BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10386_c0_seq1-m.148 5prime_partial 1-1452(+) 484 (+)
         (483 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384496232|gb|EIE86723.1| hypothetical protein RO3G_11434 [Rhi...   345   2e-92   Rhizopus delemar RA 99-880
gi|511003983|gb|EPB85365.1| hypothetical protein HMPREF1544_0782...   338   3e-90   Mucor circinelloides f. circinelloides 1006PhL
gi|281202894|gb|EFA77096.1| major facilitator superfamily protei...   336   1e-89   Polysphondylium pallidum PN500
gi|511010565|gb|EPB91785.1| hypothetical protein HMPREF1544_0129...   335   2e-89   Mucor circinelloides f. circinelloides 1006PhL
gi|384485914|gb|EIE78094.1| hypothetical protein RO3G_02798 [Rhi...   335   2e-89   Rhizopus delemar RA 99-880
gi|384485895|gb|EIE78075.1| hypothetical protein RO3G_02779 [Rhi...   334   3e-89   Rhizopus delemar RA 99-880
gi|330844788|ref|XP_003294295.1| hypothetical protein DICPUDRAFT...   321   3e-85   Dictyostelium purpureum
gi|357393023|ref|YP_004907864.1| putative drug resistance protei...   308   2e-81   
gi|496019323|ref|WP_008743843.1| MFS transporter [Streptomyces s...   307   4e-81   
gi|471321028|ref|YP_007520058.1| putative MFS-type transporter [...   304   5e-80   
gi|284044744|ref|YP_003395084.1| EmrB/QacA subfamily drug resist...   302   2e-79   
gi|493419339|ref|WP_006375181.1| drug resistance MFS transporter...   302   2e-79   Streptomyces turgidiscabies
gi|497730551|ref|WP_010044735.1| MFS transporter [Streptomyces c...   300   7e-79   Streptomyces chartreusis
gi|345003323|ref|YP_004806177.1| EmrB/QacA subfamily drug resist...   299   1e-78   
gi|494631190|ref|WP_007389134.1| MFS transporter [Streptomyces c...   298   2e-78   Streptomyces
gi|406701111|gb|EKD04265.1| tetracycline efflux protein [Trichos...   297   6e-78   Trichosporon asahii var. asahii CBS 8904
gi|491333368|ref|WP_005191329.1| MFS transporter [Gordonia amara...   297   6e-78   Gordonia amarae
gi|21225257|ref|NP_631036.1| membrane transport protein [Strepto...   296   8e-78   Streptomyces coelicolor A3(2)
gi|490070000|ref|WP_003972175.1| MFS transporter [Streptomyces l...   296   8e-78   
gi|357409964|ref|YP_004921700.1| EmrB/QacA subfamily drug resist...   296   9e-78   
gi|401881897|gb|EJT46178.1| tetracycline efflux protein [Trichos...   296   9e-78   Trichosporon asahii var. asahii CBS 2479
gi|494478069|ref|WP_007267546.1| MFS transporter [Streptomyces s...   296   9e-78   Streptomyces sp. C
gi|479323001|ref|YP_007863052.1| multidrug resistance protein B ...   296   1e-77   
gi|514329979|gb|EPH42858.1| putative MFS-type transporter [Strep...   296   1e-77   Streptomyces aurantiacus JA 4570
gi|66810832|ref|XP_639123.1| major facilitator superfamily prote...   295   2e-77   Dictyostelium discoideum AX4
gi|497964375|ref|WP_010278531.1| MFS transporter [Streptomyces s...   295   2e-77   
gi|392579294|gb|EIW72421.1| hypothetical protein TREMEDRAFT_2610...   295   2e-77   Tremella mesenterica DSM 1558
gi|478686811|ref|YP_007743621.1| Multidrug resistance protein B ...   295   2e-77   
gi|117165255|emb|CAJ88816.1| putative membrane transport protein...   295   2e-77   Streptomyces ambofaciens ATCC 23877
gi|496361049|ref|WP_009070225.1| MFS transporter [Streptomyces s...   295   2e-77   Streptomyces sp. SPB78
gi|498326389|ref|WP_010640545.1| MFS transporter [Streptomyces s...   295   3e-77   Streptomyces sp. S4
gi|321253947|ref|XP_003192908.1| tetracycline efflux protein [Cr...   295   3e-77   Cryptococcus gattii WM276
gi|328854822|gb|EGG03952.1| hypothetical protein MELLADRAFT_7248...   295   3e-77   Melampsora larici-populina 98AG31
gi|495094823|ref|WP_007819646.1| MFS transporter [Streptomyces s...   295   3e-77   Streptomyces
gi|512490098|ref|WP_016431227.1| drug:H+ antiporter-2 (14 Spanne...   295   3e-77   Streptomyces sp. HGB0020
gi|498042542|ref|WP_010356698.1| MFS transporter [Streptomyces a...   294   5e-77   Streptomyces acidiscabies
gi|408682109|ref|YP_006881936.1| Multidrug resistance protein B ...   292   1e-76   
gi|121701463|ref|XP_001268996.1| MFS toxin efflux pump (AflT), p...   292   2e-76   Aspergillus clavatus NRRL 1
gi|402224289|gb|EJU04352.1| MFS general substrate transporter [D...   291   2e-76   Dacryopinax primogenitus
gi|495684726|ref|WP_008409305.1| MFS transporter [Streptomyces s...   291   3e-76   
gi|494718897|ref|WP_007454763.1| MFS transporter [Streptomyces s...   291   4e-76   Streptomyces sp. W007
gi|345566551|gb|EGX49494.1| hypothetical protein AOL_s00078g527 ...   290   9e-76   Arthrobotrys oligospora ATCC 24927
gi|497297315|ref|WP_009611532.1| multidrug MFS transporter [acti...   289   1e-75   
gi|374985580|ref|YP_004961075.1| transmembrane efflux protein [S...   288   2e-75   
gi|498040943|ref|WP_010355099.1| MFS transporter [Streptomyces a...   287   4e-75   Streptomyces acidiscabies
gi|70995754|ref|XP_752632.1| MFS toxin efflux pump (AflT) [Asper...   286   7e-75   Aspergillus fumigatus Af293
gi|488613878|ref|YP_007935214.1| Membrane transport protein [Str...   286   8e-75   
gi|42820667|emb|CAF31980.1| AflT-like major facilitator superfam...   286   8e-75   Aspergillus fumigatus
gi|134109573|ref|XP_776901.1| hypothetical protein CNBC3920 [Cry...   286   9e-75   Cryptococcus neoformans var. neoformans B-3501A
gi|58265674|ref|XP_569993.1| tetracycline efflux protein [Crypto...   286   9e-75   Cryptococcus neoformans var. neoformans JEC21
gi|496020142|ref|WP_008744649.1| MFS transporter [Streptomyces s...   286   1e-74   Streptomyces sp. SPB074
gi|256397379|ref|YP_003118943.1| EmrB/QacA subfamily drug resist...   285   1e-74   
gi|336120042|ref|YP_004574820.1| drug resistance transporter [Mi...   285   2e-74   
gi|493087928|ref|WP_006128852.1| MFS transporter [Streptomyces f...   285   2e-74   Streptomyces
gi|291302635|ref|YP_003513913.1| EmrB/QacA subfamily drug resist...   285   2e-74   
gi|169628067|ref|YP_001701716.1| Probable drug resistance transp...   285   2e-74   Mycobacterium abscessus
gi|497743949|ref|WP_010058133.1| major facilitator superfamily p...   284   4e-74   Streptomyces globisporus
gi|491215079|ref|WP_005073405.1| MFS transporter [Mycobacterium ...   284   5e-74   Mycobacterium abscessus
gi|491234534|ref|WP_005092761.1| MFS transporter [Mycobacterium ...   283   7e-74   Mycobacterium abscessus
gi|491224813|ref|WP_005083101.1| MFS transporter [Mycobacterium ...   283   7e-74   Mycobacterium abscessus
gi|119495432|ref|XP_001264501.1| MFS toxin efflux pump (AflT), p...   283   1e-73   Aspergillus fischeri NRRL 181
gi|491232580|ref|WP_005090812.1| MFS transporter [Mycobacterium ...   282   2e-73   Mycobacterium abscessus
gi|491255195|ref|WP_005113375.1| MFS transporter [Mycobacterium ...   282   2e-73   Mycobacterium abscessus
gi|402226046|gb|EJU06106.1| MFS general substrate transporter [D...   282   2e-73   Dacryopinax primogenitus
gi|402219996|gb|EJU00069.1| MFS general substrate transporter [D...   281   3e-73   Dacryopinax primogenitus
gi|388580591|gb|EIM20905.1| MFS general substrate transporter [W...   281   3e-73   Wallemia mellicola CBS 633.66
gi|501752047|emb|CCG83893.1| protein of unknown function [Taphri...   281   3e-73   Taphrina deformans PYCC 5710
gi|115433719|ref|XP_001216996.1| conserved hypothetical protein ...   281   4e-73   Aspergillus terreus NIH2624
gi|493092043|ref|WP_006130902.1| transmembrane efflux protein [S...   281   4e-73   Streptomyces gancidicus
gi|491207668|ref|WP_005066001.1| MFS transporter [Mycobacterium ...   280   6e-73   Mycobacterium abscessus
gi|256378876|ref|YP_003102536.1| EmrB/QacA subfamily drug resist...   280   6e-73   
gi|491268690|ref|WP_005126827.1| MFS transporter [Mycobacterium ...   280   7e-73   
gi|397678752|ref|YP_006520287.1| MFS-type transporter [Mycobacte...   280   8e-73   
gi|491205209|ref|WP_005063548.1| MFS transporter [Mycobacterium ...   280   8e-73   Mycobacterium abscessus
gi|300786491|ref|YP_003766782.1| major facilitator superfamily t...   280   8e-73   Amycolatopsis mediterranei U32
gi|493393366|ref|WP_006349512.1| DSBA oxidoreductase [Streptomyc...   280   9e-73   Streptomyces tsukubensis
gi|328857443|gb|EGG06559.1| hypothetical protein MELLADRAFT_1064...   280   9e-73   Melampsora larici-populina 98AG31
gi|271969842|ref|YP_003344038.1| arabinose efflux permease-like ...   280   1e-72   
gi|490695857|ref|WP_004559526.1| major facilitator transporter [...   279   1e-72   Amycolatopsis vancoresmycina
gi|494728857|ref|WP_007464723.1| transporter [Micromonospora lup...   279   2e-72   Micromonospora lupini
gi|409044117|gb|EKM53599.1| hypothetical protein PHACADRAFT_1862...   279   2e-72   Phanerochaete carnosa HHB-10118-sp
gi|117929097|ref|YP_873648.1| EmrB/QacA family drug resistance t...   278   3e-72   
gi|374990280|ref|YP_004965775.1| multidrug-efflux transporter [S...   278   3e-72   
gi|395323712|gb|EJF56172.1| MFS general substrate transporter [D...   277   4e-72   Dichomitus squalens LYAD-421 SS1
gi|322702462|gb|EFY94108.1| MFS transporter [Metarhizium anisopl...   277   4e-72   Metarhizium robertsii ARSEF 23
gi|491090930|ref|WP_004952538.1| EmrB/QacA subfamily drug resist...   277   5e-72   Streptomyces mobaraensis
gi|182434844|ref|YP_001822563.1| major facilitator superfamily p...   277   5e-72   
gi|490062714|ref|WP_003964943.1| MFS transporter [Streptomyces g...   277   5e-72   Streptomyces
gi|118471119|ref|YP_887866.1| drug transporter [Mycobacterium sm...   277   5e-72   Mycobacterium smegmatis str. MC2 155
gi|489991957|ref|WP_003895014.1| squalene-hopene cyclase [Mycoba...   277   6e-72   Mycobacterium smegmatis
gi|302869694|ref|YP_003838331.1| EmrB/QacA subfamily drug resist...   277   6e-72   
gi|357390341|ref|YP_004905181.1| putative drug resistance protei...   276   8e-72   
gi|315503824|ref|YP_004082711.1| EmrB/QacA subfamily drug resist...   276   8e-72   
gi|386843525|ref|YP_006248583.1| transmembrane efflux protein [S...   276   9e-72   
gi|491061221|ref|WP_004922854.1| drug resistance transporter, Em...   276   1e-71   
gi|491850440|ref|WP_005632508.1| MFS transporter [Mycobacterium ...   276   1e-71   Mycobacterium hassiacum
gi|392560801|gb|EIW53983.1| MFS general substrate transporter [T...   276   1e-71   Trametes versicolor FP-101664 SS1
gi|169772321|ref|XP_001820629.1| MFS toxin efflux pump [Aspergil...   275   2e-71   Aspergillus oryzae RIB40
gi|291299820|ref|YP_003511098.1| EmrB/QacA subfamily drug resist...   275   2e-71   
gi|353238458|emb|CCA70404.1| probable DHA14-like major facilitat...   275   2e-71   Serendipita indica DSM 11827
gi|494765497|ref|WP_007500905.1| DSBA oxidoreductase [Streptomyc...   275   2e-71   Streptomyces zinciresistens
gi|296805221|ref|XP_002843435.1| major facilitator superfamily t...   275   2e-71   Arthroderma otae CBS 113480
gi|489988093|ref|WP_003891150.1| MFS transporter [Mycobacterium ...   275   2e-71   
gi|501750018|emb|CCG85018.1| protein of unknown function [Taphri...   275   2e-71   Taphrina deformans PYCC 5710
gi|409075615|gb|EKM75993.1| hypothetical protein AGABI1DRAFT_792...   275   3e-71   Agaricus bisporus var. burnettii JB137-S8
gi|120404021|ref|YP_953850.1| EmrB/QacA family drug resistance t...   274   3e-71   
gi|145596221|ref|YP_001160518.1| EmrB/QacA family drug resistanc...   274   4e-71   
gi|472588203|gb|EMS25675.1| MFS drug transporter [Rhodosporidium...   274   4e-71   Rhodotorula toruloides NP11
gi|490067247|ref|WP_003969433.1| DSBA oxidoreductase [Streptomyc...   274   4e-71   Streptomyces sp. ACT-1
gi|322697672|gb|EFY89449.1| MFS transporter [Metarhizium acridum...   274   5e-71   Metarhizium acridum CQMa 102
gi|494723406|ref|WP_007459272.1| DSBA oxidoreductase [Streptomyc...   273   8e-71   
gi|426198780|gb|EKV48706.1| hypothetical protein AGABI2DRAFT_203...   273   8e-71   Agaricus bisporus var. bisporus H97
gi|296422936|ref|XP_002841013.1| hypothetical protein [Tuber mel...   273   8e-71   Tuber melanosporum Mel28
gi|345014730|ref|YP_004817084.1| EmrB/QacA subfamily drug resist...   273   8e-71   
gi|380474638|emb|CCF45667.1| major facilitator superfamily trans...   273   8e-71   Colletotrichum higginsianum
gi|391865494|gb|EIT74774.1| permease of the major facilitator su...   273   1e-70   Aspergillus oryzae 3.042
gi|238490224|ref|XP_002376349.1| MFS toxin efflux pump (AflT), p...   273   1e-70   Aspergillus flavus NRRL3357
gi|493113487|ref|WP_006142963.1| MFS transporter [Streptomyces g...   273   1e-70   Streptomyces griseoaurantiacus
gi|317036407|ref|XP_001397319.2| efflux pump antibiotic resistan...   273   1e-70   Aspergillus niger CBS 513.88
gi|494133040|ref|WP_007072801.1| transporter [Micromonospora sp....   272   1e-70   Micromonospora sp. ATCC 39149
gi|390600521|gb|EIN09916.1| transporter [Punctularia strigosozon...   272   1e-70   Punctularia strigosozonata HHB-11173 SS5
gi|310795207|gb|EFQ30668.1| major facilitator superfamily transp...   272   1e-70   Colletotrichum graminicola M1.001
gi|21221795|ref|NP_627574.1| exporter [Streptomyces coelicolor A...   272   2e-70   Streptomyces coelicolor A3(2)
gi|493422764|ref|WP_006378535.1| drug resistance transporter, Em...   272   2e-70   Streptomyces turgidiscabies
gi|326472732|gb|EGD96741.1| MFS transporter [Trichophyton tonsur...   272   2e-70   Trichophyton tonsurans CBS 112818
gi|490073293|ref|WP_003975468.1| transporter [Streptomyces livid...   272   2e-70   Streptomyces
gi|496369744|ref|WP_009078734.1| MFS transporter [Streptomyces s...   272   2e-70   Streptomyces sp. AA4
gi|490077502|ref|WP_003979650.1| putative drug-resistance transp...   272   2e-70   Streptomyces
gi|182438958|ref|YP_001826677.1| major facilitator superfamily p...   272   2e-70   
gi|302662872|ref|XP_003023086.1| hypothetical protein TRV_02776 ...   272   2e-70   Trichophyton verrucosum HKI 0517
gi|496479797|ref|WP_009188367.1| DSBA oxidoreductase [Streptomyc...   272   2e-70   
gi|491130309|ref|WP_004988737.1| DSBA oxidoreductase [Streptomyc...   271   3e-70   Streptomyces ghanaensis
gi|403416244|emb|CCM02944.1| predicted protein [Fibroporia radic...   271   3e-70   Fibroporia radiculosa
gi|350633269|gb|EHA21634.1| hypothetical protein ASPNIDRAFT_1837...   271   3e-70   Aspergillus niger ATCC 1015
gi|302501568|ref|XP_003012776.1| hypothetical protein ARB_01027 ...   271   4e-70   Arthroderma benhamiae CBS 112371
gi|327304411|ref|XP_003236897.1| MFS transporter [Trichophyton r...   271   5e-70   Trichophyton rubrum CBS 118892
gi|409042671|gb|EKM52155.1| hypothetical protein PHACADRAFT_2626...   270   5e-70   Phanerochaete carnosa HHB-10118-sp
gi|496012801|ref|WP_008737380.1| transporter [Streptomyces sp. M...   270   5e-70   
gi|497743353|ref|WP_010057537.1| major facilitator superfamily p...   270   7e-70   Streptomyces globisporus
gi|494299468|ref|WP_007170081.1| MFS transporter [Mycobacterium ...   270   7e-70   Mycobacterium
gi|494763111|ref|WP_007498519.1| MFS transporter [Streptomyces z...   270   7e-70   Streptomyces zinciresistens
gi|508093090|gb|EOT03404.1| EmrB/QacA subfamily drug resistance ...   270   1e-69   
gi|496014507|ref|WP_008739086.1| DSBA oxidoreductase [Streptomyc...   270   1e-69   Streptomyces sp. Mg1
gi|324029091|gb|ADY16699.1| TqaJ [Penicillium aethiopicum]            269   1e-69   Penicillium aethiopicum
gi|242212674|ref|XP_002472169.1| predicted protein [Postia place...   269   1e-69   Postia placenta Mad-698-R
gi|353234598|emb|CCA66622.1| probable DHA14-like major facilitat...   269   1e-69   Serendipita indica DSM 11827
gi|315045508|ref|XP_003172129.1| hypothetical protein MGYG_04720...   269   1e-69   Microsporum gypseum CBS 118893
gi|379707444|ref|YP_005262649.1| putative drug-resistance transp...   269   2e-69   
gi|490080897|ref|WP_003982983.1| EmrB/QacA subfamily drug resist...   269   2e-69   Streptomyces
gi|512500114|ref|WP_016435524.1| drug:H+ antiporter-2 (14 Spanne...   268   2e-69   Streptomyces sp. HGB0020
gi|491460468|ref|WP_005318244.1| DSBA oxidoreductase [Streptomyc...   268   2e-69   
gi|494623743|ref|WP_007381687.1| multidrug-efflux transporter, p...   268   2e-69   Streptomyces sviceus
gi|345000379|ref|YP_004803233.1| EmrB/QacA subfamily drug resist...   268   2e-69   
gi|212541614|ref|XP_002150962.1| conserved hypothetical protein ...   268   3e-69   Talaromyces marneffei ATCC 18224
gi|315444237|ref|YP_004077116.1| EmrB/QacA subfamily drug resist...   268   3e-69   
gi|145223907|ref|YP_001134585.1| EmrB/QacA family drug resistanc...   268   3e-69   
gi|340519656|gb|EGR49894.1| predicted protein [Trichoderma reese...   268   3e-69   Trichoderma reesei QM6a
gi|496693124|ref|WP_009334667.1| drug resistance MFS transporter...   268   4e-69   Streptomyces ipomoeae
gi|328854855|gb|EGG03985.1| hypothetical protein MELLADRAFT_1088...   267   5e-69   Melampsora larici-populina 98AG31
gi|21224787|ref|NP_630566.1| efflux protein [Streptomyces coelic...   267   7e-69   Streptomyces coelicolor A3(2)
gi|388858155|emb|CCF48223.1| uncharacterized protein [Ustilago h...   267   7e-69   Ustilago hordei
gi|511097274|ref|WP_016327744.1| putative efflux protein [Strept...   266   7e-69   Streptomyces
gi|490070320|ref|WP_003972495.1| MFS transporter [Streptomyces l...   266   8e-69   
gi|393214384|gb|EJC99877.1| MFS general substrate transporter [F...   266   9e-69   Fomitiporia mediterranea MF3/22
gi|29832374|ref|NP_827008.1| multidrug-efflux transporter [Strep...   266   9e-69   
gi|212541604|ref|XP_002150957.1| conserved hypothetical protein ...   266   1e-68   Talaromyces marneffei ATCC 18224
gi|495046461|ref|WP_007771297.1| MFS transporter [Mycobacterium ...   266   1e-68   Mycobacterium colombiense
gi|491122653|ref|WP_004981093.1| MFS transporter [Streptomyces g...   266   1e-68   Streptomyces ghanaensis
gi|490082187|ref|WP_003984238.1| EmrB/QacA subfamily drug resist...   266   1e-68   Streptomyces
gi|497724578|ref|WP_010038762.1| MFS transporter [Streptomyces c...   266   1e-68   
gi|242783058|ref|XP_002480123.1| efflux pump antibiotic resistan...   266   1e-68   Talaromyces stipitatus ATCC 10500
gi|67902216|ref|XP_681364.1| hypothetical protein AN8095.2 [Aspe...   266   1e-68   Aspergillus nidulans FGSC A4
gi|392590836|gb|EIW80164.1| MFS general substrate transporter [C...   266   1e-68   Coniophora puteana RWD-64-598 SS2
gi|433648045|ref|YP_007293047.1| arabinose efflux permease famil...   266   1e-68   
gi|443927365|gb|ELU45864.1| transporter [Rhizoctonia solani AG-1...   266   1e-68   Rhizoctonia solani AG-1 IA
gi|512199834|gb|EPE28667.1| MFS general substrate transporter [G...   266   2e-68   Glarea lozoyensis ATCC 20868
gi|491083836|ref|WP_004945450.1| transmembrane efflux protein [S...   265   2e-68   
gi|111220691|ref|YP_711485.1| integral membrane multidrug-efflux...   265   2e-68   
gi|490029870|ref|WP_003932347.1| MFS transporter [Mycobacterium ...   265   2e-68   Mycobacterium vaccae
gi|493652523|ref|WP_006604011.1| transporter [Streptomyces aurat...   265   2e-68   Streptomyces auratus
gi|345566691|gb|EGX49633.1| hypothetical protein AOL_s00078g122 ...   265   2e-68   Arthrobotrys oligospora ATCC 24927
gi|353244942|emb|CCA76069.1| probable DHA14-like major facilitat...   265   2e-68   Serendipita indica DSM 11827
gi|386839924|ref|YP_006244982.1| multidrug-efflux transporter [S...   265   2e-68   
gi|269793916|ref|YP_003313371.1| EmrB/QacA subfamily drug resist...   265   2e-68   
gi|291303668|ref|YP_003514946.1| EmrB/QacA subfamily drug resist...   265   3e-68   
gi|490051799|ref|WP_003954136.1| DSBA oxidoreductase [Streptomyc...   265   3e-68   Streptomyces clavuligerus
gi|54023068|ref|YP_117310.1| transporter [Nocardia farcinica IFM...   265   3e-68   
gi|452981657|gb|EME81417.1| hypothetical protein MYCFIDRAFT_8147...   265   3e-68   Cercospora fijiensis CIRAD86
gi|108799722|ref|YP_639919.1| EmrB/QacA family drug resistance t...   265   3e-68   
gi|189193587|ref|XP_001933132.1| MFS transporter [Pyrenophora tr...   265   3e-68   Pyrenophora tritici-repentis Pt-1C-BFP
gi|302881493|ref|XP_003039659.1| hypothetical protein NECHADRAFT...   265   3e-68   Nectria haematococca mpVI 77-13-4
gi|479320134|ref|YP_007860185.1| putative exporter [Streptomyces...   265   3e-68   
gi|126435366|ref|YP_001071057.1| EmrB/QacA family drug resistanc...   265   3e-68   
gi|357412699|ref|YP_004924435.1| EmrB/QacA subfamily drug resist...   265   3e-68   
gi|297563090|ref|YP_003682064.1| EmrB/QacA subfamily drug resist...   264   3e-68   
gi|494716423|ref|WP_007452289.1| transporter [Streptomyces coeli...   264   4e-68   Streptomyces
gi|29828445|ref|NP_823079.1| transmembrane efflux protein [Strep...   264   4e-68   
gi|353238456|emb|CCA70402.1| probable DHA14-like major facilitat...   264   4e-68   Serendipita indica DSM 11827
gi|169601798|ref|XP_001794321.1| hypothetical protein SNOG_03774...   264   4e-68   Parastagonospora nodorum SN15
gi|386841651|ref|YP_006246709.1| exporter [Streptomyces hygrosco...   264   4e-68   
gi|315040395|ref|XP_003169575.1| SGE1 [Arthroderma gypseum CBS 1...   264   4e-68   Microsporum gypseum CBS 118893
gi|392418951|ref|YP_006455556.1| drug resistance transporter, Em...   264   5e-68   
gi|498037322|ref|WP_010351478.1| transporter [Streptomyces acidi...   263   6e-68   Streptomyces acidiscabies
gi|493111663|ref|WP_006142112.1| transporter [Streptomyces grise...   263   6e-68   
gi|497971326|ref|WP_010285482.1| transmembrane efflux protein, p...   263   7e-68   
gi|491070138|ref|WP_004931763.1| DSBA oxidoreductase [Streptomyc...   263   8e-68   
gi|449295431|gb|EMC91453.1| hypothetical protein BAUCODRAFT_3963...   263   8e-68   Baudoinia panamericana UAMH 10762
gi|256389875|ref|YP_003111439.1| EmrB/QacA subfamily drug resist...   263   9e-68   
gi|402220859|gb|EJU00929.1| hypothetical protein DACRYDRAFT_8937...   263   9e-68   Dacryopinax primogenitus
gi|344999423|ref|YP_004802277.1| EmrB/QacA subfamily drug resist...   263   9e-68   
gi|512663157|ref|WP_016468769.1| drug:H+ antiporter-2 (14 Spanne...   263   1e-67   Streptomyces
gi|290955973|ref|YP_003487155.1| transporter [Streptomyces scabi...   263   1e-67   
gi|425777471|gb|EKV15644.1| hypothetical protein PDIP_40020 [Pen...   263   1e-67   Penicillium digitatum Pd1
gi|493090109|ref|WP_006129964.1| multidrug-efflux transporter [S...   263   1e-67   Streptomyces gancidicus
gi|453081964|gb|EMF10012.1| major facilitator superfamily transp...   263   1e-67   Sphaerulina musiva SO2202
gi|256371823|ref|YP_003109647.1| EmrB/QacA subfamily drug resist...   262   1e-67   
gi|330914599|ref|XP_003296706.1| hypothetical protein PTT_06872 ...   262   1e-67   Pyrenophora teres f. teres 0-1
gi|242796877|ref|XP_002482895.1| MFS multidrug transporter, puta...   262   1e-67   Talaromyces stipitatus ATCC 10500
gi|357413676|ref|YP_004925412.1| EmrB/QacA subfamily drug resist...   262   2e-67   
gi|493077420|ref|WP_006124154.1| DSBA oxidoreductase [Streptomyc...   262   2e-67   
gi|495095321|ref|WP_007820144.1| MFS transporter [Streptomyces s...   262   2e-67   Streptomyces sp. Tu6071
gi|497956530|ref|WP_010270686.1| MFS transporter [Streptomyces s...   262   2e-67   Streptomyces sp. SA3_actG
gi|496360570|ref|WP_009069746.1| efflux protein, partial [Strept...   262   2e-67   
gi|497756394|ref|WP_010070578.1| DSBA oxidoreductase [Streptomyc...   262   2e-67   Streptomyces filamentosus
gi|471321419|ref|YP_007520449.1| transmembrane efflux protein [S...   262   2e-67   
gi|497404122|ref|WP_009718320.1| DSBA oxidoreductase [Streptomyc...   262   2e-67   Streptomyces himastatinicus
gi|159039618|ref|YP_001538871.1| EmrB/QacA family drug resistanc...   261   2e-67   
gi|396457914|ref|XP_003833570.1| similar to MFS toxin efflux pum...   261   2e-67   Leptosphaeria maculans JN3
gi|497734638|ref|WP_010048822.1| transporter [Streptomyces chart...   261   3e-67   Streptomyces chartreusis
gi|477533763|gb|ENH85334.1| MFS gliotoxin efflux transporter [Co...   261   3e-67   Colletotrichum orbiculare MAFF 240422
