHLNIGAGR+VYQ++ RI  A+++  
Sbjct: 34  PNYRRLLAGYPHTRLRASGEAVGLPAGQMGNSEVGHLNIGAGRIVYQELTRISKAIRDGS 93

Query: 65  FNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVHFFG 124
           F     +V     A+E  G +H +GLVSDGGVHSH++HL  LL+ AK  G+ + Y+H F 
Sbjct: 94  FFSNAALVGAVRAAREHGGALHLMGLVSDGGVHSHLDHLYALLDLAKREGLERVYIHAFL 153

Query: 125 DGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTKGVG 184
           DGRD  P S+  YLEQ++        G IATI+GRYYAMDRD+RWER   A+ AL  G G
Sbjct: 154 DGRDVPPASAAGYLEQVEDECRQKGIGAIATIMGRYYAMDRDRRWERTARAYRALVAGEG 213

Query: 185 EKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQIVQT 240
            ++  P   IR  + +D TDEF++P ++  +G     ++E D++ FF+FRADR RQ+ + 
Sbjct: 214 HQASSPSEAIRASYERDITDEFVEPAVITRDGRPLATVREGDSVVFFNFRADRARQLTRA 273

Query: 241 FGVPPPPFEA-KIPE---NLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCH 296
           F      F+A + P    ++   C+T+Y    P P+AFPPQ ++NVL E  A   + Q  
Sbjct: 274 F--VDRDFDAFERPGGRLDIQFVCLTQYDVTIPAPVAFPPQVLQNVLGEVIAGAGLKQLR 331

Query: 297 VAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSG 356
           +AETEK+AHVTFFFNGGVEEPF  E R LI SPKVATYD KP MS            R  
Sbjct: 332 IAETEKYAHVTFFFNGGVEEPFPGEDRLLIPSPKVATYDQKPSMS--AREVTDAVLERLD 389

Query: 357 KFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQ 416
           K+ F++ NFANPDMVGHTG   AA  A+E  D+ IG I +A       L +T+DHGNAE+
Sbjct: 390 KYDFIVLNFANPDMVGHTGDLAAAIAAVETVDECIGRIVQAMAERRAPLLLTADHGNAEE 449

Query: 417 MQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGLSL 476
           M++ +G PHTAHT N VPFIL  ++Y  A   +GAL DVAPT+LD++ ++ P EMTG SL
Sbjct: 450 MREPDGEPHTAHTSNLVPFILVDDRYRGASLREGALEDVAPTVLDILHIQQPAEMTGKSL 509

Query: 477 LKK 479
           + K
Sbjct: 510 IVK 512



>gi|495161616|ref|WP_007886415.1| phosphoglyceromutase [Roseburia inulinivorans]
 gi|225211431|gb|EEG93785.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Roseburia inulinivorans DSM 16841]
          Length = 512

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 236/485 (48%), Positives = 312/485 (64%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPVMD+L +EYP+    A GLAVGLP+G MGNSEVGH+N+GAGR+VYQ++ RI   + 
Sbjct: 28  AKTPVMDQLMKEYPFVKGNASGLAVGLPDGQMGNSEVGHMNMGAGRIVYQELTRITKEIN 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F +   ++   +  K+ N  +H  GL+SDGGVHSHI H+  LLE AK  GI   YVH
Sbjct: 88  DGDFFKNQALLDGMENVKKNNSDLHLYGLLSDGGVHSHITHVYGLLELAKREGIKNVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++E L+  + +L  GKIA+I GRYYAMDRD RW+R++ A+  LTK
Sbjct: 148 CFLDGRDTAPTSGKGFIEALEAKMAELGVGKIASISGRYYAMDRDNRWDRVEKAYNVLTK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GE++E  ++ +   ++KD TDEF  P  + E G     IK+NDT+ FF+FR DR R++
Sbjct: 208 GEGEQAESAVAAMDASYAKDVTDEFFVPTAITENGKPVATIKDNDTVIFFNFRPDRAREL 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFP-LAFPPQSMENVLSEWFAKHKISQC 295
            + F +     FE    +N+   C T Y +  P   +AF    ++N   E+ A H + Q 
Sbjct: 268 TRAFCMDEFDGFERGARKNVAYICFTEYDATIPNKEVAFKKVELKNTFGEYLAAHGMKQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDL+PEMS            RS
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPKVATYDLQPEMSAPEVCDKLCAAIRS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG  +AA KA+E  D  +G   +A K     LFI +DHGNAE
Sbjct: 388 EKYDVIVINFANPDMVGHTGILEAAIKAVETVDTCVGKAVDAIKEVNGQLFICADHGNAE 447

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+ D E G P TAHT NPVPFIL +   S+     G L D+ PT+++++G+E P EMTG 
Sbjct: 448 QLVDYETGAPFTAHTTNPVPFILVNADPSYKLRENGCLADIIPTLIELMGMEQPAEMTGK 507

Query: 475 SLLKK 479
           SLL K
Sbjct: 508 SLLVK 512



>gi|319789623|ref|YP_004151256.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Thermovibrio ammonificans HB-1]
 gi|503302740|ref|WP_013537401.1| phosphoglyceromutase [Thermovibrio ammonificans]
 gi|317114125|gb|ADU96615.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Thermovibrio ammonificans HB-1]
          Length = 528

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 241/500 (48%), Positives = 318/500 (63%), Gaps = 25/500 (5%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP  D L   YP+  L+A G AVGLPEG MGNSEVGH NIGAGR+V+QDIVRI  A++
Sbjct: 27  ANTPFWDYLWETYPHGLLKASGEAVGLPEGQMGNSEVGHTNIGAGRIVWQDIVRITKAME 86

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F +   IVK  + AKE   ++HF+GL+SDGGVHSHI HL  LL+ AK  G PK  VH
Sbjct: 87  RGEFLKNPVIVKAVETAKEKGKKLHFIGLLSDGGVHSHIKHLFGLLDAAKALGAPKVCVH 146

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
              DGRDT P+S++ YL+ L + + ++  GK+AT+ GRYY MDRDKRW+R + A+ A+  
Sbjct: 147 AILDGRDTPPKSAEPYLKALLEKLKEVGNGKVATMGGRYYYMDRDKRWQRTEKAYNAMVL 206

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQTF 241
           G G +  DP+  + + +++ ETDEF+KP +++ + +++E D LFFF+FRADRMRQIV   
Sbjct: 207 GEGFRCTDPIKALHDAYARGETDEFVKPYVINPDCLVEEGDVLFFFNFRADRMRQIVAAL 266

Query: 242 GVPPPPFEA----KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHV 297
           G+    F      K P+  ++  MT Y   FPF +AFPPQ ++NVL E  +K    Q  +
Sbjct: 267 GL--KDFNGFKRKKWPQPSYLATMTLYDETFPFDVAFPPQELKNVLGEVISKLGYKQLRI 324

Query: 298 AETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSGK 357
           AETEK+AHVT+FFNGG EEPF  E R L+ SPKVATYDLKPEMS            +SG+
Sbjct: 325 AETEKYAHVTYFFNGGREEPFPGEDRILVPSPKVATYDLKPEMSAPEVTEKVVERIKSGE 384

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
           +  V+ N+ANPDMVGHTG   A  KAIE  D  +  + +A    G +  +T+DHGNAEQM
Sbjct: 385 YKLVVLNYANPDMVGHTGNLQATIKAIETVDSCLKQVVKATLEMGGVCVVTADHGNAEQM 444

Query: 418 QD-EEGNPHTAHTCNPVPFIL---ASNKYSFAESTK---------------GALCDVAPT 458
            D E G P TAHT NPVPF++   +   Y      K               G L D+AP+
Sbjct: 445 IDPETGGPWTAHTTNPVPFVVVKGSCGSYRVKRRDKSDVELPQEFAGVPVVGILGDIAPS 504

Query: 459 ILDVIGLETPKEMTGLSLLK 478
           IL ++G E P EMTG  +++
Sbjct: 505 ILYILGEEIPPEMTGCVIVE 524



>gi|86156664|ref|YP_463449.1| phosphoglyceromutase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|499738561|ref|WP_011419295.1| phosphoglyceromutase [Anaeromyxobacter dehalogenans]
 gi|85773175|gb|ABC80012.1| phosphoglycerate mutase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 516

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 236/486 (48%), Positives = 310/486 (63%), Gaps = 10/486 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP MD L+RE+P+  LE  GL+VGLPEG MGNSEVGH N+GAGR+VYQD+VRI+ AV+
Sbjct: 29  AGTPNMDALQREFPHAALETSGLSVGLPEGQMGNSEVGHTNLGAGRIVYQDLVRINRAVE 88

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + D ++    RA+E  G +H LGLVSDGGVHSH+ HL   LE A+  G+ + YVH
Sbjct: 89  DGSFYKNDALLLACRRAREAGGALHLLGLVSDGGVHSHVEHLHACLELARREGVARTYVH 148

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P+S   YL  +++ I    YGK+AT+ GRY+AMDRDKRW+R+  A+ A+  
Sbjct: 149 AFMDGRDTPPKSGLDYLAAVERRIAAAGYGKVATVTGRYWAMDRDKRWDRVAQAYAAMVS 208

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIV-----DEEGIIKENDTLFFFDFRADRMRQ 236
           G G K+    + +   +++ ETDEF+KP +V        G I++ D + FF+FRADR R+
Sbjct: 209 GEGFKAASGAAAMEAAYARGETDEFVKPTVVVNGDGKPVGSIRDGDAILFFNFRADRARE 268

Query: 237 IVQTFGVPP-PPFEAK-IPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           I + F       FE K +P      CMT+Y   F  P+A+ PQ +  +  E  A+  + Q
Sbjct: 269 ITRAFTQDGFHDFERKAVPRLSAYVCMTQYDETFTLPVAYAPQDLTEIFPEIVARAGLRQ 328

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXX 353
              AETEK+AHVTFFFNGG E  F  E R L+ SP+ V TYD KPEMS            
Sbjct: 329 LRTAETEKYAHVTFFFNGGRETVFQNEDRILVPSPRDVKTYDEKPEMSAREVTDKLVQAL 388

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            +G++ F + N+ANPDMVGHTG  DAA KA+ V D+ +G +++A +  G  + +T+DHGN
Sbjct: 389 GTGQYGFALVNYANPDMVGHTGLLDAAVKAVRVVDECVGRLWQAARKQGMAMLVTADHGN 448

Query: 414 AEQMQDE-EGNPHTAHTCNPVPFILASNKYSFAE-STKGALCDVAPTILDVIGLETPKEM 471
            E M D   G PHTAHT NPVPFILA   +  A+   KG L DVAPT L V+GL  PKEM
Sbjct: 449 CEMMTDPVTGQPHTAHTLNPVPFILADPDFRGAKLREKGVLADVAPTALQVMGLPQPKEM 508

Query: 472 TGLSLL 477
            GL L+
Sbjct: 509 KGLGLV 514



>gi|490740165|ref|WP_004602473.1| phosphoglyceromutase [Eubacterium cellulosolvens]
 gi|389311402|gb|EIM56335.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Eubacterium cellulosolvens 6]
          Length = 515

 Score =  462 bits (1189), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 245/487 (50%), Positives = 317/487 (65%), Gaps = 9/487 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPVMD+LK + PY   +A G  VGLP+G MGNSEVGH+N+GAGR+VYQD+ RI  ++K
Sbjct: 28  AKTPVMDQLKSQCPYVKGQASGEFVGLPDGQMGNSEVGHMNMGAGRIVYQDLTRITKSIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E + ++K  + AK  NG +H  GL+SDGGVHSHI HL  LLE  K       YVH
Sbjct: 88  DGDFFENEELLKAVNNAKANNGDLHLWGLLSDGGVHSHITHLFALLELCKKQNFENVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   Y++QL   +++L  GKI  I GRYYAMDRD  W+R++IA+ ALTK
Sbjct: 148 CFLDGRDTPPASGIDYVKQLADKMNELGVGKIGVISGRYYAMDRDTNWDRVEIAYTALTK 207

Query: 182 GVG-EKSEDPLSTIRERFSKDETDEFLKPIIV-DEEG----IIKENDTLFFFDFRADRMR 235
           G G +   DP+  ++  +   +TDEF+ P ++ +E+G     +K+ D++ FF+FR DR R
Sbjct: 208 GEGVDGGVDPVQAVQASYDNGKTDEFVVPTVMKNEDGTPVTTVKDGDSVIFFNFRPDRAR 267

Query: 236 QIVQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKIS 293
           +I + F  P    FE K  +NL   C   Y    P  L AF  +S++N   EW A +K++
Sbjct: 268 EITRAFCDPAFTGFERKQLDNLTFVCFKDYDETIPNKLIAFKKESLKNTFGEWLAANKLT 327

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q  +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDL+PEMS            
Sbjct: 328 QARIAETEKYAHVTFFFNGGVEEPNEGEDRVLVPSPKVATYDLQPEMSAPKVCDKLCEAI 387

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
           RSGK+  ++ NFANPDMVGHTG   AA  AIE  D+ IG   EA K     +FIT+DHGN
Sbjct: 388 RSGKYDVIVINFANPDMVGHTGVEAAAIAAIEAVDECIGKAVEALKEVDGQMFITADHGN 447

Query: 414 AEQMQDEE-GNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           AE M DE  G P TAHT NPVPFIL +   ++     GALCD+ PT++D++G+E P EMT
Sbjct: 448 AELMVDEATGEPWTAHTTNPVPFILVNYDPAYTLKEGGALCDIVPTMIDMMGMEKPAEMT 507

Query: 473 GLSLLKK 479
           G SLL K
Sbjct: 508 GQSLLIK 514



>gi|494767798|ref|WP_007503206.1| phosphoglyceromutase [Caldalkalibacillus thermarum]
 gi|334181141|gb|EGL83713.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Caldalkalibacillus thermarum TA2.A1]
          Length = 512

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 237/489 (48%), Positives = 310/489 (63%), Gaps = 14/489 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            A TP  D+    YP+TTL+A G AVGLPEG MGNSEVGHLNIGAGR+VYQD+ R++ A+
Sbjct: 28  QAHTPNFDRYWESYPHTTLKASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQDLTRVNKAI 87

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K   F E D  ++     KE    +H  GLVSDGGVHSHI+HL  LLE AK   + K YV
Sbjct: 88  KEGDFFENDVFLQAMRHVKEKGTALHLYGLVSDGGVHSHIDHLFALLELAKKQQVDKVYV 147

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRD  P S+  Y+EQL   +D+L  G++ATI GRYYAMDRD+RW+R + A+ A+ 
Sbjct: 148 HAFLDGRDVAPDSAKGYIEQLLAKMDELGVGQLATIQGRYYAMDRDRRWDRTEKAYRAMV 207

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKP-IIVDEE----GIIKENDTLFFFDFRADRMR 235
            G G +  DP+  I E + K   DEF++P +IVD++    G+I+  D + FF+FR DR  
Sbjct: 208 YGEGPRYRDPIQAIVESYEKSVYDEFVEPTVIVDDQDQPVGLIRSEDAVIFFNFRPDRAI 267

Query: 236 QIVQTFGVPPPPFEA-----KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           QI Q F      F       K P++L   C+T +       +A+ P +++N L E   ++
Sbjct: 268 QISQAF--TNKDFRGFDRGEKFPKDLFYVCLTHFSETVDGYVAYRPVNLDNTLGEVLTQN 325

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + Q  +AETEK+ HVTFFF+GG E+ FD E R LIDSPKVATYDLKPEMS         
Sbjct: 326 GLKQLRIAETEKYPHVTFFFSGGREQKFDGEKRVLIDSPKVATYDLKPEMSAYEVTDAVL 385

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
               S +   ++ NFANPDMVGH+GK +   KA+E  D+ +G + +A  A G I  IT+D
Sbjct: 386 AEINSDEHDVIILNFANPDMVGHSGKLEPTIKAVEAVDECLGKVVDAVLAKGGIAVITAD 445

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKE 470
           HGNA+ + DE  NPHTAHT NPVPFI+   K        G L D+APT+LD++ L+ PKE
Sbjct: 446 HGNADMILDENNNPHTAHTTNPVPFII--TKAGLQLRNDGILADIAPTVLDLLNLDQPKE 503

Query: 471 MTGLSLLKK 479
           MTG +L+KK
Sbjct: 504 MTGRTLIKK 512



>gi|491506219|ref|WP_005363866.1| phosphoglyceromutase [Eubacterium ventriosum]
 gi|149734534|gb|EDM50451.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Eubacterium ventriosum ATCC 27560]
          Length = 513

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/486 (48%), Positives = 316/486 (65%), Gaps = 8/486 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TPVMDKL  EYP+   +A G+AVGLPEG MGNSEVGHLN+GAGR+VYQ++ RI   ++
Sbjct: 28  ANTPVMDKLMAEYPFVKGQASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKEIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E + +VK  + AK+ N  +H  GL+SDGGVHSHI H+   LE AK  G+ K YVH
Sbjct: 88  DGTFFENEELVKAMENAKKNNSALHIFGLLSDGGVHSHITHMYGTLEMAKKFGLEKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S+ +Y++Q+   + ++  G++ATI GRYYAMDRD  W+R + A+ A+TK
Sbjct: 148 AFLDGRDTPPASAAEYMQQMVDKMAEIGVGEVATISGRYYAMDRDNNWDREEKAYVAMTK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G +  DP+  I+  ++KD TDEF+ P ++ ++G     I + D++ F +FR DR RQI
Sbjct: 208 GEGVEETDPVQAIKNSYAKDVTDEFVLPTVIKKDGQPVATITDGDSVVFCNFRPDRARQI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            + F       F  +   +L   C T Y    P  L AF    ++N   E+ A H + Q 
Sbjct: 268 TRAFCADDFDGFAREKKLDLTFVCFTEYDVTIPNKLIAFKKVEVKNTFGEYLAAHNMKQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXXR 354
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPK VATYD KPEMS            +
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVPSPKEVATYDQKPEMSAPKVCEKMVEAIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           SGK+  ++ NFANPDMVGHTG  +AA KA+E  D+ +G + +A K     +FI +DHGNA
Sbjct: 388 SGKYDVIITNFANPDMVGHTGIVEAAVKAVETIDECVGKVVDAIKEVDGQMFICADHGNA 447

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQ+ D E G P TAHT NPVPFIL +   S+     G L D+ PT+++++G+E PKEMTG
Sbjct: 448 EQLIDYETGEPFTAHTTNPVPFILVNADPSYKLREGGVLADIVPTLIELMGMEQPKEMTG 507

Query: 474 LSLLKK 479
            SL++K
Sbjct: 508 KSLIEK 513



>gi|242279957|ref|YP_002992086.1| phosphoglyceromutase [Desulfovibrio salexigens DSM 2638]
 gi|506332644|ref|WP_015852363.1| phosphoglyceromutase [Desulfovibrio salexigens]
 gi|242122851|gb|ACS80547.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Desulfovibrio salexigens DSM 2638]
          Length = 510

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 231/481 (48%), Positives = 314/481 (65%), Gaps = 6/481 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TPV+D L    P T L+  G AVGLP+G MGNSEVGH NIGAGRVVYQD+ RID+A++
Sbjct: 31  ANTPVLDGLMESCPRTQLKCAGRAVGLPDGFMGNSEVGHTNIGAGRVVYQDMTRIDIAIE 90

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            ++      I    D  K  +GR+H++GL+SDGGVHSHINHL  L+E AK+ GI + +VH
Sbjct: 91  KQELATNAAISGLMDNVKAADGRLHYMGLLSDGGVHSHINHLFSLIEVAKDAGIKEIFVH 150

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P S   Y++QL   + ++  GK+A+I GRYY+MDRDK +ER +++++AL  
Sbjct: 151 AFMDGRDTSPTSGKVYMQQLVDKMAEIGAGKVASISGRYYSMDRDKHYERNELSYKALVL 210

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDE-EGIIKENDTLFFFDFRADRMRQIVQT 240
           G G++  DP+  + E ++  ETDEF+KP +V   +G +K+ D +FFF+FRADR RQ+ + 
Sbjct: 211 GEGQEVSDPVKGVEEAYAAGETDEFIKPRLVSGVDGTLKDGDGVFFFNFRADRARQLCRV 270

Query: 241 FGVPP-PPFE-AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVA 298
             +     F+  K PE      MT+Y+S+F FP AFPP ++ N + E  A   + Q  +A
Sbjct: 271 LAMKDFSEFDRPKAPEFSGFVTMTQYESDFAFPNAFPPLNISNPIGEVIADKGLKQLRIA 330

Query: 299 ETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXXRSGK 357
           ETEK+AHVT+F NGG EEPF+ E R L+ SP+ VATYDLKP+MS               K
Sbjct: 331 ETEKYAHVTYFMNGGREEPFEGEDRILVPSPREVATYDLKPQMSAEEVTEKLIEALP--K 388

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
           +   + N AN DMVGH+G   AA KA E  D  +G I EA KA G ++ +T+DHGNAE+M
Sbjct: 389 YSLCICNLANLDMVGHSGIIPAAIKACETVDACVGRIVEAVKAQGGVIMLTADHGNAEEM 448

Query: 418 QDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGLSLL 477
            D  G P TAH+ N VP +     +     ++GALCD+APTIL+ +G+  P+EMTG  LL
Sbjct: 449 IDANGGPQTAHSLNNVPLVFIGKAFEGVTPSEGALCDIAPTILNHMGISVPEEMTGKDLL 508

Query: 478 K 478
           K
Sbjct: 509 K 509



>gi|78042968|ref|YP_359155.1| phosphoglyceromutase [Carboxydothermus hydrogenoformans Z-2901]
 gi|499662497|ref|WP_011343231.1| phosphoglyceromutase [Carboxydothermus hydrogenoformans]
 gi|77995083|gb|ABB13982.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 506

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/478 (47%), Positives = 314/478 (65%), Gaps = 8/478 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP  ++    YP+T LEA GLAVGLP G MGNSEVGHLN+GAGR+VYQ++ RI   ++
Sbjct: 25  AGTPNFNRYWDNYPHTILEASGLAVGLPRGQMGNSEVGHLNMGAGRIVYQELTRITKEIE 84

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F +   +++  + A++T G +H +GL+SDGGVHSHI HL  LLE  +     + ++H
Sbjct: 85  EGSFFQNRELLEAVNHAQKTGGNLHLMGLLSDGGVHSHIEHLFALLELCRREKFSRVFIH 144

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+++ +Y+E L+  + +L +G+IAT++GRYYAMDRDKRWER + A+ A+  
Sbjct: 145 PFLDGRDVPPQNAREYIEALEARLKELGFGQIATVMGRYYAMDRDKRWERTEKAYRAMVF 204

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIV-----DEEGIIKENDTLFFFDFRADRMRQ 236
           G G K  +P + +   + + ETDEF+ P +V        G++KE D++ FF+FR DR RQ
Sbjct: 205 GEGFKVTEPEAAVALAYDRGETDEFVSPTVVLTSEGQPRGVVKEGDSIIFFNFRPDRARQ 264

Query: 237 IVQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
           I + F       F  K  ENLH  C T+Y      P+AF PQ++EN L E+ +K +  Q 
Sbjct: 265 ITRAFVDDDFTGFNRKKIENLHFVCFTQYDKTIKAPVAFLPQTIENCLGEYLSKKQKKQL 324

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVE+P+  E R LI SPKVATYDLKPEMS              
Sbjct: 325 RIAETEKYAHVTFFFNGGVEKPYPGEERILIPSPKVATYDLKPEMSAYEVTEKLLEEMEK 384

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
           G +  ++ N+ANPDMVGHTG ++AA +AI+  D+ +G + +   + G    IT+DHGNAE
Sbjct: 385 G-YDLIVLNYANPDMVGHTGVFEAAVRAIKAVDECLGRVVDKFLSLGGTAIITADHGNAE 443

Query: 416 QMQDEEGNPHTAHTCNPVPFILASNKY-SFAESTKGALCDVAPTILDVIGLETPKEMT 472
           +M +E+G+PHTAHT NPVPFIL   KY       KG+L +VAPTIL ++ LE P+EMT
Sbjct: 444 KMLEEDGSPHTAHTTNPVPFILVGEKYRGIKLKEKGSLANVAPTILKILELEIPEEMT 501



>gi|490169789|ref|WP_004068430.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium sp. ASF502]
 gi|476628168|gb|EMZ34790.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium sp. ASF502]
          Length = 512

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 236/486 (48%), Positives = 312/486 (64%), Gaps = 7/486 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
             +TPVMD+L  EYP+    A GLAVGLP+G MGNSEVGHLN+GAGR+VYQD+ +I  A+
Sbjct: 27  QGKTPVMDQLMAEYPFVKGNASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQDLTKITKAI 86

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           ++  F E   ++   +  K  +  +H  GLVSDGGVHSH  H+  LLE AK  GI K YV
Sbjct: 87  QDGDFFENQALLAACENVKAHDSALHMFGLVSDGGVHSHNEHIYGLLELAKRQGIQKVYV 146

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT P S  +Y+EQL++ + ++  G++A+++GRYYAMDRD RWER++ A+ AL 
Sbjct: 147 HCFLDGRDTPPASGKEYVEQLEEKMKEIGVGEVASVMGRYYAMDRDNRWERVEKAYNALV 206

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
           KG+GE ++   + I+  +  D TDEF+ P +V + G     I++ND++ FF+FR DR R+
Sbjct: 207 KGIGETAQSGPAGIQASYDADATDEFVLPTVVMKNGAPVATIQDNDSIIFFNFRPDRARE 266

Query: 237 IVQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQ 294
           I +TF       F+          C T Y       L AF  + + N   E+ A + + Q
Sbjct: 267 ITRTFCDDSFGGFDRGPRVQTTYVCFTEYDVTIENKLVAFAKEEITNTFGEFLAANGLKQ 326

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDLKPEMS            +
Sbjct: 327 ARIAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPKVATYDLKPEMSAYEVCDKLVDAIK 386

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           SG +  V+ NFANPDMVGHTG   AA +AIE  D  +G   +A K  G  +FI +DHGNA
Sbjct: 387 SGNYDVVIINFANPDMVGHTGVEGAAIQAIEAVDVCVGRAVDAVKETGGQMFICADHGNA 446

Query: 415 EQMQDEE-GNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQ+ DEE G P TAHT NPVPFIL +   ++     G L D+APT+++++GLE P EMTG
Sbjct: 447 EQLIDEETGEPFTAHTTNPVPFILVNADPAYKLREGGCLADIAPTLIELMGLEQPAEMTG 506

Query: 474 LSLLKK 479
            SLL K
Sbjct: 507 KSLLIK 512



>gi|494504626|ref|WP_007294087.1| phosphoglyceromutase [delta proteobacterium MLMS-1]
 gi|93452592|gb|EAT03166.1| Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [delta
           proteobacterium MLMS-1]
          Length = 539

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 248/509 (48%), Positives = 325/509 (63%), Gaps = 36/509 (7%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP MD+ +R+YP TTL AH  AVGLP+G MGNSEVGHLNIGAGR VYQ+  RI LAV+
Sbjct: 30  AATPNMDRWRRQYPLTTLVAHNGAVGLPKGQMGNSEVGHLNIGAGRTVYQEFTRISLAVE 89

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           N +F +   +V+  +R +ET G +H LGL+SDGGVHSH+ HLI LLE A+  G+ K Y+H
Sbjct: 90  NGEFYDNPTLVETVERVRETGGALHLLGLLSDGGVHSHLEHLIALLELARRRGLAKVYIH 149

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P     Y+E L  AID L  G++AT+ GRYYAMDRDKRWER+++A+EA+ +
Sbjct: 150 AFMDGRDTSPHGGRGYMETLLAAIDRLGVGQVATVCGRYYAMDRDKRWERLQLAWEAVVE 209

Query: 182 GVGE-KSEDPLSTIRERFSKDETDEFLKPIIVDEEGI----IKENDTLFFFDFRADRMRQ 236
           G G+  + +PL+ + E +++ ETDEF+KP +V   G     I   D + FF+FRADR RQ
Sbjct: 210 GSGQYTAAEPLAAVDEAYNRGETDEFIKPTVVVAAGAAPVKIDHGDGVIFFNFRADRARQ 269

Query: 237 IVQTF------GVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           +          G   P    + P    +T MTRY+ +F  P+AFPPQ++E ++ E  ++H
Sbjct: 270 LTAALSQDDFAGFERP----RRPALSALTTMTRYEKDFELPVAFPPQTLERIMGEEVSRH 325

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXX 349
            + Q  +AETEK+AHVT+FFNGG EEPFD E R LI S + VATYDLKPEMS        
Sbjct: 326 GLKQLRIAETEKYAHVTYFFNGGREEPFDGEERALIPSAREVATYDLKPEMSAAEVTAEL 385

Query: 350 XXXXR------------------SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAI 391
               +                  +  +  V+ NFAN DMVGH+G   AA KA E  D  I
Sbjct: 386 LRRLQPAAAPAAAANAAAGGPATTSPYALVVLNFANGDMVGHSGVLPAAIKACEAVDHCI 445

Query: 392 GIIYEACKANGYILFITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTK-- 449
           G + EA  A G  + IT+DHGNAE+M DE+GNP TAH+CNPVP +L         + +  
Sbjct: 446 GQVVEAFTAVGGAVLITADHGNAEEMLDEQGNPMTAHSCNPVPLLLIDPGARQPGTLRDD 505

Query: 450 GALCDVAPTILDVIGLETPKEMTGLSLLK 478
           G L  +APTILD++GL  P+EM G SLL+
Sbjct: 506 GTLTALAPTILDLMGLPVPREMDGGSLLQ 534



>gi|488647840|ref|WP_002584466.1| phosphoglyceromutase [Clostridium clostridioforme]
 gi|355380317|gb|EHG27456.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme 2_1_49FAA]
 gi|480639097|gb|ENY83611.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme CM201]
 gi|480663462|gb|ENZ07262.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme 90B1]
 gi|480678605|gb|ENZ21864.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme 90A1]
 gi|480678714|gb|ENZ21957.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme 90A3]
 gi|480760307|gb|ENZ59246.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme 90A6]
 gi|480763595|gb|ENZ62405.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme 90A4]
          Length = 513

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/484 (48%), Positives = 317/484 (65%), Gaps = 8/484 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMD+L  + P+   EA G+AVGLPEG MGNSEVGHLN+GAGR+VYQ++ RI  +++
Sbjct: 28  GKTPVMDQLMSQCPFVKGEASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F  +   +   +  K+ +  +H  GLVSDGGVHSH  H+  LLE AK +G+ K YVH
Sbjct: 88  DGDFFRIPEFITAVENCKKHDSALHMFGLVSDGGVHSHNTHIYGLLELAKKNGLKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++EQL+  + ++  G++A+++GRYYAMDRDKRW+R++ A+ ALTK
Sbjct: 148 CFLDGRDTPPESGKGFVEQLEAKMKEIGIGEVASVMGRYYAMDRDKRWDRVEQAYNALTK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G ++E   + I+  +  D+ DEF+ P +V ++G     I++ D++ F++FR DR R+I
Sbjct: 208 GEGNQAESAAAGIQASYDNDKADEFVIPFVVMKDGKPVATIQDKDSVIFYNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            + F       F  K   +L   C T Y       L AF  +S+ N   E+ A HK +Q 
Sbjct: 268 TRAFCDDSFDGFPRKKRLDLVYVCFTDYDETIQNKLVAFKKESITNTFGEFLAAHKKTQV 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXXR 354
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPK VATYDLKPEMS            +
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVPSPKEVATYDLKPEMSANGVCDKLVEAIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           SG++  ++ NFANPDMVGHTG  DAA KAIE  D  +G   EA K    ++FI +DHGNA
Sbjct: 388 SGRYDVIIINFANPDMVGHTGVEDAAIKAIETVDACVGRAVEAVKEVDGVMFICADHGNA 447

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQ+ D E G P TAHT NPVPFIL +   S+     GALCD+ PT+++++G+E PKEMTG
Sbjct: 448 EQLVDYETGEPFTAHTTNPVPFILVNADPSYKLREGGALCDIVPTLIELMGMEQPKEMTG 507

Query: 474 LSLL 477
            SLL
Sbjct: 508 TSLL 511



>gi|488666501|ref|WP_002595328.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme]
 gi|480674466|gb|ENZ17880.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme 90A8]
          Length = 513

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/484 (48%), Positives = 317/484 (65%), Gaps = 8/484 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMD+L  + P+   EA G+AVGLPEG MGNSEVGHLN+GAGR+VYQ++ RI  +++
Sbjct: 28  GKTPVMDQLMSQCPFVKGEASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F  +   +   +  K+ +  +H  GLVSDGGVHSH  H+  LLE AK +G+ K YVH
Sbjct: 88  DGDFFRIPEFITAVENCKKHDSALHMFGLVSDGGVHSHNTHIYGLLELAKKNGLKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++EQL+  + ++  G++A+++GRYYAMDRDKRW+R++ A+ ALTK
Sbjct: 148 CFLDGRDTPPESGKGFVEQLEAKMKEIGIGEVASVMGRYYAMDRDKRWDRVEQAYNALTK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G ++E   + I+  +  D+ DEF+ P +V ++G     I++ D++ F++FR DR R+I
Sbjct: 208 GEGNQAESAAAGIQASYDNDKADEFVIPFVVMKDGKPVATIQDKDSVIFYNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            + F       F  K   +L   C T Y       L AF  +S+ N   E+ A HK +Q 
Sbjct: 268 TRAFCDDSFDGFPRKKRLDLVYVCFTDYDETIQNKLVAFKKESITNTFGEFLAAHKKTQV 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXXR 354
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPK VATYDLKPEMS            +
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVPSPKEVATYDLKPEMSANGVCDKLVEAIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           SG++  ++ NFANPDMVGHTG  DAA KAIE  D  +G   EA K    ++FI +DHGNA
Sbjct: 388 SGRYDVIIINFANPDMVGHTGVEDAAIKAIETVDACVGRAVEAVKEVDGVMFICADHGNA 447

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQ+ D E G P TAHT NPVPFIL +   S+     GALCD+ PT+++++G+E PKEMTG
Sbjct: 448 EQLVDYETGEPFTAHTTNPVPFILVNADPSYKLREGGALCDIVPTLIELMGMEQPKEMTG 507

Query: 474 LSLL 477
            SLL
Sbjct: 508 TSLL 511



>gi|410667039|ref|YP_006919410.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Thermacetogenium phaeum DSM 12270]
 gi|504862726|ref|WP_015049828.1| phosphoglyceromutase [Thermacetogenium phaeum]
 gi|409104786|gb|AFV10911.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase GpmI
           [Thermacetogenium phaeum DSM 12270]
          Length = 513

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 234/487 (48%), Positives = 314/487 (64%), Gaps = 13/487 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP   +L+  YPYT L A G  VGLPEG MGNSEVGHLNIGAGRVVYQDI RI  A++
Sbjct: 27  AGTPNFQRLQENYPYTVLAASGERVGLPEGQMGNSEVGHLNIGAGRVVYQDITRISKAIR 86

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F     +++   + KE    +H  GL+SDGGVHSH+ HL  LLE AK   +P+ Y+H
Sbjct: 87  TGEFFSNPVLIEAMQKVKEEGSSLHLCGLLSDGGVHSHLAHLYALLEMAKRFRLPRVYIH 146

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S   Y+E+ ++   ++  G+IAT+ GRYYAMDRDKRWER++ AF A+  
Sbjct: 147 AFLDGRDVLPTSGAGYIEEAERKCREIGCGEIATVSGRYYAMDRDKRWERVEKAFNAVVY 206

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKP-IIVD----EEGIIKENDTLFFFDFRADRMRQ 236
           G GE    P + +R+ + K+ TDEF+ P ++VD     +G ++  DT+ F++FRADR R+
Sbjct: 207 GEGEPVTSPAAAVRDSYEKEVTDEFVVPKVVVDGSGRPKGTVQRGDTVIFYNFRADRARE 266

Query: 237 IVQTFGVPPPPFEAKIPE----NLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKI 292
           + + F      FE  + +    ++H  CMT+Y    P P+AFPPQ+++N L E  + + +
Sbjct: 267 LTRAF--TDRRFEGFVRKGGYPDVHFVCMTQYDVTIPAPVAFPPQTLQNTLGEILSGNGL 324

Query: 293 SQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXX 352
            Q  +AETEK+AHVTFFFNGGVE P   E R LI SPKVATYDLKPEMS           
Sbjct: 325 RQLRIAETEKYAHVTFFFNGGVEAPNPGEERVLIPSPKVATYDLKPEMSAPEVTERVLKE 384

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
              G +  ++ N+ANPDMVGHTG  +AA +AI V D+ +G + +     G I  +T+DHG
Sbjct: 385 INGGAYDVIILNYANPDMVGHTGVLEAAVRAIAVVDECLGRVVQGILDKGGIALVTADHG 444

Query: 413 NAEQM-QDEEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGLETPKE 470
           NAEQM ++E   PHTAHT NPVPFIL  ++Y      + GAL D+APT+L+++G+  P  
Sbjct: 445 NAEQMLEEESEEPHTAHTTNPVPFILVGDEYRQRRLREGGALEDIAPTMLEILGIPRPPA 504

Query: 471 MTGLSLL 477
           MTG SLL
Sbjct: 505 MTGRSLL 511



>gi|512513720|ref|WP_016440597.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Coprococcus sp. HPP0048]
 gi|512065830|gb|EPD65237.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Coprococcus sp. HPP0048]
          Length = 512

 Score =  459 bits (1180), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 315/485 (64%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPVMD L +EYP+    A G++VGLPEG MGNSEVGHLN+GAGR+VYQD+ +I  A++
Sbjct: 28  AKTPVMDSLMKEYPFVEGNASGMSVGLPEGQMGNSEVGHLNMGAGRIVYQDLTKITKAIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E + ++     AKE N  +H  GLVSDGGVHSH +H+  LLE AK  G+ K YVH
Sbjct: 88  DGDFFENEALLTACRNAKENNSALHLFGLVSDGGVHSHNSHIYGLLELAKKEGLDKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   Y+++L   + ++  G++A+++GRYYAMDRD RW+R+++A+ A+ K
Sbjct: 148 CFLDGRDTPPASGKDYVQELSDKMKEIGVGEVASVMGRYYAMDRDNRWDRVELAYNAMVK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GE++E  +  +++ +   +TDEF+ P +V  +G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEQAECGVCAVQKSYDAGKTDEFVVPTVVVRDGAPIATIKDKDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            +TF       F+          C T Y    P  L AF    + N   E+ A H ++Q 
Sbjct: 268 TRTFCDDAFDGFDRGERVKTTYVCFTEYDVTIPNKLVAFYKTEITNTFGEFLAAHNMTQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            +S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLQPEMSAFEVCDKLVDAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G   EA K     +FI +DHGNAE
Sbjct: 388 DKYDVIIINFANPDMVGHTGVENAAIKAIEAVDECVGRTVEAIKEVNGQMFICADHGNAE 447

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+ D E G P TAHT NPVPFIL +   ++     G L D+APT+++++G+E P+EMTG 
Sbjct: 448 QLVDYETGEPFTAHTTNPVPFILVNADPAYKLREDGCLADIAPTLIELMGMEQPEEMTGR 507

Query: 475 SLLKK 479
           SLL K
Sbjct: 508 SLLVK 512



>gi|496261981|ref|WP_008975366.1| phosphoglyceromutase [Coprococcus sp. HPP0074]
 gi|325472737|gb|EGC75948.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Lachnospiraceae bacterium 6_1_37FAA]
 gi|330408713|gb|EGG88178.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|512060772|gb|EPD60238.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Coprococcus sp. HPP0074]
          Length = 512

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 315/485 (64%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPVMD L +EYP+    A G++VGLPEG MGNSEVGHLN+GAGR+VYQD+ +I  A++
Sbjct: 28  AKTPVMDSLMKEYPFVEGNASGMSVGLPEGQMGNSEVGHLNMGAGRIVYQDLTKITKAIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E + ++     AKE N  +H  GLVSDGGVHSH +H+  LLE AK  G+ K YVH
Sbjct: 88  DGDFFENEALLTACRNAKENNSALHLFGLVSDGGVHSHNSHIYGLLELAKKEGLDKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   Y+++L   + ++  G++A+++GRYYAMDRD RW+R+++A+ A+ K
Sbjct: 148 CFLDGRDTPPASGKDYVQELSDKMKEIGVGEVASVMGRYYAMDRDNRWDRVELAYNAMVK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GE++E  +  +++ +   +TDEF+ P +V  +G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEQAECGVCAVQKSYDAGKTDEFVVPTVVVRDGAPIATIKDKDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            +TF       F+          C T Y    P  L AF    + N   E+ A H ++Q 
Sbjct: 268 TRTFCDDAFDGFDRGERVKTTYVCFTEYDVTIPNKLVAFHKTEITNTFGEFLAAHNMTQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            +S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLQPEMSAFEVCDKLVDAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G   EA K     +FI +DHGNAE
Sbjct: 388 DKYDVIIINFANPDMVGHTGVENAAIKAIEAVDECVGRTVEAIKEVNGQMFICADHGNAE 447

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+ D E G P TAHT NPVPFIL +   ++     G L D+APT+++++G+E P+EMTG 
Sbjct: 448 QLVDYETGEPFTAHTTNPVPFILVNADPAYKLREDGCLADIAPTLIELMGMEQPEEMTGR 507

Query: 475 SLLKK 479
           SLL K
Sbjct: 508 SLLVK 512



>gi|491478821|ref|WP_005336562.1| phosphoglyceromutase [Dorea formicigenerans]
 gi|345898801|gb|EGX68661.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Dorea
           formicigenerans 4_6_53AFAA]
          Length = 512

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/485 (48%), Positives = 316/485 (65%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPV+DKL  EYP+    A GLAVGLP+G MGNSEVGHLN+GAGR+VYQ++ +I  +++
Sbjct: 28  AKTPVVDKLMAEYPFVKGYASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQELTKITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E   ++   +  K+ +  +H +GLVSDGGVHSHI H+  LLE AK  G+ K YVH
Sbjct: 88  DGDFFENKALLAACENVKKNDSALHLMGLVSDGGVHSHIEHIFGLLELAKRQGLKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +Y+EQL+  + ++  G++A+++GRYYAMDRD RW+R++ A+ A+  
Sbjct: 148 CFLDGRDTPPASGKEYVEQLEAKMKEIGVGEVASVMGRYYAMDRDNRWDRVEKAYRAIAY 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+    + I+  + KD TDEF+ P +V+++G     +KEND++ FF+FR DR R+I
Sbjct: 208 GEGEKATSGPAGIQASYDKDTTDEFVLPTVVEKDGAALATVKENDSIIFFNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            +TF       F+  +       C T Y       L AF  + + N   E+ AK+ + Q 
Sbjct: 268 TRTFCDDKFESFDRGVRIKTTFVCFTEYDVTIENKLVAFVKEKITNTFGEFLAKNGLKQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDLKPEMS             S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPKVATYDLKPEMSAYEVCDKLVEAIES 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG   AA KAIE  D+ +G   EA K     +FI +DHGNAE
Sbjct: 388 DKYDVIIINFANPDMVGHTGVEGAAIKAIEAVDECVGKTVEAIKKVDGQMFICADHGNAE 447

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+ D E G P TAHT NPVPFIL +   ++     G L D+APT+++++G++ P EMTG 
Sbjct: 448 QLIDYESGEPFTAHTTNPVPFILVNADPAYKLREGGCLADIAPTLIELMGMKQPAEMTGK 507

Query: 475 SLLKK 479
           SLL K
Sbjct: 508 SLLVK 512



>gi|488634548|ref|WP_002571217.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium bolteae]
 gi|480700398|gb|ENZ43095.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium bolteae 90B8]
          Length = 513

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 234/488 (47%), Positives = 320/488 (65%), Gaps = 12/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMD+L  + P+   EA G+AVGLPEG MGNSEVGHLN+GAGR+VYQ++ RI  +++
Sbjct: 28  GKTPVMDQLMSQCPFVKGEASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F ++   +   +  K+ +  +H  GLVSDGGVHSH  H+  LLE AK +G+ K YVH
Sbjct: 88  DGDFFQIPEFLTAIENCKKHDSALHMFGLVSDGGVHSHNTHIYGLLELAKKNGLKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++EQL+  + ++  G++A+++GRYYAMDRDKRW+R+++A+ ALTK
Sbjct: 148 CFLDGRDTPPESGKGFVEQLEAKMKEIGVGEVASVMGRYYAMDRDKRWDRVELAYNALTK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G ++E   + I+  +   + DEF+ P +V ++G     I++ D++ F++FR DR R+I
Sbjct: 208 GEGNQAESAAAGIQASYDSGKADEFVIPFVVMKDGKPAATIQDKDSVIFYNFRPDRAREI 267

Query: 238 VQTF---GVPPPPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKIS 293
            + F        P E ++  +L   C T Y       L AF  +S+ N   E+ A HK +
Sbjct: 268 TRAFCDDSFDGFPREKRL--DLVYVCFTDYDETIQNKLVAFKKESITNTFGEFLAAHKKT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXX 352
           Q  +AETEK+AHVTFFFNGGVEEP + E R L+ SPK VATYDLKPEMS           
Sbjct: 326 QVRIAETEKYAHVTFFFNGGVEEPNEGEDRILVPSPKEVATYDLKPEMSANGVCDKLVEA 385

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
            +SGK+  ++ NFANPDMVGHTG  DAA KAIE  D  +G   EA +    ++FI +DHG
Sbjct: 386 IKSGKYDVIIINFANPDMVGHTGVEDAAIKAIETVDACVGRAVEAIREVDGVMFICADHG 445

Query: 413 NAEQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEM 471
           NAEQ+ D E G P TAHT NPVPFIL +   S      GALCD+ PT+++++G+E PKEM
Sbjct: 446 NAEQLVDYETGEPFTAHTTNPVPFILVNADPSCKLREGGALCDIVPTLIELMGMEQPKEM 505

Query: 472 TGLSLLKK 479
           TG SLL K
Sbjct: 506 TGKSLLVK 513



>gi|491474807|ref|WP_005332548.1| phosphoglyceromutase [Dorea formicigenerans]
 gi|166028188|gb|EDR46945.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Dorea
           formicigenerans ATCC 27755]
          Length = 512

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 237/487 (48%), Positives = 318/487 (65%), Gaps = 11/487 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPV+DKL  EYP+    A GLAVGLP+G MGNSEVGHLN+GAGR+VYQ++ +I  +++
Sbjct: 28  AKTPVVDKLMAEYPFVKGYASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQELTKITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E   ++   +  K+ +  +H +GLVSDGGVHSHI H+  LLE AK  G+ K YVH
Sbjct: 88  DGDFFENKALLAACENVKKNDSALHLMGLVSDGGVHSHIEHIFGLLELAKRQGLKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +Y+EQL+  + ++  GK+A+++GRYYAMDRD RW+R++ A+ A+  
Sbjct: 148 CFLDGRDTPPASGKEYVEQLEAKMKEIGVGKVASVMGRYYAMDRDNRWDRVEKAYRAIAY 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+    + I+  + KD TDEF+ P +V+++G     +KEND++ FF+FR DR R+I
Sbjct: 208 GEGEKATSGPAGIQASYDKDTTDEFVLPTVVEKDGAALATVKENDSIIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEA-KIPENLHIT--CMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKIS 293
            +TF      FE     E +  T  C T Y       L AF  + + N   E+ AK+ + 
Sbjct: 268 TRTF--CDDKFEGFDRGERIKTTFVCFTEYDVTIENKLVAFVKEKITNTFGEFLAKNGLK 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q  +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDLKPEMS            
Sbjct: 326 QARIAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPKVATYDLKPEMSAYEVCDKLVEAI 385

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            S K+  ++ NFANPDMVGHTG   AA KAIE  D+ +G   EA K     +FI +DHGN
Sbjct: 386 ESDKYDVIIINFANPDMVGHTGVEGAAIKAIEAVDECVGKTVEAIKKVDGQMFICADHGN 445

Query: 414 AEQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           AEQ+ D E G P TAHT NPVPFIL +   ++     G L D+APT+++++G++ P EMT
Sbjct: 446 AEQLIDYESGEPFTAHTTNPVPFILVNADPAYKLREGGCLADIAPTLIELMGMKQPAEMT 505

Query: 473 GLSLLKK 479
           G SLL K
Sbjct: 506 GKSLLVK 512



>gi|493472556|ref|WP_006427594.1| phosphoglyceromutase [Dorea longicatena]
 gi|149752253|gb|EDM62184.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Dorea
           longicatena DSM 13814]
          Length = 512

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 234/485 (48%), Positives = 314/485 (64%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPVMDKL  EYP     A GLAVGLP+G MGNSEVGH+N+GAGR++YQ++ +I  A++
Sbjct: 28  AKTPVMDKLMSEYPCVKGNASGLAVGLPDGQMGNSEVGHMNMGAGRIIYQELTKITKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E   ++   + AK+ +  +H +GLVSDGGVHSHI H+  LLE AK  G+ K YVH
Sbjct: 88  DGVFFENKALLAACENAKKNDSALHLMGLVSDGGVHSHIGHIFGLLELAKRQGLEKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +Y+EQL+  + ++  G++A++ GRYYAMDRD RW+R++ A++AL+ 
Sbjct: 148 CFLDGRDTPPASGKEYVEQLEAKMKEIGVGEVASVSGRYYAMDRDNRWDRVEKAYKALSA 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GE +      I+  +  D TDEF+ P +V ++G     IKEND++ FF+FR DR R++
Sbjct: 208 GEGETAASATEGIQASYDADVTDEFVVPFVVTKDGAPVATIKENDSVVFFNFRPDRAREL 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFP-LAFPPQSMENVLSEWFAKHKISQC 295
            +TF       F+          C T Y +      +AF  + + N   E+ AK+   Q 
Sbjct: 268 TRTFCDDSFDGFDRGDRIKTTFVCFTEYDATIENKQVAFVKEEITNTFGEFLAKNGKKQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDLKPEMS            +S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPKVATYDLKPEMSAYEVCDKLVAAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G  YEA K     +FI +DHGNAE
Sbjct: 388 DKYDVIVINFANPDMVGHTGVIEAAVKAIEAVDECVGKAYEALKEADGQMFICADHGNAE 447

Query: 416 QMQDEEGN-PHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
            M DEE   P TAHT NPVPFIL +   ++     G L D+APT+++++G+E P EMTG 
Sbjct: 448 YMIDEETKEPFTAHTTNPVPFILVNADPAYKLKEDGCLADIAPTLIELMGMEQPAEMTGT 507

Query: 475 SLLKK 479
           SLL K
Sbjct: 508 SLLVK 512



>gi|436842322|ref|YP_007326700.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfovibrio hydrothermalis AM13 = DSM 14728]
 gi|505150097|ref|WP_015337199.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfovibrio hydrothermalis]
 gi|432171228|emb|CCO24599.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfovibrio hydrothermalis AM13 = DSM 14728]
          Length = 510

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/481 (47%), Positives = 314/481 (65%), Gaps = 6/481 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TPV+D+L    P T L+  G AVGLP+G MGNSEVGH NIGAGRVVYQD+ RID+A++
Sbjct: 31  ARTPVLDRLFETCPNTQLQCSGRAVGLPDGFMGNSEVGHTNIGAGRVVYQDMTRIDIAIE 90

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +      + +  D+ K ++GRIH++GL+SDGGVHSHINHL  LLE AK+ GI + YVH
Sbjct: 91  KDELAATKGLSRLMDKVKASSGRIHYMGLLSDGGVHSHINHLFSLLEVAKDAGIKEVYVH 150

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P     Y+ QL   + ++  G++A++ GRYY+MDRDK +ER +++++AL  
Sbjct: 151 AFMDGRDTSPTRGKDYMRQLVDKMTEIGIGQVASVSGRYYSMDRDKHYERNELSYKALVL 210

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDE-EGIIKENDTLFFFDFRADRMRQIVQT 240
           G GE   DP+  I   +   ETDEF+KP +VD  +G++K+ D +FFF+FRADR RQ+ + 
Sbjct: 211 GEGEVIADPVKGIEAAYEAGETDEFIKPRLVDGVDGLLKDGDGVFFFNFRADRARQLCRL 270

Query: 241 FGVPP-PPFE-AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCHVA 298
                   FE  K+P+      MTRY+++FPF ++F PQ++ N + E  +K  + Q  +A
Sbjct: 271 LTYKDFDDFERPKVPQFCGFVTMTRYEADFPFDISFEPQNIINPIGEVISKEGLKQLRIA 330

Query: 299 ETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXXRSGK 357
           ETEK+AHVT+F NGG EEPF  E R L+ SP+ VATYDLKP+MS               +
Sbjct: 331 ETEKYAHVTYFMNGGREEPFPQEDRLLVPSPREVATYDLKPQMSAEEVTAKLIDALP--E 388

Query: 358 FPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQM 417
           +   + N AN DMVGH+G   AA KA E  DK +G I EA    G  +F+T+DHGNAE+M
Sbjct: 389 YSLCICNLANLDMVGHSGVIPAAIKACETVDKCVGRIVEAVNKLGGAIFLTADHGNAEEM 448

Query: 418 QDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGLSLL 477
            D +G P TAH+ N VP +     +      KGALCD+APTIL+++ +  P EMTG +LL
Sbjct: 449 IDADGGPQTAHSLNNVPLVFIGEPFKDVTPVKGALCDIAPTILNLMDISVPAEMTGKNLL 508

Query: 478 K 478
           +
Sbjct: 509 E 509



>gi|496538084|ref|WP_009244352.1| phosphoglyceromutase [Lachnospiraceae bacterium 2_1_58FAA]
 gi|336019682|gb|EGN49405.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Lachnospiraceae bacterium 2_1_58FAA]
          Length = 512