gi|375141930|ref|YP_005002579.1| EmrB/QacA subfamily drug resist...   261   3e-67   
gi|238499375|ref|XP_002380922.1| efflux pump antibiotic resistan...   261   3e-67   Aspergillus flavus NRRL3357
gi|501303484|dbj|GAC92907.1| hypothetical protein PHSY_000466 [P...   261   3e-67   Pseudozyma hubeiensis SY62
gi|490049552|ref|WP_003951908.1| MFS transporter [Streptomyces a...   261   3e-67   
gi|493087690|ref|WP_006128722.1| MFS transporter [Streptomyces f...   261   3e-67   
gi|497758504|ref|WP_010072688.1| MFS transporter [Streptomyces f...   261   3e-67   
gi|490090067|ref|WP_003992021.1| transporter [Streptomyces virid...   261   4e-67   Streptomyces viridochromogenes
gi|477530866|gb|ENH82591.1| MFS aflatoxin efflux [Colletotrichum...   261   4e-67   Colletotrichum orbiculare MAFF 240422
gi|490099722|ref|WP_004001610.1| putative Multidrug-efflux trans...   261   4e-67   Streptomyces viridochromogenes
gi|353241917|emb|CCA73698.1| probable DHA14-like major facilitat...   261   5e-67   Serendipita indica DSM 11827
gi|494476761|ref|WP_007266238.1| transporter [Streptomyces sp. C...   261   5e-67   
gi|405123274|gb|AFR98039.1| tetracycline efflux protein [Cryptoc...   260   5e-67   
gi|478687039|ref|YP_007743849.1| Efflux protein [Streptomyces al...   260   5e-67   
gi|326470039|gb|EGD94048.1| major facilitator superfamily transp...   260   6e-67   Trichophyton tonsurans CBS 112818
gi|322705044|gb|EFY96633.1| efflux pump antibiotic resistance pr...   260   6e-67   
gi|494630035|ref|WP_007387979.1| MFS transporter [Streptomyces c...   260   6e-67   Streptomyces coelicoflavus
gi|514326997|gb|EPH40117.1| putative MFS-type transporter [Strep...   260   7e-67   Streptomyces aurantiacus JA 4570
gi|489978283|ref|WP_003881419.1| MFS transporter [Mycobacterium ...   260   8e-67   Mycobacterium
gi|407927030|gb|EKG19935.1| Major facilitator superfamily [Macro...   260   8e-67   Macrophomina phaseolina MS6
gi|296269294|ref|YP_003651926.1| EmrB/QacA subfamily drug resist...   259   9e-67   
gi|346322400|gb|EGX91999.1| MFS transporter [Cordyceps militaris...   259   9e-67   Cordyceps militaris CM01
gi|498159415|ref|WP_010473571.1| DSBA oxidoreductase [Streptomyc...   259   1e-66   Streptomyces somaliensis
gi|494828120|gb|EON64992.1| hypothetical protein W97_04227 [Coni...   259   1e-66   Coniosporium apollinis CBS 100218
gi|383776927|ref|YP_005461493.1| putative MFS transporter [Actin...   259   1e-66   
gi|255943273|ref|XP_002562405.1| Pc18g05780 [Penicillium chrysog...   259   1e-66   Penicillium rubens Wisconsin 54-1255
gi|367051330|ref|XP_003656044.1| hypothetical protein THITE_2146...   259   1e-66   Thielavia terrestris NRRL 8126
gi|258653947|ref|YP_003203103.1| EmrB/QacA subfamily drug resist...   259   1e-66   
gi|479319128|ref|YP_007859179.1| multidrug resistance protein B ...   259   1e-66   
gi|86739430|ref|YP_479830.1| EmrB/QacA family drug resistance tr...   259   1e-66   
gi|242774920|ref|XP_002478540.1| efflux pump antibiotic resistan...   259   1e-66   Talaromyces stipitatus ATCC 10500
gi|345010155|ref|YP_004812509.1| EmrB/QacA subfamily drug resist...   259   1e-66   
gi|512201162|gb|EPE29994.1| MFS general substrate transporter [G...   259   2e-66   Glarea lozoyensis ATCC 20868
gi|393235496|gb|EJD43051.1| transporter [Auricularia delicata TF...   259   2e-66   Auricularia subglabra TFB-10046 SS5
gi|495686011|ref|WP_008410590.1| MFS transporter [Streptomyces s...   259   2e-66   
gi|512189468|gb|EPE05235.1| mfs general substrate transporter [O...   259   2e-66   Ophiostoma piceae UAMH 11346
gi|327297721|ref|XP_003233554.1| MFS transporter [Trichophyton r...   259   2e-66   Trichophyton rubrum CBS 118892
gi|407918657|gb|EKG11926.1| Tetracycline resistance protein TetB...   259   2e-66   Macrophomina phaseolina MS6
gi|496204568|ref|WP_008924379.1| DSBA oxidoreductase [Burkholder...   259   2e-66   Burkholderia sp. H160
gi|496482893|ref|WP_009191463.1| drug resistance transporter, Em...   259   2e-66   
gi|331696433|ref|YP_004332672.1| EmrB/QacA subfamily drug resist...   258   2e-66   
gi|512672298|ref|WP_016472888.1| drug:H+ antiporter-2 (14 Spanne...   258   2e-66   Streptomyces sp. HPH0547
gi|425769407|gb|EKV07900.1| MFS multidrug transporter, putative ...   258   2e-66   Penicillium digitatum Pd1
gi|346973445|gb|EGY16897.1| SGE1 protein [Verticillium dahliae V...   258   2e-66   Verticillium dahliae VdLs.17
gi|493104292|ref|WP_006137655.1| DSBA oxidoreductase [Streptomyc...   258   2e-66   Streptomyces griseoaurantiacus
gi|119716399|ref|YP_923364.1| EmrB/QacA family drug resistance t...   258   2e-66   
gi|494802556|ref|WP_007537964.1| EmrB/QacA subfamily drug resist...   258   2e-66   Rhodococcus triatomae
gi|390598313|gb|EIN07711.1| MFS general substrate transporter [P...   258   2e-66   Punctularia strigosozonata HHB-11173 SS5
gi|322697596|gb|EFY89374.1| efflux pump antibiotic resistance pr...   258   2e-66   Metarhizium acridum CQMa 102
gi|433604538|ref|YP_007036907.1| putative MFS-type transporter [...   258   3e-66   
gi|496481337|ref|WP_009189907.1| transporter [Streptomyces sp. e...   258   3e-66   
gi|512189648|gb|EPE05414.1| mfs aflatoxin efflux [Ophiostoma pic...   258   3e-66   
gi|398394203|ref|XP_003850560.1| major facilitator superfamily t...   258   3e-66   
gi|302659239|ref|XP_003021312.1| hypothetical protein TRV_04574 ...   258   3e-66   
gi|491621159|ref|WP_005478705.1| transporter [Streptomyces bottr...   258   3e-66   
gi|496666642|ref|WP_009309132.1| drug resistance MFS transporter...   258   3e-66   
gi|407642487|ref|YP_006806246.1| putative drug-resistance transp...   258   3e-66   
gi|357399050|ref|YP_004910975.1| transmembrane transport protein...   258   3e-66   
gi|345008367|ref|YP_004810721.1| EmrB/QacA subfamily drug resist...   258   3e-66   
gi|302655680|ref|XP_003019625.1| MFS multidrug transporter, puta...   258   3e-66   
gi|403419770|emb|CCM06470.1| predicted protein [Fibroporia radic...   258   4e-66   
gi|493654426|ref|WP_006605890.1| DSBA oxidoreductase [Streptomyc...   258   4e-66   
gi|511004338|gb|EPB85711.1| hypothetical protein HMPREF1544_0753...   258   4e-66   
gi|258570113|ref|XP_002543860.1| predicted protein [Uncinocarpus...   258   4e-66   
gi|490094666|ref|WP_003996586.1| putative Transmembrane efflux p...   257   4e-66   
gi|51981302|emb|CAF60521.1| putative efflux protein [Streptomyce...   257   5e-66   
gi|290958394|ref|YP_003489576.1| major facilitator exporter [Str...   257   5e-66   
gi|302924127|ref|XP_003053819.1| predicted protein [Nectria haem...   257   5e-66   
gi|302507454|ref|XP_003015688.1| MFS multidrug transporter, puta...   257   6e-66   
gi|393243557|gb|EJD51072.1| MFS general substrate transporter [A...   257   6e-66   
gi|497744164|ref|WP_010058348.1| major facilitator superfamily p...   257   6e-66   
gi|451848855|gb|EMD62160.1| hypothetical protein COCSADRAFT_3894...   257   6e-66   
gi|29831245|ref|NP_825879.1| transmembrane efflux protein [Strep...   257   6e-66   
gi|491618199|ref|WP_005475751.1| major facilitator exporter [Str...   257   7e-66   
gi|494723927|ref|WP_007459793.1| MFS transporter [Streptomyces s...   257   7e-66   
gi|491066409|ref|WP_004928040.1| transporter [Streptomyces grise...   257   7e-66   
gi|295672978|ref|XP_002797035.1| major facilitator superfamily t...   257   7e-66   
gi|326482792|gb|EGE06802.1| MFS aflatoxin efflux pump [Trichophy...   257   7e-66   
gi|471560583|gb|EMR62672.1| putative mfs drug transporter protei...   256   7e-66   
gi|290960882|ref|YP_003492064.1| transporter [Streptomyces scabi...   256   8e-66   
gi|475672180|gb|EMT69376.1| Putative HC-toxin efflux carrier TOX...   256   8e-66   
gi|212527234|ref|XP_002143774.1| conserved hypothetical protein ...   256   8e-66   
gi|392595389|gb|EIW84712.1| MFS amino acid permease [Coniophora ...   256   9e-66   
gi|494782307|ref|WP_007517715.1| multidrug MFS transporter [Fran...   256   9e-66   
gi|494763459|ref|WP_007498867.1| transporter [Streptomyces zinci...   256   9e-66   
gi|121704086|ref|XP_001270307.1| MFS toxin efflux pump, putative...   256   9e-66   
gi|498326731|ref|WP_010640887.1| transmembrane efflux protein [S...   256   9e-66   
gi|496020286|ref|WP_008744793.1| MFS transporter [Streptomyces s...   256   9e-66   
gi|493379526|ref|WP_006335798.1| DSBA oxidoreductase [Gordonia r...   256   9e-66   
gi|302503833|ref|XP_003013876.1| hypothetical protein ARB_07988 ...   256   1e-65   
gi|494627896|ref|WP_007385840.1| MFS transporter [Streptomyces s...   256   1e-65   
gi|477515780|gb|ENH68091.1| Putative HC-toxin efflux carrier TOX...   256   1e-65   
gi|491305072|ref|WP_005163075.1| Multidrug resistance protein B ...   256   1e-65   
gi|225680738|gb|EEH19022.1| vacuolar basic amino acid transporte...   256   1e-65   
gi|226292424|gb|EEH47844.1| major facilitator superfamily transp...   256   1e-65   
gi|255938534|ref|XP_002560037.1| Pc14g00430 [Penicillium chrysog...   256   1e-65   
gi|164422873|ref|XP_958171.2| hypothetical protein NCU09640 [Neu...   256   1e-65   
gi|327302200|ref|XP_003235792.1| hypothetical protein TERG_02844...   256   1e-65   
gi|400593374|gb|EJP61324.1| MFS toxin efflux pump (AflT) [Beauve...   256   1e-65   
gi|485929099|gb|EOD52584.1| putative mfs multidrug transporter p...   256   1e-65   
gi|498037803|ref|WP_010351959.1| DSBA oxidoreductase [Streptomyc...   256   1e-65   
gi|393218556|gb|EJD04044.1| MFS general substrate transporter [F...   256   2e-65   
gi|472587414|gb|EMS24913.1| MFS transporter [Rhodosporidium toru...   256   2e-65   
gi|336177610|ref|YP_004582985.1| EmrB/QacA subfamily drug resist...   255   2e-65   
gi|345562331|gb|EGX45400.1| hypothetical protein AOL_s00170g107 ...   255   2e-65   
gi|500255101|gb|EON98618.1| putative mfs aflatoxin efflux protei...   255   2e-65   
gi|471323500|ref|YP_007522530.1| transmembrane efflux protein [S...   255   2e-65   
gi|429850364|gb|ELA25649.1| MFS aflatoxin efflux [Colletotrichum...   255   2e-65   
gi|496447952|ref|WP_009156797.1| multidrug MFS transporter [Sacc...   255   2e-65   
gi|303321333|ref|XP_003070661.1| Major Facilitator Superfamily p...   255   2e-65   
gi|347440945|emb|CCD33866.1| similar to MFS multidrug transporte...   255   2e-65   
gi|407921410|gb|EKG14558.1| Tetracycline resistance protein TetB...   255   2e-65   
gi|491451698|ref|WP_005309482.1| MFS transporter [Streptomyces p...   255   2e-65   
gi|506932210|ref|YP_008012648.1| major facilitator transporter [...   255   2e-65   
gi|452843159|gb|EME45094.1| hypothetical protein DOTSEDRAFT_1499...   255   2e-65   
gi|315039535|ref|XP_003169143.1| hypothetical protein MGYG_08690...   255   2e-65   
gi|302407037|ref|XP_003001354.1| GliA [Verticillium albo-atrum V...   255   2e-65   
gi|493427927|ref|WP_006383595.1| drug resistance MFS transporter...   255   3e-65   
gi|493389394|ref|WP_006345575.1| MFS transporter [Streptomyces t...   255   3e-65   
gi|326470248|gb|EGD94257.1| major facilitator superfamily transp...   254   3e-65   
gi|336258649|ref|XP_003344134.1| hypothetical protein SMAC_09685...   254   3e-65   
gi|453084599|gb|EMF12643.1| MFS general substrate transporter [M...   254   3e-65   
gi|497426187|ref|WP_009740385.1| multidrug MFS transporter [Fran...   254   3e-65   
gi|353238449|emb|CCA70395.1| probable DHA14-like major facilitat...   254   3e-65   
gi|154310811|ref|XP_001554736.1| hypothetical protein BC1G_06384...   254   3e-65   
gi|472235589|gb|EMR80561.1| putative mfs transporter protein [Bo...   254   3e-65   
gi|212540922|ref|XP_002150616.1| MFS multidrug transporter, puta...   254   4e-65   
gi|296819237|ref|XP_002849815.1| major facilitator superfamily t...   254   4e-65   
gi|451998678|gb|EMD91142.1| hypothetical protein COCHEDRAFT_1156...   254   4e-65   
gi|242798234|ref|XP_002483128.1| conserved hypothetical protein ...   254   4e-65   
gi|402220894|gb|EJU00964.1| MFS general substrate transporter [D...   254   4e-65   
gi|477588699|gb|ENI05777.1| hypothetical protein COCC4DRAFT_1363...   254   4e-65   
gi|493805265|ref|WP_006753093.1| DSBA oxidoreductase [Burkholder...   254   5e-65   
gi|512205083|gb|EPE33905.1| MFS general substrate transporter [G...   254   5e-65   
gi|226289663|gb|EEH45147.1| vacuolar basic amino acid transporte...   254   5e-65   
gi|271965403|ref|YP_003339599.1| EmrB/QacA family drug resistanc...   254   5e-65   
gi|119180491|ref|XP_001241711.1| hypothetical protein CIMG_08874...   254   5e-65   
gi|408682033|ref|YP_006881860.1| putative efflux protein [Strept...   254   5e-65   
gi|452836702|gb|EME38645.1| dothistromin MFS transporter-like pr...   253   7e-65   
gi|409042798|gb|EKM52281.1| hypothetical protein PHACADRAFT_2605...   253   8e-65   
gi|494713221|ref|WP_007449090.1| DSBA oxidoreductase [Streptomyc...   253   8e-65   
gi|262340497|gb|AAL87047.2|AF448056_3 putative dothistromin tran...   253   9e-65   
gi|367029727|ref|XP_003664147.1| hypothetical protein MYCTH_2306...   253   1e-64   
gi|343424972|emb|CBQ68509.1| conserved hypothetical protein [Spo...   253   1e-64   
gi|226185575|dbj|BAH33679.1| putative drug resistance efflux pro...   253   1e-64   
gi|353240213|emb|CCA72093.1| probable DHA14-like major facilitat...   253   1e-64   
gi|295699352|ref|YP_003607245.1| EmrB/QacA subfamily drug resist...   253   1e-64   
gi|495637949|ref|WP_008362528.1| MFS transporter [Nocardioidacea...   253   1e-64   
gi|380477083|emb|CCF44345.1| hypothetical protein CH063_03310 [C...   253   1e-64   
gi|494134446|ref|WP_007074204.1| multidrug MFS transporter [Micr...   253   1e-64   
gi|380483288|emb|CCF40714.1| multidrug resistance protein fnx1 [...   252   1e-64   
gi|498112335|ref|WP_010426491.1| DSBA oxidoreductase [Enterobact...   252   1e-64   
gi|493089305|ref|WP_006129599.1| exporter [Streptomyces gancidic...   252   1e-64   
gi|378725404|gb|EHY51863.1| DNA repair protein RAD50 [Exophiala ...   252   1e-64   
gi|512667502|ref|WP_016470674.1| drug:H+ antiporter-2 (14 Spanne...   252   1e-64   
gi|374988729|ref|YP_004964224.1| exporter [Streptomyces bingchen...   252   1e-64   
gi|408677772|ref|YP_006877599.1| Multidrug resistance protein B ...   252   2e-64   
gi|485926937|gb|EOD51089.1| putative mfs transporter protein [Ne...   252   2e-64   
gi|495017665|ref|WP_007743672.1| DSBA oxidoreductase [Burkholder...   252   2e-64   
gi|238492575|ref|XP_002377524.1| MFS aflatoxin efflux pump, puta...   252   2e-64   
gi|302864980|ref|YP_003833617.1| EmrB/QacA subfamily drug resist...   252   2e-64   
gi|494862590|ref|WP_007588690.1| DSBA oxidoreductase [Burkholder...   252   2e-64   
gi|302887016|ref|XP_003042397.1| hypothetical protein NECHADRAFT...   251   2e-64   
gi|296803715|ref|XP_002842710.1| major facilitator superfamily t...   251   3e-64   
gi|388580667|gb|EIM20980.1| MFS general substrate transporter [W...   251   3e-64   
gi|255941244|ref|XP_002561391.1| Pc16g10850 [Penicillium chrysog...   251   3e-64   
gi|505759599|gb|EOR03690.1| hypothetical protein J056_003147 [Wa...   251   3e-64   
gi|256831635|ref|YP_003160362.1| EmrB/QacA subfamily drug resist...   251   3e-64   
gi|336470362|gb|EGO58523.1| hypothetical protein NEUTE1DRAFT_591...   251   3e-64   
gi|350637175|gb|EHA25533.1| hypothetical protein ASPNIDRAFT_1867...   251   3e-64   
gi|497889193|ref|WP_010203349.1| MFS transporter [Salinibacteriu...   251   3e-64   
gi|336364969|gb|EGN93322.1| hypothetical protein SERLA73DRAFT_18...   251   3e-64   
gi|327348292|gb|EGE77149.1| major facilitator superfamily transp...   251   3e-64   
gi|505758654|gb|EOR02755.1| hypothetical protein J056_003317 [Wa...   251   4e-64   
gi|336377536|gb|EGO18698.1| hypothetical protein SERLADRAFT_4542...   251   4e-64   
gi|493178256|ref|WP_006177648.1| DSBA oxidoreductase [Enterobact...   251   4e-64   
gi|497399952|ref|WP_009714158.1| MFS transporter [Streptomyces h...   251   4e-64   
gi|242798271|ref|XP_002483135.1| efflux pump antibiotic resistan...   251   4e-64   
gi|449298797|gb|EMC94812.1| hypothetical protein BAUCODRAFT_5629...   251   4e-64   
gi|407916182|gb|EKG09595.1| Tetracycline resistance protein TetB...   251   5e-64   
gi|493599971|ref|WP_006552653.1| MFS transporter [Rhodococcus py...   251   5e-64   
gi|14389419|gb|AAF64435.2|AF238225_1 DHA14-like major facilitato...   250   5e-64   
gi|358371109|dbj|GAA87718.1| MFS toxin efflux pump [Aspergillus ...   250   5e-64   
gi|475671327|gb|EMT68680.1| Putative HC-toxin efflux carrier TOX...   250   6e-64   
gi|497458558|ref|WP_009772756.1| MFS transporter [marine actinob...   250   6e-64   
gi|452846513|gb|EME48445.1| hypothetical protein DOTSEDRAFT_6747...   250   6e-64   
gi|512504074|ref|WP_016437455.1| drug:H+ antiporter-2 (14 Spanne...   250   6e-64   
gi|392595746|gb|EIW85069.1| MFS general substrate transporter [C...   250   6e-64   
gi|317156760|ref|XP_001825984.2| MFS drug transporter [Aspergill...   250   6e-64   
gi|358393078|gb|EHK42479.1| hypothetical protein TRIATDRAFT_3427...   250   6e-64   
gi|326480794|gb|EGE04804.1| MFS multidrug transporter [Trichophy...   250   7e-64   
gi|477529742|gb|ENH81492.1| MFS toxin efflux pump [Colletotrichu...   250   7e-64   
gi|408392134|gb|EKJ71494.1| hypothetical protein FPSE_08307 [Fus...   250   7e-64   
gi|350639803|gb|EHA28156.1| hypothetical protein ASPNIDRAFT_5023...   250   7e-64   
gi|495253216|ref|WP_007977971.1| drug resistance transporter, Em...   250   7e-64   
gi|182434953|ref|YP_001822672.1| major facilitator superfamily p...   250   8e-64   
gi|317054186|ref|YP_004118211.1| drug resistance transporter, Em...   250   8e-64   
gi|452837586|gb|EME39528.1| hypothetical protein DOTSEDRAFT_7525...   250   8e-64   
gi|378734582|gb|EHY61041.1| DNA repair protein RAD50 [Exophiala ...   250   8e-64   
gi|312199895|ref|YP_004019956.1| EmrB/QacA subfamily drug resist...   249   9e-64   
gi|500256725|gb|EON99948.1| putative efflux pump antibiotic resi...   249   9e-64   
gi|399170123|emb|CCE28896.1| probable DHA14-like major facilitat...   249   1e-63   
gi|157370720|ref|YP_001478709.1| EmrB/QacA family drug resistanc...   249   1e-63   
gi|512194754|gb|EPE10510.1| major facilitator superfamily transp...   249   1e-63   
gi|495164205|ref|WP_007889003.1| DSBA oxidoreductase [Pantoea sp...   249   1e-63   
gi|512200950|gb|EPE29782.1| MFS general substrate transporter [G...   249   1e-63   
gi|345566099|gb|EGX49046.1| hypothetical protein AOL_s00079g267 ...   249   1e-63   
gi|485915856|gb|EOD43338.1| putative major facilitator superfami...   249   1e-63   
gi|490062832|ref|WP_003965061.1| MFS transporter [Streptomyces g...   249   1e-63   
gi|327299822|ref|XP_003234604.1| MFS multidrug transporter [Tric...   249   1e-63   
gi|342888866|gb|EGU88084.1| hypothetical protein FOXB_01430 [Fus...   249   1e-63   
gi|507525990|ref|YP_008047613.1| drug resistance transporter Emr...   249   2e-63   
gi|302894933|ref|XP_003046347.1| hypothetical protein NECHADRAFT...   249   2e-63   
gi|482803893|gb|EOA81018.1| hypothetical protein SETTUDRAFT_1664...   249   2e-63   
gi|406864282|gb|EKD17328.1| DHA14-like major facilitator [Marsso...   249   2e-63   
gi|115386742|ref|XP_001209912.1| conserved hypothetical protein ...   249   2e-63   
gi|317034619|ref|XP_001400726.2| MFS drug transporter [Aspergill...   248   2e-63   
gi|303313977|ref|XP_003066997.1| Major Facilitator Superfamily p...   248   2e-63   
gi|238492787|ref|XP_002377630.1| MFS drug transporter, putative ...   248   2e-63   
gi|302918272|ref|XP_003052625.1| hypothetical protein NECHADRAFT...   248   2e-63   
gi|449542210|gb|EMD33190.1| hypothetical protein CERSUDRAFT_6823...   248   2e-63   
gi|302496881|ref|XP_003010441.1| MFS gliotoxin efflux transporte...   248   2e-63   
gi|340938986|gb|EGS19608.1| hypothetical protein CTHT_0040870 [C...   248   2e-63   
gi|490042497|ref|WP_003944867.1| MFS transporter [Rhodococcus qi...   248   3e-63   
gi|494718879|ref|WP_007454745.1| multidrug MFS transporter [Micr...   248   3e-63   
gi|300787534|ref|YP_003767825.1| MFS transporter multidrug efflu...   248   3e-63   
gi|145247328|ref|XP_001395913.1| MFS toxin efflux pump [Aspergil...   248   3e-63   
gi|391873811|gb|EIT82819.1| permease of the major facilitator su...   248   3e-63   
gi|491083057|ref|WP_004944671.1| DSBA oxidoreductase [Serratia p...   248   3e-63   
gi|45477397|gb|AAS66020.1| potential toxin transporter [Aspergil...   248   3e-63   
gi|497734943|ref|WP_010049127.1| DSBA oxidoreductase [Streptomyc...   248   3e-63   
gi|345003146|ref|YP_004806000.1| EmrB/QacA subfamily drug resist...   248   3e-63   
gi|350639244|gb|EHA27598.1| hypothetical protein ASPNIDRAFT_1851...   248   3e-63   
gi|493369098|ref|WP_006325435.1| DSBA oxidoreductase [Serratia p...   248   3e-63   
gi|493365515|ref|WP_006321936.1| DSBA oxidoreductase [Serratia p...   248   3e-63   
gi|295662210|ref|XP_002791659.1| multidrug resistance protein fn...   248   3e-63   
gi|46107656|ref|XP_380887.1| hypothetical protein FG00711.1 [Fus...   248   3e-63   
gi|118619058|ref|YP_907390.1| hypothetical protein MUL_3826 [Myc...   248   3e-63   
gi|306847528|gb|ADN06228.1| MFS transporter-like protein [Passal...   248   4e-63   
gi|508094437|gb|EOT04610.1| exporter [Streptomyces albulus CCRC ...   248   4e-63   
gi|477515993|gb|ENH68274.1| Putative HC-toxin efflux carrier TOX...   248   4e-63   
gi|156036306|ref|XP_001586264.1| conserved hypothetical protein ...   248   4e-63   
gi|377813201|ref|YP_005042450.1| EmrB/QacA subfamily drug resist...   248   4e-63   
gi|46122741|ref|XP_385924.1| hypothetical protein FG05748.1 [Fus...   248   4e-63   
gi|302691186|ref|XP_003035272.1| hypothetical protein SCHCODRAFT...   248   4e-63   
gi|255950952|ref|XP_002566243.1| Pc22g23520 [Penicillium chrysog...   248   4e-63   
gi|497782734|ref|WP_010096918.1| DSBA oxidoreductase [Burkholder...   248   4e-63   
gi|350631385|gb|EHA19756.1| hypothetical protein ASPNIDRAFT_1789...   248   4e-63   
gi|320589723|gb|EFX02179.1| major facilitator superfamily transp...   247   5e-63   
gi|302652257|ref|XP_003017984.1| MFS gliotoxin efflux transporte...   247   5e-63   
gi|493944376|ref|WP_006888378.1| MFS transporter [Rothia aeria] ...   247   5e-63   
gi|479271186|ref|YP_007844465.1| drug resistance transporter, Em...   247   5e-63   
gi|493865811|ref|WP_006812485.1| DSBA oxidoreductase [Enterobact...   247   6e-63   
gi|358369387|dbj|GAA86002.1| major facilitator superfamily prote...   247   6e-63   
gi|497401871|ref|WP_009716069.1| transporter [Streptomyces himas...   247   6e-63   
gi|311112862|ref|YP_003984084.1| drug resistance transporter [Ro...   247   6e-63   
gi|238497433|ref|XP_002379952.1| aflT / aflT / transmembrane pro...   247   7e-63   
gi|449297652|gb|EMC93670.1| hypothetical protein BAUCODRAFT_7585...   247   7e-63   
gi|514327893|gb|EPH40928.1| putative MFS-type transporter [Strep...   247   7e-63   
gi|327353532|gb|EGE82389.1| MFS multidrug transporter [Ajellomyc...   247   7e-63   
gi|440285546|ref|YP_007338311.1| drug resistance transporter, Em...   247   7e-63   
gi|449547587|gb|EMD38555.1| hypothetical protein CERSUDRAFT_1354...   246   8e-63   
gi|255936771|ref|XP_002559412.1| Pc13g09900 [Penicillium chrysog...   246   8e-63   
gi|296815830|ref|XP_002848252.1| MFS gliotoxin efflux transporte...   246   8e-63   
gi|367042946|ref|XP_003651853.1| hypothetical protein THITE_1196...   246   8e-63   
gi|494734276|ref|WP_007470087.1| MFS transporter [Segniliparus r...   246   8e-63   
gi|479322820|ref|YP_007862871.1| putative efflux protein [Strept...   246   8e-63   
gi|302677799|ref|XP_003028582.1| hypothetical protein SCHCODRAFT...   246   8e-63   
gi|119497561|ref|XP_001265539.1| MFS transporter, putative [Neos...   246   9e-63   
gi|239608506|gb|EEQ85493.1| MFS multidrug transporter [Ajellomyc...   246   9e-63   
gi|294656269|ref|XP_458521.2| DEHA2D01210p [Debaryomyces hanseni...   246   1e-62   