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 235/487 (48%), Positives = 317/487 (65%), Gaps = 11/487 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMDKL  EYP+    A G+AVGLPEG MGNSEVGHLN+GAGR++YQ++ +I  A++
Sbjct: 28  GKTPVMDKLMAEYPFVKGNASGMAVGLPEGQMGNSEVGHLNMGAGRIIYQELTKITKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E   ++     AKE N  +H +GLVSDGGVHSH  H+  LLE AK  G+ K YVH
Sbjct: 88  DGDFFENQALLAACKNAKENNTALHMMGLVSDGGVHSHNGHIYGLLELAKRQGVEKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +Y+E L+  + ++  G++A++ GRYYAMDRD RW+R++ A+ AL K
Sbjct: 148 CFLDGRDTPPASGKEYVEALEAKMKEIGIGEVASVSGRYYAMDRDNRWDRVERAYNALVK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G ++E   + I+  +  D+TDEF++P+++ ++G     +K+ D++ FF+FR DR R+I
Sbjct: 208 GEGVQAESATAGIQASYDADKTDEFVEPMVIVKDGAPVATVKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEA-KIPENLHIT--CMTRYKSEFPF-PLAFPPQSMENVLSEWFAKHKIS 293
            +TF      FE     E +  T  C T Y        +AF  + + N   E+ A H ++
Sbjct: 268 TRTF--CDDNFEGFDRGERVKTTFVCFTEYDVTIQNKQVAFVKEEITNTFGEFLAAHNMT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q  +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDLKPEMS            
Sbjct: 326 QARIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLKPEMSAYEVCDKLVDAI 385

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
           +S K+  ++ NFANPDMVGHTG  DAA KAIE  D+ +G   +A K     +FI +DHGN
Sbjct: 386 KSDKYDVIIINFANPDMVGHTGVEDAAIKAIEAVDECVGKAVDALKEVDGQMFICADHGN 445

Query: 414 AEQMQDE-EGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           AEQ+ DE  G P TAHT NPVPFIL +   ++     G L D+APT+++++G+E PKEMT
Sbjct: 446 AEQLIDETTGEPFTAHTTNPVPFILVNADPAYKLREGGCLADIAPTLIELMGMEQPKEMT 505

Query: 473 GLSLLKK 479
           G SLL K
Sbjct: 506 GKSLLVK 512



>gi|490981166|ref|WP_004842928.1| phosphoglyceromutase [[Ruminococcus] gnavus]
 gi|153795212|gb|EDN77632.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ruminococcus gnavus ATCC 29149]
          Length = 514

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 235/487 (48%), Positives = 317/487 (65%), Gaps = 11/487 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMDKL  EYP+    A G+AVGLPEG MGNSEVGHLN+GAGR++YQ++ +I  A++
Sbjct: 30  GKTPVMDKLMAEYPFVKGNASGMAVGLPEGQMGNSEVGHLNMGAGRIIYQELTKITKAIE 89

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E   ++     AKE N  +H +GLVSDGGVHSH  H+  LLE AK  G+ K YVH
Sbjct: 90  DGDFFENQALLAACKNAKENNTALHMMGLVSDGGVHSHNGHIYGLLELAKRQGVEKVYVH 149

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +Y+E L+  + ++  G++A++ GRYYAMDRD RW+R++ A+ AL K
Sbjct: 150 CFLDGRDTPPASGKEYVEALEAKMKEIGIGEVASVSGRYYAMDRDNRWDRVERAYNALVK 209

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G ++E   + I+  +  D+TDEF++P+++ ++G     +K+ D++ FF+FR DR R+I
Sbjct: 210 GEGVQAESATAGIQASYDADKTDEFVEPMVIVKDGAPVATVKDGDSVIFFNFRPDRAREI 269

Query: 238 VQTFGVPPPPFEA-KIPENLHIT--CMTRYKSEFPF-PLAFPPQSMENVLSEWFAKHKIS 293
            +TF      FE     E +  T  C T Y        +AF  + + N   E+ A H ++
Sbjct: 270 TRTF--CDDNFEGFDRGERVKTTFVCFTEYDVTIQNKQVAFVKEEITNTFGEFLAAHNMT 327

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q  +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDLKPEMS            
Sbjct: 328 QARIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLKPEMSAYEVCDKLVDAI 387

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
           +S K+  ++ NFANPDMVGHTG  DAA KAIE  D+ +G   +A K     +FI +DHGN
Sbjct: 388 KSDKYDVIIINFANPDMVGHTGVEDAAIKAIEAVDECVGKAVDALKEVDGQMFICADHGN 447

Query: 414 AEQMQDE-EGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           AEQ+ DE  G P TAHT NPVPFIL +   ++     G L D+APT+++++G+E PKEMT
Sbjct: 448 AEQLIDETTGEPFTAHTTNPVPFILVNADPAYKLREGGCLADIAPTLIELMGMEQPKEMT 507

Query: 473 GLSLLKK 479
           G SLL K
Sbjct: 508 GKSLLVK 514



>gi|496293281|ref|WP_009005319.1| phosphoglyceromutase [Clostridium sp. D5]
 gi|324029720|gb|EGB91008.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium sp. D5]
          Length = 512

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 236/485 (48%), Positives = 315/485 (64%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMDKL  E P+    A GLAVGLP+G MGNSEVGHLN+GAGR+VYQD+ +I  A++
Sbjct: 28  GKTPVMDKLMAECPFVKGNASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQDLTKITKAIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F +   ++   + AK+ +  +H  GLVSDGGVHSH  H+  LLE AK  GI K YVH
Sbjct: 88  DGDFFQNKALLAACENAKKNDSALHMFGLVSDGGVHSHNEHIYGLLELAKKQGIKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   Y+EQL+  + ++  G++A+++GRYYAMDRD RW+R++ A++AL K
Sbjct: 148 CFLDGRDTPPASGKDYVEQLEAKMKEIGVGEVASVMGRYYAMDRDNRWDRVEKAYKALVK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GE +    + I+  +  D+TDEF+ P +V ++G     IK+ND++ FF+FR DR R+I
Sbjct: 208 GEGETAVSGPAGIQASYDADKTDEFVLPAVVMKDGAPVATIKDNDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            +TF       F+          C T Y       L AF    + N   E+ AK+  +Q 
Sbjct: 268 TRTFCDDDFEGFDRGARVKTVFVCFTDYDVTIGNKLVAFAKDEITNTFGEFLAKNHKTQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDLKPEMS            +S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPKVATYDLKPEMSAYEVCGKLVDAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG  DAA KAIE  D+ +G   +A K     +FI +DHGNAE
Sbjct: 388 DKYDVIIINFANPDMVGHTGVEDAAVKAIEAVDECVGKAVDALKEVNGQMFICADHGNAE 447

Query: 416 QMQDEE-GNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+ D+E G P TAHT NPVPFIL +   +++    G L D+APT+++++G+E PKEMTG 
Sbjct: 448 QLIDQETGEPFTAHTTNPVPFILVNADPAYSLREGGCLADIAPTLIEMMGMEQPKEMTGR 507

Query: 475 SLLKK 479
           SLL K
Sbjct: 508 SLLLK 512



>gi|347531325|ref|YP_004838088.1| phosphoglyceromutase [Roseburia hominis A2-183]
 gi|503845207|ref|WP_014079201.1| phosphoglyceromutase [Roseburia hominis]
 gi|345501473|gb|AEN96156.1| phosphoglyceromutase [Roseburia hominis A2-183]
          Length = 513

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 236/484 (48%), Positives = 304/484 (62%), Gaps = 7/484 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            A+ P +D L +EYP+    A GLAVGLP+G MGNSEVGHLN+GAGR+VYQ++ RI   +
Sbjct: 27  QAKKPNIDALMKEYPFVKGNASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQELTRITKEI 86

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
            + +F     ++      KE N  +H  GL+SDGGVHSHI HL  LLE AK  G+   YV
Sbjct: 87  NDGEFFSNQALLDGIANVKENNSDLHLYGLLSDGGVHSHITHLYGLLELAKRQGVKNVYV 146

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT P S   ++E L+  + +L  GKIA+I GRYYAMDRD RW+R++ A++ LT
Sbjct: 147 HCFLDGRDTAPTSGKGFIEALEAKMAELGIGKIASISGRYYAMDRDNRWDRVQKAYDVLT 206

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
           KG GE +E  ++ +   ++KD TDEF  P  + E G     IK+ DT+ FF+FR DR R+
Sbjct: 207 KGEGETAESAVAAMEASYAKDVTDEFFVPTAITENGKPVATIKDKDTVIFFNFRPDRARE 266

Query: 237 IVQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFP-LAFPPQSMENVLSEWFAKHKISQ 294
           I +TF       F+    +N+   C T Y    P   +AF    ++N   E+ A H ++Q
Sbjct: 267 ITRTFCADEFDGFDRGARKNVKYICFTEYDVTIPNKEVAFKKVELKNTFGEYLAAHGMTQ 326

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            R
Sbjct: 327 ARIAETEKYAHVTFFFNGGVEEPNVGEDRILVKSPKVATYDLQPEMSAPEVCEKLCAAIR 386

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           S K+  ++ NFANPDMVGHTG   AA KAIE  D  +G   EA K     +FI +DHGNA
Sbjct: 387 SEKYDVIVINFANPDMVGHTGIIPAAIKAIETVDTCVGKAVEALKEVDGQMFICADHGNA 446

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQM D E G P TAHT NPVPFIL +   S+     G L D+ PT+++++G+E P EMTG
Sbjct: 447 EQMVDYETGAPFTAHTTNPVPFILVNADPSYTLRENGCLADIIPTLIELMGMEQPAEMTG 506

Query: 474 LSLL 477
            SLL
Sbjct: 507 KSLL 510



>gi|479205097|ref|YP_007833688.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Roseburia intestinalis M50/1]
 gi|505374346|ref|WP_015561448.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Roseburia intestinalis]
 gi|291537535|emb|CBL10647.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Roseburia intestinalis M50/1]
          Length = 513

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 231/486 (47%), Positives = 311/486 (63%), Gaps = 7/486 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            A+TPV+D L ++YP+    A GLAVGLP+G MGNSEVGHLN+GAGR+VYQ++ RI   +
Sbjct: 27  QAKTPVIDGLMKDYPFVKGNASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQELTRITKEI 86

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
            +  F +   ++   +  K+    +H  GL+S+GGVHSHI HL  LLE AK  G+   YV
Sbjct: 87  SDGDFFKNQALLDGMENVKKNGSDLHLYGLLSNGGVHSHITHLFGLLEMAKKEGVENVYV 146

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT P S  +++E+L+  + ++  GKIA+I GRYYAMDRD RW+R++ A++ LT
Sbjct: 147 HCFLDGRDTAPTSGKEFIEELEAKMKEIGVGKIASISGRYYAMDRDNRWDRVEKAYKVLT 206

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
            G GE +E  ++ +   ++KD TDEF  P  + E G     IK+NDT+ FF+FR DR R+
Sbjct: 207 TGEGETAESAVAAMEASYAKDVTDEFFVPTAITENGKPIATIKDNDTVIFFNFRPDRARE 266

Query: 237 IVQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFP-LAFPPQSMENVLSEWFAKHKISQ 294
           I +TF +     F+    +N+   C T Y    P   +AF    ++N   E+ A H ++Q
Sbjct: 267 ITRTFCMDDFDGFDRGARKNVKYICFTEYDVTIPNKEVAFKKVELKNTFGEYLAAHDMTQ 326

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            R
Sbjct: 327 ARIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLQPEMSAPEVCDKLCAAIR 386

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           S K+  ++ NFANPDMVGHTG  DAA KA+E  D  +G   EA K     +FI +DHGNA
Sbjct: 387 SEKYDVIIINFANPDMVGHTGILDAAIKAVETVDTCVGKAVEALKEVDGQMFICADHGNA 446

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQ+ + E G P T+HT NPVPFIL +   S+     G L D+ PT+++++G+E P EMTG
Sbjct: 447 EQLVNYETGEPLTSHTTNPVPFILVNADPSYTLKEDGCLADIIPTMIELMGMEQPAEMTG 506

Query: 474 LSLLKK 479
            SLL K
Sbjct: 507 KSLLIK 512



>gi|510801521|ref|WP_016176312.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Enterococcus saccharolyticus]
 gi|508148872|gb|EOT25680.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Enterococcus saccharolyticus ATCC 43076]
 gi|508209001|gb|EOT83210.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Enterococcus saccharolyticus ATCC 43076]
          Length = 507

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 231/483 (47%), Positives = 304/483 (62%), Gaps = 9/483 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP  DK   +YP++TL+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID ++ 
Sbjct: 28  ANTPNFDKYWSKYPHSTLKASGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKSIL 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           + +F +   ++  FD  K+ N  +H +GLVSDGGVHSHINHL  LLE AK HG+P A+V 
Sbjct: 88  DGEFAQEKALLDLFDFVKKNNSNLHLMGLVSDGGVHSHINHLFALLEEAKKHGVP-AFVD 146

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
              DGRD +P S   Y++QLQ  ID+L +GKIA+I GRYYAMDRDKRWER++  ++ +  
Sbjct: 147 VILDGRDVSPTSGINYVKQLQAKIDELGHGKIASISGRYYAMDRDKRWERVQQYYDVVIH 206

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G GEKS D +  + + ++   TDEFL P ++ E       I +ND + FF+FR DR  Q+
Sbjct: 207 GEGEKSTDAVDVVEKSYAAGVTDEFLLPTVIVENDQPVATINDNDGVLFFNFRPDRALQM 266

Query: 238 VQTFGVPPPPF--EAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
            Q        F    + P+N+ +  MT+Y  +    + F P S++NVL E   K+ I+Q 
Sbjct: 267 SQALTEKEWEFFERGQTPQNVKLVTMTQYSDKLDTEVVFAPISLDNVLGEVLDKNNINQL 326

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+ HVTFFFNGG    +  E R LI SPKVATYDL+PEMS              
Sbjct: 327 RIAETEKYPHVTFFFNGGSNTVYGTEERILIASPKVATYDLQPEMSIYEVTDALVNAIND 386

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            KF  ++ NFANPDMVGH+G  +   KAIE  D+ +G + E          IT+DHGN+E
Sbjct: 387 EKFEAIILNFANPDMVGHSGMVEPTVKAIEAVDECLGRVVETILGKEGFAIITADHGNSE 446

Query: 416 QMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGLS 475
            + DE GNPHTAHT  PVP I+  +       T G L D+APT+LD++ +E P EMTG S
Sbjct: 447 TLMDENGNPHTAHTTVPVPVIVTKDNVEL--RTDGRLADLAPTMLDLLDIELPAEMTGRS 504

Query: 476 LLK 478
           L+K
Sbjct: 505 LVK 507



>gi|479148528|ref|YP_007778957.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Roseburia intestinalis XB6B4]
 gi|505334476|ref|WP_015521578.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Roseburia intestinalis]
 gi|291540069|emb|CBL13180.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Roseburia intestinalis XB6B4]
          Length = 505

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 231/486 (47%), Positives = 311/486 (63%), Gaps = 7/486 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            A+TPV+D L ++YP+    A GLAVGLP+G MGNSEVGHLN+GAGR+VYQ++ RI   +
Sbjct: 19  QAKTPVIDGLMKDYPFVKGNASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQELTRITKEI 78

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
            +  F +   ++   +  K+    +H  GL+S+GGVHSHI HL  LLE AK  G+   YV
Sbjct: 79  SDGDFFKNQALLDGMENVKKNGSDLHLYGLLSNGGVHSHITHLFGLLEMAKKEGVENVYV 138

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT P S  +++E+L+  + ++  GKIA+I GRYYAMDRD RW+R++ A++ LT
Sbjct: 139 HCFLDGRDTAPTSGKEFIEELEAKMKEIGVGKIASISGRYYAMDRDNRWDRVEKAYKVLT 198

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
            G GE +E  ++ +   ++KD TDEF  P  + E G     IK+NDT+ FF+FR DR R+
Sbjct: 199 TGEGETAESAVAAMEASYAKDVTDEFFVPTAITENGKPIATIKDNDTVIFFNFRPDRARE 258

Query: 237 IVQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFP-LAFPPQSMENVLSEWFAKHKISQ 294
           I +TF +     F+    +N+   C T Y    P   +AF    ++N   E+ A H ++Q
Sbjct: 259 ITRTFCMDDFDGFDRGARKNVKYICFTEYDVTIPNKEVAFKKVELKNTFGEYLAAHDMTQ 318

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            R
Sbjct: 319 ARIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLQPEMSAPEVCDKLCAAIR 378

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           S K+  ++ NFANPDMVGHTG  DAA KA+E  D  +G   EA K     +FI +DHGNA
Sbjct: 379 SEKYDVIIINFANPDMVGHTGILDAAIKAVETVDTCVGKAVEALKEVDGQMFICADHGNA 438

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQ+ + E G P T+HT NPVPFIL +   S+     G L D+ PT+++++G+E P EMTG
Sbjct: 439 EQLVNYETGEPLTSHTTNPVPFILVNADPSYTLKEDGCLADIIPTMIELMGMEQPAEMTG 498

Query: 474 LSLLKK 479
            SLL K
Sbjct: 499 KSLLIK 504



>gi|495979469|ref|WP_008704048.1| phosphoglyceromutase [Ruminococcus sp. 5_1_39BFAA]
 gi|251850808|gb|EES78766.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ruminococcus sp. 5_1_39BFAA]
          Length = 513

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 234/485 (48%), Positives = 313/485 (64%), Gaps = 11/485 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPVMDKL  EYP+    A GLAVGLP+G MGNSEVGH+N+GAGR+VYQ++ RI   ++
Sbjct: 28  AKTPVMDKLMAEYPFVKGNASGLAVGLPDGQMGNSEVGHMNMGAGRIVYQELTRITKEIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + + ++     AKE N  +HF+GL+SDGGVHSH  HL  LLE AK  G+ K YVH
Sbjct: 88  DGDFFKNEALLAAMKNAKENNSAVHFMGLLSDGGVHSHNTHLYGLLEMAKREGVEKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +++E L+  +  +  G+IAT+ GRYYAMDRD RW+R+++A+ ALT 
Sbjct: 148 CFLDGRDTPPASGKEFVEALEAEMKKIGVGEIATVSGRYYAMDRDNRWDRVELAYNALTT 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G G K  D  + ++  +  D+TDEF+ P +++++    G+I + D++ FF+FR DR R+I
Sbjct: 208 GEGVKGTDAPAAVQASYDNDKTDEFVLPTVIEKDGQPTGVISDKDSVVFFNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPF-PLAFPPQSMENVLSEWFAKHKISQC 295
            + F       FE K    +   C T Y        +AF    + N   E+ A H ++Q 
Sbjct: 268 TRAFCDDDFQGFERKARPQVTFVCFTDYDDTIQNKQVAFHKVQLHNTFGEYLAAHNMTQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            +S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLQPEMSAPQVCEKLVDAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG  +AA KA+E  D+ +G   EA K     +FI +DHGNAE
Sbjct: 388 DKYDVIVINFANPDMVGHTGVQEAAIKAVETVDECVGKAVEALKEVDGQMFICADHGNAE 447

Query: 416 QMQD-EEGNPHTAHTCNPVPFIL--ASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           Q+ D E G P TAHT NPVPFIL  A  KY+  E+  G L D+ PT++ ++G+E P EMT
Sbjct: 448 QLIDYETGAPWTAHTTNPVPFILVNADPKYTLREN--GCLADIVPTLIQLMGMEQPAEMT 505

Query: 473 GLSLL 477
           G SLL
Sbjct: 506 GKSLL 510



>gi|489576918|ref|WP_003481364.1| phosphoglyceromutase [Clostridium perfringens]
 gi|380304922|gb|EIA17206.1| phosphoglyceromutase [Clostridium perfringens F262]
          Length = 512

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 316/488 (64%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+L  +YP+T L+A GL VGLPEG MGNSEVGHLNIGAGR++YQ++ RI   +K
Sbjct: 28  ANKPNYDRLFNKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F     +VK  D AKE N  +H +GL+S+GGVHSHI+HL  LLE AK  G+ K YVH
Sbjct: 88  EGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S   ++ +L+ A+ ++  G+IATI GRYYAMDRD RWER+++A+ A+  
Sbjct: 148 AFMDGRDVAPSSGKAFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAYNAMVL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+   +  I + +  ++TDEF+ P +++E+G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVSRIKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRY-KSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +  P F+    + LH+   CMT+Y K+     +A+ P+S  N L E+ A   ++Q
Sbjct: 268 --TRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVAAKGLNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVE+P   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEQPNTNEYRALIASPKVATYDLKPEMSAYEVTDELINRLD 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G + +        LFIT+DHGNA
Sbjct: 386 QDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNA 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTK--GALCDVAPTILDVIGLETPKEM 471
           E M D   G P TAHT +PVPF+  S K +  +S K  G L D+APT+L V+GLE P EM
Sbjct: 446 EVMIDYSTGKPMTAHTSDPVPFLWIS-KDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEM 504

Query: 472 TGLSLLKK 479
           TG  LL K
Sbjct: 505 TGTCLLNK 512



>gi|110801419|ref|YP_695951.1| phosphoglyceromutase [Clostridium perfringens ATCC 13124]
 gi|499910012|ref|WP_011590746.1| phosphoglyceromutase [Clostridium perfringens]
 gi|122958895|sp|Q0TQY9.1|GPMI_CLOP1 RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|110676066|gb|ABG85053.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Clostridium perfringens ATCC 13124]
          Length = 512

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 317/488 (64%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+L  +YP+T L+A GL VGLPEG MGNSEVGHLNIGAGR++YQ++ RI   +K
Sbjct: 28  ANKPNYDRLFAKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F     +VK  D AKE N  +H +GL+S+GGVHSHI+HL  LLE AK  G+ K YVH
Sbjct: 88  EGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S  +++ +L+ A+ ++  G+IATI GRYYAMDRD RWER+++A+ A+  
Sbjct: 148 AFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAYNAMVL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+   +  I + +  ++TDEF+ P +++E+G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVARIKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRY-KSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +  P F+    + LH+   CMT+Y K+     +A+ P+S  N L E+ A   ++Q
Sbjct: 268 --TRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVASKGLNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVE+P   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELINRLD 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G + +        LFIT+DHGNA
Sbjct: 386 QDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNA 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTK--GALCDVAPTILDVIGLETPKEM 471
           E M D   G P TAHT +PVPF+  S K +  +S K  G L D+APT+L V+GLE P EM
Sbjct: 446 EVMIDYSTGKPMTAHTSDPVPFLWVS-KDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEM 504

Query: 472 TGLSLLKK 479
           TG  LL K
Sbjct: 505 TGTCLLNK 512



>gi|489573474|ref|WP_003477920.1| phosphoglyceromutase [Clostridium perfringens]
 gi|373227180|gb|EHP49500.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium perfringens WAL-14572]
          Length = 512

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 317/488 (64%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+L  +YP+T L+A GL VGLPEG MGNSEVGHLNIGAGR++YQ++ RI   +K
Sbjct: 28  ANKPNYDRLFNKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F     +VK  D AKE N  +H +GL+S+GGVHSHI+HL  LLE AK  G+ K YVH
Sbjct: 88  EGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S  +++ +L+ A+ ++  G+IATI GRYYAMDRD RWER+++A+ A+  
Sbjct: 148 AFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAYNAMVL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+   +  I + +  ++TDEF+ P +++E+G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVSRIKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRY-KSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +  P F+    + LH+   CMT+Y K+     +A+ P+S  N L E+ A   ++Q
Sbjct: 268 --TRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVASKGLNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVE+P   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELINRLD 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G + +        LFIT+DHGNA
Sbjct: 386 QDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNA 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTK--GALCDVAPTILDVIGLETPKEM 471
           E M D   G P TAHT +PVPF+  S K +  +S K  G L D+APT+L V+GLE P EM
Sbjct: 446 EVMIDYSTGKPMTAHTSDPVPFLWVS-KDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEM 504

Query: 472 TGLSLLKK 479
           TG  LL K
Sbjct: 505 TGTCLLNK 512



>gi|18310283|ref|NP_562217.1| phosphoglyceromutase [Clostridium perfringens str. 13]
 gi|499319884|ref|WP_011010376.1| phosphoglyceromutase [Clostridium perfringens]
 gi|27734316|sp|Q8XKU2.1|GPMI_CLOPE RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|18144963|dbj|BAB81007.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium perfringens str. 13]
          Length = 512

 Score =  456 bits (1172), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 316/488 (64%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+L  +YP+T L+A GL VGLPEG MGNSEVGHLNIGAGR++YQ++ RI   +K
Sbjct: 28  ANKPNYDRLFNKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F     +VK  D AKE N  +H +GL+S+GGVHSHI+HL  LLE AK  G+ K YVH
Sbjct: 88  EGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S   ++ +L+ A+ ++  G+IATI GRYYAMDRD RWER+++A+ A+  
Sbjct: 148 AFMDGRDVAPSSGKDFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAYNAMAL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+   +  I + +  ++TDEF+ P +++E+G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVARIKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRY-KSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +  P F+    + LH+   CMT+Y K+     +A+ P+S  N L E+ A   ++Q
Sbjct: 268 --TRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVASKGLNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVE+P   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELINRLD 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G + +        LFIT+DHGNA
Sbjct: 386 QDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNA 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTK--GALCDVAPTILDVIGLETPKEM 471
           E M D   G P TAHT +PVPF+  S K +  +S K  G L D+APT+L V+GLE P EM
Sbjct: 446 EVMIDYSTGKPMTAHTSDPVPFLWVS-KDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEM 504

Query: 472 TGLSLLKK 479
           TG  LL K
Sbjct: 505 TGTCLLNK 512



>gi|118444017|ref|YP_877495.1| phosphoglyceromutase [Clostridium novyi NT]
 gi|500040785|ref|WP_011721503.1| phosphoglyceromutase [Clostridium novyi]
 gi|166991378|sp|A0PYP3.1|GPMI_CLONN RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|118134473|gb|ABK61517.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium novyi NT]
          Length = 511

 Score =  456 bits (1172), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 238/486 (48%), Positives = 314/486 (64%), Gaps = 11/486 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+ P +DK+ +EYP+T L A GL+VGLP+G MGNSEVGHLNIGAGR+VYQ + RI  +++
Sbjct: 28  AKKPNLDKIFKEYPHTVLGASGLSVGLPDGQMGNSEVGHLNIGAGRIVYQALTRITKSIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +    + + ++K  D AK  +  IHF+GL+SDGGVHSHI+HL  L++ A   G+ K YVH
Sbjct: 88  DGDIFKNEALLKAIDNAKNNDSAIHFMGLLSDGGVHSHIDHLKGLIDFAAKSGVKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P+S+  Y+E L+K + ++  G IAT+ GRYYAMDRDKRWERI++A+ A+  
Sbjct: 148 AFLDGRDTAPKSALTYIEDLEKHMAEVGVGSIATVSGRYYAMDRDKRWERIELAYNAMVL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GE +  P   +   +  ++TDEF+ P +++++G     IK ND++ FF+FR DR RQI
Sbjct: 208 GKGEVATSPKEAVERSYHDNKTDEFVLPTVIEKDGKPVATIKSNDSVVFFNFRPDRARQI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +    F+    E L++    MT Y S      +AF P+S  N L E+ +K    Q
Sbjct: 268 --TRAINDKEFDGFKRETLNLVFVTMTEYDSTIEGVEVAFKPESYVNTLGEYVSKQGKKQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVEEP   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEEPNQNEDRALIPSPKVATYDLKPEMSAYEVTDEVLKRID 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           S ++  ++ N+ANPDMVGHTG  DAA KA+E  D+ +G + +        LFIT+DHGN 
Sbjct: 386 SDEYDMIILNYANPDMVGHTGVIDAAVKAVETVDECLGKVMDKILEKNGALFITADHGNC 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAE-STKGALCDVAPTILDVIGLETPKEMT 472
           EQM D   GNP TAHT N VPF   +N     E   +G L D+APT+L  +GLE PKEMT
Sbjct: 446 EQMIDYSTGNPMTAHTTNLVPFAYIANDAKEKELREEGILADIAPTMLQSMGLEVPKEMT 505

Query: 473 GLSLLK 478
           G SL K
Sbjct: 506 GKSLFK 511



>gi|489555780|ref|WP_003460356.1| phosphoglyceromutase [Clostridium perfringens]
 gi|170710287|gb|EDT22469.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Clostridium perfringens B str. ATCC 3626]
 gi|170713458|gb|EDT25640.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Clostridium perfringens CPE str. F4969]
 gi|182379791|gb|EDT77270.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Clostridium perfringens NCTC 8239]
          Length = 512

 Score =  455 bits (1171), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 317/488 (64%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+L  +YP+T L+A GL VGLPEG MGNSEVGHLNIGAGR++YQ++ RI   +K
Sbjct: 28  ANKPNYDRLFNKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F     +VK  D AKE N  +H +GL+S+GGVHSHI+HL  LLE AK  G+ K YVH
Sbjct: 88  EGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S  +++ +L+ A+ ++  G+IATI GRYYAMDRD RWER+++A+ A+  
Sbjct: 148 AFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAYNAMVL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+   +  I + +  ++TDEF+ P +++E+G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVARIKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRY-KSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +  P F+    + LH+   CMT+Y K+     +A+ P+S  N L E+ A   ++Q
Sbjct: 268 --TRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVAAKGLNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVE+P   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELIKRLD 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G + +        LFIT+DHGNA
Sbjct: 386 QDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNA 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTK--GALCDVAPTILDVIGLETPKEM 471
           E M D   G P TAHT +PVPF+  S K +  +S K  G L D+APT+L V+GLE P EM
Sbjct: 446 EVMIDYSTGKPMTAHTSDPVPFLWIS-KDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEM 504

Query: 472 TGLSLLKK 479
           TG  LL K
Sbjct: 505 TGTCLLNK 512



>gi|126700791|ref|YP_001089688.1| phosphoglyceromutase [Clostridium difficile 630]
 gi|500188509|ref|WP_011861866.1| phosphoglyceromutase [[Clostridium] difficile]
 gi|123362967|sp|Q181T7.1|GPMI_CLOD6 RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|115252228|emb|CAJ70068.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM)
           [Clostridium difficile 630]
          Length = 510

 Score =  455 bits (1171), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 235/486 (48%), Positives = 321/486 (66%), Gaps = 11/486 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           ++TP +D++K+EYP T + A GL VGLP+G MGNSEVGH NIGAGR+VYQD+ RI  ++K
Sbjct: 28  SKTPNLDRIKKEYPNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F     + +  D AKE +  +H +GL+SDGGVHSHI+HL  +++ AK+ G+ K YVH
Sbjct: 88  DGDFFTNKVLCEAMDNAKENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVH 145

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P+S+ +Y +++Q ++D++  G+ AT+ GRYYAMDRDKRWER+++A+ A+ +
Sbjct: 146 AFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKRWERVELAYNAMVR 205

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G+GEK+      I+  +   + DEF+ P ++ ++    G IKEND++ FF+FR DR RQI
Sbjct: 206 GIGEKANSIEEAIQNSYDDGKNDEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQI 265

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKISQC 295
            +         F+ +  +N  + C+T Y        +AF PQS+ N L E+ AK+  +Q 
Sbjct: 266 TRALVCEEFDGFKREDIKNFFV-CLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQL 324

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
             AETEK+AHVTFFFNGGVEEP   E R LI SPKVATYDLKPEMS              
Sbjct: 325 RAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGE 384

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            KF F++ NFANPDMVGHTG  +AA KA+E  D  +G + +     G    IT+DHGNAE
Sbjct: 385 DKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNAE 444

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMTG 473
            M D E G   TAH+ NPVPFI+   +Y  A+   G  L D+APTILD++ LE P+EMTG
Sbjct: 445 YMLDPETGKTVTAHSINPVPFIVVGQEYESAKLLDGGRLSDIAPTILDMMKLEKPEEMTG 504

Query: 474 LSLLKK 479
            SL+ K
Sbjct: 505 HSLISK 510



>gi|489636014|ref|WP_003540454.1| phosphoglyceromutase [Desulfotomaculum nigrificans]
 gi|323533509|gb|EGB23375.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Desulfotomaculum nigrificans DSM 574]
          Length = 517

 Score =  455 bits (1171), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/489 (47%), Positives = 303/489 (61%), Gaps = 16/489 (3%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+T  + KL   YP T L   G AVGLPEG MGNSEVGHLNIGAGRVVYQ++ RI  A+K
Sbjct: 30  ADTSHIKKLMATYPTTILTCSGEAVGLPEGQMGNSEVGHLNIGAGRVVYQELTRITKAIK 89

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + + ++K    AKE    +H +GL+SDGGVHSHI H+   L+ A+  G+ + Y H
Sbjct: 90  DGDFFQNEELLKAVRNAKERQTALHIMGLLSDGGVHSHIRHIFATLKLARQEGLSRVYFH 149

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S+  Y+  L   + ++  G++AT+ GRYYAMDRD+RWER ++A+ AL  
Sbjct: 150 AFLDGRDVPPSSAKSYMNVLLTKMKEIGVGQVATVSGRYYAMDRDRRWERTELAYRALVY 209

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE-----GIIKENDTLFFFDFRADRMRQ 236
             G ++  P+  I   + + ETDEF+KP I+ ++       + + D++ F +FR DR RQ
Sbjct: 210 SEGLQANSPVEAIDVGYERGETDEFIKPTIITDDQKQPVAKVADGDSVIFVNFRPDRARQ 269

Query: 237 IVQTF------GVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           I + F      G    P   ++    H  CMT+Y      P+AFPP  + N L EW +KH
Sbjct: 270 ITRAFVDEDFTGFDRGPGRPRV----HFVCMTQYDKTIEAPVAFPPAKLVNTLGEWLSKH 325

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + Q  +AETEK+AHVTFFFNGGVE     E R LI SPKVATYDLKPEMS         
Sbjct: 326 GLKQLRLAETEKYAHVTFFFNGGVEAANPGEERILIPSPKVATYDLKPEMSAYEITDTFL 385

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
               SG++  ++ NFANPDMVGHTG   A   AI   DK IG I EA       + IT D
Sbjct: 386 ERLNSGQYDVIITNFANPDMVGHTGDLQATEAAITTVDKCIGRIAEAMLEKSGTVIITGD 445

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAE-STKGALCDVAPTILDVIGLETPK 469
           HGNA++M+DE G  +TAHT +PVPFIL  ++Y  A+    G+L D+APT+LD++GL  P 
Sbjct: 446 HGNADKMRDEHGGAYTAHTTSPVPFILVDDRYKGAKLRNGGSLQDIAPTMLDILGLPKPP 505

Query: 470 EMTGLSLLK 478
           EMTG SLLK
Sbjct: 506 EMTGESLLK 514



>gi|488637369|ref|WP_002574027.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium bolteae]
 gi|480671973|gb|ENZ15466.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium clostridioforme 90A7]
 gi|480698598|gb|ENZ41325.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium bolteae 90B3]
 gi|480710988|gb|ENZ53433.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium bolteae 90A9]
          Length = 513

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 233/488 (47%), Positives = 320/488 (65%), Gaps = 12/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMD+L  + P+   EA G+AVGLPEG MGNSEVGHLN+GAGR+VYQ++ RI  +++
Sbjct: 28  GKTPVMDQLMSQCPFVKGEASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F ++   +   +  K+ +  +H  GLVSDGGVHSH  H+  LLE AK +G+ K YVH
Sbjct: 88  DGDFFQIPEFLTAVENCKKHDSALHMFGLVSDGGVHSHNTHIYGLLELAKKNGLKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++EQL+  + ++  G++A+++GRYYAMDRDKRW+R+++A+ ALTK
Sbjct: 148 CFLDGRDTPPESGKGFVEQLEAKMKEIGVGEVASVMGRYYAMDRDKRWDRVELAYNALTK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G ++E   + I+  +   + DEF+ P +V ++G     I++ D++ F++FR DR R+I
Sbjct: 208 GEGNQAESAAAGIQASYDSGKADEFVIPFVVMKDGKPAATIQDKDSVIFYNFRPDRAREI 267

Query: 238 VQTF---GVPPPPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKIS 293
            + F        P E ++  +L   C T Y       L AF  +S+ N   E+ A +K +
Sbjct: 268 TRAFCDDSFDGFPREKRL--DLVYVCFTDYDETIQNKLVAFKKESITNTFGEFLAANKKT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXX 352
           Q  +AETEK+AHVTFFFNGGVEEP + E R L+ SPK VATYDLKPEMS           
Sbjct: 326 QVRIAETEKYAHVTFFFNGGVEEPNEGEDRILVPSPKEVATYDLKPEMSANGVCDKLVEA 385

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
            +SGK+  ++ NFANPDMVGHTG  DAA KAIE  D  +G   EA +    ++FI +DHG
Sbjct: 386 IKSGKYDVIIINFANPDMVGHTGVEDAAIKAIETVDACVGRAVEAIREVDGVMFICADHG 445

Query: 413 NAEQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEM 471
           NAEQ+ D E G P TAHT NPVPFIL +   S      GALCD+ PT+++++G+E PKEM
Sbjct: 446 NAEQLVDYETGEPFTAHTTNPVPFILVNADPSCKLREGGALCDIVPTLIELMGMEQPKEM 505

Query: 472 TGLSLLKK 479
           TG SLL K
Sbjct: 506 TGKSLLVK 513



>gi|489545829|ref|WP_003450482.1| phosphoglyceromutase [Clostridium perfringens]
 gi|169298671|gb|EDS80750.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Clostridium perfringens C str. JGS1495]
          Length = 512

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 317/488 (64%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+L  +YP+T L+A GL VGLPEG MGNSEVGHLNIGAGR++YQ++ RI   +K
Sbjct: 28  ANKPNYDRLFNKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F     +VK  D AKE N  +H +GL+S+GGVHSHI+HL  LLE AK  G+ K YVH
Sbjct: 88  EGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S  +++ +L+ A+ ++  G+IATI GRYYAMDRD RWER+++A+ A+  
Sbjct: 148 AFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAYNAMIL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+   +  I + +  ++TDEF+ P +++E+G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVSRIKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRY-KSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +  P F+    + LH+   CMT+Y K+     +A+ P+S  N L E+ A   ++Q
Sbjct: 268 --TRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVASKGLNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVE+P   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELIKRLD 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G + +        LFIT+DHGNA
Sbjct: 386 EDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNA 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTK--GALCDVAPTILDVIGLETPKEM 471
           E M D   G P TAHT +PVPF+  S K +  +S K  G L D+APT+L V+GLE P EM
Sbjct: 446 EVMIDYSTGKPMTAHTSDPVPFLWIS-KDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEM 504

Query: 472 TGLSLLKK 479
           TG  LL K
Sbjct: 505 TGTCLLNK 512



>gi|374997848|ref|YP_004973347.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfosporosinus orientis DSM 765]
 gi|503953640|ref|WP_014187634.1| phosphoglyceromutase [Desulfosporosinus orientis]
 gi|357216214|gb|AET70832.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfosporosinus orientis DSM 765]
          Length = 514

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/486 (46%), Positives = 322/486 (66%), Gaps = 8/486 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           +A+ P  ++L ++YP+T LEA G AVGLP+G MGNSEVGHLN+GAGRVVYQ++ RI   +
Sbjct: 28  SAKIPNFERLSKDYPFTVLEASGEAVGLPKGQMGNSEVGHLNMGAGRVVYQELTRIFKGI 87

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           ++    +   +++  ++AKE N  +H +GL+S+GGVHSHI+HL  LLE +K  G+ K ++
Sbjct: 88  QDGSIYKNSVLLEGMNQAKENNKGLHLMGLLSNGGVHSHIDHLFALLEMSKQQGLEKVFI 147

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H   DGRD  P+S+ +++ QL++ I +L  GKIA++ GRYY MDRDKRWER++  + A+ 
Sbjct: 148 HVILDGRDVLPQSAKEFISQLEEKIKELGVGKIASVSGRYYVMDRDKRWERLEKGYRAIA 207

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE-----GIIKENDTLFFFDFRADRMR 235
            G G+ +   L+ +   +    TDEF+ P ++D+      G ++E D++ FF+FR+DR R
Sbjct: 208 YGEGKHAPGALAAVEFSYDTRVTDEFVVPTVIDDPEGNPVGRVQEGDSIIFFNFRSDRAR 267

Query: 236 QIVQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           +I + F     P FE     ++H  CMT Y      P+AFP Q+++N L E  +   + Q
Sbjct: 268 EITRAFVDEEFPGFERPQRPHVHFVCMTEYDETISAPVAFPQQNLDNTLGEVLSDQGLKQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGG+EEPF  E R LI SPKVATY+LKPEMS            +
Sbjct: 328 LRIAETEKYAHVTFFFNGGLEEPFPNEERILIPSPKVATYNLKPEMSAREITKDVLEQLK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
              F  V+ NFANPDMVGHTG +DA  +A+EV D+ +G IY+  +     L +T+DHGNA
Sbjct: 388 ESAFDVVILNFANPDMVGHTGVFDATVQAVEVVDECLGQIYDELRKEKGTLIVTADHGNA 447

Query: 415 EQMQDEEGN-PHTAHTCNPVPFILASNKY-SFAESTKGALCDVAPTILDVIGLETPKEMT 472
           E+  D + + P TAH+ N VPFILA ++Y   +  + GALCDVAPTIL+++ +  PKEMT
Sbjct: 448 EEKVDPKTSLPLTAHSTNCVPFILADDRYKGRSLRSGGALCDVAPTILELLQIPLPKEMT 507

Query: 473 GLSLLK 478
           G SL++
Sbjct: 508 GKSLIE 513



>gi|493912729|ref|WP_006858103.1| phosphoglyceromutase [Roseburia intestinalis]
 gi|257201793|gb|EEV00078.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Roseburia intestinalis L1-82]
          Length = 513

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 230/486 (47%), Positives = 311/486 (63%), Gaps = 7/486 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            A+TPV+D L ++YP+    A GLAVGLP+G MGNSEVGHLN+GAGR+VYQ++ RI   +
Sbjct: 27  QAKTPVIDGLMKDYPFVKGNASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQELTRITKEI 86

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
            +  F +   ++   +  K+    +H  GL+S+GGVHSHI HL  LL+ AK  G+   YV
Sbjct: 87  SDGDFFKNQALLDGMENVKKNGSDLHLYGLLSNGGVHSHITHLFGLLDMAKKEGVENVYV 146

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT P S  +++E+L+  + ++  GKIA+I GRYYAMDRD RW+R++ A++ LT
Sbjct: 147 HCFLDGRDTAPTSGKEFIEELEAKMKEIGVGKIASISGRYYAMDRDNRWDRVEKAYKVLT 206

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
            G GE +E  ++ +   ++KD TDEF  P  + E G     IK+NDT+ FF+FR DR R+
Sbjct: 207 TGEGETAESAVAAMEASYAKDVTDEFFVPTAITENGKPIATIKDNDTVIFFNFRPDRARE 266

Query: 237 IVQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFP-LAFPPQSMENVLSEWFAKHKISQ 294
           I +TF +     F+    +N+   C T Y    P   +AF    ++N   E+ A H ++Q
Sbjct: 267 ITRTFCMDDFDGFDRGARKNVKYICFTEYDVTIPNKEVAFKKVELKNTFGEYLAAHDMTQ 326

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            R
Sbjct: 327 ARIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLQPEMSAPEVCDKLCAAIR 386

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           S K+  ++ NFANPDMVGHTG  DAA KA+E  D  +G   EA K     +FI +DHGNA
Sbjct: 387 SEKYDVIIINFANPDMVGHTGILDAAIKAVETVDTCVGKAVEALKEVDGQMFICADHGNA 446

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQ+ + E G P T+HT NPVPFIL +   S+     G L D+ PT+++++G+E P EMTG
Sbjct: 447 EQLVNYETGEPLTSHTTNPVPFILVNADPSYTLKEDGCLADIIPTMIELMGMEQPAEMTG 506

Query: 474 LSLLKK 479
            SLL K
Sbjct: 507 KSLLIK 512



>gi|497579679|ref|WP_009893863.1| phosphoglyceromutase [[Clostridium] difficile]
          Length = 509

 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 234/486 (48%), Positives = 321/486 (66%), Gaps = 11/486 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           ++TP +D++K+EYP T + A GL VGLP+G MGNSEVGH NIGAGR+VYQD+ RI  ++K
Sbjct: 27  SKTPNLDRIKKEYPNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIK 86

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F     + +  D AKE +  +H +GL+SDGGVHSHI+HL  +++ AK+ G+ K YVH
Sbjct: 87  DGDFFANKVLCEAMDNAKENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVH 144

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P+S+ +Y +++Q ++D++  G+ AT+ GRYYAMDRDKRWER+++A+ A+ +
Sbjct: 145 AFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKRWERVELAYNAMVR 204

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G+GEK+      I+  +   + DEF+ P ++ ++    G IKEND++ FF+FR DR RQI
Sbjct: 205 GIGEKANSIEEAIQNSYDDGKNDEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQI 264

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKISQC 295
            +         F+ +  +N  + C+T Y        +AF PQS+ N L E+ AK+  +Q 
Sbjct: 265 TRALVCEEFDGFKREDIKNFFV-CLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQL 323

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
             AETEK+AHVTFFFNGGVEEP   E R LI SPKVATYDLKPEMS              
Sbjct: 324 RAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGE 383

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            KF F++ NFANPDMVGHTG  +AA KA+E  D  +G + +     G    IT+DHGNAE
Sbjct: 384 DKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNAE 443

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMTG 473
            M D E G   TAH+ NPVPFI+   +Y  A+   G  L D+APT+LD++ LE P+EMTG
Sbjct: 444 YMLDPETGKTVTAHSINPVPFIVVGQEYESAKLLDGGRLSDIAPTVLDMMKLEKPEEMTG 503

Query: 474 LSLLKK 479
            SL+ K
Sbjct: 504 HSLISK 509



>gi|260684710|ref|YP_003215995.1| phosphoglyceromutase [Clostridium difficile CD196]
 gi|260688368|ref|YP_003219502.1| phosphoglyceromutase [Clostridium difficile R20291]
 gi|384362378|ref|YP_006200230.1| phosphoglyceromutase [Clostridium difficile BI1]
 gi|497577397|ref|WP_009891581.1| phosphoglyceromutase [[Clostridium] difficile]
 gi|260210873|emb|CBA66016.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium difficile CD196]
 gi|260214385|emb|CBE06785.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium difficile R20291]
          Length = 510

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 235/487 (48%), Positives = 321/487 (65%), Gaps = 13/487 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           ++TP +D++K+EYP T + A GL VGLP+G MGNSEVGH NIGAGR+VYQD+ RI  ++K
Sbjct: 28  SKTPNLDRIKKEYPNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F     + +  D AKE +  +H +GL+SDGGVHSHI+HL  +++ AK+ G+ K YVH
Sbjct: 88  DGDFFANKVLCEAMDNAKENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVH 145

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P+S+ +Y +++Q ++D++  G+ AT+ GRYYAMDRDKRWER+++A+ A+ +
Sbjct: 146 AFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKRWERVELAYNAMVR 205

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G+GEK+      I+  +   + DEF+ P ++ ++    G IKEND++ FF+FR DR RQI
Sbjct: 206 GIGEKANSIEEAIQNSYDDGKNDEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQI 265

Query: 238 VQTFGVPPPPFEAKIPENLH--ITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +    F+    E++     C+T Y        +AF PQS+ N L E+ AK+  +Q
Sbjct: 266 --TRALVCEEFDGFKREDIKNFFVCLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQ 323

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
              AETEK+AHVTFFFNGGVEEP   E R LI SPKVATYDLKPEMS             
Sbjct: 324 LRAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLG 383

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             KF F++ NFANPDMVGHTG  +AA KA+E  D  +G + +     G    IT+DHGNA
Sbjct: 384 EDKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNA 443

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMT 472
           E M D E G   TAH+ NPVPFI+   +Y  A+   G  L D+APT+LD++ LE P+EMT
Sbjct: 444 EYMLDPETGKTVTAHSINPVPFIVVGQEYESAKLLDGGRLSDIAPTVLDMMKLEKPEEMT 503

Query: 473 GLSLLKK 479
           G SL+ K
Sbjct: 504 GHSLISK 510



>gi|489529413|ref|WP_003434147.1| phosphoglyceromutase [[Clostridium] difficile]
 gi|357559264|gb|EHJ40718.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium difficile 70-100-2010]
          Length = 510

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 234/486 (48%), Positives = 321/486 (66%), Gaps = 11/486 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           ++TP +D++K+EYP T + A GL VGLP+G MGNSEVGH NIGAGR+VYQD+ RI  ++K
Sbjct: 28  SKTPNLDRIKKEYPNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F     + +  D AKE +  +H +GL+SDGGVHSHI+HL  +++ AK+ G+ K YVH
Sbjct: 88  DGDFFTNKVLCEAMDNAKENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVH 145

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P+S+ +Y +++Q ++D++  G+ AT+ GRYYAMDRDKRWER+++A+ A+ +
Sbjct: 146 AFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKRWERVELAYNAMVR 205

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G+GEK+      I+  +   + DEF+ P ++ ++    G IKEND++ FF+FR DR RQI
Sbjct: 206 GIGEKANSIEEAIQNSYDDGKNDEFIMPTVIMKDDKPAGSIKENDSIIFFNFRPDRARQI 265

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKISQC 295
            +         F+ +  +N  + C+T Y        +AF PQS+ N L E+ AK+  +Q 
Sbjct: 266 TRALVCEEFDGFKREDIKNFFV-CLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQL 324

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
             AETEK+AHVTFFFNGGVEEP   E R LI SPKVATYDLKPEMS              
Sbjct: 325 RAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGE 384

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            KF F++ NFANPDMVGHTG  +AA KA+E  D  +G + +     G    IT+DHGNAE
Sbjct: 385 DKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNAE 444

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMTG 473
            M D E G   TAH+ NPVPFI+   +Y  A+   G  L D+APT+LD++ LE P+EMTG
Sbjct: 445 YMLDPETGKTVTAHSINPVPFIVVGQEYESAKLLDGGRLSDIAPTVLDMMKLEKPEEMTG 504

Query: 474 LSLLKK 479
            SL+ K
Sbjct: 505 HSLISK 510



>gi|479157227|ref|YP_007786822.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ruminococcus torques L2-14]
 gi|505341801|ref|WP_015528903.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [[Ruminococcus] torques]
 gi|291550052|emb|CBL26314.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ruminococcus torques L2-14]
          Length = 512

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 228/485 (47%), Positives = 316/485 (65%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TPVMDKL  EYP+    A GL+VGLP+G MGNSEVGH+N+GAGR++YQ++ +I  +++
Sbjct: 28  ANTPVMDKLMAEYPFVKGNASGLSVGLPDGQMGNSEVGHMNMGAGRIIYQELTKITKSIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           + +F E   ++   +  K+ +  +H +GLVSDGGVHSHI H+  +LE AK  GI K YVH
Sbjct: 88  DGEFFENKALLAACENVKKNDSALHLMGLVSDGGVHSHITHIYGILELAKRQGIEKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +Y+EQL+  + ++  G++A++ GRYYAMDRD RW+R++ A++AL  
Sbjct: 148 CFLDGRDTPPASGKEYVEQLEAKMKEIGVGEVASVSGRYYAMDRDNRWDRVEKAYKALVA 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G  +E   + I+  + +D TDEF+ P +V ++G     IKEND++ FF+FR DR R++
Sbjct: 208 GEGNTAESATAGIQASYDEDVTDEFVVPFVVTKDGAATATIKENDSVVFFNFRPDRAREL 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            +TF       FE          C T Y +     + AF  +S+ N   ++ A + + Q 
Sbjct: 268 TRTFCDDSFDGFERGDRVKTTFVCFTEYDATIENKMVAFVKESITNTFGQFLADNGLKQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDLKPEMS            +S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPKVATYDLKPEMSAYEVCDKLVGAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
             +  ++ NFANPDMVGHTG  +AA KA+E  D+ +G   EA K     +FI +DHGNAE
Sbjct: 388 ENYDVIVINFANPDMVGHTGVQEAAIKAVEAVDECVGKAVEALKEVDGQMFICADHGNAE 447

Query: 416 QMQDEE-GNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+ DEE G P TAHT NPVPFIL +   ++     G L D+APT+++++G++ P EMTG 
Sbjct: 448 QLIDEETGEPFTAHTTNPVPFILVNADPAYKLREGGCLADIAPTLIELMGMQQPAEMTGK 507

Query: 475 SLLKK 479
           SLL K
Sbjct: 508 SLLVK 512



>gi|302390383|ref|YP_003826204.1| phosphoglycerate mutase [Thermosediminibacter oceani DSM 16646]
 gi|503041626|ref|WP_013276602.1| phosphoglyceromutase [Thermosediminibacter oceani]
 gi|302201011|gb|ADL08581.1| phosphoglycerate mutase [Thermosediminibacter oceani DSM 16646]
          Length = 514

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/490 (47%), Positives = 321/490 (65%), Gaps = 15/490 (3%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           +A TP  D+L R YP T LE+ GLAVGLPEG MGNSEVGHLN+GAGR+VYQ+  RI   +
Sbjct: 27  SARTPNYDRLLRHYPNTVLESSGLAVGLPEGQMGNSEVGHLNLGAGRIVYQEFTRISEDI 86

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           K+ +F E + +V+   RA+E    +H +GL+SDGGVHSHI+HLI LL+ ++  G+ + YV
Sbjct: 87  KSGRFFENEELVEAVRRAREGGKALHLMGLLSDGGVHSHIDHLIALLKLSRKEGLDRVYV 146

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRD  P ++  Y+E+L+K +  L  G+IATI GRYYAMDRDKRWER + A+ A+ 
Sbjct: 147 HAFLDGRDVPPANATVYIEKLEKEMAQLGVGRIATISGRYYAMDRDKRWERTEKAYNAMV 206

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKP-IIVDEE----GIIKENDTLFFFDFRADRMR 235
            G G ++E  +  + E + + ETDEF+ P +I D E    G+++  D++ FF+FR DR R
Sbjct: 207 LGEGLRAESAMKALEEAYKRGETDEFVIPTVITDAEGKPTGVVEAGDSIIFFNFRPDRAR 266

Query: 236 QIVQTFGVPPPPFEAKIPEN----LHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKH 290
           Q+  T+      F+    +     +H  CMT+Y  +     +A+ PQ ++N+ +E  +  
Sbjct: 267 QL--TYAFCEEDFKGFTRQKGFIPVHYVCMTQYDEKVKNAKIAYKPQLLKNIFAEVISNI 324

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + Q  +AETEK+AHVTFFFNGG E+PF  E R L+ SPKV TYD+KPEMS         
Sbjct: 325 GLKQLRIAETEKYAHVTFFFNGGEEKPFPGEDRLLVPSPKVPTYDMKPEMSAYEVTEEVI 384