>gi|384496232|gb|EIE86723.1| hypothetical protein RO3G_11434 [Rhizopus delemar RA 99-880]
          Length = 557

 Score =  345 bits (885), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 204/489 (41%), Positives = 282/489 (57%), Gaps = 12/489 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATALP I S+F  +  ++WVATAY+LT  AFQP + KFSDIFGRK   LF +  F 
Sbjct: 61  NTIIATALPTIGSEFNQMTIVSWVATAYMLTFDAFQPLFAKFSDIFGRKWILLFGISVFL 120

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCG A NM  +I+ RAIAG+GG GI S+V I+ISDIV L+ RG YQ          
Sbjct: 121 FGSILCGAAKNMVMLIVGRAIAGIGGAGITSMVFIVISDIVPLEKRGSYQGLVNAVFALA 180

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG+FTD+VTWRW+FYINLP+GAI + +  F L +P P+    +KLKR+DY GT
Sbjct: 181 SVLGPLVGGSFTDYVTWRWNFYINLPIGAIAIALITFFLHLPIPQSKFSEKLKRVDYTGT 240

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V+  +   LL LN+GG  +PW S                  +VE K A EP+ PP LF
Sbjct: 241 AIVLAFSTLFLLALNFGGQTFPWKSAAVIVLLVLSVLLVGLLAIVEKKFAKEPIMPPRLF 300

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +   VV     N+F GM FFS VYY+P+YFQVV+ DSA  SG+ LIP+ L + + S++ G
Sbjct: 301 RNRSVVSVLLVNWFFGMTFFSAVYYLPVYFQVVRNDSAMWSGIRLIPMQLVLSVISIAVG 360

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
            ++S+T    Y+ L   G A++    GL +L+D+ +  +                   T+
Sbjct: 361 LSISKTG--IYKPLISFGMAMLTAWIGLTSLYDQETPFSRIYGITIIGSLGLGFLFSPTI 418

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V+ KD+A VT L  F R++G+  GVAI  T+ ++ L   + ++ IP E A  V 
Sbjct: 419 IALQAAVDVKDIAVVTGLGNFSRILGSALGVAISSTVLNSHLNQELAHV-IPAEEAAKVL 477

Query: 421 ASATVVNQ-LPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNH--------KP 471
           AS+  VN+ LP + +   +  YV  LRT +   I +  L FLAS F+ +H        KP
Sbjct: 478 ASSEYVNRGLPEQYKEATLEVYVNGLRTLWYVLIAMSGLGFLASFFVKHHPIRRPPKQKP 537

Query: 472 SLRTTDTVV 480
           +    D VV
Sbjct: 538 AEPEGDDVV 546



>gi|511003983|gb|EPB85365.1| hypothetical protein HMPREF1544_07825 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 639

 Score =  338 bits (866), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 202/476 (42%), Positives = 276/476 (57%), Gaps = 6/476 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TIVATALP I SDF  +  +AWVATAY+LT  AFQP + KFSDIFGRK   +F +  F 
Sbjct: 101 NTIVATALPKIGSDFNQMAIVAWVATAYILTFDAFQPLFSKFSDIFGRKWILMFGIAVFL 160

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCG +  M  +I+ RAIAG+G  GI S+V +I SD+V L+ RG YQ          
Sbjct: 161 FGSVLCGASTTMIMLIVGRAIAGIGAAGIFSMVFVIFSDLVPLEQRGTYQGIINAVFALS 220

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG+ TD+V+WRW+FYINLP+GA+ ++V  F LR+P P G LL KLKR+DY GT
Sbjct: 221 SVCGPLIGGSLTDYVSWRWNFYINLPIGAVAMLVLFFFLRLPTPHGKLLDKLKRVDYAGT 280

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           ++V+      LL LN+GG E+PW+S                  +VE K A EP+ PP LF
Sbjct: 281 VIVLAFATLFLLALNFGGQEFPWNSAAVIVPLVLSILLVGLLVVVEKKFAKEPIMPPRLF 340

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
               VV    TN+F GM FFS VYY+P+YFQVV+ DSA  SG+ LIP+ L + + S   G
Sbjct: 341 TNRSVVSVILTNWFFGMTFFSAVYYLPIYFQVVRNDSAMWSGIRLIPMQLVLTVLSTIVG 400

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             +S+T    YR L   G AL+ +  GL +L+ E++  +                  +T+
Sbjct: 401 VTISKTG--VYRPLICVGMALLTMWIGLFSLFKEDTPFSQIYGITIIGGAGLGCLFSSTI 458

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  VE KD+A VT L  F R++G   GVAI   + ++ LT  +    +P E A  V 
Sbjct: 459 IALQASVEPKDIAVVTGLGNFARILGGALGVAISSAVLNSQLTQELPKY-LPMEEAVKVI 517

Query: 421 ASATVVNQ-LPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRT 475
            S+  VN  LP E     +  YV +L+  +   IP+  L F++SLF+ +H  S+R+
Sbjct: 518 QSSEYVNHGLPAEYLTVTLRVYVESLQLIWYVLIPMAGLGFISSLFVKHH--SIRS 571



>gi|281202894|gb|EFA77096.1| major facilitator superfamily protein [Polysphondylium pallidum
           PN500]
          Length = 774

 Score =  336 bits (861), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 187/476 (39%), Positives = 273/476 (57%), Gaps = 6/476 (1%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALPAIA D  ++D+++WV T YLLT TA  P +GKFSDIFG+K T LF+++TF I
Sbjct: 219 TIVATALPAIAEDLGSMDQMSWVITIYLLTSTAISPLFGKFSDIFGKKLTLLFSLVTFLI 278

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLC ++ +MT +II RAI G+GGGG+++ VMI++++IV L+ RGKYQ           
Sbjct: 279 GSLLCAVSTSMTMLIIVRAIQGIGGGGLMAAVMIVMAEIVPLRQRGKYQGLIGGVYALSS 338

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTI 181
              PL+GG+FTD+V WRW+F+IN+P+G I ++V  F L++ +      + +KR+D+IGT+
Sbjct: 339 VIGPLVGGSFTDNVNWRWAFWINIPIGVIALVVVFFALKLQQEVIPFRKGIKRVDFIGTL 398

Query: 182 VVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFK 241
             V   I  LL L+WGG  Y W+SP               F L E K   +P+ P  LF 
Sbjct: 399 TSVTCIIGFLLALSWGGQVYSWTSPIMIGLFVGTAVFLGVFILNEAKFTNDPIIPLELFT 458

Query: 242 RLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQ 301
             + V    T+FF G   F ++YY+PLYFQ+V G SAT SGL+L+P +LG+V     SG 
Sbjct: 459 NRNYVLSILTSFFLGFIMFGVIYYIPLYFQIVIGKSATVSGLQLLPTMLGIVAMGAVSGY 518

Query: 302 AVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLL 361
            +  T    Y+T  + G     +G+ L++ W   S +A  I Y           MQ   +
Sbjct: 519 LI--TSFGHYKTYPVIGTLFFTVGTFLLSYWTPESTQAEYIGYQIFIGFGIGLTMQVLTM 576

Query: 362 CGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL-AGAVK 420
             Q  VEYK +A  TA + FFR IG V  V++  TI ++   +NI ++ +P  +   +  
Sbjct: 577 IVQNSVEYKYIAIATATISFFRTIGGVVSVSLFSTILNSQFRSNINHLNLPFSIDTNSFD 636

Query: 421 ASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTT 476
                  + P+ ++  +++AY  +L   F    P   +  L + F+  HK  LRTT
Sbjct: 637 VQFVHSIEDPV-VKAEILNAYSKSLSMVFLVATPFAAMGCLLTFFIKAHK--LRTT 689



>gi|511010565|gb|EPB91785.1| hypothetical protein HMPREF1544_01293 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 621

 Score =  335 bits (860), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 184/447 (41%), Positives = 263/447 (58%), Gaps = 5/447 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TIV+TALP I SDF  +  ++WVATAY+LT  AFQP + KFSDIFGRK   +F ++ F 
Sbjct: 84  STIVSTALPRIGSDFNQMSIVSWVATAYILTFDAFQPLFSKFSDIFGRKWVLIFGIVIFL 143

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS+LCG A +M  +I+ RAIAG+GG  I S+V IIISD+V L+ RG YQ          
Sbjct: 144 LGSVLCGAANSMIMLIVCRAIAGIGGASIFSMVFIIISDLVPLEKRGSYQGIVNAVFALS 203

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG+FTD+VTWRW+FYINLP+GA+ + V +F L +P P+G+L  KLKRIDY+GT
Sbjct: 204 SVFGPLIGGSFTDYVTWRWNFYINLPIGAVALFVLVFFLHLPVPQGNLKDKLKRIDYVGT 263

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V+      LL +N+GG  +PW S                   +E+K+A EP+ PP LF
Sbjct: 264 CIVLAFATLFLLAMNFGGQTFPWKSAAVIVPLVLTGLLVALLIFIESKVA-EPLLPPRLF 322

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +   +     TN+F GM FFS+VYY+P+YFQVV+ DSA  SG+ LIP+ L + + S  SG
Sbjct: 323 RNRTISAVLATNWFFGMTFFSMVYYLPIYFQVVREDSAMWSGIRLIPMELLIAVFSTFSG 382

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             +S+T  F  + L   G  L+ +  GLI+L+ E++  +    +             + +
Sbjct: 383 LFISKTGIF--KPLLPIGMGLLTLCVGLISLFGEDTPWSKVYGFTVIGGMGLGCMFSSAI 440

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q   E +D+A VT L  F R++G   GVAI   I ++ L  ++    +P ++  +V 
Sbjct: 441 IALQASAEPRDIAVVTGLGNFSRILGGALGVAISSAILNSSLAQDLP-ARVPSDVVQSVL 499

Query: 421 ASATVVNQ-LPIEIRGPVISAYVGALR 446
            S+  V    P E    V+  Y+ ALR
Sbjct: 500 GSSEYVRHGCPPEYVEFVLDCYLDALR 526



>gi|384485914|gb|EIE78094.1| hypothetical protein RO3G_02798 [Rhizopus delemar RA 99-880]
          Length = 591

 Score =  335 bits (859), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 195/468 (41%), Positives = 270/468 (57%), Gaps = 2/468 (0%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TI++TALP I SDF  +  ++WVATAY+LT  AFQP + KFSDIFGRK   +F +  F  
Sbjct: 71  TIISTALPRIGSDFNQMTIVSWVATAYILTFDAFQPLFAKFSDIFGRKWILMFGIGLFLF 130

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GS+LCG A  M  +I+ RAIAG+G  GI S+V IIISDIV L+ RG YQ           
Sbjct: 131 GSVLCGAATTMIMLIVARAIAGIGAAGINSMVFIIISDIVPLEKRGSYQGIINAVFALAS 190

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTI 181
              PL+GG+FTD+VTWRW+FYINLP+GA+ V V ++ LR+P PK  L +KLKR+DYIGT+
Sbjct: 191 VFGPLIGGSFTDYVTWRWNFYINLPIGAVAVAVLLYFLRLPTPKSKLSEKLKRVDYIGTV 250

Query: 182 VVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFK 241
           +V+  +   LL LN+GG  +PW S                  +VE K A EP+ PP LF+
Sbjct: 251 IVLAFSTLFLLALNFGGQTFPWKSAAVIVPLVLSVLLVGLLMVVEKKFAKEPLMPPRLFR 310

Query: 242 RLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQ 301
              VV     N+F GM+FFS VYY+P+YFQVV+ DSA  SG+ LIP+ L +   S  +G 
Sbjct: 311 NRSVVSVLFVNWFFGMSFFSAVYYLPVYFQVVRNDSAMWSGIRLIPMQLVLCFISTLAGL 370

Query: 302 AVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLL 361
            +S+T    YR +   G  L+ +  GL TL+D+    +                  +T++
Sbjct: 371 TISKTG--VYRPMICIGMGLMTLWIGLTTLYDQTIPFSQIYGITILGSGSLGCLFSSTII 428

Query: 362 CGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKA 421
             Q  VE KD+A VT L  F R++G   GVAI   + ++ L   + N+    E    +++
Sbjct: 429 ALQASVEIKDIAVVTGLGNFSRILGGALGVAISSAVLNSHLNQELPNLLPIDEATKVIQS 488

Query: 422 SATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNH 469
           S  V + LP + +   I  YV  L+  +   I +  L F+AS F+ +H
Sbjct: 489 SEYVNHGLPEQYKVLAIEVYVHGLQMIWYVLIAMSGLGFIASFFVKHH 536



>gi|384485895|gb|EIE78075.1| hypothetical protein RO3G_02779 [Rhizopus delemar RA 99-880]
          Length = 581

 Score =  334 bits (857), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 271/469 (57%), Gaps = 2/469 (0%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI++TALP I SDF  +  ++WVATAY+LT  AFQP + KFSDIFGRK   +F +  F 
Sbjct: 60  STIISTALPTIGSDFNQMTIVSWVATAYILTYDAFQPLFSKFSDIFGRKWILMFGIGLFL 119

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCG A  M  +I+ RAIAG+G  GI S+V III+DIV L+ RG YQ          
Sbjct: 120 FGSVLCGAATTMIMLIVARAIAGIGAAGINSMVYIIITDIVPLEKRGSYQGVVNAVYSLS 179

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG+FTD+VTWRW+FYINLP+GA+ V V ++ LR+P PK  L +KLKR+DYIGT
Sbjct: 180 SIFGPLIGGSFTDYVTWRWNFYINLPIGAVAVAVLLYFLRLPTPKSKLSEKLKRVDYIGT 239

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           ++V+  +   LL LN+GG  +PW S                  +VE K A EP+ PP LF
Sbjct: 240 VIVLAFSTLFLLALNFGGQAFPWKSAVVIVPLVLSVLLVGLLMVVEKKFAKEPLMPPRLF 299

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +   VV     N+F GM+FF+ VYY+P+YFQVV+ DSA  SG+ LIP+ L + + S  +G
Sbjct: 300 RNRSVVSVLFVNWFYGMSFFAAVYYLPVYFQVVRNDSAMWSGIRLIPMQLVLCVTSTLTG 359

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             +S+T    YR +   G  L+ +  GL TL+D+    +                  +T+
Sbjct: 360 FTISKTG--VYRPMICIGMGLMTLWIGLTTLYDQTIPFSQIYGITILGSGSLGCLFSSTI 417

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  VE KD+A VT L  F R++G   GVAI   + ++ L   + N+    E    ++
Sbjct: 418 IALQASVEIKDIAVVTGLGNFSRILGGALGVAISSAVLNSHLNQELPNLLPIDEATKVIQ 477

Query: 421 ASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNH 469
           +S  V + LP + +   I  YV  L+  +   I +  L F+AS F+ +H
Sbjct: 478 SSEYVNHGLPEQYKVLAIEVYVHGLQMIWYVLIAMSGLGFIASFFVKHH 526



>gi|330844788|ref|XP_003294295.1| hypothetical protein DICPUDRAFT_58958 [Dictyostelium purpureum]
 gi|325075263|gb|EGC29173.1| hypothetical protein DICPUDRAFT_58958 [Dictyostelium purpureum]
          Length = 994

 Score =  321 bits (822), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 193/483 (39%), Positives = 276/483 (57%), Gaps = 15/483 (3%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALPAI +D    +++ WV T YLLT T+  P +GKFSDIFG+K   L +++ F I
Sbjct: 443 TIVATALPAIVADLHGAEQLPWVVTIYLLTSTSVSPLFGKFSDIFGKKILLLSSLVIFLI 502

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLC +A +M  +I+ RAI GVGGGG++S VMI++++IV L+DRGKYQ           
Sbjct: 503 GSLLCAVATSMNMLILARAIQGVGGGGLMSAVMIVMAEIVPLRDRGKYQGLLGAVYAVSS 562

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTI 181
              PL+GG FTD++TWRW+F+INLPLGA+  IV  F LRIP+      + +K+ID +G++
Sbjct: 563 VVGPLMGGTFTDNITWRWAFWINLPLGAVAFIVVFFALRIPQKVIPFSEGVKKIDVVGSL 622

Query: 182 VVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETK-LAIEPVAPPHLF 240
            +V +TI  LL L+WGG +YPW SP               F + E       P+ P  LF
Sbjct: 623 CLVAATICFLLGLSWGGIDYPWDSPIIICLLAGTGIFVLIFWINEKYWFNTHPIIPLDLF 682

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K  + V C   +F  G   F ++YY+PLYFQ VKG +AT SGL+L+P +LG+V+    SG
Sbjct: 683 KTRNYVLCSIGSFLLGFVMFGVIYYIPLYFQYVKGATATASGLQLLPTMLGIVLFGAISG 742