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                 K+  ++ N+ANPDMVGHTG ++AA KAIE  D+ IG + EA +     + IT+D
Sbjct: 385 KKIDEDKYDVIIMNYANPDMVGHTGVFEAAVKAIETVDECIGRVVEAVQKKNGTVIITAD 444

Query: 411 HGNAEQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPK 469
           HGNAE+M D E G  HTAHT +PVPFIL S++        G L DVAPT+L+++G+E P 
Sbjct: 445 HGNAEKMVDFETGEAHTAHTSDPVPFILVSDRS--CRLRPGILADVAPTMLELLGIEKPA 502

Query: 470 EMTGLSLLKK 479
           EMTG SL+++
Sbjct: 503 EMTGCSLIEE 512



>gi|488632762|ref|WP_002569446.1| phosphoglyceromutase [Clostridium bolteae]
 gi|158436907|gb|EDP14674.1| hypothetical protein CLOBOL_05217 [Clostridium bolteae ATCC
           BAA-613]
 gi|480705961|gb|ENZ48518.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium bolteae 90A5]
 gi|480766219|gb|ENZ64959.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium bolteae 90B7]
          Length = 513

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 233/488 (47%), Positives = 319/488 (65%), Gaps = 12/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMD+L  + P+   EA G+AVGLPEG MGNSEVGHLN+GAGR+VYQ++ RI  +++
Sbjct: 28  GKTPVMDQLMSQCPFVKGEASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F ++   +   +  K+ +  +H  GLVSDGGVHSH  H+  LLE AK +G+ K YVH
Sbjct: 88  DGDFFQIPEFLTAIENCKKHDSALHMFGLVSDGGVHSHNTHIYGLLELAKKNGLKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++EQL+  + ++  G++A+++GRYYAMDRDKRW+R+++A+ ALTK
Sbjct: 148 CFLDGRDTPPESGKGFVEQLEAKMKEIGVGEVASVMGRYYAMDRDKRWDRVELAYNALTK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G ++E   + I+  +   + DEF+ P +V ++G     I++ D++ F++FR DR R+I
Sbjct: 208 GEGNQAESAAAGIQASYDSGKADEFVIPFVVMKDGKPAATIQDKDSVIFYNFRPDRAREI 267

Query: 238 VQTF---GVPPPPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKIS 293
            + F        P E ++  +L   C T Y       L AF  +S+ N   E+ A HK +
Sbjct: 268 TRAFCDDSFDGFPREKRL--DLVYVCFTDYDETIQNKLVAFKKESITNTFGEFLAAHKKT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXX 352
           Q  +AETEK+AHVTFFFNGGVEEP + E R L+ SPK VATYDLKPEMS           
Sbjct: 326 QVRIAETEKYAHVTFFFNGGVEEPNEGEDRILVPSPKEVATYDLKPEMSANGVCDKLVEA 385

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
            +S K+  ++ NFANPDMVGHTG  DAA KAIE  D  +G   EA +    ++FI +DHG
Sbjct: 386 IKSDKYDVIIINFANPDMVGHTGVEDAAIKAIETVDACVGRAVEAIREVDGVMFICADHG 445

Query: 413 NAEQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEM 471
           NAEQ+ D E G P TAHT NPVPFIL +   S      GALCD+ PT+++++G+E PKEM
Sbjct: 446 NAEQLVDYETGEPFTAHTTNPVPFILVNADPSCKLREGGALCDIVPTLIELMGMEQPKEM 505

Query: 472 TGLSLLKK 479
           TG SLL K
Sbjct: 506 TGKSLLVK 513



>gi|489517132|ref|WP_003421955.1| phosphoglyceromutase [[Clostridium] difficile]
 gi|296429441|gb|EFH15307.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium difficile NAP07]
          Length = 510

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 234/486 (48%), Positives = 321/486 (66%), Gaps = 11/486 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           ++TP +D++K+EYP T + A GL VGLP+G MGNSEVGH NIGAGR+VYQD+ RI  ++K
Sbjct: 28  SKTPNLDRIKKEYPNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F     + +  D AKE +  +H +GL+SDGGVHSHI+HL  +++ AK+ G+ K YVH
Sbjct: 88  DGDFFTNKVLCEAMDNAKENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVH 145

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P+S+ +Y +++Q ++D++  G+ AT+ GRYYAMDRDKRWER+++A+ A+ +
Sbjct: 146 AFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKRWERVELAYNAMVR 205

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G+GEK+      I+  +   + DEF+ P ++ ++    G IKEND++ FF+FR DR RQI
Sbjct: 206 GIGEKATSIEEAIQNSYDDGKNDEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQI 265

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKISQC 295
            +         F+ +  +N  + C+T Y        +AF PQS+ N L E+ AK+  +Q 
Sbjct: 266 TRALVCEEFDGFKREDIKNFFV-CLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQL 324

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
             AETEK+AHVTFFFNGGVEEP   E R LI SPKVATYDLKPEMS              
Sbjct: 325 RAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGE 384

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            KF F++ NFANPDMVGHTG  +AA KA+E  D  +G + +     G    IT+DHGNAE
Sbjct: 385 DKFDFIVLNFANPDMVGHTGSIEAAVKAVETVDTCVGKLIDKIVELGGSAIITADHGNAE 444

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMTG 473
            M D E G   TAH+ NPVPFI+   +Y  A+   G  L D+APT+LD++ LE P+EMTG
Sbjct: 445 YMLDPETGKTVTAHSINPVPFIVVGQEYENAKLLDGGRLSDIAPTVLDMMKLEKPEEMTG 504

Query: 474 LSLLKK 479
            SL+ K
Sbjct: 505 HSLISK 510



>gi|490588079|ref|WP_004453099.1| phosphoglyceromutase [[Clostridium] difficile]
 gi|296259118|gb|EFH06000.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium difficile NAP08]
          Length = 509

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 234/486 (48%), Positives = 321/486 (66%), Gaps = 11/486 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           ++TP +D++K+EYP T + A GL VGLP+G MGNSEVGH NIGAGR+VYQD+ RI  ++K
Sbjct: 27  SKTPNLDRIKKEYPNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIK 86

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F     + +  D AKE +  +H +GL+SDGGVHSHI+HL  +++ AK+ G+ K YVH
Sbjct: 87  DGDFFTNKVLCEAMDNAKENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVH 144

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P+S+ +Y +++Q ++D++  G+ AT+ GRYYAMDRDKRWER+++A+ A+ +
Sbjct: 145 AFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKRWERVELAYNAMVR 204

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G+GEK+      I+  +   + DEF+ P ++ ++    G IKEND++ FF+FR DR RQI
Sbjct: 205 GIGEKATSIEEAIQNSYDDGKNDEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQI 264

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKISQC 295
            +         F+ +  +N  + C+T Y        +AF PQS+ N L E+ AK+  +Q 
Sbjct: 265 TRALVCEEFDGFKREDIKNFFV-CLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQL 323

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
             AETEK+AHVTFFFNGGVEEP   E R LI SPKVATYDLKPEMS              
Sbjct: 324 RAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLGE 383

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            KF F++ NFANPDMVGHTG  +AA KA+E  D  +G + +     G    IT+DHGNAE
Sbjct: 384 DKFDFIVLNFANPDMVGHTGSIEAAVKAVETVDTCVGKLIDKIVELGGSAIITADHGNAE 443

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMTG 473
            M D E G   TAH+ NPVPFI+   +Y  A+   G  L D+APT+LD++ LE P+EMTG
Sbjct: 444 YMLDPETGKTVTAHSINPVPFIVVGQEYENAKLLDGGRLSDIAPTVLDMMKLEKPEEMTG 503

Query: 474 LSLLKK 479
            SL+ K
Sbjct: 504 HSLISK 509



>gi|489561458|ref|WP_003465989.1| phosphoglyceromutase [Clostridium perfringens]
 gi|170661010|gb|EDT13693.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Clostridium perfringens E str. JGS1987]
          Length = 512

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 316/488 (64%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+L  +YP+T L+A GL VGLPEG MGNSEVGHLNIGAGR++YQ++ RI   +K
Sbjct: 28  ANKPNYDRLFNKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F     +VK  D AKE N  +H +GL+S+GGVHSHI+HL  LLE AK  G+ K YVH
Sbjct: 88  EGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S  +++ +L+ A+ ++  G+IATI GRYYAMDRD RWER+++A  A+  
Sbjct: 148 AFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAHNAMVL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+   +  I + +  ++TDEF+ P +++E+G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVARIKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRY-KSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +  P F+    + LH+   CMT+Y K+     +A+ P+S  N L E+ A   ++Q
Sbjct: 268 --TRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPESYTNTLGEYVAAKGLNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVE+P   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELIKRLD 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G + +        LFIT+DHGNA
Sbjct: 386 QDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNA 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTK--GALCDVAPTILDVIGLETPKEM 471
           E M D   G P TAHT +PVPF+  S K +  +S K  G L D+APT+L V+GLE P EM
Sbjct: 446 EVMIDYSTGKPMTAHTSDPVPFLWVS-KDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEM 504

Query: 472 TGLSLLKK 479
           TG  LL K
Sbjct: 505 TGTCLLNK 512



>gi|497584119|ref|WP_009898303.1| phosphoglyceromutase [[Clostridium] difficile]
          Length = 509

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 235/487 (48%), Positives = 321/487 (65%), Gaps = 13/487 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           ++TP +D++K+EYP T + A GL VGLP+G MGNSEVGH NIGAGR+VYQD+ RI  ++K
Sbjct: 27  SKTPNLDRIKKEYPNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIK 86

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F     + +  D AKE +  +H +GL+SDGGVHSHI+HL  +++ AK+ G+ K YVH
Sbjct: 87  DGDFFTNKVLCEAMDNAKENS--LHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQKVYVH 144

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P+S+ +Y +++Q ++D++  G+ AT+ GRYYAMDRDKRWER+++A+ A+ +
Sbjct: 145 AFTDGRDTDPQSALEYAKEVQVSMDEIGVGEFATVSGRYYAMDRDKRWERVELAYNAMVR 204

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G+GEK+      I+  +   + DEF+ P ++ ++    G IKEND++ FF+FR DR RQI
Sbjct: 205 GIGEKANSIEEAIQNSYDDGKNDEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQI 264

Query: 238 VQTFGVPPPPFEAKIPENLH--ITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +    F+    E++     C+T Y        +AF PQS+ N L E+ AK+  +Q
Sbjct: 265 --TRALVCEEFDGFKREDIKNFFVCLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQ 322

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
              AETEK+AHVTFFFNGGVEEP   E R LI SPKVATYDLKPEMS             
Sbjct: 323 LRAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALDKLG 382

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             KF F++ NFANPDMVGHTG  +AA KA+E  D  +G + +     G    IT+DHGNA
Sbjct: 383 EDKFDFIVLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVELGGSAIITADHGNA 442

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMT 472
           E M D E G   TAH+ NPVPFI+   +Y  A+   G  L D+APT+LD++ LE P+EMT
Sbjct: 443 EYMLDPETGKTVTAHSINPVPFIVVGQEYESAKLLDGGRLSDIAPTVLDMMKLEKPEEMT 502

Query: 473 GLSLLKK 479
           G SL+ K
Sbjct: 503 GHSLISK 509



>gi|489524794|ref|WP_003429567.1| phosphoglyceromutase [[Clostridium] difficile]
 gi|357546499|gb|EHJ28421.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium difficile 002-P50-2011]
 gi|357547465|gb|EHJ29347.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium difficile 050-P50-2011]
          Length = 509

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 234/487 (48%), Positives = 321/487 (65%), Gaps = 13/487 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           ++TP +D++K+EYP T + A GL VGLP+G MGNSEVGH NIGAGR+VYQD+ RI  ++K
Sbjct: 27  SKTPNLDRIKKEYPNTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIK 86

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F     + +  D AKE +  +H +GL+SDGGVHSHI+HL  +++ +K+ G+ K YVH
Sbjct: 87  DGDFFTNKVLCEAMDNAKENS--LHVMGLLSDGGVHSHIDHLKAIIKMSKDKGVQKVYVH 144

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+P+S+ +Y +++Q ++D++  G+ AT+ GRYYAMDRDKRWER+++A+ A+ +
Sbjct: 145 AFTDGRDTDPQSALEYAKEVQASMDEIGVGEFATVSGRYYAMDRDKRWERVELAYNAMVR 204

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQI 237
           G+GEK+      I+  +   + DEF+ P ++ ++    G IKEND++ FF+FR DR RQI
Sbjct: 205 GIGEKANSIEEAIQNSYDDGKNDEFIMPTVIMKDDKPVGSIKENDSIIFFNFRPDRARQI 264

Query: 238 VQTFGVPPPPFEAKIPENLH--ITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +    F+    E++     C+T Y        +AF PQS+ N L E+ AK+  +Q
Sbjct: 265 --TRALVCEEFDGFKREDIKSFFVCLTEYDITIENVHIAFGPQSLANTLGEYLAKNGKTQ 322

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
              AETEK+AHVTFFFNGGVEEP   E R LI SPKVATYDLKPEMS             
Sbjct: 323 LRAAETEKYAHVTFFFNGGVEEPNKGEERLLIPSPKVATYDLKPEMSAYELTDKALEKLG 382

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             KF F++ NFANPDMVGHTG  +AA KA+E  D  +G + +     G    IT+DHGNA
Sbjct: 383 EDKFDFIVLNFANPDMVGHTGSIEAAVKAVETVDTCVGKLVDKIVELGGSAIITADHGNA 442

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGA-LCDVAPTILDVIGLETPKEMT 472
           E M D E G   TAH+ NPVPFI+   +Y  A+   G  L D+APT+LD++ LE P+EMT
Sbjct: 443 EYMLDPETGKTVTAHSINPVPFIVVGQEYESAKLLDGGRLSDIAPTVLDMMKLEKPEEMT 502

Query: 473 GLSLLKK 479
           G SL+ K
Sbjct: 503 GHSLISK 509



>gi|110803633|ref|YP_698620.1| phosphoglyceromutase [Clostridium perfringens SM101]
 gi|499911547|ref|WP_011592281.1| phosphoglyceromutase [Clostridium perfringens]
 gi|123047400|sp|Q0STD7.1|GPMI_CLOPS RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|110684134|gb|ABG87504.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Clostridium perfringens SM101]
          Length = 512

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 239/488 (48%), Positives = 317/488 (64%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+L  +YP+T L+A GL VGLPEG MGNSEVGHLNIGAGR++YQ++ RI   +K
Sbjct: 28  ANKPNYDRLFNKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F     +VK  D AKE N  +H +GL+S+GGVHSHI+HL  LLE AK  G+ K YVH
Sbjct: 88  EGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S  +++ +L+ A+ ++  G+IATI GRYYAMDRD RWER+++A+ A+  
Sbjct: 148 AFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAYNAMVL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+   +  I + +  ++TDEF+ P +++E+G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVSRIKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRY-KSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +  P F+    + LH+   CMT+Y K+     +A+ P++  N L E+ A   ++Q
Sbjct: 268 --TRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRPENYTNTLGEYVASKGLNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVE+P   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELIKRLD 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G + +        LFIT+DHGNA
Sbjct: 386 EDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNA 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTK--GALCDVAPTILDVIGLETPKEM 471
           E M D   G P TAHT +PVPF+  S K +  +S K  G L D+APT+L V+GLE P EM
Sbjct: 446 EVMIDYSTGKPMTAHTSDPVPFLWIS-KDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEM 504

Query: 472 TGLSLLKK 479
           TG  LL K
Sbjct: 505 TGTCLLNK 512



>gi|489816941|ref|WP_003720761.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria ivanovii]
 gi|313627013|gb|EFR95912.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria ivanovii FSL F6-596]
          Length = 510

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 302/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYLANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTYTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE LQKAI DLNYG IAT+ GR+YAMDRDKRWER++ A+ A+  
Sbjct: 148 AFLDGRDVAPQSSVEYLETLQKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYNAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPPPPF---EAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F           A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFNRGADHPKNIKFVTMTLYNPSIDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDL+PEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G+E P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVEKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|493825767|ref|WP_006773217.1| phosphoglyceromutase [Clostridium hathewayi]
 gi|288866762|gb|EFC99060.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium hathewayi DSM 13479]
          Length = 512

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/485 (47%), Positives = 314/485 (64%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
             TPVMD+L  + P+    A GLAVGLP+G MGNSEVGHLN+GAGR+VYQ++ RI  +++
Sbjct: 28  GRTPVMDQLMSQCPFVKGNASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQELTRITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F +V   ++  +  K+ +  +H  GLVSDGGVHSH  H+  LLE AK +G+ K YVH
Sbjct: 88  DGDFFDVPEFLQAVENCKKNHSALHLWGLVSDGGVHSHNTHIYGLLELAKRNGLDKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++E+L+  + ++  GK+A+++GRYYAMDRD RW+R++ A+ ALTK
Sbjct: 148 CFLDGRDTPPASGKGFVEELEAKMKEIGVGKVASVMGRYYAMDRDNRWDRVERAYNALTK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G+ +      I+  +  +  DEF++P +V E+G    ++ ++D++ FF+FR DR R+I
Sbjct: 208 GEGKTAVSAADGIQASYDAEVNDEFVEPFVVVEDGKPVAVVNDHDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            + F       F  +   +L   C T Y       L AF  +S+ N   ++ A H ++Q 
Sbjct: 268 TRAFCDDEFKGFAREKRLDLTYVCFTDYDDTIANKLVAFKKESIVNTFGQYLADHNMTQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            +S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNKGEDRILVPSPKVATYDLQPEMSAPAVCDKLVEAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
           GK+  ++ NFANPDMVGHTG  DAA KAIE  D  +G   +A K    ILFI +DHGNAE
Sbjct: 388 GKYDVIIINFANPDMVGHTGIEDAAIKAIETVDACVGRTVDAVKETDGILFICADHGNAE 447

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+ D E G P TAHT NPVPFIL +   SF     G L D+APT+++++G+E PKEMTG 
Sbjct: 448 QLVDYETGTPFTAHTTNPVPFILVNADPSFKLREGGCLADIAPTLIELMGMEQPKEMTGK 507

Query: 475 SLLKK 479
           SLL K
Sbjct: 508 SLLVK 512



>gi|16804494|ref|NP_465979.1| phosphoglyceromutase [Listeria monocytogenes EGD-e]
 gi|386051427|ref|YP_005969418.1| phosphoglyceromutase [Listeria monocytogenes FSL R2-561]
 gi|404284948|ref|YP_006685845.1| phosphoglycerate mutase [Listeria monocytogenes SLCC2372]
 gi|405759504|ref|YP_006688780.1| phosphoglycerate mutase [Listeria monocytogenes SLCC2479]
 gi|497616207|ref|WP_009930391.1| phosphoglyceromutase [Listeria monocytogenes]
 gi|27734317|sp|Q8Y4I4.1|GPMI_LISMO RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|16411944|emb|CAD00534.1| pgm [Listeria monocytogenes EGD-e]
 gi|346425273|gb|AEO26798.1| phosphoglyceromutase [Listeria monocytogenes FSL R2-561]
 gi|404234450|emb|CBY55853.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes SLCC2372]
 gi|404237386|emb|CBY58788.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes SLCC2479]
          Length = 510

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 306/485 (63%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+   ++P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWADFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE LQKAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFDRGADHPKNIKFVTMTLYNPSIDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDL+PEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|510891638|ref|WP_016224900.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Lachnospiraceae bacterium 3-2]
 gi|507813009|gb|EOS69710.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Lachnospiraceae bacterium 3-2]
          Length = 512

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 231/485 (47%), Positives = 313/485 (64%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMDKL  E P+    A G+AVGLP+G MGNSEVGHLN+GAGR+VYQD+ +I  +++
Sbjct: 28  GKTPVMDKLMAECPFVKGNASGMAVGLPDGQMGNSEVGHLNMGAGRIVYQDLTKITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E   ++   + AK+ +  +H  GLVSDGGVHSH  H+  LLE AK  G+ K YVH
Sbjct: 88  DGDFFENRALLAACENAKKNDSALHMYGLVSDGGVHSHNTHIYGLLELAKRQGLKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +Y+E+L   ++++  G++AT++GRYYAMDRD RW+R++ A+ A+  
Sbjct: 148 CFLDGRDTPPASGKEYVEELVAKMEEIGVGEVATVMGRYYAMDRDNRWDRVEKAYRAMVY 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GE +      I+  + KD TDEF+ P +V ++G     IK+ND++ FF+FR DR R+I
Sbjct: 208 GEGETAASGPEGIQNSYDKDTTDEFVLPTVVTKDGAAVATIKDNDSIIFFNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPF-PLAFPPQSMENVLSEWFAKHKISQC 295
            +TF       F+          C T Y    P   +AF  + + N   E+ AK+ + Q 
Sbjct: 268 TRTFCDDGFTGFDRGERVKTTYVCFTEYDVTIPNKQVAFVKEEITNTFGEFLAKNGLKQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP + E R L++SPKVATYDLKPEMS            +S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVNSPKVATYDLKPEMSAYEVCDKLTGAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
           G++  ++ NFANPDMVGHTG   AA KAIE  D+ +G   +A +  G  +FI +DHGNAE
Sbjct: 388 GEYDVIIINFANPDMVGHTGVETAAIKAIEAVDECVGKAVDALREVGGQMFICADHGNAE 447

Query: 416 QM-QDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+  DE G P TAHT NPVPFIL +    +     G L D+APT+++++GLE P EMTG 
Sbjct: 448 QLIDDETGEPFTAHTTNPVPFILVNANPEYKLKEGGCLADIAPTLIELMGLEQPAEMTGK 507

Query: 475 SLLKK 479
           SL+ K
Sbjct: 508 SLILK 512



>gi|402574830|ref|YP_006624173.1| phosphoglycerate mutase [Desulfosporosinus meridiei DSM 13257]
 gi|504718106|ref|WP_014905208.1| phosphoglyceromutase [Desulfosporosinus meridiei]
 gi|402256027|gb|AFQ46302.1| phosphoglycerate mutase [Desulfosporosinus meridiei DSM 13257]
          Length = 512

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 227/487 (46%), Positives = 316/487 (64%), Gaps = 11/487 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           +A  P   +L+ EYPYTTL+A G AVGLP G MGNSEVGHLNIGAGRVVYQ++ RI   +
Sbjct: 27  SANIPNFKRLEGEYPYTTLQASGEAVGLPSGQMGNSEVGHLNIGAGRVVYQELTRIHKGI 86

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           ++    +   +++  D+A+  N R+H +GL+S+GGVHSHI+HL  LLE AK   + + Y+
Sbjct: 87  QDGTLFKNPVLLEAMDKARVNNKRLHLMGLLSNGGVHSHIDHLFALLEMAKKQELTEVYI 146

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H   DGRD  P+S+ +Y+ QL+  I +L  GKIA++ GRYY MDRDKRW+R++  ++A+ 
Sbjct: 147 HVILDGRDVLPQSAKEYICQLEGKIKELGVGKIASVSGRYYVMDRDKRWDRLEKGYQAIV 206

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE----GIIKENDTLFFFDFRADRMRQ 236
            G G+ +   LS +   +    TDEF+ P ++DE     G ++E D++ F++FR+DR R+
Sbjct: 207 NGEGKHAAGALSAVEISYDTRVTDEFVIPTVIDEAGNPVGQVQEGDSVIFYNFRSDRARE 266

Query: 237 IVQTF---GVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKIS 293
           I   F   G     FE      +H  CMT+Y+   P P+AFP Q+++N L E  +   + 
Sbjct: 267 ITHAFVDEGF--SEFERSNHPQVHFVCMTQYEETIPAPVAFPQQNLDNTLGEVLSDQGLK 324

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q  +AETEK+AHVTFFFNGG+EEP+  E R LI SPKVATY+LKPEMS            
Sbjct: 325 QLRIAETEKYAHVTFFFNGGLEEPYPKEERILIPSPKVATYNLKPEMSAPELTETVLGKL 384

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
           R   +  ++ NFANPDMVGHTG +DA  KA+EV D+ +G IY+  + +   L +T+DHGN
Sbjct: 385 RESTYDVIILNFANPDMVGHTGVFDATVKAVEVIDECLGRIYDELRKHKGSLIVTADHGN 444

Query: 414 AEQMQDEEGN-PHTAHTCNPVPFILASNKY-SFAESTKGALCDVAPTILDVIGLETPKEM 471
           AE+  D +   P TAH+ N VPFILA  ++   A    GALCD+APTIL ++ +  P EM
Sbjct: 445 AEEKVDPQTMLPITAHSTNCVPFILADERFKGQALRQGGALCDIAPTILKLLQIPIPNEM 504

Query: 472 TGLSLLK 478
           TG SL++
Sbjct: 505 TGKSLME 511



>gi|498350827|ref|WP_010664983.1| phosphoglyceromutase [Marinilabilia salmonicolor]
          Length = 508

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 240/486 (49%), Positives = 320/486 (65%), Gaps = 17/486 (3%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  + L ++YP   L+A G  VGLP+G MGNSEVGHLNIGAGRVVYQD+V+I+LA+K
Sbjct: 27  AGAPYFESLVKKYPNAQLQASGENVGLPDGQMGNSEVGHLNIGAGRVVYQDLVKINLAIK 86

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +    E   +VK F+ AKE N ++HFLGLVS GGVHS   HL  L + AK+ G+ K +VH
Sbjct: 87  DNSIAENPELVKAFNYAKENNKQVHFLGLVSKGGVHSSQEHLYKLTDVAKDFGLEKVFVH 146

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDL--NYGKIATIIGRYYAMDRDKRWERIKIAFEAL 179
            F DGRDT+P+S   Y+ +L   +D L  + GK+A++IGRYYAMDRDKRWERIK A++ +
Sbjct: 147 AFMDGRDTDPKSGKGYMSEL---LDHLKTSAGKVASVIGRYYAMDRDKRWERIKDAYDLM 203

Query: 180 TKGVGEKSEDPLSTIRERFSKDETDEFLKPII-VDEEG----IIKENDTLFFFDFRADRM 234
             G G+ + D LS I+E +  D TDEF+KPI+ VDE G     I+E+D + FF+FR DR 
Sbjct: 204 VNGTGKGTSDLLSAIQESYDNDVTDEFIKPIVNVDENGKPVGTIQEDDVVVFFNFRNDRA 263

Query: 235 RQIVQTFGVPP-PPFEAK-IPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHK 291
           R+I Q       P +E K IP  LH   +T Y + F    + F   +++N + E  AK+ 
Sbjct: 264 REITQVLTQQDMPEYEMKTIP--LHYCTLTPYDTTFKGMHILFDKDNVKNTMGEVVAKNG 321

Query: 292 ISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXX 351
           + Q  +AETEK+AHVTFFF+GG EE F+ E R LI+SPKVATYDL+PEMS          
Sbjct: 322 LKQLRIAETEKYAHVTFFFSGGREEVFEGEDRILINSPKVATYDLQPEMSAYEVKDAIVG 381

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDH 411
                K+ FV  NFAN DMVGHTG YDA  KA++  D  +  + EA K NGY   I +DH
Sbjct: 382 ELNKKKYDFVCLNFANGDMVGHTGVYDAIEKAVKAVDSCLEDVVEAAKKNGYEAIIIADH 441