Query: 301 QAVSRTDKFA-YRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
             ++   KF  Y++  + G A + IG  L++LWD NS +   I Y           MQ  
Sbjct: 743 LLIT---KFGHYKSYPIVGMAFMMIGIYLLSLWDHNSTQKEYIGYQCFIGVGIGLTMQIL 799

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPE---LA 416
           +L  Q  V    ++  TA + FFR IG V  VA+   I +   + N+ ++ +  +   L 
Sbjct: 800 VLIVQNSVNVVYISISTATVSFFRSIGGVVSVAVFSAILNQQFSQNL-SVLVEKDAFILN 858

Query: 417 GAVKASATV--VNQLPIEIRGPVISAYVGALRTAFTADIPI-GILCFLASLFMGNHKPSL 473
           G    +  +  + +     +  +IS+Y  AL T F +  P  G+ C L  LF+ N+K  L
Sbjct: 859 GRAPHNFNIEWIKEYSEPAKSQIISSYQEALSTVFLSAAPFAGLGCVLV-LFVRNNK--L 915

Query: 474 RTT 476
           RTT
Sbjct: 916 RTT 918



>gi|357393023|ref|YP_004907864.1| putative drug resistance protein [Kitasatospora setae KM-6054]
 gi|503905210|ref|WP_014139204.1| MFS transporter [Kitasatospora setae]
 gi|311899500|dbj|BAJ31908.1| putative drug resistance protein [Kitasatospora setae KM-6054]
          Length = 687

 Score =  308 bits (790), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 182/486 (37%), Positives = 266/486 (54%), Gaps = 22/486 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I +D      ++WV T+YLL  T      GK  D+FGRK  F  + I F 
Sbjct: 38  QTIVGTALPTIVADLGGASHMSWVVTSYLLAETVTTALVGKMGDLFGRKVVFQVSAIIFI 97

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGL+ NM  +II+RA+ G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 98  TGSFLCGLSTNMLLLIIWRAVQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGVS 157

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIG- 179
               PLLGG FTDH++WRW+FY+N+P+  + VI A     IP  K +       IDY+G 
Sbjct: 158 TVIGPLLGGLFTDHLSWRWAFYVNVPIAVLVVIAAA--RNIPVVKSA---SRPVIDYLGI 212

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
           T+V +G++ AL+L  +WGGNEY W+S                F  VET+ A EP  P  L
Sbjct: 213 TLVAIGAS-ALILATSWGGNEYAWNSAVIIGLFAAGIVALALFCWVETR-AAEPTLPMRL 270

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+      C   +F  G A    + ++P + Q V GDSAT SG+  +P++LG++IAS+ S
Sbjct: 271 FRNQVFTVCSILSFIVGFAMLGALTFLPTFLQYVDGDSATVSGVRTLPMVLGLLIASIFS 330

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  VS+T K  YR   + G+ ++ +G  L++L D  +       YM          MQ  
Sbjct: 331 GNVVSKTGK--YRIFPIVGSVVMGVGLYLLSLLDVGTSAWLASLYMFVLGVGIGLSMQVL 388

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI---------A 410
            +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N L  N+            A
Sbjct: 389 TIAVQNTVDYSDLGTATSGVTFFRTLGSSFGTAVFGTIYTNALKTNLTGAVTRAAQATGA 448

Query: 411 IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
            P +LAGA + S   V++LP E   P++ AY  +L T F   +P+ ++ F+ +LF+   K
Sbjct: 449 DPQQLAGAAQ-SPHGVHELPPEQAAPIVQAYADSLHTVFLWTVPVALVGFVVALFLKQVK 507

Query: 471 PSLRTT 476
             LR T
Sbjct: 508 --LRDT 511



>gi|496019323|ref|WP_008743843.1| MFS transporter [Streptomyces sp. Mg1]
 gi|194345865|gb|EDX26831.1| membrane transport protein [Streptomyces sp. Mg1]
          Length = 697

 Score =  307 bits (787), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 181/479 (37%), Positives = 258/479 (53%), Gaps = 18/479 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I +D    D ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 49  QTIVGTALPTIVADLGGGDHMSWVVTSYLLAETVSTALVGKFGDLFGRKLIFQISAIVFI 108

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGL+PNMT +I++R + G+G GG++   M +I+D+V L++RGKYQ          
Sbjct: 109 SGSFLCGLSPNMTFLIVWRGVQGIGAGGLMVTAMALIADVVPLRERGKYQGMIGAVFGVA 168

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIG- 179
               PLLGG FTD +TWRW FY+N+P+  + VI A   +   R +G  +     IDY+G 
Sbjct: 169 TVIGPLLGGLFTDQLTWRWCFYVNVPIAILVVIAAARTIPAVRAEGKPV-----IDYLGI 223

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
           T+V +G++ AL+L  +WGGNEY WSSP               F LVET+ A +P+ P  L
Sbjct: 224 TMVAIGAS-ALILATSWGGNEYAWSSPVIIGLFAAGVLALALFCLVETR-AEQPMLPMRL 281

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F       C   +F  G A    + ++P Y Q V GDSAT SG+  +PL+ G++IASV S
Sbjct: 282 FGTPVFGVCSVLSFVVGFAMLGAMTFLPTYLQYVDGDSATVSGVRTLPLVFGLLIASVFS 341

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G   SRT +  YR     G A++A G  L++     +    +  YM          MQ  
Sbjct: 342 GTVTSRTGR--YRIFPTVGCAVMAAGLFLLSTMRPGTSVWLESLYMFVLGTGIGLSMQVL 399

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAI 411
            +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N L   +++           
Sbjct: 400 TIAVQNTVDYADLGTATSGVTFFRTLGSAFGTAVFGTIYANSLGPALKSGVAEAARRTGQ 459

Query: 412 PPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
            P L     +S   V++LP E  GP++ AY  AL T F   +P+ +  F+  LF+   K
Sbjct: 460 DPALLAKAASSPDGVHRLPPEAAGPIVDAYADALHTVFLWTVPVALFGFVVGLFLKQVK 518



>gi|471321028|ref|YP_007520058.1| putative MFS-type transporter [Streptomyces davawensis JCM 4913]
 gi|505469527|ref|WP_015656326.1| putative MFS-type transporter [Streptomyces davawensis]
 gi|408527757|emb|CCK25931.1| putative MFS-type transporter [Streptomyces davawensis JCM 4913]
          Length = 692

 Score =  304 bits (778), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 175/474 (36%), Positives = 254/474 (53%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 41  QTIVGTALPTIVSDLGGAEHMSWVVTSYLLAETVSTVLVGKFGDMFGRKVVFQVSAIVFI 100

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NMT +I++RA+ GVG GG++   M +I+D++ L++RGKYQ          
Sbjct: 101 TGSFLCGLAGNMTMLILWRAMQGVGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGVA 160

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P+  + V  A   + + +     +     IDY+G 
Sbjct: 161 TVIGPLLGGLFTDHLTWRWAFYVNVPIAIVVVFAAARTIPVVKAASRPI-----IDYLGI 215

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
             V     AL+L  +WGGNEY W S                F  VET+ A EP+ P  LF
Sbjct: 216 AFVAVGASALILATSWGGNEYAWGSGVIIGLFVGGVIALGLFCWVETR-AAEPMLPMRLF 274

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + Y+P Y Q V GDSAT SG+  +P+++G++IASV SG
Sbjct: 275 RNPVFTVCSVLSFIVGFAMLGAMTYLPSYLQYVDGDSATVSGVRTLPMVIGLLIASVFSG 334

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T K  YR   + G+ ++ +G  L++L    +G   +  YM          MQ   
Sbjct: 335 NVVSKTGK--YRLFPIIGSLVMGVGLYLMSLMGPETGAWLESLYMFVLGTGIGLCMQVLT 392

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-----ENIAIP--- 412
           +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N L  N+     E  A+P   
Sbjct: 393 IAVQNTVDYADLGTATSGVTFFRTLGSSFGTAVFGTIYTNSLAPNLRQGIAEASAVPGAD 452

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           P +      S   ++ LP  +  P++ AY   L+  F   +P+  + F+ SLF+
Sbjct: 453 PAIVAQAATSPEGLHDLPSAVAAPIVDAYADTLQMVFLWTVPVAAIGFVVSLFL 506



>gi|284044744|ref|YP_003395084.1| EmrB/QacA subfamily drug resistance transporter [Conexibacter
           woesei DSM 14684]
 gi|502699428|ref|WP_012934760.1| DSBA oxidoreductase [Conexibacter woesei]
 gi|283948965|gb|ADB51709.1| drug resistance transporter, EmrB/QacA subfamily [Conexibacter
           woesei DSM 14684]
          Length = 666

 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 187/481 (38%), Positives = 261/481 (54%), Gaps = 12/481 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I  D   L+ I+WV TAYLL  TA  P YGK  D++GRK  F  A++ F 
Sbjct: 31  QTIVATALPTIVGDLGGLEHISWVTTAYLLASTASTPLYGKLGDLYGRKLVFQVAIVIFL 90

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG++ +M  +I+FRA+ G+GGGG++     II D+VS ++RG+YQ          
Sbjct: 91  IGSALCGMSQSMLELILFRALQGLGGGGLIVGAQAIIGDVVSPRERGRYQGLFGAVFGVT 150

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F +H+TWRW FY+NLP+GAI ++V   +L       S L+   RID++GT
Sbjct: 151 SVAGPLLGGFFVEHLTWRWIFYVNLPIGAIALVVIATVL-----PASALRARHRIDWLGT 205

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L L+ GG   PW SP               F L E + A EP+ P  LF
Sbjct: 206 ALMASGVSCLILFLSLGGTTQPWGSPQSVALGVAGLVLTVLFVLAERR-AEEPILPLRLF 264

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                       F  G A F  V ++PL+ QVV G SAT+SGL+L+P++LGV++ S+ SG
Sbjct: 265 SNRVFAVASAIGFIVGFALFGAVTFLPLFLQVVNGASATSSGLQLVPMMLGVLVTSIGSG 324

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +SRT +  YR   + G A++A+G  L++  D ++G   +   M          MQ  +
Sbjct: 325 QIISRTGR--YRLFPIVGTAVMAVGFVLLSRMDASTGALQRSVSMLVLGLGLGMVMQVLV 382

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN---IAIPPELAG 417
           L  Q  V+Y+D+ + T+   FFR IG  FGVAI G IFSN L   + +      P     
Sbjct: 383 LAVQNAVDYRDLGTATSGATFFRSIGGSFGVAIFGAIFSNRLATTLADAFPNGPPGGGGS 442

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
                   + QLP  IR   + AY  AL+T F   +PI ++ F A  ++    P  RT +
Sbjct: 443 GEGVDPAAIQQLPPPIRSDFVDAYAQALQTVFLVAVPIALVGF-ALTWLLREVPLRRTVE 501

Query: 478 T 478
           T
Sbjct: 502 T 502



>gi|493419339|ref|WP_006375181.1| drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner)
           (DHA2) family protein [Streptomyces turgidiscabies]
 gi|440282052|gb|ELP69556.1| drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner)
           (DHA2) family protein [Streptomyces turgidiscabies Car8]
          Length = 696

 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 177/474 (37%), Positives = 257/474 (54%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 41  QTIVGTALPTIVSDLGGAEHMSWVVTSYLLAETVATVLVGKFGDLFGRKVVFQVSAIVFI 100

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NMT +I++RA+ GVG GG++   M +I+D++ L++RGKYQ          
Sbjct: 101 TGSFLCGLATNMTLLIVWRAMQGVGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVA 160

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P+  + V+ A     IP  K ++      IDY+G 
Sbjct: 161 TVIGPLLGGLFTDHLTWRWAFYVNVPIAILVVVAAA--RTIPVVKSAVRPV---IDYLGI 215

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
             V     AL+L  +WGGN+Y W S                F   E++ A EP+ P  LF
Sbjct: 216 AFVAVGASALILATSWGGNQYAWGSGVIIALFVGGAVSLGLFCWAESR-AAEPMLPMRLF 274

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + Y+P + Q V GDSAT SG+  +P++LG++IASV SG
Sbjct: 275 GNPVFTVCSILSFIVGFAMLGAMTYLPTFLQYVDGDSATVSGVRTLPMVLGLLIASVFSG 334

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS++ K  YR   + G A++ +G  L++L D ++       YM          MQ   
Sbjct: 335 NVVSKSGK--YRYFPVVGLAVMGLGLYLLSLMDASTSTWLASLYMFVLGTGIGLGMQVLT 392

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-ENIAIPPELAGAV 419
           +  Q  VEY D+ + T+ + FFR +G+ FG A+ GT+++N LT N+ E IA       A 
Sbjct: 393 IAVQNTVEYADLGTATSGVTFFRTLGSSFGTAVFGTLYTNSLTPNLTEGIAEAARTGTAD 452

Query: 420 KASATV-------VNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           +A+ T        ++ LP     P+I AY   ++T F   +P+ ++ F+ +LF+
Sbjct: 453 QAAITSAATSPAGLHHLPARAAEPIIGAYADTIQTVFLWTVPVALIGFVVALFL 506



>gi|497730551|ref|WP_010044735.1| MFS transporter [Streptomyces chartreusis]
          Length = 692

 Score =  300 bits (768), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 185/486 (38%), Positives = 259/486 (53%), Gaps = 22/486 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    D ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 40  QTIVGTALPTIVSDLGGADHMSWVVTSYLLAETVATVLVGKFGDLFGRKVVFQVSAIVFI 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NM+ +I +RA+ G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 100 TGSFLCGLATNMSLLIAWRAMQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGVS 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR--IDYI 178
               PLLGG FTDH+TWRW+FY+N+P     V+VA     IP     +++ + R  IDY+
Sbjct: 160 TVIGPLLGGLFTDHLTWRWAFYVNVP--IAIVVVAAAARTIP-----VVKAVSRPVIDYL 212

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           G  +V     AL+L  +WGGNEY W S                F  VET+ A EP+ P  
Sbjct: 213 GIALVAVGASALILATSWGGNEYAWGSGVIIALFVGGVTALGLFCWVETR-AREPMLPMR 271

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           LF       C   +F  G A    + Y+P Y Q V GDSAT SG+  +P++ G++IASV 
Sbjct: 272 LFGNPVFTVCSVLSFIVGFAMLGALTYLPTYLQYVDGDSATVSGVRTLPMVAGLLIASVF 331

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SG  VSRT +  YR   + GA ++  G  L++L   ++G   +  YM          MQ 
Sbjct: 332 SGGVVSRTGR--YRIFPIVGALVMGAGLFLMSLMGPDTGAWLESLYMFVMGTGIGLCMQV 389

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-ENI-------A 410
             +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ E +        
Sbjct: 390 LTIAVQNTVDYADLGTATSGVTFFRTLGSSFGTAVFGTIYTNALAPNLREGVTLAARTGG 449

Query: 411 IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           + P +      S   V+QLP     P+I AY   L+T F   +P+  L FL +LF+   +
Sbjct: 450 VEPGVVARAATSPDGVHQLPPATAAPIIDAYADTLQTVFLWTVPVAALGFLVALFLKQVR 509

Query: 471 PSLRTT 476
             LR T
Sbjct: 510 --LRDT 513



>gi|345003323|ref|YP_004806177.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces sp.
           SirexAA-E]
 gi|503815592|ref|WP_014049586.1| MFS transporter [Streptomyces sp. SirexAA-E]
 gi|344318949|gb|AEN13637.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces sp.
           SirexAA-E]
          Length = 691

 Score =  299 bits (766), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 185/488 (37%), Positives = 260/488 (53%), Gaps = 19/488 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV TAYLL  T      GKF D+FGRK  F  + + F 
Sbjct: 43  QTIVGTALPTIVSDLGGAEHMSWVVTAYLLAETVATVLVGKFGDLFGRKLIFQISAVIFI 102

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +II+R + GVG GG++   M +I+D++ L+DRGKYQ          
Sbjct: 103 TGSFLCGLASDMLLLIIWRGVQGVGAGGLMVTAMALIADVIPLRDRGKYQGAIGAVFGVA 162

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P+  + V+ A   +   R  G  +     IDY+G 
Sbjct: 163 TVVGPLLGGLFTDHLTWRWAFYVNVPIAIVVVVAAARTIPSVRAAGRPV-----IDYLGI 217

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W SP               F +VET+ A EP+ P  LF
Sbjct: 218 ALVAVGASALILGTSWGGNEYAWGSPMIIGLFIGGVVALALFCVVETR-AKEPMLPMRLF 276

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + Y+P Y Q V GDSAT SG+  +PL++G++ AS+ SG
Sbjct: 277 RNPVFAVCSILSFIVGFAMLGAMIYLPTYLQYVDGDSATLSGVRTLPLVIGLLAASIFSG 336

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T    YR   + G+ ++A G  L++    +SG   +  +M          MQ   
Sbjct: 337 NVVSKTGH--YRLFPVVGSLVMAGGLFLLSRMGPDSGIWRESLFMLVLGIGIGLSMQVLT 394

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNN----IENIA----IP 412
           +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N L  N    IE  A     P
Sbjct: 395 IAVQNTVDYADLGTATSGVTFFRTLGSSFGTAVFGTIYANALRPNLAQGIEQAARAGGDP 454

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK-- 470
             LA A + S   V+ LP E   P+  AY   L T F   +P+ ++ F+ SLF+   K  
Sbjct: 455 ARLAAAAE-SPQAVHALPAEQTAPLAQAYADTLHTVFLWTVPVALIGFVVSLFLKQVKLR 513

Query: 471 PSLRTTDT 478
            S R + T
Sbjct: 514 DSARASST 521



>gi|494631190|ref|WP_007389134.1| MFS transporter [Streptomyces coelicoflavus]
 gi|371551213|gb|EHN78536.1| membrane transporter [Streptomyces coelicoflavus ZG0656]
          Length = 706

 Score =  298 bits (764), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 172/474 (36%), Positives = 254/474 (53%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV T+YLL  T      GKF D+FGRK  F  + + F 
Sbjct: 41  QTIVGTALPTIVSDLGGAEHMSWVVTSYLLAETVATVLVGKFGDLFGRKVVFQVSAVVFI 100

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NM  +I++RA+ GVG GG++   M +I+D++ L++RGKYQ          
Sbjct: 101 TGSFLCGLATNMPLLIVWRAVQGVGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVA 160

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW+FY+N+P+  + VI A   + + +     +     IDY+G 
Sbjct: 161 TVIGPLLGGLFTDHLSWRWAFYVNVPIAVVVVIAAARTIPVVKSAARPV-----IDYLGI 215

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W S                F  VET+ A +P+ P  LF
Sbjct: 216 ALVAVGASALILATSWGGNEYAWGSAVIVGLFAGGLLALGLFCWVETR-AAQPMLPMRLF 274

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + Y+P Y Q V GDSAT SG+  +P++ G++IASV SG
Sbjct: 275 SNPVFTVCSVLSFIVGFAMLGALTYLPTYLQYVDGDSATVSGVRTLPMVAGLLIASVFSG 334

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  ++ +G  L++L   ++G   +  YM          MQ   
Sbjct: 335 NVVSKTGR--YRLFPIVGTLVMGVGLYLMSLMGASTGAGLESLYMFVLGTGIGLSMQVLT 392

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAIP 412
           +  Q  VEY D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ +         A  
Sbjct: 393 IAVQNTVEYSDLGTATSGVTFFRTLGSSFGTAVFGTIYANTLGPNLRDGVAAAARTGAAD 452

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           P + G    S   V++LP     P++ AY   ++T F   +P+ +L F+ +LF+
Sbjct: 453 PSVIGRAATSPEGVHRLPPRASAPIVGAYADTIQTVFLWTVPVAVLGFVVALFL 506



>gi|406701111|gb|EKD04265.1| tetracycline efflux protein [Trichosporon asahii var. asahii CBS
           8904]
          Length = 753

 Score =  297 bits (760), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 182/485 (37%), Positives = 264/485 (54%), Gaps = 4/485 (0%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP +   F      +WV TAY+LT TA QP YG+ SDIFGRK+  L ++I F 
Sbjct: 153 QTIVATALPTLGRIFNQASIASWVGTAYMLTSTALQPVYGRLSDIFGRKSVLLGSLIIFL 212

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GSL C LA  M  +IIFRAI G+GGGGIL+L MIIISD+VSL+DRGKYQ          
Sbjct: 213 FGSLACALAQTMIQLIIFRAIQGLGGGGILTLAMIIISDVVSLKDRGKYQGITGGVVAVA 272

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P+LGG FT+ VTWRW FYINLPL  + ++V  F L + R +GS++ KLK++DY+G+
Sbjct: 273 NSVGPILGGIFTEKVTWRWCFYINLPLTGLAIVVVFFFLPLKRVQGSMVAKLKKLDYLGS 332

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            + +   + +L+ ++WGG EY W+S                F +VE KL   P+ P ++F
Sbjct: 333 ALTLAWAVLVLIAISWGGVEYSWTSAAVLAPLIIGIVLLIVFIVVEAKLMTLPLIPMYIF 392

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K   V     T F  G AF++ +YY+P YFQVV+ +S   SG++++PL    V  S  SG
Sbjct: 393 KDRTVAASMATTFANGCAFYATLYYLPQYFQVVRQESPVQSGVDMLPLTFVQVFFSFLSG 452

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T  + +    M G  +  IG G+++    ++ +A    Y            QT+L
Sbjct: 453 FLVSKTGDYKWNL--MAGFFIWTIGLGVMSSVGPDTSKAKIYGYQVLIAVGAGQTFQTSL 510

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V  KD+A+ T    F R++G    +A+   I +NV+T+ +        L  +V 
Sbjct: 511 IAIQASVARKDMATATGCRNFLRMLGGTVSLAVCAAIINNVVTSELTGKGFQRSLIDSVL 570

Query: 421 ASATVVNQLPIEIR--GPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTDT 478
              T ++ LP++      V +AY   +   F   +P+  L F+ ++F        R  D 
Sbjct: 571 KDPTELHDLPLDAAQLDAVRAAYSRGINACFWFCVPMAGLSFIITVFFIRRVSLKREDDA 630

Query: 479 VVAFE 483
            +  E
Sbjct: 631 KLKEE 635



>gi|491333368|ref|WP_005191329.1| MFS transporter [Gordonia amarae]
 gi|358238469|dbj|GAB07095.1| putative drug resistance protein [Gordonia amarae NBRC 15530]
          Length = 725

 Score =  297 bits (760), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 169/468 (36%), Positives = 261/468 (55%), Gaps = 11/468 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TIV+TALP I  D      ++WV T+YLL  T      GKF D++GRKA F+ A++ F 
Sbjct: 78  STIVSTALPTIVGDLGGGGHMSWVVTSYLLAQTVSTVLAGKFGDLYGRKAIFISAIVVFI 137

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS  CGLA NM  +II RA+ G+GGG I      +I+D++ L+DRGKYQ          
Sbjct: 138 VGSFFCGLAGNMAWLIIARAVQGIGGGAITVTATALIADVIPLRDRGKYQGALGAVFGVT 197

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLK-RIDYIG 179
               PLLGG FTDH++WRW+FYIN+P+  I + +A  L  IP     + ++++ +IDY+G
Sbjct: 198 TVIGPLLGGLFTDHLSWRWAFYINVPIALIVIPLA--LKTIP----GISERIQSKIDYLG 251

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
            I V    +A+ L L+WGG+EY W S                F   E + A EP+ P HL
Sbjct: 252 IIFVSLGAVAVTLGLSWGGSEYDWGSVQIIGLFVGSAVSFVIFVFAERR-AAEPILPMHL 310

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F +     C   +F  G A    + ++P + Q V+G SAT SGL ++P+++G++I S+ +
Sbjct: 311 FAKRVFTICSILSFIVGFAMMGAMTFLPTFLQYVQGTSATDSGLRMLPMVIGLLITSILA 370

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  V +T +  Y+   + G+A+IA+G  L++L DEN+       Y+          MQ  
Sbjct: 371 GGYVGKTGQ--YKMFPIAGSAVIALGLFLLSLMDENTSILVTSLYIFIIGLGIGLTMQVL 428

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV 419
            L  Q    Y D+ + T+ + FFR +G  FG +++GT++SN L++++    +  +L    
Sbjct: 429 TLVVQNTASYADLGTATSAVTFFRTLGMSFGASVMGTLYSNKLSSDLPGAIMSAKLTDPA 488

Query: 420 KASATV-VNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            A++ V +++LP   + P+I AY  AL   F   +P+ IL  L ++FM
Sbjct: 489 AATSPVSLHKLPDAQKAPIIHAYADALHNVFLWVVPVAILALLLAVFM 536



>gi|21225257|ref|NP_631036.1| membrane transport protein [Streptomyces coelicolor A3(2)]
 gi|499341659|ref|WP_011031345.1| membrane transport protein [Streptomyces lividans]
 gi|7649556|emb|CAB89031.1| putative membrane transport protein [Streptomyces coelicolor A3(2)]
 gi|509522564|gb|EOY51877.1| Multidrug resistance protein B [Streptomyces lividans 1326]
          Length = 714

 Score =  296 bits (759), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 173/474 (36%), Positives = 252/474 (53%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV T+YLL  T      GKF D+FGRK  F  + + F 
Sbjct: 49  QTIVGTALPTIVSDLGGAEHMSWVVTSYLLAETVATVLVGKFGDLFGRKVVFQVSAVVFI 108