Query: 412 GNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEM 471
           GNA+   + +G+P+TAH+ NPVPFI  +++    E   G L DVAP++L ++G+E P++M
Sbjct: 442 GNADNAVNPDGSPNTAHSLNPVPFIWVTDRK--GEVEDGILADVAPSLLSLMGVEQPEDM 499

Query: 472 TGLSLL 477
           TG SL+
Sbjct: 500 TGHSLI 505



>gi|497545703|ref|WP_009859901.1| phosphoglyceromutase [Parabacteroides goldsteinii]
 gi|409226601|gb|EKN19508.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Parabacteroides goldsteinii CL02T12C30]
          Length = 507

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 237/485 (48%), Positives = 314/485 (64%), Gaps = 10/485 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           N  TP  D+L + YP + L+A G  VGLP+G MGNSEVGHLNIGAGR+VYQD+V+I++A 
Sbjct: 26  NTPTPYWDELLKTYPNSQLQASGENVGLPDGQMGNSEVGHLNIGAGRIVYQDLVKINIAC 85

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +     +   I + +  AKE   +IHF+GLVSDGGVHS + HL  L + AK +GI KAYV
Sbjct: 86  RQNTILDNPEIKRAYSYAKENGKQIHFMGLVSDGGVHSSLEHLFKLADIAKEYGIDKAYV 145

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT+PRS   ++EQL+  +     GKIA+IIGRYYAMDRDKRWER+K A++ + 
Sbjct: 146 HCFMDGRDTDPRSGKGFIEQLENHLQTTG-GKIASIIGRYYAMDRDKRWERVKEAYDLIV 204

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
            G G+  ED +  + E +++  TDEF+KPI+  E G     I+E D + FF++R DR ++
Sbjct: 205 NGTGKPCEDMVQAMEESYAEGVTDEFIKPIVHVENGKPVATIEEGDVVIFFNYRNDRAKE 264

Query: 237 --IVQTFGVPPPPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKIS 293
             +V T    P      IP NL   CMT Y + F    + F   ++EN L E+ A    +
Sbjct: 265 LTVVLTQQDMPEAGMKTIP-NLQYFCMTPYDASFEGVHILFDKDNVENTLGEYLASVGKT 323

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H+AETEK+AHVTFFFNGG E PF+ E R L+ SPKVATYDLKPEMS            
Sbjct: 324 QLHIAETEKYAHVTFFFNGGRETPFEGEDRILVPSPKVATYDLKPEMSAFEVKDKLVEAI 383

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            + K+ +++ N+AN DMVGHTG Y A  KA+   D  +    EA KANGY + I +DHGN
Sbjct: 384 YTKKYDYIVCNYANGDMVGHTGIYSAIEKAVVTIDACLNDTVEAAKANGYEVIIIADHGN 443

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           A+   +E+G P+TAH+ NPVPF+  +     A+   G L DVAP+IL ++GL+ PKEMTG
Sbjct: 444 ADHALNEDGTPNTAHSLNPVPFVYVTENKD-AKVEDGILADVAPSILHIMGLKQPKEMTG 502

Query: 474 LSLLK 478
            SL+K
Sbjct: 503 KSLIK 507



>gi|404282012|ref|YP_006682910.1| phosphoglycerate mutase [Listeria monocytogenes SLCC2755]
 gi|404287826|ref|YP_006694412.1| phosphoglycerate mutase [Listeria monocytogenes serotype 7 str.
           SLCC2482]
 gi|405750800|ref|YP_006674266.1| phosphoglycerate mutase [Listeria monocytogenes ATCC 19117]
 gi|489824140|ref|WP_003727922.1| phosphoglyceromutase [Listeria monocytogenes]
 gi|258606914|gb|EEW19522.1| phosphoglycerate mutase [Listeria monocytogenes FSL R2-503]
 gi|293583860|gb|EFF95892.1| phosphoglycerate mutase [Listeria monocytogenes HPB2262]
 gi|293594665|gb|EFG02426.1| phosphoglycerate mutase [Listeria monocytogenes FSL J1-194]
 gi|300514036|gb|EFK41098.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes FSL N1-017]
 gi|328471267|gb|EGF42167.1| phosphoglyceromutase [Listeria monocytogenes J1-220]
 gi|332312886|gb|EGJ25981.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria monocytogenes str. Scott A]
 gi|404220000|emb|CBY71364.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes ATCC 19117]
 gi|404228647|emb|CBY50052.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes SLCC2755]
 gi|404246755|emb|CBY04980.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes serotype 7 str. SLCC2482]
          Length = 510

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 305/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE LQKAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFDRGANHPKNIKFVTMTLYNPSIDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDL+PEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|493484938|ref|WP_006439752.1| phosphoglyceromutase [[Clostridium] hiranonis]
 gi|210154529|gb|EEA85535.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium hiranonis DSM 13275]
          Length = 510

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 233/484 (48%), Positives = 316/484 (65%), Gaps = 10/484 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TP +D+L  +YP T + A GL VGLP+G MGNSEVGH NIGAGR+VYQ + RI  +++
Sbjct: 27  AKTPNLDRLSTDYPCTLMRASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQPLTRITKSIQ 86

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F   + + +  + AKE    +H +GL+SDGGVHSHI HL  LL+ A   G+ K YVH
Sbjct: 87  DGDFFTNEVLCQAMENAKEN--ALHIMGLLSDGGVHSHIEHLKGLLDMAAKKGVEKVYVH 144

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT+PRS+  Y ++  +A+ +   G+ AT+ GRYYAMDRD RWER+++A+ A+ K
Sbjct: 145 AFTDGRDTDPRSAIGYAKETLEAMKEAGVGEFATVSGRYYAMDRDNRWERVELAYNAMVK 204

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G KSE  L  I + ++ D  DEF+ P +++++G     IKEND++ FF+FR DR RQI
Sbjct: 205 GEGNKSECILDAIEKSYADDINDEFIVPTVIEKDGKPVATIKENDSVIFFNFRPDRARQI 264

Query: 238 VQTFGVPPPPFEAKIPENLHITCMTRYKSEF--PFPLAFPPQSMENVLSEWFAKHKISQC 295
            +   V      ++   N +  C+T Y +       +A+ P+++ N L E+ AK+   Q 
Sbjct: 265 TKAIAVKDFDGFSREFFNTYFVCLTEYDAAINDDVNVAYKPETLVNTLGEYLAKNGKLQL 324

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
             AETEK+AHVTFFFNGGVEEP + E R LI SPKVATYDL+PEMS              
Sbjct: 325 RAAETEKYAHVTFFFNGGVEEPNEGEDRLLIPSPKVATYDLQPEMSANELLANVEEKLNE 384

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+ F++ NFANPDMVGHTG  DAA KA+E  DK +G + +   A G  L IT+DHGNAE
Sbjct: 385 DKYDFIVVNFANPDMVGHTGSMDAAVKAVETVDKCVGELADKIIAKGGSLIITADHGNAE 444

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAEST-KGALCDVAPTILDVIGLETPKEMTG 473
            M D E G   TAH+ NPVPFI+A  ++  A+    G L D+APT+LD++G+E PKEMTG
Sbjct: 445 LMTDPETGKTVTAHSTNPVPFIVAGEEFKGAKLLDDGRLSDIAPTVLDMMGMEQPKEMTG 504

Query: 474 LSLL 477
            +L+
Sbjct: 505 HTLI 508



>gi|479194367|ref|YP_007823905.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [butyrate-producing bacterium SS3/4]
 gi|505366587|ref|WP_015553689.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [butyrate-producing bacterium SS3/4]
 gi|291562612|emb|CBL41428.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [butyrate-producing bacterium SS3/4]
          Length = 514

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 229/484 (47%), Positives = 313/484 (64%), Gaps = 8/484 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+ PVMD+L +E P+   +A GLAVGLP+G MGNSEVGHLN+GAGR+VYQ++ RI  +++
Sbjct: 28  AKKPVMDRLMKECPFVEGQASGLAVGLPDGQMGNSEVGHLNMGAGRIVYQELTRITKSIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + +  +   +  K+ N  +H  GL+SDGGVHSHI H+  LLE AK +G+ K +VH
Sbjct: 88  DGDFFKNEEFLAAVENCKKNNSALHLFGLLSDGGVHSHITHVYGLLELAKRNGLDKVFVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++  L++ + +L  GK+A+++GRYYAMDRD RW+R+++A++ALT 
Sbjct: 148 CFLDGRDTPPASGKDFVAALEEKMKELGVGKVASVMGRYYAMDRDNRWDRVELAYKALTA 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE-----GIIKENDTLFFFDFRADRMRQ 236
           G G K       I+  +   +TDEF+ P +V  E     G IK+ND++ FF+FR DR R+
Sbjct: 208 GEGNKGTSATELIQASYDDGKTDEFVVPAVVTGEDGNAIGTIKDNDSVIFFNFRPDRARE 267

Query: 237 IVQTFGVPPPPFEAKIPE-NLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQ 294
           + + F        A+         C   Y    P  L AF  ++++N L E+ A H  +Q
Sbjct: 268 MTRAFCDDEFTGFARAKRIKTTYVCFVDYDETIPNKLVAFKKETIKNTLGEFLAAHGKTQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            R
Sbjct: 328 ARIAETEKYAHVTFFFNGGVEEPNPGEDRILVKSPKVATYDLQPEMSAPAVCEKLTDAIR 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           SGK+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G   EA K    ++FI +DHGNA
Sbjct: 388 SGKYDVIIVNFANPDMVGHTGVENAAIKAIEAVDECVGKAVEAIKEVDGVMFICADHGNA 447

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQ+ D + G P TAHT NPVPFIL +    +     G L D+APT+++++G+E PKEMTG
Sbjct: 448 EQLIDYKTGEPWTAHTTNPVPFILVNAGEGYGLREGGCLADIAPTLIELMGMEQPKEMTG 507

Query: 474 LSLL 477
            SLL
Sbjct: 508 KSLL 511



>gi|217963442|ref|YP_002349120.1| phosphoglyceromutase [Listeria monocytogenes HCC23]
 gi|386009174|ref|YP_005927452.1| phosphoglycerate mutase [Listeria monocytogenes L99]
 gi|386027785|ref|YP_005948561.1| phosphoglyceromutase [Listeria monocytogenes M7]
 gi|404408831|ref|YP_006691546.1| phosphoglycerate mutase [Listeria monocytogenes SLCC2376]
 gi|501576435|ref|WP_012580779.1| phosphoglyceromutase [Listeria monocytogenes]
 gi|217332712|gb|ACK38506.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria monocytogenes HCC23]
 gi|307571984|emb|CAR85163.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes L99]
 gi|336024366|gb|AEH93503.1| phosphoglyceromutase [Listeria monocytogenes M7]
 gi|404242980|emb|CBY64380.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes SLCC2376]
          Length = 510

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 305/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE LQKAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFDRGADHPKNIKFVTMTLYNPSIDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDL+PEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|489571486|ref|WP_003475932.1| phosphoglyceromutase [Clostridium perfringens]
 gi|177908073|gb|EDT70646.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Clostridium perfringens D str. JGS1721]
          Length = 512

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 239/488 (48%), Positives = 316/488 (64%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+L  +YP+T L+A GL VGLPEG MGNSEVGHLNIGAGR++YQ++ RI   +K
Sbjct: 28  ANKPNYDRLFNKYPHTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
              F     +VK  D AKE N  +H +GL+S+GGVHSHI+HL  LLE AK  G+ K YVH
Sbjct: 88  EGTFFTNKALVKAMDEAKENNTSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S  +++ +L+ A+ ++  G+IATI GRYYAMDRD RWER+++A+ A+  
Sbjct: 148 AFMDGRDVAPSSGKEFIVELENAMKEIGVGEIATISGRYYAMDRDNRWERVELAYNAMVL 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GEK+   +  I + +  ++TDEF+ P +++E+G     IK+ D++ FF+FR DR R+I
Sbjct: 208 GEGEKASSAVEAIEKSYHDNKTDEFVLPTVIEEDGHPVSRIKDGDSVIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEAKIPENLHI--TCMTRY-KSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
             T  +  P F+    + LH+   CMT+Y K+     +A+  +S  N L E+ A   ++Q
Sbjct: 268 --TRAIVDPEFKGFERKQLHVNFVCMTQYDKTLECVDVAYRSESYTNTLGEYVASKGLNQ 325

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+AHVTFFFNGGVE+P   E R LI SPKVATYDLKPEMS             
Sbjct: 326 LRIAETEKYAHVTFFFNGGVEQPNTNEDRALIASPKVATYDLKPEMSAYEVTDELINRLD 385

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
             K+  ++ NFANPDMVGHTG  +AA KAIE  D+ +G + +        LFIT+DHGNA
Sbjct: 386 QDKYDMIILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLEKEGTLFITADHGNA 445

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTK--GALCDVAPTILDVIGLETPKEM 471
           E M D   G P TAHT +PVPF+  S K +  +S K  G L D+APT+L V+GLE P EM
Sbjct: 446 EVMIDYSTGKPMTAHTSDPVPFLWIS-KDAEGKSLKDGGKLADIAPTMLTVMGLEVPSEM 504

Query: 472 TGLSLLKK 479
           TG  LL K
Sbjct: 505 TGTCLLNK 512



>gi|375266892|ref|YP_005024335.1| phosphoglyceromutase [Vibrio sp. EJY3]
 gi|503999223|ref|WP_014233217.1| phosphoglyceromutase [Vibrio sp. EJY3]
 gi|369842212|gb|AEX23356.1| phosphoglyceromutase [Vibrio sp. EJY3]
          Length = 510

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 227/485 (46%), Positives = 310/485 (63%), Gaps = 9/485 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           NA+TPVMD L    P T + A G+ VGLP+G MGNSEVGH NIGAGRVVYQD+ RI  ++
Sbjct: 28  NAKTPVMDALIANNPNTLISASGMDVGLPDGQMGNSEVGHTNIGAGRVVYQDLTRITKSI 87

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
            + +F E   +V+  D A +    +H +GL+S GGVHSH +H+   +E A   G  K Y+
Sbjct: 88  ADGEFAETPALVEAIDAAVKAEKAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEKIYL 147

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT PRS++  L++ Q     L  G++A+++GRYYAMDRD  WER+++A++ LT
Sbjct: 148 HCFLDGRDTPPRSAENSLQRFQDLFAKLGKGRVASLVGRYYAMDRDNNWERVQVAYDLLT 207

Query: 181 KGVGE-KSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMR 235
           +   E  +E  ++ +   ++++E DEF+K   +  EG    I+++ D + F ++RADR R
Sbjct: 208 QAKAEFTAETAVAGLEAAYAREENDEFVKATAIKAEGEEDAIMQDGDAVIFMNYRADRAR 267

Query: 236 QIVQTFGVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
           QI + F      FE +   +LH   +T+Y ++ P  +AFPP S+EN   EW +K   +Q 
Sbjct: 268 QITRAFVPEFDGFEREAFPSLHFVMLTQYAADIPLAIAFPPASLENTYGEWLSKQGQTQL 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            ++ETEK+AHVTFFFNGGVE  FD E R L+ SPKVATYDL+PEMS            +S
Sbjct: 328 RISETEKYAHVTFFFNGGVESEFDGEERQLVASPKVATYDLQPEMSSPELTEKLVAAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
           GK+  ++ N+ N DMVGHTG Y+AA KAIE  D+++G + EA K  G  L IT+DHGNAE
Sbjct: 388 GKYDTIICNYPNADMVGHTGVYEAAEKAIEALDESVGKVVEAIKEAGGQLLITADHGNAE 447

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNK-YSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
            M D E G  HTAHT  PVP I   +K   F E   G L D+APT+L + GLE P EM+G
Sbjct: 448 MMVDPETGGTHTAHTNLPVPLIYVGDKAVEFKEG--GKLSDLAPTMLSLAGLEIPAEMSG 505

Query: 474 LSLLK 478
             L+K
Sbjct: 506 DILVK 510



>gi|46908629|ref|YP_015018.1| phosphoglyceromutase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|226225004|ref|YP_002759111.1| phosphoglycerate mutase [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|386733140|ref|YP_006206636.1| phosphoglyceromutase [Listeria monocytogenes 07PF0776]
 gi|405753663|ref|YP_006677128.1| phosphoglycerate mutase [Listeria monocytogenes SLCC2378]
 gi|406705191|ref|YP_006755545.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes L312]
 gi|424715269|ref|YP_007015984.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria monocytogenes serotype 4b str. LL195]
 gi|489822787|ref|WP_003726580.1| phosphoglyceromutase [Listeria monocytogenes]
 gi|50400341|sp|Q71WX0.1|GPMI_LISMF RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|46881901|gb|AAT05195.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes serotype 4b str. F2365]
 gi|47017443|gb|EAL08259.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes str. 4b H7858]
 gi|225877466|emb|CAS06180.1| Putative phosphoglycerate mutase [Listeria monocytogenes serotype
           4b str. CLIP 80459]
 gi|328465321|gb|EGF36578.1| phosphoglyceromutase [Listeria monocytogenes J1816]
 gi|384391898|gb|AFH80968.1| phosphoglyceromutase [Listeria monocytogenes 07PF0776]
 gi|404222863|emb|CBY74226.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes SLCC2378]
 gi|406362221|emb|CBY68494.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes L312]
 gi|424014453|emb|CCO64993.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria monocytogenes serotype 4b str. LL195]
          Length = 510

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 305/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE LQKAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVN 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFDRGANHPKNIKFVTMTLYNPSIDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDL+PEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|442318266|ref|YP_007358287.1| phosphoglyceromutase [Myxococcus stipitatus DSM 14675]
 gi|505159764|ref|WP_015346866.1| phosphoglyceromutase [Myxococcus stipitatus]
 gi|441485908|gb|AGC42603.1| phosphoglyceromutase [Myxococcus stipitatus DSM 14675]
          Length = 513

 Score =  452 bits (1163), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/484 (47%), Positives = 307/484 (63%), Gaps = 8/484 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP +DKL   YP+T L   GLAVGLPEG MGNSEVGH NIGAGR+VYQD+VRI+ AV+
Sbjct: 29  AGTPHLDKLTSPYPFTELATSGLAVGLPEGQMGNSEVGHTNIGAGRIVYQDLVRINRAVE 88

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           + +  +   +    D  K     +H LGLVS GGVHS ++HL  LL  A+  G+   YVH
Sbjct: 89  SGELAQNPVLRAAMDGVKADGKALHLLGLVSPGGVHSSMDHLFALLRAARERGVAHVYVH 148

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P+S+  Y+EQL++ + +   G+IAT+ GRYYAMDRDKRW+R+++A+EAL  
Sbjct: 149 AFLDGRDTPPQSALGYVEQLERFLHETQAGRIATVSGRYYAMDRDKRWDRVQLAYEALVH 208

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE-----GIIKENDTLFFFDFRADRMRQ 236
           G G K+ D LS IR  +++  TDEF+KP ++        G I++ DT+ FF+FRADR R+
Sbjct: 209 GQGPKAPDALSAIRASYAEKVTDEFVKPTLIANGDGTPVGRIQDGDTVLFFNFRADRARE 268

Query: 237 IVQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQC 295
           + Q    P    F+          CMT+Y   F  P+AF P   +++  E  ++  + Q 
Sbjct: 269 LTQALAYPSFKEFDRGGLRLGRYVCMTQYDETFDLPVAFGPDQPQDIFPELLSRQGLRQF 328

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXXR 354
             AETEK+AHVTFFFNGG E  +  E R L+ SP+ V TYDLKPEMS             
Sbjct: 329 RTAETEKYAHVTFFFNGGREVVYPGEDRFLVPSPRDVKTYDLKPEMSAREVTAELVKRLD 388

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           SG + F + NFANPDMVGH+G+ DAA +A+ V D+ +G++ +AC+ NG++L I++DHGN 
Sbjct: 389 SGTYDFALANFANPDMVGHSGRLDAAMQAVRVVDECLGVLGKACERNGWVLAISADHGNC 448

Query: 415 EQMQDE-EGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQM D   G PHTAHT NPVPF L    +   +   G L D+APT+  V+GL   KEM  
Sbjct: 449 EQMVDPVTGEPHTAHTLNPVPFHLIHPAFRGQKLRPGILADIAPTLCKVMGLPQSKEMNR 508

Query: 474 LSLL 477
           + +L
Sbjct: 509 MGVL 512



>gi|16801612|ref|NP_471880.1| phosphoglyceromutase [Listeria innocua Clip11262]
 gi|499300303|ref|WP_010991253.1| phosphoglyceromutase [Listeria innocua]
 gi|27734322|sp|Q928I2.1|GPMI_LISIN RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|16415072|emb|CAC97777.1| pgm [Listeria innocua Clip11262]
          Length = 510

 Score =  452 bits (1163), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 305/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE L+KAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLEKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFDRGANHPKNIKFVTMTLYNPSIDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDLKPEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLKPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|489860225|ref|WP_003763866.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase,
           partial [Listeria innocua]
 gi|313617302|gb|EFR89745.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria innocua FSL S4-378]
          Length = 485

 Score =  452 bits (1163), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 306/485 (63%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+   ++P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 3   ANKPNFDRYWADFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 62

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 63  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 122

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE L+KAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 123 AFLDGRDVAPQSSLEYLETLEKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 182

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 183 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAIIFFNFRPDRAIQL 242

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 243 SNAFTDKEWDHFDRGADHPKNIKFVTMTLYNPSIDAEVAFEPIEMKNVIGEVLSNEGLSQ 302

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDLKPEMS            +
Sbjct: 303 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLKPEMSAYEVTDALVEDIK 362

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 363 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 422

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 423 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 480

Query: 475 SLLKK 479
           SL++K
Sbjct: 481 SLIQK 485



>gi|150009254|ref|YP_001303997.1| phosphoglyceromutase [Parabacteroides distasonis ATCC 8503]
 gi|500656806|ref|WP_011966935.1| phosphoglyceromutase [Parabacteroides distasonis]
 gi|166991392|sp|A6LFB1.1|GPMI_PARD8 RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|149937678|gb|ABR44375.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Parabacteroides distasonis ATCC 8503]
          Length = 507

 Score =  452 bits (1163), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 320/486 (65%), Gaps = 12/486 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           N  TP  D+L + YP + L+A G  VGLP+G MGNSEVGHLNIGAGR+VYQD+V+I++A 
Sbjct: 26  NTPTPYWDELLKTYPASQLQASGENVGLPDGQMGNSEVGHLNIGAGRIVYQDLVKINIAC 85

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +     E   I + +  AKE N +IHF+GLVSDGGVHS + HL+ L + AK +GI KAYV
Sbjct: 86  RENTIMENPEIKRAYSYAKENNKQIHFMGLVSDGGVHSSLEHLLKLTDIAKEYGISKAYV 145

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT+P+S   ++E+L+  +     GKIA+IIGRYYAMDRDKRWER+K A++ L 
Sbjct: 146 HCFMDGRDTDPKSGKGFIEELENHLKTTG-GKIASIIGRYYAMDRDKRWERVKEAYDLLV 204

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
           +G G+++E  +  + E +++  TDEF+KPI+  E G    +I+E D + FF++R DR ++
Sbjct: 205 EGKGKQAECMVKAMEESYAEGVTDEFIKPIVHVENGKPVAVIEEGDVVIFFNYRNDRAKE 264

Query: 237 --IVQTFGVPPPPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKIS 293
             +V T    P      IP  L   CMT Y + F    + F  +++ N L E+ A    +
Sbjct: 265 LTVVLTQQDMPEAGMHTIP-GLQYFCMTPYDASFKGVHILFDKENVNNTLGEFLANVGKT 323

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H+AETEK+AHVTFFFNGG E PFD E R L+ SPKVATYDLKPEMS            
Sbjct: 324 QLHIAETEKYAHVTFFFNGGRETPFDSEERILVPSPKVATYDLKPEMSAFEVKDKLVDAI 383

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            + KF F++ N+AN DMVGHTG Y A  KA+   D  +    EA KAN Y + I +DHGN
Sbjct: 384 NTKKFDFIVVNYANGDMVGHTGIYKAIEKAVVTIDACLHDTVEAAKANDYEVIIIADHGN 443

Query: 414 AEQMQDEEGNPHTAHTCNPVPFI-LASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           A+   +E+G P+TAH+ NPVPF+ + +NK +  E   G L DVAP+IL ++GL+ PKEMT
Sbjct: 444 ADHALNEDGTPNTAHSLNPVPFVYVTANKDAKVED--GILADVAPSILHILGLKQPKEMT 501

Query: 473 GLSLLK 478
           G SL+K
Sbjct: 502 GKSLIK 507



>gi|489835999|ref|WP_003739717.1| phosphoglyceromutase [Listeria monocytogenes]
 gi|378751371|gb|EHY61961.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria monocytogenes FSL J1-208]
          Length = 510

 Score =  452 bits (1163), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 305/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE L+KAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLEKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFDRGADHPKNIKFVTMTLYNPSIDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDLKPEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLKPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|490751561|ref|WP_004613869.1| phosphoglyceromutase [Clostridium nexile]
 gi|210150140|gb|EEA81149.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium nexile DSM 1787]
          Length = 512

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 235/487 (48%), Positives = 315/487 (64%), Gaps = 11/487 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TPVMDKL  EYP+    A G+AVGLPEG MGNSEVGHLN+GAGR+VYQD+ +I  A++
Sbjct: 28  GKTPVMDKLMAEYPFVKGNASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQDLTKITKAIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E + ++     AKE +  +H  GLVSDGGVHSH +H+  LLE AK  G+ K YVH
Sbjct: 88  DGDFFENEALLAACKNAKEHDSALHMFGLVSDGGVHSHNSHIYGLLELAKKQGLSKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   Y+++L   + ++  G+IA+++GRYYAMDRD RW+R+++A+ A+ K
Sbjct: 148 CFLDGRDTPPASGKDYVQELADKMKEIGVGEIASVMGRYYAMDRDNRWDRVELAYNAMVK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G GE +E     ++  +  ++TDEF+ P ++ ++G     IK+ND++ FF+FR DR R+I
Sbjct: 208 GEGETAECGPCAVQASYDAEKTDEFVLPTVIVKDGAPVATIKDNDSIIFFNFRPDRAREI 267

Query: 238 VQTFGVPPPPFEA-KIPENLHIT--CMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKIS 293
            +TF      FE     E +  T  C T Y       L AF    + N   E+ A + ++
Sbjct: 268 TRTF--CDDNFEGFDRGERVKTTFICFTEYDVTIENKLVAFHKTEITNTFGEFLAANNMT 325

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q  +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            
Sbjct: 326 QARIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLQPEMSAFEVCDKLVDAI 385

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
           +S K+  ++ NFANPDMVGHTG  +AA KAIE  D  +G   EA K     +FI +DHGN
Sbjct: 386 KSEKYDVIIINFANPDMVGHTGVENAAIKAIEAVDSCVGRAVEAIKEVDGQMFICADHGN 445

Query: 414 AEQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           AEQ+ D E G P TAHT NPVPFIL +   ++     G L D+APT+++++G+E PKEMT
Sbjct: 446 AEQLVDYETGEPFTAHTTNPVPFILVNADPAYKLREGGCLADIAPTLIELMGMEQPKEMT 505