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NM  +I++RA+ GVG GG++   M +I+D++ L++RGKYQ          
Sbjct: 109 TGSFLCGLATNMPLLILWRAVQGVGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVA 168

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW+FY+N+P+  + VI A   + + +     +     IDY+G 
Sbjct: 169 TVIGPLLGGLFTDHLSWRWAFYVNVPIAVVVVIAAARTIPVVKSAARPV-----IDYLGI 223

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W S                F  VET+ A EP+ P  LF
Sbjct: 224 ALVAVGASALILATSWGGNEYAWGSAVIIGLFAGGLIALGLFCWVETR-AAEPMLPMRLF 282

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + Y+P Y Q V GDSAT SG+  +P++ G++IASV SG
Sbjct: 283 ANPVFTVCSILSFIVGFAMLGALTYLPTYLQYVDGDSATVSGVRTLPMVAGLLIASVFSG 342

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  ++ +G  L++L   ++G   +  YM          MQ   
Sbjct: 343 NVVSKTGR--YRLFPIAGTLVMGVGLYLMSLMGPDTGAGLESLYMFVLGTGIGLSMQVLT 400

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAIP 412
           +  Q  VEY D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ +         A  
Sbjct: 401 IAVQNTVEYSDLGTATSGVTFFRTLGSSFGTAVFGTIYANALGPNLRDGVAAAARTGAAD 460

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           P +      S   V++LP     P++ AY   ++T F   +P+  L FL +LF+
Sbjct: 461 PSVIAGASTSPEGVHRLPPPASAPIVGAYADTIQTVFLWTVPVAALGFLVALFL 514



>gi|490070000|ref|WP_003972175.1| MFS transporter [Streptomyces lividans]
 gi|289697812|gb|EFD65241.1| membrane transporter [Streptomyces lividans TK24]
          Length = 706

 Score =  296 bits (759), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 173/474 (36%), Positives = 252/474 (53%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV T+YLL  T      GKF D+FGRK  F  + + F 
Sbjct: 41  QTIVGTALPTIVSDLGGAEHMSWVVTSYLLAETVATVLVGKFGDLFGRKVVFQVSAVVFI 100

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NM  +I++RA+ GVG GG++   M +I+D++ L++RGKYQ          
Sbjct: 101 TGSFLCGLATNMPLLILWRAVQGVGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVA 160

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW+FY+N+P+  + VI A   + + +     +     IDY+G 
Sbjct: 161 TVIGPLLGGLFTDHLSWRWAFYVNVPIAVVVVIAAARTIPVVKSAARPV-----IDYLGI 215

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W S                F  VET+ A EP+ P  LF
Sbjct: 216 ALVAVGASALILATSWGGNEYAWGSAVIIGLFAGGLIALGLFCWVETR-AAEPMLPMRLF 274

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + Y+P Y Q V GDSAT SG+  +P++ G++IASV SG
Sbjct: 275 ANPVFTVCSILSFIVGFAMLGALTYLPTYLQYVDGDSATVSGVRTLPMVAGLLIASVFSG 334

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  ++ +G  L++L   ++G   +  YM          MQ   
Sbjct: 335 NVVSKTGR--YRLFPIAGTLVMGVGLYLMSLMGPDTGAGLESLYMFVLGTGIGLSMQVLT 392

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAIP 412
           +  Q  VEY D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ +         A  
Sbjct: 393 IAVQNTVEYSDLGTATSGVTFFRTLGSSFGTAVFGTIYANALGPNLRDGVAAAARTGAAD 452

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           P +      S   V++LP     P++ AY   ++T F   +P+  L FL +LF+
Sbjct: 453 PSVIAGASTSPEGVHRLPPPASAPIVGAYADTIQTVFLWTVPVAALGFLVALFL 506



>gi|357409964|ref|YP_004921700.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           flavogriseus ATCC 33331]
 gi|503918864|ref|WP_014152858.1| MFS transporter [Streptomyces flavogriseus]
 gi|320007333|gb|ADW02183.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces
           flavogriseus ATCC 33331]
          Length = 691

 Score =  296 bits (758), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 187/488 (38%), Positives = 258/488 (52%), Gaps = 19/488 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV TAYLL  T      GKF D+FGRK  F  + + F 
Sbjct: 43  QTIVGTALPTIVSDLGGAEHMSWVVTAYLLAETVATVLVGKFGDLFGRKLIFQISAVIFI 102

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NM  +II+R + G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 103 TGSFLCGLASNMLLLIIWRGLQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGVA 162

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P+  + V+ A   +   R  G  +     IDY G 
Sbjct: 163 TVVGPLLGGLFTDHLTWRWAFYVNVPIAIVVVVAAARTIPSVRAAGRPV-----IDYPGI 217

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V   + AL+L  +WGGNEY W SP               F LVET+ A EP+ P  LF
Sbjct: 218 GLVAVGSGALILGTSWGGNEYAWGSPVIIGLFVGGLIALALFCLVETR-AKEPMLPMRLF 276

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + Y+P Y Q V GDSAT SG+  +PL++G++ AS+ SG
Sbjct: 277 RGPVFAVCSILSFIVGFAMLGAMIYLPTYLQYVDGDSATLSGVRTLPLVIGLLAASIFSG 336

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VSRT    YR   + G+ ++A G  L++     SG   +  YM          MQ   
Sbjct: 337 NVVSRTGH--YRFFPVIGSLVMAAGLYLLSRMGPGSGVWLESLYMLVLGIGIGLSMQVLT 394

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNV----LTNNIENIAI----P 412
           +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N     LT  +E  A     P
Sbjct: 395 IAVQNTVDYADLGTATSGVTFFRTLGSSFGTAVFGTIYANALRPNLTQGVEQAARAGGDP 454

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK-- 470
             LA  V  S   V+ LP E   P+  AY   L T F   +P+ +L F+ SLF+   K  
Sbjct: 455 ASLA-RVAESPQAVHALPPEQTAPLAQAYADTLHTVFLWTVPVALLGFVVSLFLKQVKLR 513

Query: 471 PSLRTTDT 478
            S R + T
Sbjct: 514 DSARASST 521



>gi|401881897|gb|EJT46178.1| tetracycline efflux protein [Trichosporon asahii var. asahii CBS
           2479]
          Length = 753

 Score =  296 bits (758), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 182/479 (37%), Positives = 265/479 (55%), Gaps = 5/479 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP +   F      +WV TAY+LT TA QP YG+ SDIFGRK+  L ++I F 
Sbjct: 153 QTIVATALPTLGRIFNQASIASWVGTAYMLTSTALQPVYGRLSDIFGRKSVLLGSLIIFL 212

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GSL C LA  M  +IIFRAI G+GGGGIL+L MIIISD+VSL+DRGKYQ          
Sbjct: 213 FGSLACALAQTMIQLIIFRAIQGLGGGGILTLAMIIISDVVSLKDRGKYQGITGGVVAVA 272

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P+LGG FT+ VTWRW FYINLPL  + ++V  F L + R +GS++ KLK++DY+G+
Sbjct: 273 NSVGPILGGIFTEKVTWRWCFYINLPLTGLAIVVVFFFLPLKRVQGSMVAKLKKLDYLGS 332

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            + +   + +L+ ++WGG EY W+S                F +VE KL   P+ P ++F
Sbjct: 333 ALTLAWAVLVLIAISWGGVEYSWTSAAVLAPLIIGIVLLIVFIVVEAKLMTLPLIPMYIF 392

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K   V     T F  G AF++ +YY+P YFQVV+ +S   SG++++PL    V  S  SG
Sbjct: 393 KDRTVAASMATTFANGCAFYATLYYLPQYFQVVRQESPVQSGVDMLPLTFVQVFFSFLSG 452

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T  + +    M G  +  IG G+++    ++ +A    Y            QT+L
Sbjct: 453 FLVSKTGDYKWNL--MAGFFIWTIGLGVMSSVGPDTSKAKIYGYQVLIAVGAGQTFQTSL 510

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V  KD+A+ T    F R++G    +A+   I +NV+T+ +        L  +V 
Sbjct: 511 IAIQASVARKDMATATGCRNFLRMLGGTVSLAVCAAIINNVVTSELTGKGFQRSLIDSVL 570

Query: 421 ASATVVNQLPIEIR--GPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
              T ++ LP++      V +AY   +   F   +P+  L F+ ++F    + SL+  D
Sbjct: 571 KDPTELHDLPLDAAQLDAVRAAYSRGINACFWFCVPMAGLSFIITVFF-IRRVSLKRED 628



>gi|494478069|ref|WP_007267546.1| MFS transporter [Streptomyces sp. C]
 gi|302446805|gb|EFL18621.1| membrane transporter [Streptomyces sp. C]
          Length = 696

 Score =  296 bits (758), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 179/474 (37%), Positives = 251/474 (52%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I +D      +AWV TAYLL  T      GKF D+FGRK  F  + + F 
Sbjct: 49  QTIVGTALPTIVADLGGAAHMAWVVTAYLLAETVATVLVGKFGDLFGRKIIFQISAVVFI 108

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NMT +I++R + G+G GG++   M +I+D+V L++RGKYQ          
Sbjct: 109 TGSFLCGLAGNMTLLILWRGLQGIGAGGLMVTSMALIADVVPLRERGKYQGAIGAVFGVA 168

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW+FY+N+P+  + V  A   +   R  G  +     IDY+G 
Sbjct: 169 TVIGPLLGGLFTDHLSWRWAFYVNVPVAVVVVAAAARTIPSVRAVGRPV-----IDYLGI 223

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY WSSP               F L ET+ A EP+ P  LF
Sbjct: 224 ALVAAGASALILATSWGGNEYAWSSPVIIGLFAGGALALALFCLAETR-AAEPMLPMRLF 282

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +PL++G++IASV SG
Sbjct: 283 RNPVFTVCSVLSFVVGFAMLGAMTFLPTYLQYVDGDSATLSGVRTLPLVIGLLIASVFSG 342

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
            A S+T +  YR   + G A++  G  L++L    +G   +  YM          MQ   
Sbjct: 343 NATSKTGR--YRIYPIVGCAVMGAGLYLLSLMGPGTGAWLESAYMFVLGAGIGLCMQVLT 400

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIE--------NIAIP 412
           +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GT+++N L   +E             
Sbjct: 401 IAVQNTVDYADLGTATSGVTFFRTLGSSFGTAVFGTLYANSLEPELEAGVAEAARATGTD 460

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           P   GA   S   V+ L     GPVI AY  AL T F   +P+  + F+ +LF+
Sbjct: 461 PARIGAAAQSPQGVHGLDPAASGPVIDAYADALHTVFLWTVPVAAVGFVVALFL 514



>gi|479323001|ref|YP_007863052.1| multidrug resistance protein B [Streptomyces sp. PAMC26508]
 gi|505392520|ref|WP_015579622.1| multidrug resistance protein B [Streptomyces sp. PAMC26508]
 gi|478749988|gb|AGJ58568.1| multidrug resistance protein B [Streptomyces sp. PAMC26508]
          Length = 691

 Score =  296 bits (758), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 187/488 (38%), Positives = 258/488 (52%), Gaps = 19/488 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV TAYLL  T      GKF D+FGRK  F  + + F 
Sbjct: 43  QTIVGTALPTIVSDLGGAEHMSWVVTAYLLAETVATVLVGKFGDLFGRKLIFQISAVIFI 102

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NM  +II+R + G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 103 TGSFLCGLASNMLLLIIWRGLQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGVA 162

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P+  + V+ A   +   R  G  +     IDY G 
Sbjct: 163 TVVGPLLGGLFTDHLTWRWAFYVNVPIAIVVVVAAARTIPSVRAAGRPV-----IDYPGI 217

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V   + AL+L  +WGGNEY W SP               F LVET+ A EP+ P  LF
Sbjct: 218 GLVAVGSGALILGTSWGGNEYAWGSPVIIGLFVGGLIALALFCLVETR-AKEPMLPMRLF 276

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + Y+P Y Q V GDSAT SG+  +PL++G++ AS+ SG
Sbjct: 277 RGPVFAVCSILSFIVGFAMLGAMIYLPTYLQYVDGDSATLSGVRTLPLVIGLLAASIFSG 336

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VSRT    YR   + G+ ++A G  L++     SG   +  YM          MQ   
Sbjct: 337 NVVSRTGH--YRFFPVIGSLVMAAGLYLLSRMGPGSGVWLESLYMLVLGIGIGLSMQVLT 394

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNV----LTNNIENIAI----P 412
           +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N     LT  +E  A     P
Sbjct: 395 IAVQNTVDYADLGTATSGVTFFRTLGSSFGTAVFGTIYANALRPNLTQGVEQAARAGGDP 454

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK-- 470
             LA  V  S   V+ LP E   P+  AY   L T F   +P+ +L F+ SLF+   K  
Sbjct: 455 ASLA-RVAESPLAVHALPPEQTAPLAQAYADTLHTVFLWTVPVALLGFVVSLFLKQVKLR 513

Query: 471 PSLRTTDT 478
            S R + T
Sbjct: 514 DSARASST 521



>gi|514329979|gb|EPH42858.1| putative MFS-type transporter [Streptomyces aurantiacus JA 4570]
          Length = 701

 Score =  296 bits (757), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 170/474 (35%), Positives = 251/474 (52%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV TAYLL  T      GKF D+FGRK  F  + + F 
Sbjct: 41  QTIVGTALPTIVSDLGGAEHMSWVVTAYLLAETVATVLVGKFGDLFGRKIVFQVSAVVFI 100

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGL+ NMT +I +RA+ G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 101 TGSFLCGLSTNMTLLIAWRALQGIGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVS 160

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P+  + V+ A   + + R     +     IDY G 
Sbjct: 161 TVIGPLLGGLFTDHLTWRWAFYVNVPIAILVVVAAARTIPVVRSASRPV-----IDYAGI 215

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGN+Y W S                F  VET+ A EP+ P  LF
Sbjct: 216 ALVAVGASALILATSWGGNQYAWGSGIIIGLFVGGLLALAAFCWVETR-AAEPMLPMRLF 274

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + ++P Y Q V GDSAT SG+  +P++ G+++ASV SG
Sbjct: 275 ANPVFTVCSILSFIVGFAMLGAMTFLPTYLQYVDGDSATISGVRTLPMVFGLLVASVFSG 334

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+     YR   + G+ ++A+G  L++L    +    +  YM          MQ  +
Sbjct: 335 NVVSKGG--GYRIFPIAGSLVMALGLYLLSLMGRATNTWLESLYMGVLGVGIGLSMQVLV 392

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAIP 412
           +  Q  V Y D+ + T+ + FFR +GA FG A+ GTI++N L +N+ +         A P
Sbjct: 393 IAVQNTVAYADLGTATSGVTFFRTLGASFGTAVFGTIYANTLASNLRDGVAEAARTGAAP 452

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            +       S   ++ LP E   P+I+AY   L+T F   +P+ +  F+ +LF+
Sbjct: 453 QDTIAKAAQSPQGLHDLPDEAAAPLITAYADTLQTVFLWTVPVALAGFVVALFL 506



>gi|66810832|ref|XP_639123.1| major facilitator superfamily protein [Dictyostelium discoideum AX4]
 gi|29500764|gb|AAO75105.1| ComD [Dictyostelium discoideum]
 gi|60467752|gb|EAL65769.1| major facilitator superfamily protein [Dictyostelium discoideum AX4]
          Length = 1175

 Score =  295 bits (756), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 189/483 (39%), Positives = 271/483 (56%), Gaps = 14/483 (2%)

Query: 2    TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
            TIVATALPAI +D   L+++ WV T YLLT T+  P +GKFSDIFG+K   L ++I F I
Sbjct: 619  TIVATALPAIVADLHGLEQLPWVVTIYLLTSTSVSPLFGKFSDIFGKKILLLSSLIIFLI 678

Query: 62   GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
            GSLLC +A  M  +I+ RAI G+GGGG++S VMI++++IV L+DRGKYQ           
Sbjct: 679  GSLLCAVATTMNMLILARAIQGIGGGGLMSAVMIVMAEIVPLRDRGKYQGLLGAVYAVSS 738

Query: 122  XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTI 181
               PL+GG FTD++TWRW+F+INLPLGA+  +V  F L+IP+      + +K++D +G++
Sbjct: 739  VVGPLMGGTFTDNITWRWAFWINLPLGAVAFVVVFFALKIPQKVIPWREGIKKVDVLGSL 798

Query: 182  VVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETK--LAIEPVAPPHL 239
             +V +TI+ LL LNWGG +YPW+SP               F +V  K    + P+ P  L
Sbjct: 799  SLVAATISFLLALNWGGIDYPWTSPIIICLFIGTALFVALF-IVNEKYWFNVHPIIPLDL 857

Query: 240  FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
            FK  + V C   +F  G   F ++YY+PLYFQ V+G +AT SGL+L+P +LG+V+    S
Sbjct: 858  FKTRNYVLCSIGSFLLGFVMFGVIYYIPLYFQYVRGATATASGLQLLPTMLGIVLFGAIS 917

Query: 300  GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
            G  ++R     Y++  + G   + IG  LI+LW+  S +   I Y           MQ  
Sbjct: 918  GLLITRFGH--YKSYPIIGMGFMMIGIYLISLWNHQSTQNEFIGYQCFIGVGIGLTMQIL 975

Query: 360  LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPE--LAG 417
            +L  Q  V    ++  TA + FFR IG V  V++   I +   + N+  +       L G
Sbjct: 976  VLIVQNSVNVIYISISTATVSFFRTIGGVVSVSVFSAILNQQFSQNLNGLLEKDAFVLGG 1035

Query: 418  AVKASATVVNQLPIE---IRGPVISAYVGALRTAFTADIPI-GILCFLASLFMGNHKPSL 473
                +  + N   IE    +  +  AY  AL   F +  P  G+ C L  LF+ N K  L
Sbjct: 1036 MSPHNFNMENIKHIENPIHQQQIRDAYQSALSIVFLSAAPFAGLGCILI-LFVKNQK--L 1092

Query: 474  RTT 476
            RTT
Sbjct: 1093 RTT 1095



>gi|497964375|ref|WP_010278531.1| MFS transporter [Streptomyces sp. SA3_actG]
          Length = 696

 Score =  295 bits (756), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 257/479 (53%), Gaps = 18/479 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I +D    + ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 25  QTIVGTALPTIVADLGGGEHMSWVVTSYLLAETVSTVLVGKFGDLFGRKVVFQVSAIVFI 84

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +I++RA+ G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 85  TGSFLCGLASDMLLLIMWRALQGIGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVS 144

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FTDH+TWRW+FY+N+P+  + VI A       R   S+   +K  IDY+G
Sbjct: 145 TVVGPLLGGVFTDHLTWRWAFYVNVPIAIVVVIAAA------RTIPSVRSGVKPVIDYLG 198

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
             +V     AL+L  +WGGN+Y W S                F LVET+ A +P+ P  L
Sbjct: 199 IALVAIGASALILATSWGGNQYAWGSGVVIGLFAAGVAGLGLFCLVETR-ARQPMLPMRL 257

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+      C   +F  G A    + ++P Y Q V GDSAT SG+  +P+++G++IAS+ S
Sbjct: 258 FRNPVFGVCAILSFVVGFAMLGALTFLPTYLQYVDGDSATISGVRTLPMVIGLLIASIFS 317

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  VS+T    YR   + G  ++ +G  L++  D +SG   +  YM          MQ  
Sbjct: 318 GNVVSKTGH--YRIFPIVGTLVMGVGLFLLSRMDNHSGAWRESLYMFVLGVGIGLSMQVL 375

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAI 411
            +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N LT  +            +
Sbjct: 376 TIAVQNTVDYSDLGAATSGVTFFRTLGSSFGTAVFGTIYANALTPRLRTGVGEGARAAGL 435

Query: 412 PPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
            P +      S   V++LP   R P++ AY  +L+T F   +P+ +  FL +LF+   K
Sbjct: 436 DPAVVARGAGSPDGVHRLPAAARAPIVHAYAESLQTVFLWTVPVAVFGFLVALFLKQVK 494



>gi|392579294|gb|EIW72421.1| hypothetical protein TREMEDRAFT_26105 [Tremella mesenterica DSM
           1558]
          Length = 699

 Score =  295 bits (755), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 175/483 (36%), Positives = 261/483 (54%), Gaps = 8/483 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP +   F   D  +WV TAYLLT T+ QP YG+ SDIFGRK   L +   F 
Sbjct: 100 QTIVTTALPTLGRVFNRADITSWVGTAYLLTSTSMQPIYGRLSDIFGRKVVLLGSCAIFL 159

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS+ C ++ +M  +I+FRAI G+GGGGIL+LVMII+SD+VSL++RGKYQ          
Sbjct: 160 IGSIACAVSNSMIQLIVFRAIQGIGGGGILTLVMIIVSDVVSLKERGKYQGVTGCIVACS 219

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P++GG FT+ VTWRW FYIN+P+    ++V   LL +   KGS+ +KL+++D+ G+
Sbjct: 220 NAIGPVVGGLFTEKVTWRWCFYINIPVTVFAMVVITILLPLKPVKGSVFEKLRKVDWFGS 279

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           I+ +   + +LL L+W GN+Y WSS                F  VE KL   P+ P H+F
Sbjct: 280 ILTIAWAVLVLLGLSWAGNQYSWSSAAVLAPLILGLALLGVFIFVEMKLVPLPLIPFHIF 339

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +   V     T +F GM FF  +YY+P YFQVV+GDSA  SG+ ++P++L   + S ++G
Sbjct: 340 RNRTVAAALLTTWFNGMIFFGTLYYLPNYFQVVRGDSAIRSGVLILPVVLTQTVCSFTAG 399

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
              SRT  + Y  ++  G  +  IG GL++  DE +  A  + +            QT+L
Sbjct: 400 MIQSRTGDYYYNLVA--GFGIWTIGIGLLSSIDETTSTAKIVIFGLIDGIGAGQTFQTSL 457

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V+  ++A+ T    F R++G   G+ +   + +N++  N+ N     E    + 
Sbjct: 458 VAIQAAVQRSEMATATGCRNFVRMLGGTIGLTVCSALVNNIVRQNLNNGGFDAETIRKIL 517

Query: 421 ASATVVNQLPIEI--RGPVISAYVGALRTAFTAD----IPIGILCFLASLFMGNHKPSLR 474
              T +  + ++   +   I+AY   +  A  A     IP   L F   +F     P  R
Sbjct: 518 NDPTQIGGIGLDAVHKSRAIAAYSDKIAKAINACFWYFIPCAGLSFFIVIFFVEQIPLKR 577

Query: 475 TTD 477
             D
Sbjct: 578 PDD 580



>gi|478686811|ref|YP_007743621.1| Multidrug resistance protein B [Streptomyces albus J1074]
 gi|490049781|ref|WP_003952135.1| MFS transporter [Streptomyces albus]
 gi|291358360|gb|EFE85262.1| membrane transporter [Streptomyces albus J1074]
 gi|477542665|gb|AGI86618.1| Multidrug resistance protein B [Streptomyces albus J1074]
          Length = 694

 Score =  295 bits (755), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 174/474 (36%), Positives = 252/474 (53%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I ++      ++WV T+YLL  T      GKF D+FGRK  F  + + F 
Sbjct: 40  QTIVGTALPTIVAELGGASHMSWVVTSYLLAETVATVLVGKFGDLFGRKVVFQISAVVFI 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +I +RA+ GVG GG++   M +I+D++ L++RGKYQ          
Sbjct: 100 TGSFLCGLATDMLLLITWRAVQGVGAGGLMVTAMALIADVIPLRERGKYQGAMGAVFGVS 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P     V+V      IP  + +   K   IDY+G 
Sbjct: 160 TVVGPLLGGLFTDHLTWRWAFYVNVP--IAIVVVIAAARTIPAVRAAHKPK---IDYLGI 214

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L   WGGNEY W SP               F LVET+ A EP+ P  LF
Sbjct: 215 ALVAVGASALILATAWGGNEYAWGSPVIIGLFAGGLVALAFFCLVETR-AREPMLPMRLF 273

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +P+++ ++ ASV SG
Sbjct: 274 RNPVFSVCAVLSFIVGFAMLGALTFLPTYLQYVDGDSATFSGVRTLPMVVALLAASVLSG 333

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             V RT +  YR   + G+ ++A+G  L++  D ++    +  YM          MQ   
Sbjct: 334 TVVGRTGR--YRIFPVVGSLVMALGLFLLSRMDADTSDWLESLYMVVLGAGIGLSMQVLT 391

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI+++ L  N++        AG V 
Sbjct: 392 IVVQNTVDYADLGTATSGVTFFRTLGSAFGTAVFGTIYASALGPNLDEGVRSAAAAGGVD 451

Query: 421 ASATV--------VNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            +A          V+ LP   RGPV+ AY   L T F   +P+ +L F+ +LF+
Sbjct: 452 PAALAQAARSPQGVHGLPGTARGPVVEAYAETLHTVFLWTVPVALLGFVVALFL 505



>gi|117165255|emb|CAJ88816.1| putative membrane transport protein [Streptomyces ambofaciens ATCC
           23877]
          Length = 692