Query: 473 GLSLLKK 479
           G SLL K
Sbjct: 506 GTSLLVK 512



>gi|116873820|ref|YP_850601.1| phosphoglyceromutase [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|500022424|ref|WP_011703142.1| phosphoglyceromutase [Listeria welshimeri]
 gi|123466584|sp|A0ALE0.1|GPMI_LISW6 RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|116742698|emb|CAK21822.1| phosphoglycerate mutase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 510

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/485 (47%), Positives = 307/485 (63%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+   ++P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWADFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE LQKA++DLNYG+IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLQKAMNDLNYGEIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFDRGANHPKNIKFVTMTLYNPSVDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDL+PEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLQPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+        E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVKLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|489868820|ref|WP_003772389.1| phosphoglyceromutase [Listeria innocua]
 gi|370792700|gb|EHN60556.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria innocua ATCC 33091]
          Length = 510

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/485 (47%), Positives = 305/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE L+KAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLEKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVVFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFDRGANHPKNIKFVTMTLYNPSVDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDLKPEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGENRILINSPKVETYDLKPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|333924667|ref|YP_004498247.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfotomaculum carboxydivorans CO-1-SRB]
 gi|503576700|ref|WP_013810776.1| phosphoglyceromutase [Desulfotomaculum carboxydivorans]
 gi|333750228|gb|AEF95335.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Desulfotomaculum carboxydivorans CO-1-SRB]
          Length = 517

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 230/489 (47%), Positives = 302/489 (61%), Gaps = 16/489 (3%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+T  + KL   YP T L   G AVGLPEG MGNSEVGHLNIGAGRVVYQ++ RI  A+K
Sbjct: 30  ADTSHIKKLMATYPTTILTCSGEAVGLPEGQMGNSEVGHLNIGAGRVVYQELTRITKAIK 89

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + + ++K    AKE    +H +GL+SDGGVHSHI H+   L+ A+  G+ +   H
Sbjct: 90  DGDFFQNEELLKAVRNAKERQTALHIMGLLSDGGVHSHIRHIFATLKLARQEGLSRVCFH 149

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S+  Y+  L   + ++  G++AT+ GRYYAMDRD+RWER ++A+ AL  
Sbjct: 150 AFLDGRDVPPSSAKSYMNVLLTKMKEIGVGQVATVSGRYYAMDRDRRWERTELAYRALVY 209

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE-----GIIKENDTLFFFDFRADRMRQ 236
             G ++  P+  I   + + ETDEF+KP I+ ++       + + D++ F +FR DR RQ
Sbjct: 210 SEGLQANSPVEAIDVGYERGETDEFIKPTIITDDQKQPVAKVADGDSVIFVNFRPDRARQ 269

Query: 237 IVQTF------GVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
           I + F      G    P   ++    H  CMT+Y      P+AFPP  + N L EW +KH
Sbjct: 270 ITRAFVDEDFTGFDRGPGRPRV----HFVCMTQYDKTIEAPVAFPPAKLVNTLGEWLSKH 325

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + Q  +AETEK+AHVTFFFNGGVE     E R LI SPKVATYDLKPEMS         
Sbjct: 326 GLKQLRLAETEKYAHVTFFFNGGVEAANPGEERILIPSPKVATYDLKPEMSAYEITDTFL 385

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
               SG++  ++ NFANPDMVGHTG   A   AI   DK IG I EA       + IT D
Sbjct: 386 ERLNSGQYDVIITNFANPDMVGHTGDLQATEAAITTVDKCIGRIAEAMLEKSGTVIITGD 445

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAE-STKGALCDVAPTILDVIGLETPK 469
           HGNA++M+DE G  +TAHT +PVPFIL  ++Y  A+    G+L D+APT+LD++GL  P 
Sbjct: 446 HGNADKMRDEHGGAYTAHTTSPVPFILVDDRYKGAKLRNGGSLQDIAPTMLDILGLPKPP 505

Query: 470 EMTGLSLLK 478
           EMTG SLLK
Sbjct: 506 EMTGESLLK 514



>gi|511036544|ref|WP_016290578.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Lachnospiraceae bacterium 28-4]
 gi|507774110|gb|EOS32539.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Lachnospiraceae bacterium 28-4]
          Length = 514

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 230/486 (47%), Positives = 318/486 (65%), Gaps = 8/486 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TPVMD L +EYP+    A G+AVGLPEG MGNSEVGHLN+GAGR+VYQ++ RI   ++
Sbjct: 28  AATPVMDGLMKEYPFVKGNASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKEIQ 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E   ++   +  K+ +  +H  GLVSDGGVHSH  H+  +LE AK +G+ K YVH
Sbjct: 88  DGTFFENPALLDAVNNCKKNDSALHMFGLVSDGGVHSHNTHIYGILELAKRNGLSKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++E+L++ + ++  G++A+++GRYYAMDRD  ++R+K+A++ALTK
Sbjct: 148 CFLDGRDTPPESGKGFVEELEEKMKEIGVGEVASVMGRYYAMDRDNNYDRVKLAYDALTK 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G  +    + I E + + ETDEF+KP +V ++G     I++ D++ FF+FR DR R+I
Sbjct: 208 GEGLTAAGGPAAIAESYERGETDEFVKPTVVVKDGAPVATIRDKDSVVFFNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFP-LAFPPQSMENVLSEWFAKHKISQC 295
            + F       F+     +L   C + Y    P   +AF   ++EN   EW A +K++Q 
Sbjct: 268 TRCFCNDEFTAFDRGERLDLTYVCFSDYDPTIPNKEVAFHKITVENTFGEWLAANKMTQA 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXXR 354
            +AETEK+AHVTFFFNGGVEEP + E R L++SPK VATYDLKP+MS            +
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVNSPKDVATYDLKPQMSAYEVCDKLVEAIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           SGK+  ++ NFANPDMVGHTG   AA KA+E  D+ +G   EA K     +FI +DHGNA
Sbjct: 388 SGKYDVIIINFANPDMVGHTGVEAAAIKAVEAVDECVGRAVEAIKEVDGTMFICADHGNA 447

Query: 415 EQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           EQ+ D E G P TAHT NPVPFIL + K  +     G L D+ PT+++++G+E P EMTG
Sbjct: 448 EQLVDYETGEPFTAHTTNPVPFILVNYKKDYTLREGGCLADIIPTMIEIMGMEQPAEMTG 507

Query: 474 LSLLKK 479
            SLL K
Sbjct: 508 KSLLMK 513



>gi|284802894|ref|YP_003414759.1| phosphoglyceromutase [Listeria monocytogenes 08-5578]
 gi|284996035|ref|YP_003417803.1| phosphoglyceromutase [Listeria monocytogenes 08-5923]
 gi|404414473|ref|YP_006700060.1| phosphoglycerate mutase [Listeria monocytogenes SLCC7179]
 gi|496234664|ref|WP_008948699.1| phosphoglyceromutase [Listeria monocytogenes]
 gi|284058456|gb|ADB69397.1| phosphoglyceromutase [Listeria monocytogenes 08-5578]
 gi|284061502|gb|ADB72441.1| phosphoglyceromutase [Listeria monocytogenes 08-5923]
 gi|313612786|gb|EFR86771.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Listeria marthii FSL S4-120]
 gi|404240172|emb|CBY61573.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Listeria monocytogenes SLCC7179]
          Length = 510

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/485 (47%), Positives = 305/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE LQKAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLQKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   ++Q
Sbjct: 268 SNAFTDKEWDHFDRGADHPKNIKFVTMTLYNPSVDAEVAFEPIEMKNVIGEVLSNEGLAQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDL+PEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGESRILINSPKVETYDLQPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|334342104|ref|YP_004547084.1| phosphoglycerate mutase [Desulfotomaculum ruminis DSM 2154]
 gi|503609468|ref|WP_013843544.1| phosphoglyceromutase [Desulfotomaculum ruminis]
 gi|334093458|gb|AEG61798.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Desulfotomaculum ruminis DSM 2154]
          Length = 516

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/494 (46%), Positives = 307/494 (62%), Gaps = 24/494 (4%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TP +++L  +YP+T L   G AVGLP+G MGNSEVGHLNIGAGRVVYQ++ RI  ++K
Sbjct: 30  ADTPNINRLLFQYPHTQLACSGEAVGLPQGQMGNSEVGHLNIGAGRVVYQELTRITKSIK 89

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F +   +++     K  +  +H LGL+SDGGVHSHI HL+  L+ A+  G+ K Y+H
Sbjct: 90  DGDFFKNPVLLEAMQMVKAKDSALHILGLLSDGGVHSHIKHLMAALKLAQQQGLTKVYLH 149

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P S+  Y+  L   + ++  G+IAT+ GRYYAMDRD+RWER ++A+ A+  
Sbjct: 150 AFLDGRDVPPSSAKVYMNALLAKMKEIGVGQIATVAGRYYAMDRDRRWERTELAYRAMVY 209

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEE-----GIIKENDTLFFFDFRADRMRQ 236
           G G  +  P+  I   + + ETDEF+KP +V ++       I + D + F +FR DR RQ
Sbjct: 210 GEGLLANSPVEAIDVGYERQETDEFIKPTVVTDDHKQPLAKIADGDAVLFINFRPDRARQ 269

Query: 237 IVQTF----------GVPPPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEW 286
           I + F          G   P         +H  CMT Y      P+AFPP  +EN L EW
Sbjct: 270 ITRAFVDEDFTGFDRGAQRP--------KVHFVCMTVYDKTIDAPVAFPPTKLENTLGEW 321

Query: 287 FAKHKISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXX 346
            +K    Q  +AETEK+AHVTFFFNGGVE P   E R LI SPKVATYDL+PEMS     
Sbjct: 322 LSKQGCRQLRLAETEKYAHVTFFFNGGVEAPNPKEDRVLIPSPKVATYDLEPEMSAYEVT 381

Query: 347 XXXXXXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILF 406
                  +SGK+  ++ NFANPDMVGHTG   A   AIE  DK IG I  A       + 
Sbjct: 382 EAFLENLKSGKYQVMVVNFANPDMVGHTGDLKATRIAIETVDKCIGKIVAAVLEKSGTVL 441

Query: 407 ITSDHGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTK-GALCDVAPTILDVIGL 465
           IT+DHGNAE+M+DE+G   TAHT +PVPFIL ++ +  A+  + G+L D++PTILD++GL
Sbjct: 442 ITADHGNAEKMRDEKGGAFTAHTTDPVPFILVNDGHKGAKLRRGGSLQDISPTILDLLGL 501

Query: 466 ETPKEMTGLSLLKK 479
             P EMTG SLL K
Sbjct: 502 PKPPEMTGESLLLK 515



>gi|493838022|ref|WP_006785195.1| phosphoglyceromutase [Turicibacter sp. HGF1]
 gi|292645179|gb|EFF63244.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Turicibacter sanguinis PC909]
 gi|325490666|gb|EGC92977.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Turicibacter sp. HGF1]
          Length = 513

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 223/488 (45%), Positives = 309/488 (63%), Gaps = 13/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+ P +D+L   YP+ TLEA GL VGLPEG MGNSEVGHLN+GAGR+VYQ + RI+LAVK
Sbjct: 28  AKMPNLDRLFHTYPHNTLEASGLGVGLPEGQMGNSEVGHLNLGAGRIVYQSLTRINLAVK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           N + N    I +    A E N +IH +GL+S GG+HSH  H+  L+E AK  G  + YVH
Sbjct: 88  NGELNTDATIAEGVKHALENNKKIHVMGLLSPGGIHSHNEHMYALVEAAKAQGAKEVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P+S+ +Y+E L+  + ++  GK+AT+ GRYY+MDRDK ++R ++A++A+T+
Sbjct: 148 AFLDGRDTAPKSALEYVEALEAKLAEIGMGKVATVSGRYYSMDRDKNYDRTQLAYDAMTQ 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGIIKENDTLFFFDFRADRMRQIVQTF 241
           G GEK E   + +   +  D  DEF+ P +VDE G+I++ DT+ F +FR DR +QI    
Sbjct: 208 GTGEKFESAKAGVEASYKNDILDEFVAPFVVDENGLIQDGDTVIFANFRPDRAQQIAIAL 267

Query: 242 GVP-----------PPPFEAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKH 290
             P           P    +K P++++   M  Y S    P+ FP Q + N   +  A +
Sbjct: 268 SNPENVANYAKEGKPALDSSKGPKDVYFISMMSYGSAVNGPVVFPLQDLANTYGDVIAAN 327

Query: 291 KISQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXX 350
            + Q  +AETEK+AHVTFFF+GGV++  +   R LI+SPKVATYDLKPEMS         
Sbjct: 328 GLKQLRIAETEKYAHVTFFFDGGVDKEIEGATRVLINSPKVATYDLKPEMSAYEVADACV 387

Query: 351 XXXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSD 410
                     ++ NFANPDMVGHTG +DA  KA+E  D+ +G + +A  A G +  IT+D
Sbjct: 388 AEINKDIHDTIILNFANPDMVGHTGVFDATVKALEAVDECLGKVVDAIIAKGGVAIITAD 447

Query: 411 HGNAEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKE 470
           HGNAE+++DE G  +TAHT NPVP I+   K        G L D+APT+L ++G+E P E
Sbjct: 448 HGNAEKLEDENGGAYTAHTSNPVPVIV--TKEGIELRNGGNLGDLAPTMLQLLGVEQPVE 505

Query: 471 MTGLSLLK 478
           MTG S++K
Sbjct: 506 MTGKSIIK 513



>gi|496049430|ref|WP_008773937.1| phosphoglyceromutase [Bacteroides sp. 2_1_33B]
 gi|262295039|gb|EEY82971.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Bacteroides sp. 2_1_33B]
          Length = 507

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 319/486 (65%), Gaps = 12/486 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           N  TP  D+L + YP + L+A G  VGLP+G MGNSEVGHLNIGAGR+VYQD+V+I++A 
Sbjct: 26  NTPTPYWDELLKTYPASQLQASGENVGLPDGQMGNSEVGHLNIGAGRIVYQDLVKINIAC 85

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +     E   I + +  AKE N +IHF+GLVSDGGVHS + HL+ L + AK +GI KAYV
Sbjct: 86  RENTIMENPEIKRAYSYAKENNKQIHFMGLVSDGGVHSSLEHLLKLTDIAKEYGISKAYV 145

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT+P+S   ++E L+  +     GKIA+IIGRYYAMDRDKRWER+K A++ L 
Sbjct: 146 HCFMDGRDTDPKSGKGFIETLENHLKTTG-GKIASIIGRYYAMDRDKRWERVKEAYDLLV 204

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
           +G G+++E  +  + E +++  TDEF+KPI+  E G    +I+E D + FF++R DR ++
Sbjct: 205 EGKGKQAECMVKAMEESYAEGVTDEFIKPIVHVENGKPVAVIEEGDVVIFFNYRNDRAKE 264

Query: 237 --IVQTFGVPPPPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKIS 293
             +V T    P      IP  L   CMT Y + F    + F  +++ N L E+ A    +
Sbjct: 265 LTVVLTQQDMPEAGMHTIP-GLQYFCMTPYDASFKGVHILFDKENVNNTLGEFLANVGKT 323

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H+AETEK+AHVTFFFNGG E PFD E R L+ SPKVATYDLKPEMS            
Sbjct: 324 QLHIAETEKYAHVTFFFNGGRETPFDSEERILVPSPKVATYDLKPEMSAFEVKDKLVDAI 383

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            + KF F++ N+AN DMVGHTG Y A  KA+   D  +    EA KAN Y + I +DHGN
Sbjct: 384 TTKKFDFIVVNYANGDMVGHTGIYKAIEKAVVTIDACLHDTVEAAKANDYEVIIIADHGN 443

Query: 414 AEQMQDEEGNPHTAHTCNPVPFI-LASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           A+   +E+G P+TAH+ NPVPF+ + +NK +  E   G L DVAP+IL ++GL+ PKEMT
Sbjct: 444 ADHALNEDGTPNTAHSLNPVPFVYVTANKAAKVED--GILADVAPSILHILGLKQPKEMT 501

Query: 473 GLSLLK 478
           G SL+K
Sbjct: 502 GKSLIK 507



>gi|494273144|ref|WP_007157998.1| phosphoglyceromutase [Oribacterium sinus]
 gi|227839697|gb|EEJ50151.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Oribacterium sinus F0268]
          Length = 535

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 233/485 (48%), Positives = 315/485 (64%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TPVMD LK++YPY   +A GLAVGLP+G MGNSEVGH+N+GAGR+VYQ++ RI  A++
Sbjct: 51  ANTPVMDHLKKDYPYVEGQASGLAVGLPDGQMGNSEVGHMNMGAGRIVYQELTRISKAIQ 110

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E   +    +  K+ +  +HF+GL+SDGGVHSHI H+  LLE AK  G+ K Y+H
Sbjct: 111 DGDFFENAALKGAVEHCKKKDSALHFMGLLSDGGVHSHIEHIYGLLELAKRAGLKKVYLH 170

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   +L Q++K + ++  G++A+I GRYYAMDRDK ++R++ A+ A+T+
Sbjct: 171 AFLDGRDTPPDSGKHFLMQIEKKMQEIGVGEVASIAGRYYAMDRDKNYDRVEKAYLAMTQ 230

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG---IIKENDTLFFFDFRADRMRQIV 238
           G+GEK+      I   ++K+  DEF+ P ++++ G   +I + D   FF+FR DR R+I 
Sbjct: 231 GIGEKASSVEEAISASYAKEVFDEFVLPTVIEKNGATHLISDGDACIFFNFRPDRAREIC 290

Query: 239 QTFGVPPPPFEAK-IPENLHITCMTRYKSEFPFP-LAFPPQSMENVLSEWFAKHKISQCH 296
             F      F  +   + ++  C T Y    P   +AF  + + N   E+ +    +Q  
Sbjct: 291 HCFCDDDFSFFNRGARKEVYFVCFTDYDPTIPNKEVAFHKEEISNTYGEYLSSLGKTQLR 350

Query: 297 VAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXXRS 355
           +AETEK+AHVTFFFNGG EEPF  E R L+ SPK VATYDLKPEMS            RS
Sbjct: 351 IAETEKYAHVTFFFNGGKEEPFSGEDRILVPSPKDVATYDLKPEMSCYTVTEKLTEAIRS 410

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
           GK+  ++ NFANPDMVGHTG   AA KAIEV D+ +G + EA +  G  LFI +DHGNA+
Sbjct: 411 GKYDAIVANFANPDMVGHTGVLPAAIKAIEVVDECVGKVVEAVQEVGGNLFILADHGNAD 470

Query: 416 QMQDEE-GNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
            M DE+ G P+TAHT NPVPFIL +   S      G L DV PT+LD++G+  PKEMTG 
Sbjct: 471 MMVDEKTGEPYTAHTTNPVPFILVAADKSLKLKEGGCLADVTPTLLDLMGIPKPKEMTGK 530

Query: 475 SLLKK 479
           SLL+K
Sbjct: 531 SLLEK 535



>gi|491569320|ref|WP_005426903.1| phosphoglyceromutase [[Ruminococcus] obeum]
 gi|149833621|gb|EDM88702.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ruminococcus obeum ATCC 29174]
          Length = 513

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 234/485 (48%), Positives = 313/485 (64%), Gaps = 11/485 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPVMDKL  EYP+    A GLAVGLP+G MGNSEVGH+N+GAGR+VYQ++ RI   + 
Sbjct: 28  AKTPVMDKLMAEYPFVKGNASGLAVGLPDGQMGNSEVGHMNMGAGRIVYQELTRITKEIN 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + + ++     AKE +  IHF+GL+SDGGVHSH  HL  LLE AK  G+ K YVH
Sbjct: 88  DGDFFKNEALLAAMKNAKENDSAIHFMGLLSDGGVHSHNTHLYALLEMAKREGLKKVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +++EQL+  + ++  G+I  + GRYYAMDRD RW+R+++A++ALT+
Sbjct: 148 CFLDGRDTPPASGKEFIEQLEAKMKEIGVGQIGVVSGRYYAMDRDNRWDRVELAYKALTE 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEGI----IKENDTLFFFDFRADRMRQI 237
           G G K  D  + ++  +  D+TDEF+ P +++++G     I++ D++ FF+FR DR R+I
Sbjct: 208 GEGVKGTDAAAAVQASYDNDKTDEFVLPTVIEKDGQPVAKIQDKDSVVFFNFRPDRAREI 267

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPF-PLAFPPQSMENVLSEWFAKHKISQC 295
            + F       FE     +L   C T Y        +AF    ++N   E+ A H ++Q 
Sbjct: 268 TRAFCDDEFKGFERAKKLDLTYVCFTDYDETIQNKQVAFHKVLLKNTFGEYLAAHDMTQV 327

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP   E R L+ SPKVATYDL+PEMS            +S
Sbjct: 328 RIAETEKYAHVTFFFNGGVEEPNKGEDRILVKSPKVATYDLQPEMSAPEVCDKLVDAIKS 387

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG   AA KAIE  D  +G   EA K     +FI +DHGNAE
Sbjct: 388 DKYDVIIINFANPDMVGHTGVQAAAVKAIETVDGCVGRAVEALKEVDGQMFICADHGNAE 447

Query: 416 QMQD-EEGNPHTAHTCNPVPFIL--ASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           Q+ D E G P TAHT NPVPFIL  A  KY+  E+  G L D+ PT++ ++G+E P EMT
Sbjct: 448 QLIDYETGEPWTAHTTNPVPFILVNADPKYTLREN--GCLADIIPTLIQLMGMEQPAEMT 505

Query: 473 GLSLL 477
           G SLL
Sbjct: 506 GESLL 510



>gi|347549759|ref|YP_004856087.1| putative phosphoglycerate mutase [Listeria ivanovii subsp. ivanovii
           PAM 55]
 gi|503859677|ref|WP_014093671.1| phosphoglyceromutase [Listeria ivanovii]
 gi|346982830|emb|CBW86858.1| Putative phosphoglycerate mutase [Listeria ivanovii subsp. ivanovii
           PAM 55]
          Length = 510

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/485 (47%), Positives = 304/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE LQKAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSVEYLETLQKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ +EG     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKEGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+     P+N+    MT Y       +AF P  M+NV+ E  +   ++Q
Sbjct: 268 SNAFTDKEWDHFDRGENHPKNIKFVTMTLYNPSIVAEVAFEPIEMKNVIGEVLSNEGLAQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDL+PEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGESRILINSPKVETYDLQPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|492483882|ref|WP_005861057.1| phosphoglyceromutase [Parabacteroides sp. D25]
 gi|409225621|gb|EKN18539.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Parabacteroides distasonis CL03T12C09]
 gi|409233691|gb|EKN26525.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Parabacteroides sp. D25]
          Length = 507

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 319/486 (65%), Gaps = 12/486 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           N  TP  D+L + YP + L+A G  VGLP+G MGNSEVGHLNIGAGR+VYQD+V+I++A 
Sbjct: 26  NTPTPYWDELLKTYPASQLQASGENVGLPDGQMGNSEVGHLNIGAGRIVYQDLVKINIAC 85

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +     E   I + +  AKE N +IHF+GLVSDGGVHS + HL+ L + AK +GI KAYV
Sbjct: 86  RENTIMENPEIKRAYSYAKENNKQIHFMGLVSDGGVHSSLEHLLKLTDIAKEYGISKAYV 145

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT+P+S   ++E L+  +     GKIA+IIGRYYAMDRDKRWER+K A++ L 
Sbjct: 146 HCFMDGRDTDPKSGKGFIETLENHLKTTG-GKIASIIGRYYAMDRDKRWERVKEAYDLLV 204

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
           +G G+++E  +  + E +++  TDEF+KPI+  E G    +I+E D + FF++R DR ++
Sbjct: 205 EGKGKQAECMVKAMEESYAEGVTDEFIKPIVHVENGKPVAVIEEGDVVIFFNYRNDRAKE 264

Query: 237 --IVQTFGVPPPPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKIS 293
             +V T    P      IP  L   CMT Y + F    + F  +++ N L E+ A    +
Sbjct: 265 LTVVLTQQDMPEAGMHTIP-GLQYFCMTPYDASFKGVHILFDKENVNNTLGEFLANVGKT 323

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H+AETEK+AHVTFFFNGG E PFD E R L+ SPKVATYDLKPEMS            
Sbjct: 324 QLHIAETEKYAHVTFFFNGGRETPFDSEERILVPSPKVATYDLKPEMSAFEVKDKLVDAI 383

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            + KF F++ N+AN DMVGHTG Y A  KA+   D  +    EA KAN Y + I +DHGN
Sbjct: 384 NTKKFDFIVVNYANGDMVGHTGIYKAIEKAVVTIDACLHDTVEAAKANDYEVIIIADHGN 443

Query: 414 AEQMQDEEGNPHTAHTCNPVPFI-LASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           A+   +E+G P+TAH+ NPVPF+ + +NK +  E   G L DVAP+IL ++GL+ PKEMT
Sbjct: 444 ADHALNEDGTPNTAHSLNPVPFVYVTANKDAKVED--GILADVAPSILHILGLKQPKEMT 501

Query: 473 GLSLLK 478
           G SL+K
Sbjct: 502 GKSLIK 507



>gi|498500086|ref|WP_010800788.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Parabacteroides sp. ASF519]
 gi|476628489|gb|EMZ35109.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Parabacteroides sp. ASF519]
 gi|507757036|gb|EOS15927.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Parabacteroides goldsteinii dnLKV18]
          Length = 507

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 237/485 (48%), Positives = 314/485 (64%), Gaps = 10/485 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           N  TP  D+L + YP + L+A G  VGLP+G MGNSEVGHLNIGAGR+VYQD+V+I++A 
Sbjct: 26  NTPTPYWDELLKTYPNSQLQASGENVGLPDGQMGNSEVGHLNIGAGRIVYQDLVKINIAC 85

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +     +   I + +  AKE   +IHF+GLVSDGGVHS + HL  L + AK +GI KAYV
Sbjct: 86  RQNTILDNLEIKRAYSYAKENGKQIHFMGLVSDGGVHSSLEHLFKLADIAKEYGIDKAYV 145

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT+PRS   ++EQL+  +     GKIA+IIGRYYAMDRDKRWER+K A++ + 
Sbjct: 146 HCFMDGRDTDPRSGKGFIEQLENHLQTTG-GKIASIIGRYYAMDRDKRWERVKEAYDLIM 204

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
            G G+  ED +  + E +++  TDEF+KPI+  E G     I+E D + FF++R DR ++
Sbjct: 205 NGTGKPCEDMVQAMEESYAEGVTDEFIKPIVHVENGKPVATIEEGDVVIFFNYRNDRAKE 264

Query: 237 --IVQTFGVPPPPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKIS 293
             +V T    P      IP NL   CMT Y + F    + F   ++EN L E+ A    +
Sbjct: 265 LTVVLTQQDMPEAGMKTIP-NLQYFCMTPYDASFKGVHILFDKDNVENTLGEFLASVGKT 323

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H+AETEK+AHVTFFFNGG E PF+ E R L+ SPKVATYDLKPEMS            
Sbjct: 324 QLHIAETEKYAHVTFFFNGGRETPFEGEDRILVPSPKVATYDLKPEMSAFEVKDKLVEAI 383