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 177/476 (37%), Positives = 260/476 (54%), Gaps = 20/476 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 41  QTIVGTALPTIVSDLGGGEHMSWVVTSYLLAETVATVLVGKFGDMFGRKVVFQVSAIVFI 100

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +II+RA+ GVG GG++   M +I+D++ L++RGKYQ          
Sbjct: 101 TGSFLCGLATSMPLLIIWRAMQGVGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGVA 160

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIG- 179
               PLLGG FTDH++WRW+FY+N+P+  + VI A   + + +     +     +DY+G 
Sbjct: 161 TVIGPLLGGLFTDHLSWRWAFYVNVPIAVVVVIAAARTIPVVKSAARPV-----VDYLGI 215

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
           T+V VG++ AL+L  +WGGNEY W S                F   ET+ A EP+ P  L
Sbjct: 216 TLVAVGAS-ALILATSWGGNEYAWGSVVIIGLFAGGLVALGLFCWAETR-AAEPMLPMRL 273

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F       C   +F  G A    + Y+P Y Q V GDSAT SG+  +P++ G++IASV S
Sbjct: 274 FDNPVFTVCSVLSFIVGFAMLGALTYLPTYLQYVDGDSATVSGVRTLPMVAGLLIASVFS 333

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  VSRT +  YR   + G  ++ +G  L++L   ++G   +  +M          MQ  
Sbjct: 334 GSVVSRTGR--YRLFPLVGTLVMGVGLYLMSLMGPSTGAGLESLFMFVLGTGIGLSMQVL 391

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN---------IA 410
            +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ +          A
Sbjct: 392 TIAVQNTVDYSDLGTATSGVTFFRTLGSSFGTAVFGTIYANALGPNLRDGVSDATRTGAA 451

Query: 411 IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            P  ++GA   S   V++LP E   P++ AY   ++T F   +P+  L FL +LF+
Sbjct: 452 DPAVISGAAT-SPEGVHRLPAEASAPIVGAYADTIQTVFLWTVPVAALGFLVALFL 506



>gi|496361049|ref|WP_009070225.1| MFS transporter [Streptomyces sp. SPB78]
 gi|302431974|gb|EFL03790.1| membrane transporter [Streptomyces sp. SPB78]
          Length = 711

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 257/479 (53%), Gaps = 18/479 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I +D    + ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 40  QTIVGTALPTIVADLGGGEHMSWVVTSYLLAETVSTVLVGKFGDLFGRKVVFQVSAIVFI 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +I++RA+ G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 100 TGSFLCGLASDMLLLIMWRALQGIGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVS 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FTDH+TWRW+FY+N+P+  + VI A       R   S+   +K  IDY+G
Sbjct: 160 TVVGPLLGGVFTDHLTWRWAFYVNVPIAIVVVIAAA------RTIPSVRSGVKPVIDYLG 213

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
             +V     AL+L  +WGGN+Y W S                F LVET+ A +P+ P  L
Sbjct: 214 IALVAIGASALILATSWGGNQYAWGSGVVIGLFAAGVAGLGLFCLVETR-ARQPMLPMRL 272

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+      C   +F  G A    + ++P Y Q V GDSAT SG+  +P+++G++IAS+ S
Sbjct: 273 FRNPVFGVCAILSFVVGFAMLGALTFLPTYLQYVDGDSATISGVRTLPMVIGLLIASIFS 332

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  VS+T    YR   + G  ++ +G  L++  D +SG   +  YM          MQ  
Sbjct: 333 GNVVSKTGH--YRIFPIVGTLVMGVGLFLLSRMDNHSGAWRESLYMFVLGVGIGLSMQVL 390

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAI 411
            +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N LT  +            +
Sbjct: 391 TIAVQNTVDYSDLGAATSGVTFFRTLGSSFGTAVFGTIYANALTPRLRTGVGEGARAAGL 450

Query: 412 PPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
            P +      S   V++LP   R P++ AY  +L+T F   +P+ +  FL +LF+   K
Sbjct: 451 DPAVVARGAGSPDDVHRLPAAARAPIVHAYAESLQTVFLWTVPVAVFGFLVALFLKQVK 509



>gi|498326389|ref|WP_010640545.1| MFS transporter [Streptomyces sp. S4]
          Length = 694

 Score =  295 bits (754), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 174/474 (36%), Positives = 252/474 (53%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I ++      ++WV T+YLL  T      GKF D+FGRK  F  + + F 
Sbjct: 40  QTIVGTALPTIVAELGGASHMSWVVTSYLLAETVATVLVGKFGDLFGRKVVFQISAVVFI 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +I +RA+ GVG GG++   M +I+D++ L++RGKYQ          
Sbjct: 100 TGSFLCGLATDMLLLITWRAVQGVGAGGLMVTAMALIADVIPLRERGKYQGAMGAVFGVS 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P     V+V      IP  + +   K   IDY+G 
Sbjct: 160 TVVGPLLGGLFTDHLTWRWAFYVNVP--IAVVVVIAAARTIPAVRAAHKPK---IDYLGI 214

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L   WGGNEY W SP               F LVET+ A EP+ P  LF
Sbjct: 215 ALVAVGASALILATAWGGNEYAWGSPVIIGLFAGGLVALAFFCLVETR-AWEPMLPMRLF 273

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +P+++ ++ ASV SG
Sbjct: 274 RNPVFSVCAVLSFIVGFAMLGALTFLPTYLQYVDGDSATFSGVRTLPMVVALLAASVLSG 333

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             V RT +  YR   + G+ ++A+G  L++  D ++    +  YM          MQ   
Sbjct: 334 TVVGRTGR--YRIFPVVGSLVMALGLFLLSRMDADTSDWLESLYMVVLGAGIGLSMQVLT 391

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI+++ L  N++        AG V 
Sbjct: 392 IVVQNTVDYADLGTATSGVTFFRTLGSAFGTAVFGTIYASALGPNLDEGVRSAAAAGGVD 451

Query: 421 ASATV--------VNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            +A          V+ LP   RGPV+ AY   L T F   +P+ +L F+ +LF+
Sbjct: 452 PAALAQAARSPQGVHGLPGTARGPVVEAYAETLHTVFLWTVPVALLGFVVALFL 505



>gi|321253947|ref|XP_003192908.1| tetracycline efflux protein [Cryptococcus gattii WM276]
 gi|317459377|gb|ADV21121.1| tetracycline efflux protein, putative [Cryptococcus gattii WM276]
          Length = 643

 Score =  295 bits (754), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 167/409 (40%), Positives = 238/409 (58%), Gaps = 2/409 (0%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP +   F   D   WV TAYLLT TA QP YG+ SDIFGRK T L  +  F 
Sbjct: 114 QTIVTTALPTLGQVFGRADISPWVGTAYLLTSTATQPIYGRLSDIFGRKFTLLGCLFIFL 173

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL C LA  M  +IIFRAI G+GGGGIL+L MIIISD+VSL++RGKYQ          
Sbjct: 174 MGSLACALAQTMIQLIIFRAIQGLGGGGILTLAMIIISDVVSLKERGKYQGITGCVVALA 233

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P++GGAFT+  +WRW FYINLPL +I++I+ +FLL + R +GS++ K+K++D+ G+
Sbjct: 234 NSCGPIVGGAFTERASWRWCFYINLPLTSISMIIIVFLLPLRRVRGSMIAKIKKLDFYGS 293

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           I+ +      L+ L+W G++YPW S                F  VE K+   P+ P H+F
Sbjct: 294 ILTLAWAAPFLIALSWAGSQYPWDSAAVLVPLLVGLALLGVFIFVEAKMVSLPLVPMHIF 353

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K + V  CF T F  G++F++ +YY+P YFQ+V+G SA  SG+  +PL+L   + S +SG
Sbjct: 354 KNISVCACFFTTFMNGLSFYATLYYLPQYFQIVRGASAIRSGVLTLPLMLVQTVTSFTSG 413

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
              S+T  + +  ++  G  +  IG GL++     +  A    Y            QT+L
Sbjct: 414 YVQSKTGDYWWNLVA--GFTIWTIGLGLLSSITPTTSIAKLSGYQVIVGVGAGQTFQTSL 471

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI 409
           +  Q  VE KD+A+ T L  F R +G    +A   +I +N +  N+  +
Sbjct: 472 IAIQASVERKDMATATGLRNFLRQMGGTIALAACNSIVNNCVRRNLSGV 520



>gi|328854822|gb|EGG03952.1| hypothetical protein MELLADRAFT_72481 [Melampsora larici-populina
           98AG31]
          Length = 631

 Score =  295 bits (754), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 186/510 (36%), Positives = 271/510 (53%), Gaps = 37/510 (7%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI++ ALP IAS F ALD+I W+A+AYL+T  +F   Y +    + R+  F+ A+  FE
Sbjct: 122 QTILSPALPVIASSFDALDQIGWIASAYLITQVSFLLLYAQLLVTYNRRWIFVAAIFIFE 181

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+C ++PN+ ++II RA++G+G  GIL   + II+DI  LQDR K            
Sbjct: 182 LGSLICAVSPNLISLIIGRAVSGLGAAGILISCLSIIADITELQDRPKLLGSFGAVFATS 241

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPR----------------- 163
               PLLGGA TD ++WRW F+INLP GAITV+ +IFLL IP                  
Sbjct: 242 SVVGPLLGGALTDRLSWRWCFWINLPCGAITVL-SIFLL-IPNTPSPPLSEKLLELVDHR 299

Query: 164 -----------PKGSLLQKLKRIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXX 212
                      P  S+L KL  +D++G  ++VG  I L+LPL WGGN+YPW S       
Sbjct: 300 WNSITFGKWVPPHHSVLHKLGSLDFVGAFLMVGLIILLVLPLQWGGNKYPWDSGVVIGTL 359

Query: 213 XXXXXXXXXFGLVETKLAIEP----VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPL 268
                    F L E K         + P  LF+    VG     FF  ++  S+VY++P+
Sbjct: 360 CGFGVMLTAFLLWEWKGVDAKNGRGLLPFRLFRSRTQVGACLQAFFIKLSMLSVVYFLPI 419

Query: 269 YFQVVKGDSATTSGLELIPLILGVVIASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGL 328
           YFQVV+  SAT SG++LIPL+L +V  S  +G A+S T  + +  LS+ G+ ++ IG+ L
Sbjct: 420 YFQVVQHASATKSGIDLIPLMLSIVFCSGLAGFAISHTGYY-WPALSV-GSVILTIGTAL 477

Query: 329 ITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAV 388
           +   DE +  A  I +           +Q   +  Q  VE KD+   T+L  F +LIG V
Sbjct: 478 LYTLDEYASNAKVIGFQILVGGGLGFILQNVTVAIQANVEDKDIPQATSLSSFSQLIGGV 537

Query: 389 FGVAIVGTIFSNVLTNNIENIAIPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTA 448
            G+A+  TIF+N L+ N+E  A P   A  +++S   + QL   ++  VI AY  +L+  
Sbjct: 538 IGIAVAQTIFNNALSVNLEKYA-PDAPAALIRSSLEEIGQLRDSLKPGVIHAYTESLKQV 596

Query: 449 FTADIPIGILCFLASLFMGNHKPSLRTTDT 478
           +   I  G+ CF A+  + +     R   T
Sbjct: 597 YILGIVCGVACFFAAFLVKSKNIKKRKNQT 626



>gi|495094823|ref|WP_007819646.1| MFS transporter [Streptomyces sp. Tu6071]
 gi|332742955|gb|EGJ73396.1| putative membrane transport protein [Streptomyces sp. Tu6071]
          Length = 711

 Score =  295 bits (754), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 257/479 (53%), Gaps = 18/479 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I +D    + ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 40  QTIVGTALPTIVADLGGGEHMSWVVTSYLLAETVSTVLVGKFGDLFGRKVVFQVSAIVFI 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +I++RA+ G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 100 TGSFLCGLASDMLLLIMWRALQGIGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVS 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FTDH+TWRW+FY+N+P+  + VI A       R   S+   +K  IDY+G
Sbjct: 160 TVVGPLLGGVFTDHLTWRWAFYVNVPIAIVVVIAAA------RTIPSVRSGVKPVIDYLG 213

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
             +V     AL+L  +WGGN+Y W S                F LVET+ A +P+ P  L
Sbjct: 214 IALVAIGASALILATSWGGNQYAWGSGVVIGLFAAGVAGLGLFCLVETR-ARQPMLPMRL 272

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+      C   +F  G A    + ++P Y Q V GDSAT SG+  +P+++G++IAS+ S
Sbjct: 273 FRNPVFGVCAILSFVVGFAMLGALTFLPTYLQYVDGDSATISGVRTLPMVIGLLIASIFS 332

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  VS+T    YR   + G  ++ +G  L++  D +SG   +  YM          MQ  
Sbjct: 333 GNVVSKTGH--YRIFPIVGTLVMGVGLFLLSRMDNHSGAWRESLYMFVLGVGIGLSMQVL 390

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAI 411
            +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N LT  +            +
Sbjct: 391 TIAVQNTVDYSDLGAATSGVTFFRTLGSSFGTAVFGTIYANALTPRLRTGVGEGARAAGL 450

Query: 412 PPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
            P +      S   V++LP   R P++ AY  +L+T F   +P+ +  FL +LF+   K
Sbjct: 451 DPAVVARGAGSPDGVHRLPAAARAPIVHAYAESLQTVFLWTVPVAVFGFLVALFLKQVK 509



>gi|512490098|ref|WP_016431227.1| drug:H+ antiporter-2 (14 Spanner) (DHA2) family drug resistance MFS
           transporter [Streptomyces sp. HGB0020]
 gi|512067623|gb|EPD66996.1| drug:H+ antiporter-2 (14 Spanner) (DHA2) family drug resistance MFS
           transporter [Streptomyces sp. HGB0020]
          Length = 693

 Score =  295 bits (754), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 176/474 (37%), Positives = 252/474 (53%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD    + ++WV TAYLL  T      GKF D+FGRK  F  + + F 
Sbjct: 42  QTIVGTALPTIVSDLGGAEHMSWVVTAYLLAETVSTVLVGKFGDLFGRKVVFQVSAVVFI 101

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NM+ +I +RA+ G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 102 TGSFLCGLATNMSLLIAWRAMQGIGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVA 161

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FYIN+P     V+VA     IP  K +       IDY+G 
Sbjct: 162 TVVGPLLGGVFTDHLTWRWAFYINVP--IAIVVVAAAARTIPVVKSA---SRPVIDYLGI 216

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     A++L  +WGGNEY W S                F  VET+ A EP+ P  LF
Sbjct: 217 ALVAVGASAVILATSWGGNEYAWGSGVIIGLFAGGALALGLFCWVETR-ASEPMLPMRLF 275

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + Y+P Y Q V GDSAT SG+  +P+++G++IASV SG
Sbjct: 276 SNPVFTVCSILSFIVGFAMLGAMTYLPSYLQYVDGDSATISGVRTLPMVVGLLIASVFSG 335

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G+ ++ +G  L++L    +G   +  YM          MQ   
Sbjct: 336 NVVSKTGQ--YRYFPVAGSLVMGLGLYLMSLMGPQTGAWLESLYMFVLGTGIGLCMQVLT 393

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAIP 412
           +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ +          + 
Sbjct: 394 IAVQNTVDYADLGTATSGVTFFRTLGSSFGTAVFGTIYTNALKPNLSDGIAAAARGGGVD 453

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           P        S   V++LP  +  P+I AY   L+T F   +P+  + F+ SLF+
Sbjct: 454 PGTLARAATSPEGVHRLPPGVAAPIIDAYADTLQTVFLWTVPVAAVGFVVSLFL 507



>gi|498042542|ref|WP_010356698.1| MFS transporter [Streptomyces acidiscabies]
          Length = 687

 Score =  294 bits (752), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 176/476 (36%), Positives = 255/476 (53%), Gaps = 20/476 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD      ++WV TAYLL  T      GKF D+FGRK  F  + I F 
Sbjct: 40  QTIVGTALPTIVSDLGGASHMSWVVTAYLLAETVATVLVGKFGDLFGRKVVFQVSAIVFI 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NM  +I +RA+ G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 100 TGSFLCGLATNMPLLIAWRAVQGIGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVA 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR--IDYI 178
               PLLGG FTDH+TWRW+FY+N+P     V+V      IP     +++ + R  IDY+
Sbjct: 160 TVIGPLLGGLFTDHLTWRWAFYVNVP--IAIVVVIAAARTIP-----VVKSVSRPVIDYL 212

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           G   V     AL+L  +WGGNEY W S                F   ET+ A EP+ P  
Sbjct: 213 GIAWVALGASALILATSWGGNEYAWGSGVIVGLFVGGVIALGLFCWTETR-AAEPMLPMR 271

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           LF+      C   +F  G A    + Y+P Y Q V GDSAT SG+  +P++LG++IAS+ 
Sbjct: 272 LFRNPVFTVCSVLSFIVGFAMLGAMTYLPSYLQYVDGDSATVSGVRTLPMVLGLLIASIG 331

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SG  +S+T +  YR   + G+ ++ +G  L++     +G   +  YM          MQ 
Sbjct: 332 SGNVISQTGR--YRVFPIIGSLVMGLGLFLMSRMGPGTGAWLESLYMFVLGFGIGLCMQV 389

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN------IAIP 412
             +  Q  VEY D+ + T+ + FFR +G+ FG A+ GTI++N LT N+ +          
Sbjct: 390 LTIAVQNTVEYADLGTATSGVTFFRTLGSSFGTAVFGTIYTNALTPNLRDGIREAAATGT 449

Query: 413 PELAGAVKASATV--VNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            ++A   KA+++   V++LP    GP+I AY   ++T F   +P+  L FL +L +
Sbjct: 450 ADVASLAKAASSPDGVHRLPARAAGPIIGAYADTIQTVFLWTVPVAALGFLVALLL 505



>gi|408682109|ref|YP_006881936.1| Multidrug resistance protein B [Streptomyces venezuelae ATCC 10712]
 gi|504850470|ref|WP_015037572.1| MFS transporter [Streptomyces venezuelae]
 gi|328886438|emb|CCA59677.1| Multidrug resistance protein B [Streptomyces venezuelae ATCC 10712]
          Length = 703

 Score =  292 bits (748), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 172/478 (35%), Positives = 249/478 (52%), Gaps = 21/478 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD      ++WV T+YLL  T      GKF D+FGRK  F  + + F 
Sbjct: 42  QTIVGTALPTIVSDLGGAAHMSWVVTSYLLAETVATVLVGKFGDLFGRKVIFQISAVVFI 101

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA NMT +I++R + G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 102 TGSFLCGLATNMTLLIVWRGLQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGVS 161

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FTDH+TWRW+FY+N+P+  + VI A       R   SL    K  IDY G
Sbjct: 162 TVIGPLLGGLFTDHLTWRWAFYVNVPIAILVVIAA------ARTIPSLRSASKPVIDYAG 215

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
             +V   + AL+L  +WGGNEY W S                F  VET+ A EP+ P  L
Sbjct: 216 IALVAAGSSALILATSWGGNEYAWGSGVIIGLFAGGIVALALFCWVETR-AAEPMLPMRL 274

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F       C   +F  G A    + ++P Y Q V GDSAT SG+  +P+++G++IAS+ S
Sbjct: 275 FGNPVFTVCSVLSFVVGFAMLGAMTFLPTYLQYVDGDSATVSGIRTLPMVIGLLIASIFS 334

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  VS+T    YR   + G  ++ +G  L++L    +       YM          MQ  
Sbjct: 335 GNVVSKTGH--YRIFPILGCLVMGLGLYLLSLMGPETSAWLASLYMFVLGVGIGLCMQVL 392

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIE-----------N 408
            +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI+ N LT N++           +
Sbjct: 393 TIAVQNTVDYADLGTATSGVTFFRTLGSSFGTAVFGTIYVNSLTPNLKTGVAEASAVAGS 452

Query: 409 IAIPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
             + P        S   V+ LP ++  P+++AY   L T F   +P+  + F+ +LF+
Sbjct: 453 QGLDPAAVARAAQSPDGVHGLPEQVAEPIVNAYADTLHTVFLWTVPVAAVGFVVALFL 510



>gi|121701463|ref|XP_001268996.1| MFS toxin efflux pump (AflT), putative [Aspergillus clavatus NRRL
           1]
 gi|119397139|gb|EAW07570.1| MFS toxin efflux pump (AflT), putative [Aspergillus clavatus NRRL
           1]
          Length = 548

 Score =  292 bits (747), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 177/492 (35%), Positives = 265/492 (53%), Gaps = 23/492 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+  A+P I   FK+++ IAW  +AY LT TA QP+YG+   IF  K  FL AV+ FE
Sbjct: 56  QTIIGVAIPKITDQFKSIEDIAWYGSAYFLTSTALQPSYGRIYKIFSVKWGFLIAVLIFE 115

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C +AP+ T +I+ RA+AG+G  GI S  M+IIS  V L  R              
Sbjct: 116 IGSLICAVAPSSTVLIVGRAVAGIGVAGIFSGAMVIISVTVPLPKRPLVFGMFGMVWGIA 175

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKG----SLLQKLKRID 176
               PLLGGAFTD ++WRW FYINLP+G +++ V +F+LR+P         ++ +++++D
Sbjct: 176 SIAGPLLGGAFTDGISWRWCFYINLPIGGVSLAVILFILRLPENTEFSGTPIMHRIQQLD 235

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IG  +++ S I LLL L WGGN+YPWS+                F   + K+  +   P
Sbjct: 236 LIGASLLIPSIICLLLALQWGGNKYPWSNSRIIGLFIGFGLMAILFAFSQVKMGDKATLP 295

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P +F    V+       F G AFF LVYY+P++FQ VKG SA  SG++L+PL+L  V++S
Sbjct: 296 PRMFTNRTVLAATLYALFFGGAFFLLVYYLPIFFQSVKGSSAMKSGIQLLPLMLATVVSS 355

Query: 297 VSSGQAVSRTDKFAYRTLSMTGA-ALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           V+ G  V+      Y T  + G+ A+ AIG+GLIT++  +      I Y           
Sbjct: 356 VAIGGLVTAV---GYYTPFLIGSTAIAAIGAGLITMYAVDISDGKWIGYQILLGAGVGAG 412

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL 415
            Q  +   Q ++  +D+   TA +MFF+ +G    +A+  ++F N L + I   A   + 
Sbjct: 413 FQIPMTAVQTVLSAEDIPLGTAAVMFFQTLGGALFIAVGQSVFQNGLISGIGKYAPSVDP 472

Query: 416 AGAVKASATVVNQLPIEIRGP------VISAYVGALRTAFTADIPIGILCFLASLFM--- 466
              VKA AT V  + +++ G       VI+AY+  LR ++   + + ++ F  SL M   
Sbjct: 473 VEIVKAGATEVRHV-LDVLGKTDQLDGVINAYMSGLRDSYRVSLALTVVAFAVSLLMEWK 531

Query: 467 -----GNHKPSL 473
                GN K  +
Sbjct: 532 SVKAAGNEKKEM 543



>gi|402224289|gb|EJU04352.1| MFS general substrate transporter [Dacryopinax sp. DJM-731 SS1]
          Length = 673

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 181/480 (37%), Positives = 265/480 (55%), Gaps = 7/480 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TA+P IA+DF +  +  WV T+YL+T T FQP YG+ SDIFGRK   LF +  F 
Sbjct: 141 QTIVSTAIPQIANDFNSGQQAEWVGTSYLVTSTVFQPIYGRVSDIFGRKFVLLFTLAVFL 200

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS+LC +A +M  +I FRA+ G+GGGGI++LVMII+SD+V+++DRGKYQ          
Sbjct: 201 IGSILCAIAQSMIQLIAFRAVTGIGGGGIITLVMIIVSDVVAMKDRGKYQGIIGGIVALG 260

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P++GG FT   TWRW F++ +PL  + ++V IFLL + R KG +  KLK++DY+GT
Sbjct: 261 NSIGPVIGGTFTTKATWRWCFWLGVPLAGVAIVVVIFLLPLRRVKGDMKTKLKQVDYVGT 320

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           ++ +  T+ +LLPL+WGG  +PW+S                F +VE K A  P  P  +F
Sbjct: 321 VLSLMGTMGILLPLSWGGTSFPWNSAAVIAPLILGAFFIGCFVIVEWKFAKIPNIPLEIF 380

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +   V G     F  G AF+  +YY+P YFQVVKG ++  SG +L+PLI+   + S SSG
Sbjct: 381 RNKTVCGVQIATFLSGCAFYVQLYYLPQYFQVVKGVTSLQSGTQLLPLIVVQTVFSFSSG 440

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS + K  YR     G A+ ++G GL++    +S  A Q+ Y+           QTTL
Sbjct: 441 LIVSLSGK--YRANIYLGFAIWSVGLGLLSTLSLHSTEAQQVGYLILTGVGAGQTFQTTL 498

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V    +A VT    F R++G    +A+   I +N +   + N     +L   + 
Sbjct: 499 IAAQAAVPRNQMAVVTGTRNFVRMLGGTVALAVCQAILNNTVKTGLLNAGFAQDLVDTIT 558