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            + K+ +++ N+AN DMVGHTG Y A  KA+   D  +    EA KANGY + I +DHGN
Sbjct: 384 YTKKYDYIVCNYANGDMVGHTGIYSAIEKAVVTIDACLNDTVEAAKANGYEVIIIADHGN 443

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
           A+   +E+G P+TAH+ NPVPF+  +     A+   G L DVAP+IL ++GL+ PKEMTG
Sbjct: 444 ADHALNEDGTPNTAHSLNPVPFVYVTENKD-AKVEDGILADVAPSILHIMGLKQPKEMTG 502

Query: 474 LSLLK 478
            SL+K
Sbjct: 503 KSLIK 507



>gi|406980990|gb|EKE02525.1| hypothetical protein ACD_20C00372G0003 [uncultured bacterium]
          Length = 516

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/484 (46%), Positives = 309/484 (63%), Gaps = 8/484 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P    L  +YP T + A G  VGLPEG MGNSEVGHLN+GAGRVVYQ++ RI+ A++
Sbjct: 28  ANLPTFHSLLNDYPDTCIYADGEHVGLPEGQMGNSEVGHLNLGAGRVVYQELTRINKAIR 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
            K F E   ++   + AK+ N  IHF+GLVS+GGVHS + HL  L++ A  HG+   YVH
Sbjct: 88  EKTFFENTELLNAINHAKKNNSSIHFMGLVSEGGVHSAMGHLYALIDLAHQHGLKDVYVH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P+S+ +Y+  + + ++ L    +A++IGRYYAMDRD+RW+R++ A++ L  
Sbjct: 148 AFLDGRDTPPQSAIEYVTPVDEKLNKLGLPAVASVIGRYYAMDRDQRWDRVQKAYDCLLY 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIV-DEEGIIKENDTLFFFDFRADRMRQIVQT 240
             G  + + +  I+  ++KD  DEF+ P +V DE+  +K+ND + FF+FR DR RQ+  T
Sbjct: 208 SEGNSANNAVEGIQNSYNKDANDEFVLPTVVGDEKSRLKDNDAIIFFNFRPDRARQL--T 265

Query: 241 FGVPPPPFEA----KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQCH 296
             +  P F+      +  N +  CMT+Y   F  P+AF PQ +  +L E   +HK+ Q  
Sbjct: 266 RAINDPNFDGFNRKTVLNNTYYVCMTQYDETFNLPIAFTPQHLNQILGEVLDQHKVQQFR 325

Query: 297 VAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRSG 356
            AETEK+AH+TFFFNGGVE+ F  E R ++ SPKVATYDLKPEMS            +S 
Sbjct: 326 TAETEKYAHITFFFNGGVEKSFPTETRVMVPSPKVATYDLKPEMSAPEVAQKVIEALKSK 385

Query: 357 KFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAEQ 416
           K+ F++ NFANPDMVGHTGK DA  KA+E  D  +  I    K    ++ +TSDHGNAE 
Sbjct: 386 KYQFILVNFANPDMVGHTGKLDATVKALETIDNLLNQIVNTVKQVDAVMLLTSDHGNAEC 445

Query: 417 MQDEEGN-PHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGLS 475
           M+D + + P TAHT NPVP IL +     +    G L DVAPTILD++ ++ P+EMTG S
Sbjct: 446 MEDPKTHEPFTAHTTNPVPLILINYDQEASLKEGGNLADVAPTILDILEIQKPEEMTGNS 505

Query: 476 LLKK 479
           L+ K
Sbjct: 506 LIVK 509



>gi|492749396|ref|WP_005948548.1| phosphoglyceromutase [Blautia hydrogenotrophica]
 gi|225039111|gb|EEG49357.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Blautia hydrogenotrophica DSM 10507]
          Length = 544

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 235/483 (48%), Positives = 311/483 (64%), Gaps = 7/483 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
            +TP+MD+L  + P+    A G+AVGLPEG MGNSEVGHLN+GAGR+VYQ++ RI   ++
Sbjct: 59  GKTPIMDQLMSQCPFVKGAASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKEIQ 118

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F + + ++     AKE N  IHF+GL+SDGGVHSH  HL  LLE AK  G+ K YVH
Sbjct: 119 DGDFYKNEALLVAVKNAKERNSAIHFMGLLSDGGVHSHNTHLYALLELAKREGLTKVYVH 178

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   Y+E+LQ  I ++  G+I  + GRYYAMDRD RW+R+++A+ ALTK
Sbjct: 179 CFLDGRDTPPASGKGYIEELQAKIKEIGVGEIGVVSGRYYAMDRDNRWDRVEMAYRALTK 238

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G    D    ++  +  ++TDEF+ P ++++ G    +I++ D++ FF+FR DR R+I
Sbjct: 239 GEGVLGSDAAEAVQASYDDEKTDEFVLPTVIEKHGKPVTVIQDGDSVVFFNFRPDRAREI 298

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFP-LAFPPQSMENVLSEWFAKHKISQC 295
            + F       FE +   +L   C T Y    P   +AF   ++ N   E+ A H + Q 
Sbjct: 299 TRAFCADEFDGFEREKRLDLTYVCFTEYDETIPNKVVAFHKVAITNTFGEFLAAHNLKQA 358

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDLKPEMS            RS
Sbjct: 359 RIAETEKYAHVTFFFNGGVEEPNEGEERILVKSPKVATYDLKPEMSAYEVCDKLVEAIRS 418

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG   AA KAIE  D+ +G   EA K     +FI +DHGNAE
Sbjct: 419 QKYDVIIINFANPDMVGHTGVEAAAIKAIEAVDECVGRTVEAIKEVNGQMFICADHGNAE 478

Query: 416 QMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+ D E G P TAHT NPVPFIL +   S+     G L D+APT+++++GLE PKEMTG 
Sbjct: 479 QLIDYETGEPFTAHTTNPVPFILVNADPSYTLREGGCLADIAPTLIELMGLEQPKEMTGR 538

Query: 475 SLL 477
           SLL
Sbjct: 539 SLL 541



>gi|491803893|ref|WP_005609229.1| phosphoglyceromutase [Ruminococcus lactaris]
 gi|197297745|gb|EDY32303.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Ruminococcus lactaris ATCC 29176]
          Length = 527

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/485 (46%), Positives = 315/485 (64%), Gaps = 7/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TPVMDKL  E P+    A GLAVGLP+G MGNSEVGH+N+GAGR++YQ++ +I  +++
Sbjct: 43  ANTPVMDKLMAECPFVKGNASGLAVGLPDGQMGNSEVGHMNMGAGRIIYQELTKITKSIE 102

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F E   ++   +  K+ +  +H +GLVSDGGVHSHI H+  +LE AK  GI K YVH
Sbjct: 103 DGDFFENKALLAACENVKKNDSALHLMGLVSDGGVHSHITHIYGILELAKRQGIKKVYVH 162

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S  +Y+EQL+  + ++  G++A++ GRYYAMDRD RW+R++ A++AL  
Sbjct: 163 CFLDGRDTPPASGKEYVEQLEAKMKEIGVGEVASVSGRYYAMDRDNRWDRVEKAYKALVA 222

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G  +E   + I+  + +D TDEF+ P +V ++G     +KEND++ FF+FR DR R++
Sbjct: 223 GEGNTAESATAGIQASYDEDVTDEFVVPFVVTKDGAAKATVKENDSVVFFNFRPDRAREL 282

Query: 238 VQTFGVPP-PPFEAKIPENLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKISQC 295
            +TF       F+          C T Y +     + AF  +S+ N   ++ A + + Q 
Sbjct: 283 TRTFCDDSFDGFDRGERVKTTFVCFTEYDATIENKMVAFVKESITNTFGQFLADNGLKQA 342

Query: 296 HVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXRS 355
            +AETEK+AHVTFFFNGGVEEP + E R L+ SPKVATYDLKPEMS            +S
Sbjct: 343 RIAETEKYAHVTFFFNGGVEEPNEGEDRILVKSPKVATYDLKPEMSAYEVCDKLVGAIKS 402

Query: 356 GKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNAE 415
            K+  ++ NFANPDMVGHTG   AA KA+E  D+ +G   EA K     +FI +DHGNAE
Sbjct: 403 EKYDVIVINFANPDMVGHTGVQAAAIKAVEAVDECVGKAVEALKEVDGQMFICADHGNAE 462

Query: 416 QMQDEE-GNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           Q+ DEE G P TAHT NPVPFIL +   ++     G L D+APT+++++G++ P+EMTG 
Sbjct: 463 QLIDEETGEPFTAHTTNPVPFILVNADPAYKLREGGCLADIAPTLIELMGMQQPEEMTGK 522

Query: 475 SLLKK 479
           SLL K
Sbjct: 523 SLLVK 527



>gi|470208327|ref|YP_007604902.1| 3-bisphosphoglycerate-independent phosphoglycerate mutase [Listeria
           monocytogenes]
 gi|505268101|ref|WP_015455203.1| 3-bisphosphoglycerate-independent phosphoglycerate mutase [Listeria
           monocytogenes]
 gi|441472233|emb|CCQ21988.1| 3-bisphosphoglycerate-independent phosphoglycerate mutase [Listeria
           monocytogenes]
          Length = 510

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/485 (47%), Positives = 305/485 (62%), Gaps = 9/485 (1%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A  P  D+    +P+  L+A GL VGLPEG MGNSEVGH NIGAGR+VYQ + RID A++
Sbjct: 28  ANKPNFDRYWANFPHGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIE 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
             +F E   +   F   KE N  +H  GL+SDGGVHSHINHL+ LLETAK+ G+   Y+H
Sbjct: 88  EGEFQENKALNNAFTHTKENNSDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKNVYIH 147

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRD  P+SS +YLE L+KAI DLNYG IAT+ GR+YAMDRDKRWER++ A++A+  
Sbjct: 148 AFLDGRDVAPQSSLEYLETLEKAISDLNYGAIATVSGRFYAMDRDKRWERVEKAYKAIVS 207

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
             GEK EDP+  ++  ++ D+ DEF+ P I+ ++G     +K+ND + FF+FR DR  Q+
Sbjct: 208 AEGEKFEDPIELVKASYANDKNDEFVVPAIITKDGKPVATVKDNDAVIFFNFRPDRAIQL 267

Query: 238 VQTFGVPP-PPFE--AKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
              F       F+  A  P+N+    MT Y       +AF P  M+NV+ E  +   +SQ
Sbjct: 268 SNAFTDKEWDHFDRGADHPKNIKFVTMTLYNPSVDAEVAFEPIEMKNVIGEVLSNEGLSQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXXR 354
             +AETEK+ HVTFF NGG  E F  E R LI+SPKV TYDL+PEMS            +
Sbjct: 328 LRIAETEKYPHVTFFMNGGRNEEFPGESRILINSPKVETYDLQPEMSAYEVTDALVEDIK 387

Query: 355 SGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGNA 414
           + K   ++ NFANPDMVGH+G  +   KAIE  D+ +G + +     G    I +DHGN+
Sbjct: 388 NDKHDAIILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILEKGGSAIIFADHGNS 447

Query: 415 EQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTGL 474
           E M   EG PHTAHT  PVP I+     +  E   G L DVAPT+LD++G++ P EMTG 
Sbjct: 448 ETMSTPEGKPHTAHTTVPVPVIVTKKGVTLREG--GRLADVAPTMLDLLGVKKPAEMTGE 505

Query: 475 SLLKK 479
           SL++K
Sbjct: 506 SLIQK 510



>gi|404494242|ref|YP_006718348.1| phosphoglyceromutase [Pelobacter carbinolicus DSM 2380]
 gi|499661616|ref|WP_011342350.1| phosphoglyceromutase [Pelobacter carbinolicus]
 gi|85540990|sp|Q3A1E5.1|GPMI_PELCD RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate
           mutase; Short=BPG-independent PGAM;
           Short=Phosphoglyceromutase; Short=iPGM
 gi|77546250|gb|ABA89812.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Pelobacter carbinolicus DSM 2380]
          Length = 514

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/485 (46%), Positives = 307/485 (63%), Gaps = 9/485 (1%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
            A+TP +  L   +P+  + A G  VGLP+G MGNSEVGHLNIGAGR VYQD+ RI L++
Sbjct: 30  QADTPRLRALLESWPHARIGASGRDVGLPDGQMGNSEVGHLNIGAGRTVYQDLTRISLSI 89

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +   F E   + K   +  E+ G++H +GL+SDGGVHSH+ HL  L+E A+  G+ +  +
Sbjct: 90  EEDTFFENTELRKVMQQVVESQGKLHLMGLLSDGGVHSHMEHLYALVEMARRAGVEQVCI 149

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT P+S   YL QL+  + D+  G++AT+IGRY+AMDRD RWER++ A+ A+T
Sbjct: 150 HAFMDGRDTPPQSGAGYLAQLEDKLQDIGLGRVATVIGRYWAMDRDNRWERVEKAYRAMT 209

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG--IIKENDTLFFFDFRADRMRQIV 238
           +GVG   E   + I + +++ +TDEF++P  V  E    + + D + FF+FRADR R+I 
Sbjct: 210 EGVGTSFESSAAAIADAYAQGQTDEFVEPRFVGGEKPCTVDDGDGMIFFNFRADRAREIT 269

Query: 239 QTFGVPPPPFEA----KIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKISQ 294
           +TF      F      K P      C+T Y + F  P+AFPP++   +L E  ++    Q
Sbjct: 270 RTF--TSSDFSGFSREKTPRLAGYVCLTEYDASFGLPMAFPPETYPELLGEVVSRAGRKQ 327

Query: 295 CHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXXX 353
             +AETEK+AHVTFFFNGG EEPFD E R LI SPK VATYDLKPEMS            
Sbjct: 328 LRIAETEKYAHVTFFFNGGSEEPFDGEDRVLIPSPKEVATYDLKPEMSAPAVTDAMLERV 387

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            SG++  ++ NFANPDMVGHTG   AA  A+E  D  +G + +A    G  L IT+DHGN
Sbjct: 388 ASGRYDLIVLNFANPDMVGHTGVESAAIAAMETVDACVGRVVDAVLNAGGSLLITADHGN 447

Query: 414 AEQMQDEEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEMTG 473
            EQM D +G PHTAHT NPVP IL     +  +   G L D+APT+L+++G++ P  MTG
Sbjct: 448 CEQMADAKGAPHTAHTSNPVPVILVDPDRTGVKLRNGILADLAPTLLELMGIDKPAAMTG 507

Query: 474 LSLLK 478
            SLL+
Sbjct: 508 RSLLE 512



>gi|494983851|ref|WP_007709874.1| phosphoglyceromutase [Clostridium asparagiforme]
 gi|225045558|gb|EEG55804.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Clostridium asparagiforme DSM 15981]
          Length = 505

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/488 (47%), Positives = 316/488 (64%), Gaps = 12/488 (2%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A+TPVMD+L  + P+   +A G+ VGLP+G MGNSEVGHLN+GAGR+VYQ++ RI  +++
Sbjct: 20  AKTPVMDQLMSQCPFVEGQASGMFVGLPDGQMGNSEVGHLNMGAGRIVYQELTRITKSIQ 79

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYVH 121
           +  F EV   +   +  K+    +H  GLVSDGGVHSH  H+  LLE AK +G+ K YVH
Sbjct: 80  DGDFFEVPEFLTAVENCKKNGSALHLFGLVSDGGVHSHNTHIYGLLELAKRNGLEKVYVH 139

Query: 122 FFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALTK 181
            F DGRDT P S   ++ QL+  + ++  G++A+++GRYYAMDRDKRW+R+++A+ ALTK
Sbjct: 140 CFLDGRDTPPESGKDFVAQLEAKMAEIGVGQVASVMGRYYAMDRDKRWDRVEMAYNALTK 199

Query: 182 GVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQI 237
           G G+ ++     I+  +   + DEF+ P +V+++G     I++ D++ FF+FR DR R+I
Sbjct: 200 GQGKTAQSATGGIQASYDDGKADEFVIPFVVEKDGKPVATIQDRDSVIFFNFRPDRAREI 259

Query: 238 VQTFGVPPPPFEAKIPE---NLHITCMTRYKSEFPFPL-AFPPQSMENVLSEWFAKHKIS 293
            + F      F+    E   +L   C T Y       L AF  +S+ N   E+ A H  +
Sbjct: 260 TRAF--CDDEFDGFAREKRLDLVYVCFTDYDETIANKLVAFRKESITNTFGEYLAAHGKT 317

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXXX 352
           Q  +AETEK+AHVTFFFNGGVEEP + E R L+ SPK VATYDLKPEMS           
Sbjct: 318 QVRIAETEKYAHVTFFFNGGVEEPNEGEDRILVPSPKEVATYDLKPEMSAPQVCDKLVEA 377

Query: 353 XRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHG 412
            +SGK+  V+ NFANPDMVGHTG  DAA KAIE  D  +G   EA K    ++FI +DHG
Sbjct: 378 IKSGKYDVVIINFANPDMVGHTGVEDAAIKAIETVDACVGRAVEAVKEVDGVMFICADHG 437

Query: 413 NAEQMQDE-EGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETPKEM 471
           NAEQ+ D   G+P TAHT NPVPFIL +    +     GALCD+ PT+++++G+E PKEM
Sbjct: 438 NAEQLVDYVTGDPFTAHTTNPVPFILVNADPQYKLREGGALCDIVPTLIELMGMEQPKEM 497

Query: 472 TGLSLLKK 479
           TG SLL K
Sbjct: 498 TGKSLLVK 505



>gi|496309210|ref|WP_009018388.1| phosphoglyceromutase [Parabacteroides sp. D13]
 gi|256736706|gb|EEU50034.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Parabacteroides sp. D13]
          Length = 507

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 319/486 (65%), Gaps = 12/486 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           N  TP  D+L + YP + L+A G  VGLP+G MGNSEVGHLNIGAGR+VYQD+V+I++A 
Sbjct: 26  NTPTPYWDELLKTYPASQLQASGENVGLPDGQMGNSEVGHLNIGAGRIVYQDLVKINIAC 85

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +     E   I + +  AKE N +IHF+GLVSDGGVHS + HL+ L + AK +GI KAYV
Sbjct: 86  RENTIMENPEIKRAYSYAKENNKQIHFMGLVSDGGVHSSLEHLLKLTDIAKEYGISKAYV 145

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT+P+S   ++E L+  +     GKIA+IIGRYYAMDRDKRWER+K A++ L 
Sbjct: 146 HCFMDGRDTDPKSGKGFIETLENHLKTTG-GKIASIIGRYYAMDRDKRWERVKEAYDLLV 204

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
           +G G+++E  +  + E +++  TDEF+KPI+  E G    +I+E D + FF++R DR ++
Sbjct: 205 EGKGKQAECMVKAMEESYAEGVTDEFIKPIVHVENGKPVAVIEEGDVVIFFNYRNDRAKE 264

Query: 237 --IVQTFGVPPPPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKIS 293
             +V T    P      IP  L   CMT Y + F    + F  +++ N L E+ A    +
Sbjct: 265 LTVVLTQQDMPEAGMHTIP-GLQYFCMTPYDASFKGVHILFDKENVNNTLGEFLANVGKT 323

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H+AETEK+AHVTFFFNGG E PFD E R L+ SPKVATYDLKPEMS            
Sbjct: 324 QLHIAETEKYAHVTFFFNGGRETPFDSEERILVPSPKVATYDLKPEMSAFEVKDKLVDAI 383

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            + KF F++ N+AN DMVGHTG Y A  KA+   D  +    EA KAN Y + I +DHGN
Sbjct: 384 TTKKFDFIVVNYANGDMVGHTGIYKAIEKAVVTIDACLHDTVEAAKANDYEVIIIADHGN 443

Query: 414 AEQMQDEEGNPHTAHTCNPVPFI-LASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           A+   +E+G P+TAH+ NPVPF+ + +NK +  E   G L DVAP+IL ++GL+ PKEMT
Sbjct: 444 ADHALNEDGTPNTAHSLNPVPFVYVTANKDAKVED--GILADVAPSILHILGLKQPKEMT 501

Query: 473 GLSLLK 478
           G SL+K
Sbjct: 502 GKSLIK 507



>gi|337286377|ref|YP_004625850.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Thermodesulfatator indicus DSM 15286]
 gi|503673552|ref|WP_013907628.1| phosphoglyceromutase [Thermodesulfatator indicus]
 gi|335359205|gb|AEH44886.1| phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent
           [Thermodesulfatator indicus DSM 15286]
          Length = 516

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/490 (47%), Positives = 322/490 (65%), Gaps = 15/490 (3%)

Query: 2   AETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAVK 61
           A TP +D LK  YP+T L+  G AVGLPEG MGNSEVGHLNIGAGR+VYQD+ RI+ A+K
Sbjct: 28  AGTPNLDALKEVYPFTLLKCSGEAVGLPEGQMGNSEVGHLNIGAGRIVYQDLTRINRAIK 87

Query: 62  NKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGI-PKAYV 120
           +  F     + + F +A+ET G++H LGLVSDGGVHS ++HL  LLE AK  G+  + ++
Sbjct: 88  DGSFFNNPVLKEAFAKARETGGKVHLLGLVSDGGVHSSLDHLFALLEFAKKEGLCDRVFL 147

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT P+S+  Y+ Q+++ +++L  G+IA++ GR+YAMDRDKRWER+  A+ AL 
Sbjct: 148 HAFTDGRDTPPKSALGYITQIKQKMEELGCGEIASVSGRFYAMDRDKRWERVAQAYYALV 207

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
            G   +  D L  ++E +++ ETDEF+KP ++ + G    +I++ D + FF+FRADR R+
Sbjct: 208 LGEALEVSDALQAVKEAYNRGETDEFIKPTVIVKNGKPLALIEDGDIVIFFNFRADRARE 267

Query: 237 IVQTFGVPPPPF----EAKIPENLHITCMTRYKSEFPFPLAFPPQSMENVLSEWFAKHKI 292
           +  T  +  P F      K P+  +  CMT Y   F  P+AFPP+ + N+  E  +K  +
Sbjct: 268 L--TRALTDPDFNEFDRKKWPKLAYYVCMTLYDETFDLPVAFPPEHLVNIWGEVISKASL 325

Query: 293 SQCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPK-VATYDLKPEMSXXXXXXXXXX 351
            Q   AETEK+AHVT+FFNGG E+PF LE R LI SP+ +ATYD KPEMS          
Sbjct: 326 YQFRTAETEKYAHVTYFFNGGEEKPFPLEERKLIPSPRDIATYDQKPEMSAYEVTEEVIK 385

Query: 352 XXRSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACK--ANGYILFITS 409
             +S K+ F++ N+AN DMVGHTG  +AA KA++V D+ +G + +  +   +     +T+
Sbjct: 386 RIKSDKYSFIVMNYANGDMVGHTGVLEAAIKAVKVVDECVGKVLKVWREVTDNAPAIVTA 445

Query: 410 DHGNAEQMQD-EEGNPHTAHTCNPVPFILASNKYSFAESTKGALCDVAPTILDVIGLETP 468
           DHGN E M D E G P TAHT NPVPF L  +++   +  +G L D+APT L ++GLE P
Sbjct: 446 DHGNCEMMVDPETGGPFTAHTANPVPFYLVDDRFKNKKLYQGILADIAPTGLFLMGLEIP 505

Query: 469 KEMTGLSLLK 478
           KEMTG  LLK
Sbjct: 506 KEMTGNILLK 515



>gi|496056141|ref|WP_008780648.1| phosphoglyceromutase [Bacteroides sp. 3_1_19]
 gi|298265943|gb|EFI07602.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
           [Bacteroides sp. 3_1_19]
          Length = 507

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 319/486 (65%), Gaps = 12/486 (2%)

Query: 1   NAETPVMDKLKREYPYTTLEAHGLAVGLPEGLMGNSEVGHLNIGAGRVVYQDIVRIDLAV 60
           N  TP  D+L + YP + L+A G  VGLP+G MGNSEVGHLNIGAGR+VYQD+V+I++A 
Sbjct: 26  NTPTPYWDELLKTYPASQLQASGENVGLPDGQMGNSEVGHLNIGAGRIVYQDLVKINIAC 85

Query: 61  KNKKFNEVDNIVKCFDRAKETNGRIHFLGLVSDGGVHSHINHLIHLLETAKNHGIPKAYV 120
           +     E   I + +  AKE N +IHF+GLVSDGGVHS + HL+ L + AK +GI KAYV
Sbjct: 86  RENTIMENPEIKRAYGYAKENNKQIHFMGLVSDGGVHSSLEHLLKLTDIAKEYGISKAYV 145

Query: 121 HFFGDGRDTNPRSSDKYLEQLQKAIDDLNYGKIATIIGRYYAMDRDKRWERIKIAFEALT 180
           H F DGRDT+P+S   ++E L+  +     GKIA+IIGRYYAMDRDKRWER+K A++ L 
Sbjct: 146 HCFMDGRDTDPKSGKGFIETLENHLKTTG-GKIASIIGRYYAMDRDKRWERVKEAYDLLV 204

Query: 181 KGVGEKSEDPLSTIRERFSKDETDEFLKPIIVDEEG----IIKENDTLFFFDFRADRMRQ 236
           +G G+++E  +  + E +++  TDEF+KPI+  E G    +I+E D + FF++R DR ++
Sbjct: 205 EGKGKQAECMVKAMEESYAEGVTDEFIKPIVHVENGKPVAVIEEGDVVIFFNYRNDRAKE 264

Query: 237 --IVQTFGVPPPPFEAKIPENLHITCMTRYKSEFP-FPLAFPPQSMENVLSEWFAKHKIS 293
             +V T    P      IP  L   CMT Y + F    + F  +++ N L E+ A    +
Sbjct: 265 LTVVLTQQDMPEAGMHTIP-GLQYFCMTPYDASFKGVHILFDKENVNNTLGEFLANVGKT 323

Query: 294 QCHVAETEKFAHVTFFFNGGVEEPFDLEVRDLIDSPKVATYDLKPEMSXXXXXXXXXXXX 353
           Q H+AETEK+AHVTFFFNGG E PFD E R L+ SPKVATYDLKPEMS            
Sbjct: 324 QLHIAETEKYAHVTFFFNGGRETPFDSEERILVPSPKVATYDLKPEMSAFEVKDKLVDAI 383

Query: 354 RSGKFPFVMNNFANPDMVGHTGKYDAATKAIEVTDKAIGIIYEACKANGYILFITSDHGN 413
            + KF F++ N+AN DMVGHTG Y A  KA+   D  +    EA KAN Y + I +DHGN
Sbjct: 384 NTKKFDFIVVNYANGDMVGHTGIYKAIEKAVVTIDACLHDTVEAAKANDYEVIIIADHGN 443

Query: 414 AEQMQDEEGNPHTAHTCNPVPFI-LASNKYSFAESTKGALCDVAPTILDVIGLETPKEMT 472
           A+   +E+G P+TAH+ NPVPF+ + +NK +  E   G L DVAP+IL ++GL+ PKEMT
Sbjct: 444 ADHALNEDGTPNTAHSLNPVPFVYVTANKDAKVED--GILADVAPSILHILGLKQPKEMT 501

Query: 473 GLSLLK 478
           G SL+K
Sbjct: 502 GKSLIK 507