Query: 421 ASATVVNQL---PIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
           +S T    L   P +I   V + +   ++  F    P  ++ F  S  M     SL+  D
Sbjct: 559 SSPTTYTSLSLTPAQIL-IVQNTFSNGVQNVFRFCFPCAVVAFFVSALMIEQH-SLKRGD 616



>gi|495684726|ref|WP_008409305.1| MFS transporter [Streptomyces sp. SM8]
 gi|406690340|gb|EKC94154.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces sp.
           SM8]
          Length = 694

 Score =  291 bits (746), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 173/474 (36%), Positives = 251/474 (52%), Gaps = 16/474 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I ++      ++WV T+YLL  T      GKF D+FGRK  F  + + F 
Sbjct: 40  QTIVGTALPTIVAELGGASHMSWVVTSYLLAETVATVLVGKFGDLFGRKVVFQISAVVFI 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +I +RA+ GVG GG++   M +I+D++ L++RGKYQ          
Sbjct: 100 TGSFLCGLATDMLLLITWRAVQGVGAGGLMVTAMALIADVIPLRERGKYQGAMGAVFGVS 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P     V+V      IP  + +   K   IDY+G 
Sbjct: 160 TVVGPLLGGLFTDHLTWRWAFYVNVP--IAIVVVIAAARTIPAVRAAHKPK---IDYLGI 214

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L   WGGNEY W SP               F  VET+ A EP+ P  LF
Sbjct: 215 ALVAVGASALILATAWGGNEYAWGSPVIIGLFAGGLVALAFFCRVETR-AREPMLPMRLF 273

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +P+++ ++ ASV SG
Sbjct: 274 RNPVFSVCAVLSFIVGFAMLGALTFLPTYLQYVDGDSATFSGVRTLPMVVALLAASVLSG 333

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             V RT +  YR   + G+ ++A+G  L++  D ++    +  YM          MQ   
Sbjct: 334 TVVGRTGR--YRIFPVVGSLVMALGLFLLSGMDADTSDWLESLYMVVLGAGIGLSMQVLT 391

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI+++ L  N++        AG V 
Sbjct: 392 IVVQNTVDYADLGTATSGVTFFRTLGSAFGTAVFGTIYASALGPNLDEGVRSAAAAGGVD 451

Query: 421 ASATV--------VNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            +A          V+ LP   RGPV+ AY   L T F   +P+ +L F+ +LF+
Sbjct: 452 PAALAQAARSPQGVHGLPGTARGPVVEAYAETLHTVFLWTVPVALLGFVVALFL 505



>gi|494718897|ref|WP_007454763.1| MFS transporter [Streptomyces sp. W007]
 gi|364005369|gb|EHM26450.1| major facilitator superfamily permease [Streptomyces sp. W007]
          Length = 697

 Score =  291 bits (744), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 177/478 (37%), Positives = 254/478 (53%), Gaps = 17/478 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD      ++WV TAYLL  T      GKF D+FGRK  F  + I F 
Sbjct: 44  QTIVGTALPTIVSDLGGAAHMSWVVTAYLLAETVATVLVGKFGDLFGRKLVFQVSAIIFI 103

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +II+R + G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 104 TGSFLCGLASDMLLLIIWRGMQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGIS 163

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P     V+V      IP  K +       IDY G 
Sbjct: 164 TVIGPLLGGLFTDHLTWRWAFYVNVP--IAIVVVIAAARNIPSVKAA---GRPVIDYSGI 218

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W SP               F +VET+ A EP+ P  LF
Sbjct: 219 ALVTVGASALILATSWGGNEYAWGSPMIIGLFVGGLIALALFCVVETR-AKEPMLPMRLF 277

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +PL++G+++AS+ SG
Sbjct: 278 RNPVFTVCSILSFIVGFAMLGSMIFLPTYLQYVDGDSATLSGVRTLPLVVGLLVASIFSG 337

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  ++A G  L++     +G   +  YM          MQ   
Sbjct: 338 NVVSKTGR--YRVFPIVGTLVMAAGLFLLSRMGPGTGVWLESLYMVVLGLGIGLAMQVLT 395

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-ENIA-------IP 412
           +  Q  V+Y+D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ + +A        P
Sbjct: 396 IAVQNTVDYEDLGTATSGVTFFRTLGSAFGTAVFGTIYANALKPNLTDGVARAVAAGGDP 455

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
             LAGA + S   ++ LP     P+  AY   L T F   +P+ ++ F+ +LF+   K
Sbjct: 456 AALAGASQ-SPQALHALPAAQSEPLAQAYADTLHTVFLWTVPVALIGFVVALFLKEVK 512



>gi|345566551|gb|EGX49494.1| hypothetical protein AOL_s00078g527 [Arthrobotrys oligospora ATCC
           24927]
          Length = 582

 Score =  290 bits (741), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 178/477 (37%), Positives = 272/477 (57%), Gaps = 15/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+ATA+P I   FK++D I W  +AY LT TA QPT+G+   IF  K TFL A+  FE
Sbjct: 81  QTIIATAIPKITDRFKSIDDIGWYGSAYFLTSTALQPTFGRIYKIFSIKGTFLVAIFLFE 140

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+APN T++II RAIAG+G GGI S  ++I++ ++ L+ R              
Sbjct: 141 VGSLVCGIAPNSTSLIIGRAIAGLGVGGIFSGGIVILAYVLPLEKRPLAFASIASMWGIA 200

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPR---PKG-SLLQKLKRID 176
               PLLGGAFTDHV+WRW FYINLPLG I+V V + +L+IPR   P+G ++L++++++D
Sbjct: 201 SIVGPLLGGAFTDHVSWRWCFYINLPLGVISVAVVLLVLKIPREANPEGLTVLERVRQLD 260

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IG  +++ + ++LLL L WGG  YPW++                F   + KL      P
Sbjct: 261 LIGAAILIPAVVSLLLALQWGGVTYPWNNAKIIGLFVCFGGLIIIFIFSQWKLGEAATLP 320

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  V+       F G AFF  VYY+P+YFQ VKG SAT SG++++P++L  V++S
Sbjct: 321 PRILKQRTVLSSLIFACFFGAAFFVDVYYLPIYFQSVKGSSATKSGIQVLPILLSCVLSS 380

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALI-AIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           + SG  ++      Y T  + G  L+ A+G+GLIT +D ++  A  I Y           
Sbjct: 381 IVSGGLIT---ALGYYTPFLIGGMLLYAVGAGLITTFDVDTKSAHWIGYQVIAGLGVGVG 437

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI--AIPP 413
            Q  +L  Q ++   D+   TA++ FF+ +G    +++   IFSN L   +E     +P 
Sbjct: 438 FQVPILAVQTVLHIDDIPVGTAIITFFQSLGGALFISVGQNIFSNGLKEGLERYIPEVPS 497

Query: 414 E---LAGAVKASATVVNQLPIEIRGP-VISAYVGALRTAFTADIPIGILCFLASLFM 466
               L+GA +    V+  L ++ R P V  +Y+  L+  +  D+ +    F+A+ F+
Sbjct: 498 SVFLLSGATEIK-DVLASLGLQDRLPDVRKSYMVGLKDTYRLDVALACCAFVAACFL 553



>gi|497297315|ref|WP_009611532.1| multidrug MFS transporter [actinobacterium SCGC AAA027-L06]
 gi|402915748|gb|EJX36692.1| arabinose efflux permease family protein [actinobacterium SCGC
           AAA027-L06]
          Length = 544

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 182/490 (37%), Positives = 259/490 (52%), Gaps = 28/490 (5%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TAL  I  DF  L+   WV TAYLLT TA  P YGK SD++GR+  F FA+ITF 
Sbjct: 44  QTIVSTALKNIVEDFNGLNHYTWVVTAYLLTSTASTPLYGKISDLYGRRPVFQFAIITFL 103

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS L G + NMT +I  RA+ G+G GG+++L  +II DIVS ++RGKYQ          
Sbjct: 104 IGSFLAGASQNMTQLIFTRALQGLGAGGLMALTFVIIGDIVSPRERGKYQGYFGAVWGLS 163

Query: 121 XXXXPLLGGAFTDHVT------WRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR 174
               PLLGG F+DH T      WRW FYINLP G + +I+   +L IP+ K     +  +
Sbjct: 164 SVAGPLLGGFFSDHATILGITGWRWIFYINLPFGILALIITSAVLHIPKVK-----REHK 218

Query: 175 IDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPV 234
           IDY G +++V +  A+LL ++  G E  W+                 F   E + A+EP+
Sbjct: 219 IDYFGALLLVLAVSAVLLAVSVYGPEDGWTDSKTVIVIGSGVFLTLAFIWQENR-AVEPI 277

Query: 235 APPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVI 294
            P  LFK           F  G   F  +  +PLY QVVKG+SAT +GL+LIPL++G+V 
Sbjct: 278 LPLRLFKNHTFSLTSALGFIIGAGMFGAIVMLPLYLQVVKGNSATEAGLKLIPLMIGIVS 337

Query: 295 ASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXX 354
            S+ SG+ +S T K  Y+   + G A++ IG  L+   DE++  A    Y          
Sbjct: 338 MSIFSGKKISVTGK--YKIFPILGTAIMTIGLLLMATLDEDTSFAVLSIYAVLVGAGLGL 395

Query: 355 XMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSN----VLTNNIENIA 410
            MQT ++  Q  V+++D+   T+   FFR +G  FG AI GTI SN     L +N   + 
Sbjct: 396 SMQTIVIALQNSVDFQDMGIATSSNTFFRSLGGAFGTAIFGTILSNRIAYYLQDNFAKLQ 455

Query: 411 I--PPELA-------GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFL 461
              P  L+         +  + +++  LP  IR  V+ ++    +  F A +PI  + FL
Sbjct: 456 STDPVSLSEFDTSKLELITTNTSIIPTLPPVIRDTVLHSFAQTFQVVFLAAVPITFIGFL 515

Query: 462 ASLFMGNHKP 471
            + F+   KP
Sbjct: 516 LAFFL-KEKP 524



>gi|374985580|ref|YP_004961075.1| transmembrane efflux protein [Streptomyces bingchenggensis BCW-1]
 gi|503941427|ref|WP_014175421.1| MFS transporter [Streptomyces bingchenggensis]
 gi|297156232|gb|ADI05944.1| transmembrane efflux protein [Streptomyces bingchenggensis BCW-1]
          Length = 820

 Score =  288 bits (738), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 172/488 (35%), Positives = 259/488 (53%), Gaps = 22/488 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP +  +   LDK++W  T+YLL  T   P YGK  D+ GRK  F+F++  F 
Sbjct: 68  QTIVATALPKVVGELHGLDKMSWAVTSYLLASTIVLPVYGKLGDLMGRKGVFIFSIAVFV 127

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G +  M  +I FRA+ GVG GG++  +  I++DIV  ++RG+Y           
Sbjct: 128 VGSALAGWSRTMDELIAFRAVQGVGAGGLMIGIQAIMADIVPPRERGRYMGLIAAAFGLA 187

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY+N+P G +T+ V    L++P+P      +  R DY+G 
Sbjct: 188 SVAGPLLGGFFTDHMSWRWCFYVNVPFGLVTLAVVTVALKLPKPT-----RRARFDYLGA 242

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  S+  L+L  +WGG EYPW S                F ++E+ +A+EP+ P  LF
Sbjct: 243 LLLAVSSTCLVLLTSWGGTEYPWKSRVILGLALGALGSAILFVVIES-VAVEPIIPLRLF 301

Query: 241 KRLHVVGCFT--TNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    V C T       G+A F    Y+P + Q+V G SAT SGL L+P++ G+V+ASV+
Sbjct: 302 R--DSVFCVTGVIGMVLGVALFGAASYLPTFLQMVDGASATESGLLLLPMMGGMVVASVA 359

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ +S T +  YR   + G  L AIG  L++  DE++ R     +M          M  
Sbjct: 360 SGQLISATGR--YRIYPIVGGVLSAIGMWLLSRMDEDTSRQDYSLWMGILGLGMGLVMPV 417

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVL---------TNNIENI 409
            +L  Q      D+ S T+   +FR +G   G A+ GT+F++ L         T + +  
Sbjct: 418 LVLAVQNSARPADIGSATSANNYFRQMGGSVGAAVFGTLFAHRLADRLAVELPTGSTDPG 477

Query: 410 AIPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNH 469
           A  P +      +  +V+ LP  +R   I+AY  A+   F   +P+ +L FL + F+   
Sbjct: 478 ASGPGIPDPESVTPQLVHSLPGPLRDGYIAAYADAMPRIFLYLVPVLVLGFLLA-FLLKE 536

Query: 470 KPSLRTTD 477
           KP +  TD
Sbjct: 537 KPLVSHTD 544



>gi|498040943|ref|WP_010355099.1| MFS transporter [Streptomyces acidiscabies]
          Length = 792

 Score =  287 bits (735), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 177/485 (36%), Positives = 252/485 (51%), Gaps = 20/485 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  TAYLLT T   P YGK  D+ GRK  F FA++ F 
Sbjct: 54  QMIVATALPKIVGELHGLDKMSWAITAYLLTATVGLPVYGKLGDLIGRKGVFQFAIVVFV 113

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS L G A  M  +I FRA+ GVG GG++  V  II+DIV  + RG+Y           
Sbjct: 114 IGSALAGRAQTMDQLIAFRAVQGVGAGGLMIGVQAIIADIVPPRQRGRYMGLIGAAFGLA 173

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY N+P G +T+ V   +L++PRPK        R D++GT
Sbjct: 174 SVAGPLLGGYFTDHLSWRWCFYFNVPFGLVTLAVVTAVLKLPRPKAR-----PRFDFLGT 228

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F L E + A EP+ P  LF
Sbjct: 229 LLLAAASTCLVLLTSWGGTEYAWGSRTILGLGAGAVAASLLFLLAEHR-AAEPLIPLRLF 287

Query: 241 KR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    +V G        G+A F    Y+P + Q+V G SAT SGL ++P++ G+V+ASV 
Sbjct: 288 RDSVFNVTGLI--GLVIGVALFGAASYLPTFLQMVDGASATESGLLMLPMMAGIVVASVV 345

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ +SRT +  Y+   + G AL A G  L++  + ++ R     +M          M  
Sbjct: 346 SGQLISRTGR--YKLYPLLGGALSAAGMWLLSRLETDTPRLHYSLWMAVLGAGIGLAMPV 403

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGA 418
            +L  Q  V   D+ + T+   +FR IG   G AI GT+F+N L + +      P  AG 
Sbjct: 404 LVLAVQNSVRPADLGTATSANNYFRQIGGSVGAAIFGTLFANRLADALRERV--PAHAGQ 461

Query: 419 VKASAT-----VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSL 473
               A      +V+ LP  +R   ISAY  A+   F   +P+ ++    + F+   KP +
Sbjct: 462 TPPDAESITPQLVHALPPALRDAYISAYADAMPRIFLYLVPVLLVGLFLAFFL-KEKPLV 520

Query: 474 RTTDT 478
              +T
Sbjct: 521 SHNET 525



>gi|70995754|ref|XP_752632.1| MFS toxin efflux pump (AflT) [Aspergillus fumigatus Af293]
 gi|66850267|gb|EAL90594.1| MFS toxin efflux pump (AflT), putative [Aspergillus fumigatus
           Af293]
 gi|159131385|gb|EDP56498.1| MFS toxin efflux pump (AflT), putative [Aspergillus fumigatus
           A1163]
          Length = 551

 Score =  286 bits (733), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 180/476 (37%), Positives = 267/476 (56%), Gaps = 13/476 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+  A+P I   FK+++ IAW  +AY LT TA QP+YG+   IF  K  FL AV+ FE
Sbjct: 58  QTIIGVAIPKITDQFKSIEDIAWYGSAYFLTSTALQPSYGRIYKIFSVKWAFLIAVLIFE 117

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C +AP+ T +I+ RAIAG+G  GI S  M+IIS  V L  R              
Sbjct: 118 IGSLICAVAPSSTVLIVGRAIAGIGVAGIFSGAMVIISVTVPLPKRPLVFGMFGMVWGIA 177

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK---GS-LLQKLKRID 176
               PLLGGAFTD V+WRW FYINLP+G +++ V +F+LR+P      GS +L++++++D
Sbjct: 178 SIAGPLLGGAFTDGVSWRWCFYINLPIGGVSLAVILFVLRLPDKNDFSGSPILERIQQLD 237

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IG  +++ + I LLL L WGGN+YPW++                F   + KLA +   P
Sbjct: 238 LIGAGLLIPAIICLLLALQWGGNKYPWNNSRIIGLFVGFGVMAILFAFSQVKLADKATLP 297

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P +FK   V+       F G AFF LVYY+P++FQ VK  SA  SG++L+PL+L  V++S
Sbjct: 298 PRMFKNRSVLAATLFALFFGGAFFVLVYYLPIFFQSVKDSSAMKSGIQLLPLMLATVVSS 357

Query: 297 VSSGQAVSRTDKFAYRTLSMTGA-ALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           +  G AV+      Y T  + G+ A+ AIG+GL+T+++ +      I Y           
Sbjct: 358 MVMGGAVTAA---GYYTPFLIGSTAIAAIGAGLVTMYEIDISTGKWIGYQIVLGAGVGAG 414

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL 415
            Q  +   Q ++  +D+   TA +MFF+ +G    +A+  ++F N L + +   A   + 
Sbjct: 415 FQIPMTAVQTVLPAEDIPIGTAAVMFFQTLGGALFIAVAQSVFQNGLISGLAKYAPTVDP 474

Query: 416 AGAVKASA----TVVNQL-PIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
              VKA A    TV+ QL  ++    VI AY+  LR ++   + + ++ FLASL M
Sbjct: 475 TAIVKAGATEMRTVLTQLGQLDQLMNVIKAYMDGLRASYRVSLALVLVAFLASLLM 530



>gi|488613878|ref|YP_007935214.1| Membrane transport protein [Streptomyces fulvissimus DSM 40593]
 gi|505425519|ref|WP_015612621.1| Membrane transport protein [Streptomyces fulvissimus]
 gi|485098146|gb|AGK81329.1| Membrane transport protein [Streptomyces fulvissimus DSM 40593]
          Length = 697

 Score =  286 bits (733), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 171/477 (35%), Positives = 247/477 (51%), Gaps = 15/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I S+    + ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 44  QTIVGTALPTIVSELGGAEHVSWVVTSYLLAETVATVLVGKFGDLFGRKLIFQISAIVFI 103

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +II+R + G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 104 TGSFLCGLASDMLLLIIWRGMQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGIS 163

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P     V+V      IP  K +       IDY G 
Sbjct: 164 TVIGPLLGGLFTDHLTWRWAFYVNVP--IAIVVVIAAARNIPSVKAA---GRPVIDYTGI 218

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W SP               F  VET+ A EP+ P  LF
Sbjct: 219 ALVAVGASALILATSWGGNEYAWGSPMIIGLFVAGIVALALFRRVETR-AKEPMLPMRLF 277

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +PL++G+++AS+ SG
Sbjct: 278 RNPVFTVCSILSFIVGFAMLGSMIFLPTYLQYVDGDSATLSGVRTLPLVVGLLVASIFSG 337

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  ++A G  L++     +G   +  YM          MQ   
Sbjct: 338 NVVSKTGR--YRIFPIVGTLVMAAGLFLLSRMGPGTGVWVESLYMVVLGLGIGLAMQVLT 395

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN-------IAIPP 413
           +  Q  VEY D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ +           P
Sbjct: 396 IAVQNTVEYADLGTATSGVTFFRTLGSAFGTAVFGTIYANALGPNLADGIGRAVAAGGDP 455

Query: 414 ELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
            +      S   ++ LP     P+  AY   L T F   +P+ ++ F+ +LF+   K
Sbjct: 456 AVLARASQSPQALHALPAAQAEPLAQAYAQTLHTVFLWTVPVALIGFVVALFLKEVK 512



>gi|42820667|emb|CAF31980.1| AflT-like major facilitator superfamily protein, putative
           [Aspergillus fumigatus]
          Length = 612

 Score =  286 bits (733), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 180/476 (37%), Positives = 267/476 (56%), Gaps = 13/476 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+  A+P I   FK+++ IAW  +AY LT TA QP+YG+   IF  K  FL AV+ FE
Sbjct: 119 QTIIGVAIPKITDQFKSIEDIAWYGSAYFLTSTALQPSYGRIYKIFSVKWAFLIAVLIFE 178

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C +AP+ T +I+ RAIAG+G  GI S  M+IIS  V L  R              
Sbjct: 179 IGSLICAVAPSSTVLIVGRAIAGIGVAGIFSGAMVIISVTVPLPKRPLVFGMFGMVWGIA 238

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK---GS-LLQKLKRID 176
               PLLGGAFTD V+WRW FYINLP+G +++ V +F+LR+P      GS +L++++++D
Sbjct: 239 SIAGPLLGGAFTDGVSWRWCFYINLPIGGVSLAVILFVLRLPDKNDFSGSPILERIQQLD 298

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IG  +++ + I LLL L WGGN+YPW++                F   + KLA +   P
Sbjct: 299 LIGAGLLIPAIICLLLALQWGGNKYPWNNSRIIGLFVGFGVMAILFAFSQVKLADKATLP 358

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P +FK   V+       F G AFF LVYY+P++FQ VK  SA  SG++L+PL+L  V++S
Sbjct: 359 PRMFKNRSVLAATLFALFFGGAFFVLVYYLPIFFQSVKDSSAMKSGIQLLPLMLATVVSS 418

Query: 297 VSSGQAVSRTDKFAYRTLSMTGA-ALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           +  G AV+      Y T  + G+ A+ AIG+GL+T+++ +      I Y           
Sbjct: 419 MVMGGAVTAA---GYYTPFLIGSTAIAAIGAGLVTMYEIDISTGKWIGYQIVLGAGVGAG 475

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL 415
            Q  +   Q ++  +D+   TA +MFF+ +G    +A+  ++F N L + +   A   + 
Sbjct: 476 FQIPMTAVQTVLPAEDIPIGTAAVMFFQTLGGALFIAVAQSVFQNGLISGLAKYAPTVDP 535

Query: 416 AGAVKASA----TVVNQL-PIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
              VKA A    TV+ QL  ++    VI AY+  LR ++   + + ++ FLASL M
Sbjct: 536 TAIVKAGATEMRTVLTQLGQLDQLMNVIKAYMDGLRASYRVSLALVLVAFLASLLM 591



>gi|134109573|ref|XP_776901.1| hypothetical protein CNBC3920 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259581|gb|EAL22254.1| hypothetical protein CNBC3920 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 651

 Score =  286 bits (732), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 178/459 (38%), Positives = 252/459 (54%), Gaps = 5/459 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP +   F   D   WV TAYLLT TA QP YG+ SDIFGRK T L  +  F 
Sbjct: 110 QTIVTTALPTLGQVFGRADISPWVGTAYLLTSTATQPVYGRLSDIFGRKFTLLGCLFIFL 169

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL C LA  M  +IIFRAI G+GGGGIL+L MIIISD+VSL++RGKYQ          
Sbjct: 170 MGSLACALAQTMIQLIIFRAIQGLGGGGILTLAMIIISDVVSLKERGKYQGITGCVVALA 229

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P++GGAFT++ +WRW FYINLPL +I++I+ +FLL + R +GS++ K+K++D+ G+
Sbjct: 230 NSCGPIVGGAFTENASWRWCFYINLPLTSISMIIIVFLLPLRRVRGSMVAKIKKLDFYGS 289

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           I+ +      L+ L+W G++Y W S                F  VE K+   P+ P H+F
Sbjct: 290 ILTLAWAAPFLIALSWAGSQYAWDSAAVLVPLLVGLALLGLFIFVEAKVVSLPLVPMHIF 349

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K   V  CF T F  G++F++ +YY+P YFQ+V+G SA  SG+  +PL+L   + S +SG
Sbjct: 350 KNASVSACFFTTFMNGLSFYATLYYLPQYFQIVRGASAIRSGVLTLPLMLVQTVTSFTSG 409

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
              S+T  + +  +   G  +  IG GLI+     +  A    Y            QT+L
Sbjct: 410 IIQSKTGDYWWNLV--VGYTIWTIGLGLISSITSTTSIAKLSGYQIIVGIGAGQTFQTSL 467

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  VE KD+A+ T L  F R +G    +A   +I +N +  N+  + +P     A+ 
Sbjct: 468 VAIQAGVERKDMATATGLRNFLRQLGGTIALAACNSIVNNCVRRNLSGV-LPGTAYKAIL 526

Query: 421 ASATVVNQLPIEIR--GPVISAYVGALRTAFTADIPIGI 457
              T    L +       V  AY  A R     ++  GI
Sbjct: 527 EDPTRATSLGLSASELSAVTDAYGNADREGGDLNVARGI 565



>gi|58265674|ref|XP_569993.1| tetracycline efflux protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57226225|gb|AAW42686.1| tetracycline efflux protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 652

 Score =  286 bits (732), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 178/459 (38%), Positives = 252/459 (54%), Gaps = 5/459 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP +   F   D   WV TAYLLT TA QP YG+ SDIFGRK T L  +  F 
Sbjct: 111 QTIVTTALPTLGQVFGRADISPWVGTAYLLTSTATQPVYGRLSDIFGRKFTLLGCLFIFL 170

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL C LA  M  +IIFRAI G+GGGGIL+L MIIISD+VSL++RGKYQ          
Sbjct: 171 MGSLACALAQTMIQLIIFRAIQGLGGGGILTLAMIIISDVVSLKERGKYQGITGCVVALA 230

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P++GGAFT++ +WRW FYINLPL +I++I+ +FLL + R +GS++ K+K++D+ G+
Sbjct: 231 NSCGPIVGGAFTENASWRWCFYINLPLTSISMIIIVFLLPLRRVRGSMVAKIKKLDFYGS 290

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           I+ +      L+ L+W G++Y W S                F  VE K+   P+ P H+F
Sbjct: 291 ILTLAWAAPFLIALSWAGSQYAWDSAAVLVPLLVGLALLGLFIFVEAKVVSLPLVPMHIF 350

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K   V  CF T F  G++F++ +YY+P YFQ+V+G SA  SG+  +PL+L   + S +SG
Sbjct: 351 KNASVSACFFTTFMNGLSFYATLYYLPQYFQIVRGASAIRSGVLTLPLMLVQTVTSFTSG 410

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
              S+T  + +  +   G  +  IG GLI+     +  A    Y            QT+L
Sbjct: 411 IIQSKTGDYWWNLV--VGYTIWTIGLGLISSITSTTSIAKLSGYQIIVGIGAGQTFQTSL 468

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  VE KD+A+ T L  F R +G    +A   +I +N +  N+  + +P     A+ 
Sbjct: 469 VAIQAGVERKDMATATGLRNFLRQLGGTIALAACNSIVNNCVRRNLSGV-LPGTAYKAIL 527

Query: 421 ASATVVNQLPIEIR--GPVISAYVGALRTAFTADIPIGI 457
              T    L +       V  AY  A R     ++  GI
Sbjct: 528 EDPTRATSLGLSASELSAVTDAYGNADREGGDLNVARGI 566



>gi|496020142|ref|WP_008744649.1| MFS transporter [Streptomyces sp. SPB74]
 gi|295825528|gb|EDY45516.2| drug transporter [Streptomyces sp. SPB74]
          Length = 705

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 172/479 (35%), Positives = 251/479 (52%), Gaps = 18/479 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I +D    + ++WV T+YLL  T      GKF D+FGRK  F  + I F 
Sbjct: 40  QTIVGTALPTIVADLGGGEHMSWVVTSYLLAETVSTVLVGKFGDLFGRKIVFQVSAIVFI 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +I +RA+ G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 100 TGSFLCGLASDMLLLIAWRAVQGIGAGGLMVTAMALIADVIPLRERGKYQGAIGAVFGVS 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FTDH+TWRW+FY+N+P+  + VI A       R   S+   +K  IDY+G
Sbjct: 160 TVVGPLLGGVFTDHLTWRWAFYVNVPIAIVVVIAAA------RTIPSVRSGVKPVIDYLG 213

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
             +V     AL+L  +WGGN+Y W S                F L ET+ A +P+ P  L
Sbjct: 214 IALVAIGASALILATSWGGNQYAWGSGVVIGLFAAGIAGLGLFCLAETR-ARQPMLPMRL 272

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+      C   +F  G A    + ++P Y Q V GDSAT SG+  +P+++G++IAS+ S
Sbjct: 273 FRDPVFAVCAVLSFVVGFAMLGALTFLPTYLQYVDGDSATISGVRTLPMVIGLLIASIFS 332

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  VS+T    YR   + G  ++ +G  L++  D +SG   +  YM          MQ  
Sbjct: 333 GNVVSKTGH--YRIFPIVGTLVMGLGLFLLSRMDNHSGAWLESLYMFVLGTGIGLSMQVL 390

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--------IAI 411
            +  Q  V+Y D+ + T+ + FFR +G+ FG A+ GTI++N L   + +           
Sbjct: 391 TIAVQNTVDYADLGAATSGVTFFRTLGSSFGTAVFGTIYANALAPRLRDGVGGAARATGR 450

Query: 412 PPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
            P        S   V+ LP   R PV+ AY  AL+T F   +P+    F+ +LF+   K
Sbjct: 451 DPAAVARAAGSPDGVHGLPAAAREPVVHAYAEALQTVFLWTVPVAAFGFVLALFLRQVK 509



>gi|256397379|ref|YP_003118943.1| EmrB/QacA subfamily drug resistance transporter [Catenulispora
           acidiphila DSM 44928]
 gi|506277052|ref|WP_015796827.1| EmrB/QacA subfamily drug resistance transporter [Catenulispora
           acidiphila]
 gi|256363605|gb|ACU77102.1| drug resistance transporter, EmrB/QacA subfamily [Catenulispora
           acidiphila DSM 44928]
          Length = 680

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 175/463 (37%), Positives = 258/463 (55%), Gaps = 15/463 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD    + I+WV T+YLL  TA  P +GK  D FGRK  F  A++ F 
Sbjct: 34  QTIVSTALPTIVSDLGGANHISWVVTSYLLASTALTPLWGKLGDQFGRKRIFQTAIVVFL 93

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCGL+ NMT +I  RA+ GVGGGG++ L M +I+D+V  +DRGKYQ          
Sbjct: 94  IGSALCGLSQNMTQLIASRALQGVGGGGLMVLAMALIADVVPPRDRGKYQGVVGAVFGVA 153

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG F D+++WRW FY+NLP+GAI ++V    LR          +   IDY+GT
Sbjct: 154 SVIGPLIGGFFVDNLSWRWVFYVNLPVGAIALVVVAIGLRT-----HTAHRKPVIDYLGT 208

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++  +  +L+L  ++GG+ + WSS                +   E K A EPV P H+F
Sbjct: 209 FLIAAAASSLILITSFGGSTWAWSSWQVYLCGAVAAACLIAWFYAE-KHAKEPVLPLHMF 267

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K      C T  F  G+  F  + ++PLY QVV G + T SGL+L+PL+ G++ AS++SG
Sbjct: 268 KNPVFAMCSTIGFVVGLCMFGSLTFLPLYQQVVHGATPTASGLQLLPLMAGLLFASITSG 327

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +SRT +  Y+   + G A++ +G+ L++   + +  A     M          MQ  +
Sbjct: 328 QLISRTGR--YKIFPIVGTAVMTVGAWLLSRMTDTTSTASNAVAMLVFGLGLGLVMQVLI 385

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIE----NIAIPPE-- 414
           +  Q  V+Y+++ + T+ + FFR IG  FG ++ GTIF+N LT+ I+    N  I P+  
Sbjct: 386 IAVQNNVDYEELGTATSAVTFFRSIGGAFGASLFGTIFNNKLTSEIKTAVANGTISPKFP 445

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGI 457
              A++ + TV+ Q P  +  P +  Y  AL   F   IP+ I
Sbjct: 446 FEQAIE-NPTVIKQFPKSVTQPFLHTYAHALHYVFLYAIPLCI 487



>gi|336120042|ref|YP_004574820.1| drug resistance transporter [Microlunatus phosphovorus NM-1]
 gi|503631175|ref|WP_013865251.1| multidrug MFS transporter [Microlunatus phosphovorus]
 gi|334687832|dbj|BAK37417.1| putative drug resistance transporter [Microlunatus phosphovorus
           NM-1]
          Length = 554

 Score =  285 bits (730), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 168/476 (35%), Positives = 265/476 (55%), Gaps = 14/476 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q+IV  ALP I SD   LDK++WV TAYLLT TA  P +GK SD+ GR+  F  A++ F 
Sbjct: 71  QSIVGVALPRITSDLGGLDKLSWVVTAYLLTSTAATPLWGKISDLLGRRPIFQAAIVVFL 130

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS++C LAPN+  MI  RAI G+GGGG++SL + +I D++  ++RGKYQ          
Sbjct: 131 IGSVICALAPNIEVMIAGRAIQGLGGGGLMSLALAVIGDVIPPRERGKYQGFFGAVFGVS 190

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+ W+W F INLP+G + +++    L++P      +++   +DY+G 
Sbjct: 191 SVAGPLLGGLFTDHLGWQWIFLINLPIGILALVITSMALKLPH-----VKREASVDYLGA 245

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
             +VGS  +L+L L+W G +  W+SP               F  VETK+  EP+ PP LF
Sbjct: 246 ATIVGSVTSLVLYLSWAGPDLGWTSPTGLGLLVAFLGLALAFAYVETKVK-EPILPPELF 304

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +    V   +     G+  F  + Y+P+Y Q VKG +AT SGL ++P+++G+   S+SSG
Sbjct: 305 RHWTFVSNISFAMIMGVGMFGGLIYLPIYLQAVKGFTATESGLAMLPMVVGMFATSISSG 364

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +SRT +  Y+ + +TG+A++ +   L++    ++      C M          MQ  +
Sbjct: 365 QLMSRTGR--YKWMPITGSAVVGVALVLMSRLAVDTPYWHLACTMLLFGAGLGFTMQVVV 422

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI---AIPPELAG 417
              Q  VE + + + TA + FFR +G   G A+ G I +  L+++++ I   A   +L G
Sbjct: 423 TAVQNSVERRHLGAATASVAFFRSMGGAIGTALFGAILNTRLSHHLQEIVPAAAQSQLGG 482

Query: 418 AVKA--SATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKP 471
           A  +    T ++ LP  ++  V++A+  ++   F   +P   + FL +L M   +P
Sbjct: 483 AAASMNDITAIHALPEPVKTWVLTAFTQSMDDLFLVAVPFMAIAFLIALTM-RERP 537



>gi|493087928|ref|WP_006128852.1| MFS transporter [Streptomyces filamentosus]
 gi|291351963|gb|EFE78867.1| membrane transport protein [Streptomyces roseosporus NRRL 15998]
          Length = 697

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 177/477 (37%), Positives = 249/477 (52%), Gaps = 15/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD      ++WV TAYLL  T      GKF D+FGRK  F  + I F 
Sbjct: 44  QTIVGTALPTIVSDLGGASHMSWVVTAYLLAETVATVLVGKFGDLFGRKLVFQVSAIIFI 103

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +II+R + G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 104 TGSFLCGLASDMLLLIIWRGMQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGIS 163

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P     V+V      IP  K +       IDY G 
Sbjct: 164 TVIGPLLGGLFTDHLTWRWAFYVNVP--IAIVVVIAAARNIPSVKAA---GRPVIDYRGI 218

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W S                F LVET+ A EP+ P  LF
Sbjct: 219 ALVTVGASALILATSWGGNEYAWGSAVIIGLFVCGLIALALFCLVETR-AKEPMLPMRLF 277

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +PL+ G++ AS+ SG
Sbjct: 278 RNPVFTVCSILSFIVGFAMLGSMIFLPTYLQYVDGDSATLSGVRTLPLVAGLLAASIFSG 337

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  ++A G  L++     +G   +  YM          MQ   
Sbjct: 338 NVVSKTGR--YRVFPIVGTLVMAAGLFLLSRMGPGTGVWLESLYMVVLGLGIGLAMQVLT 395

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG--- 417
           +  Q  V+Y+D+ + T+ + FFR +G+ FG A+ GTI+SN L  N+ +       AG   
Sbjct: 396 IAVQNTVDYEDLGTATSGVTFFRTLGSAFGTAVFGTIYSNALKPNLTDGVAQAVAAGGDP 455

Query: 418 AVKASAT----VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AV A A+     ++ LP     P+  AY   L T F   +P+ ++ F+ +LF+   K
Sbjct: 456 AVLARASESPQALHALPAAQSEPLAQAYADTLHTVFLWTVPVALIGFVIALFLKEVK 512



>gi|291302635|ref|YP_003513913.1| EmrB/QacA subfamily drug resistance transporter [Stackebrandtia
           nassauensis DSM 44728]
 gi|502785415|ref|WP_013020391.1| transporter [Stackebrandtia nassauensis]
 gi|290571855|gb|ADD44820.1| drug resistance transporter, EmrB/QacA subfamily [Stackebrandtia
           nassauensis DSM 44728]
          Length = 525

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 175/481 (36%), Positives = 247/481 (51%), Gaps = 17/481 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TIV TALP I  +F     ++WV TAY+L  T   P YGK  D++GRK  F+FA+  F 
Sbjct: 37  NTIVGTALPTIVGEFGGYGHMSWVVTAYILAATVSTPLYGKLGDLYGRKRLFMFAIGVFL 96

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS+  G A +M  +I FRA+ G+G GG++  VM I+ D+V  ++RGKYQ          
Sbjct: 97  IGSVASGAAQSMEQLIAFRALQGLGAGGLMVGVMAILGDLVPPRERGKYQGFMAAVMMVA 156

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL GG  TDHV WRW+FYINLPLGAI +I+    L +PR +        +IDY G 
Sbjct: 157 TIGGPLAGGLLTDHVDWRWAFYINLPLGAIALIIIATTLHLPRHRNK-----AKIDYAGI 211

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++     +L+L   WGGNEY W SP               F +VE K A EPV P  LF
Sbjct: 212 ALLSAVAASLVLVTTWGGNEYEWDSPQILGLSAFSLVALVAFIMVERK-AAEPVLPLRLF 270

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
              +        F QG A F  + ++P+Y Q+V+G + T SG+  IP++LG ++ S+ +G
Sbjct: 271 TDRNFTLINVVGFLQGFAMFGAMTFIPMYQQIVQGLTPTESGVFFIPMMLGAMVFSLGAG 330

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q ++RT K  Y+   + G A++  G  L+T    ++       YM          MQ T+
Sbjct: 331 QIITRTGK--YKIFPIAGGAVMIAGMLLLTQLTTSTSELTTSIYMVVFGIGLGLLMQVTM 388

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           L  Q     +D+   ++   F R IG  FGVA  G+IF+N LT ++    +PP++A    
Sbjct: 389 LVAQNSAPQRDIGVASSTSTFLRNIGGSFGVAAFGSIFANQLTESMSG-KLPPDIAKNFS 447

Query: 421 ASAT------VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLR 474
              T       + QLP +I   V      A+ T F   IP   L FL + F+   +  LR
Sbjct: 448 GGGTGGLEPSKLAQLPDKIMDVVSGGVTDAITTVFVWTIPFAALGFLVAWFI--KEVPLR 505

Query: 475 T 475
           T
Sbjct: 506 T 506



>gi|169628067|ref|YP_001701716.1| Probable drug resistance transporter [Mycobacterium abscessus]
 gi|491263950|ref|WP_005122092.1| MFS transporter [Mycobacterium abscessus]
 gi|169240034|emb|CAM61062.1| Probable drug resistance transporter [Mycobacterium abscessus]
 gi|392203526|gb|EIV29120.1| squalene-hopene cyclase [Mycobacterium abscessus 3A-0119-R]
 gi|392212803|gb|EIV38363.1| squalene-hopene cyclase [Mycobacterium abscessus 3A-0122-R]
 gi|392216264|gb|EIV41808.1| squalene-hopene cyclase [Mycobacterium abscessus 3A-0731]
 gi|392216934|gb|EIV42473.1| squalene-hopene cyclase [Mycobacterium abscessus 3A-0122-S]
 gi|392232017|gb|EIV57520.1| squalene-hopene cyclase [Mycobacterium abscessus 3A-0930-S]
 gi|392233122|gb|EIV58621.1| squalene-hopene cyclase [Mycobacterium abscessus 3A-0930-R]
 gi|392258243|gb|EIV83690.1| squalene-hopene cyclase [Mycobacterium abscessus 3A-0810-R]
          Length = 670

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 170/486 (34%), Positives = 254/486 (52%), Gaps = 22/486 (4%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 26  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 85

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 86  GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 145

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSL--LQKLKR--IDY 177
              PLLGG FTDH+ WRW+FYINLP+  + ++VA          G++  L K  R  IDY
Sbjct: 146 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVA---------AGAIPALAKATRPVIDY 196

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            G +++     AL L  +WGG  YPWSSP               F  VE+++  EP+ PP
Sbjct: 197 WGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVP-EPILPP 255

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S 
Sbjct: 256 RLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITST 315

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V RT +  Y+   + G A++AI   L++  D+++    Q  Y+          MQ
Sbjct: 316 GTGTLVGRTGR--YKRYPVAGTAIMAIALALLSRMDDSTPFVLQSLYLFILGVGIGASMQ 373

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
              L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PPE   
Sbjct: 374 VLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPE--- 430

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
               S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  D
Sbjct: 431 -ATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGAD 487

Query: 478 TVVAFE 483
           T +A +
Sbjct: 488 TSLAVD 493



>gi|497743949|ref|WP_010058133.1| major facilitator superfamily permease [Streptomyces globisporus]
          Length = 697

 Score =  284 bits (726), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 175/477 (36%), Positives = 250/477 (52%), Gaps = 15/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD      ++WV TAYLL  T      GKF D+FGRK  F  + + F 
Sbjct: 44  QTIVGTALPTIVSDLGGASHMSWVVTAYLLAETVATVLVGKFGDLFGRKLVFQVSAVIFI 103

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +II+R + G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 104 TGSFLCGLASDMLLLIIWRGMQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGIS 163

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P     V+V      IP  K +       IDY G 
Sbjct: 164 TVIGPLLGGLFTDHLTWRWAFYVNVP--IAIVVVIAAARNIPSVKAA---GRPVIDYRGI 218

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W S                F LVET+ A EP+ P  LF
Sbjct: 219 ALVTVGASALILATSWGGNEYAWGSAVIIGLFVGGLIALALFCLVETR-AEEPMLPMRLF 277

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +PL+ G++ AS+ SG
Sbjct: 278 RNPVFTVCSILSFIVGFAMLGSMIFLPTYLQYVDGDSATLSGVRTLPLVAGLLAASIFSG 337

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  ++A G  L++     +G   +  YM          MQ   
Sbjct: 338 NVVSKTGR--YRVFPIVGTLVMAAGLFLLSRMGPGTGVWLESLYMVVLGLGIGLAMQVLT 395

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG--- 417
           +  Q  V+Y+D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ +       AG   
Sbjct: 396 IAVQNTVDYEDLGTATSGVTFFRTLGSAFGTAVFGTIYTNALKPNLTDGVAQAVAAGGDP 455

Query: 418 AVKASAT----VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AV A A+     ++ LP+    P+  AY   L T F   +P+ ++ F+ +LF+   K
Sbjct: 456 AVLARASESPQALHALPVAQSEPLAQAYADTLHTVFLWTVPVALIGFVIALFLKEVK 512



>gi|491215079|ref|WP_005073405.1| MFS transporter [Mycobacterium abscessus]
 gi|364002279|gb|EHM23471.1| drug resistance transporter [Mycobacterium abscessus subsp.
           bolletii BD]
          Length = 670

 Score =  284 bits (726), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 170/486 (34%), Positives = 254/486 (52%), Gaps = 22/486 (4%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 26  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 85

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 86  GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 145

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSL--LQKLKR--IDY 177
              PLLGG FTDH+ WRW+FYINLP+  + ++VA          G++  L K  R  IDY
Sbjct: 146 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVA---------AGAIPALAKATRPVIDY 196

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            G +++     AL L  +WGG  YPWSSP               F  VE+++  EP+ PP
Sbjct: 197 WGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVP-EPILPP 255

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S 
Sbjct: 256 RLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITST 315

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V RT +  Y+   + G A++AI   L++  D+++    Q  Y+          MQ
Sbjct: 316 GTGTLVGRTGR--YKRYPVAGTAIMAIALVLLSRMDDSTPFVLQSLYLFVLGVGIGASMQ 373

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
              L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PPE   
Sbjct: 374 VLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPE--- 430

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
               S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  D
Sbjct: 431 -ATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGAD 487

Query: 478 TVVAFE 483
           T +A +
Sbjct: 488 TSLAVD 493



>gi|491234534|ref|WP_005092761.1| MFS transporter [Mycobacterium abscessus]
 gi|392074459|gb|EIU00296.1| squalene-hopene cyclase [Mycobacterium abscessus 4S-0726-RA]
 gi|392074613|gb|EIU00449.1| squalene-hopene cyclase [Mycobacterium abscessus 4S-0303]
 gi|392075959|gb|EIU01792.1| squalene-hopene cyclase [Mycobacterium abscessus 4S-0726-RB]
 gi|392188678|gb|EIV14313.1| squalene-hopene cyclase [Mycobacterium abscessus 4S-0206]
 gi|392226094|gb|EIV51608.1| squalene-hopene cyclase [Mycobacterium abscessus 4S-0116-R]
 gi|392236425|gb|EIV61923.1| squalene-hopene cyclase [Mycobacterium abscessus 4S-0116-S]
          Length = 670

 Score =  283 bits (725), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 170/486 (34%), Positives = 254/486 (52%), Gaps = 22/486 (4%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 26  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 85

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 86  GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 145

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSL--LQKLKR--IDY 177
              PLLGG FTDH+ WRW+FYINLP+  + ++VA          G++  L K  R  IDY
Sbjct: 146 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVA---------AGAIPALAKATRPVIDY 196

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            G +++     AL L  +WGG  YPWSSP               F  VE+++  EP+ PP
Sbjct: 197 WGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVP-EPILPP 255

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S 
Sbjct: 256 RLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITST 315

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V RT +  Y+   + G A++AI   L++  D+++    Q  Y+          MQ
Sbjct: 316 GTGTLVGRTGR--YKRYPVAGTAIMAIALVLLSRMDDSTPFVLQSLYLFILGVGIGASMQ 373

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
              L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PPE   
Sbjct: 374 VLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPE--- 430

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
               S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  D
Sbjct: 431 -ATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGAD 487

Query: 478 TVVAFE 483
           T +A +
Sbjct: 488 TSLAVD 493



>gi|491224813|ref|WP_005083101.1| MFS transporter [Mycobacterium abscessus]
 gi|382940614|gb|EIC64937.1| drug resistance transporter [Mycobacterium abscessus M93]
          Length = 670

 Score =  283 bits (724), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 170/486 (34%), Positives = 254/486 (52%), Gaps = 22/486 (4%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 26  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 85

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 86  GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 145

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSL--LQKLKR--IDY 177
              PLLGG FTDH+ WRW+FYINLP+  + ++VA          G++  L K  R  IDY
Sbjct: 146 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVA---------AGAIPALAKATRPVIDY 196

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            G +++     AL L  +WGG  YPWSSP               F  VE+++  EP+ PP
Sbjct: 197 WGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVP-EPILPP 255

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S 
Sbjct: 256 RLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITST 315

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V RT +  Y+   + G A++AI   L++  D+++    Q  Y+          MQ
Sbjct: 316 GTGTLVGRTGR--YKRYPVAGTAIMAIALVLLSRMDDSTPFVLQSLYLFILGVGIGASMQ 373

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
              L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PPE   
Sbjct: 374 VLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPE--- 430

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
               S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  D
Sbjct: 431 -ATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGAD 487

Query: 478 TVVAFE 483
           T +A +
Sbjct: 488 TSLAVD 493



>gi|119495432|ref|XP_001264501.1| MFS toxin efflux pump (AflT), putative [Neosartorya fischeri NRRL
           181]
 gi|119412663|gb|EAW22604.1| MFS toxin efflux pump (AflT), putative [Neosartorya fischeri NRRL
           181]
          Length = 551

 Score =  283 bits (723), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 179/488 (36%), Positives = 270/488 (55%), Gaps = 15/488 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+  A+P I   FK+++ IAW  +AY LT TA QP+YG+   IF  K  FL AV+ FE
Sbjct: 58  QTIIGVAIPKITDQFKSIEDIAWYGSAYFLTSTALQPSYGRIYKIFSVKWAFLVAVLIFE 117

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+C +AP+ T +I+ RAIAG+G  GI S  M+IIS  V L  R              
Sbjct: 118 VGSLICAVAPSSTVLIVGRAIAGIGVAGIFSGAMVIISVTVPLPKRPLVFGMFGMVWGIA 177

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKG----SLLQKLKRID 176
               PLLGGAFTD V+WRW FYINLP+G +++ V +F+LR+P         +L++++++D
Sbjct: 178 SIAGPLLGGAFTDGVSWRWCFYINLPIGGVSLAVILFVLRLPDKNEFSGTPILERIRQLD 237

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IG  +++ + I LLL L WGGN+YPW++                F   + K+A +   P
Sbjct: 238 LIGAGLLIPAIICLLLALQWGGNKYPWNNSRIIGLFVGFGLMAILFAFSQVKMADKATLP 297

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P +FK   V+       F G AFF LVYY+P++FQ VK  SA  SG++L+PL+L  V++S
Sbjct: 298 PRVFKNRTVLAATLFALFFGGAFFVLVYYLPIFFQSVKDSSAMKSGIQLLPLMLATVVSS 357

Query: 297 VSSGQAVSRTDKFAYRTLSMTGA-ALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           V  G AV+      Y T  + G+ A+ AIG+GLIT+++ +      I Y           
Sbjct: 358 VVMGGAVTAV---GYYTPFLIGSTAIAAIGAGLITMYEIDISTGKWIGYQIVLGAGVGAG 414

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL 415
            Q  +   Q ++  +D+   TA +MFF+ +G    +A+  ++F N L + +   A   + 
Sbjct: 415 FQIPMTAVQTVLPAEDIPIGTAAVMFFQTLGGALFIAVAQSVFQNGLISGLAKYAPTVDP 474

Query: 416 AGAVKASAT----VVNQL-PIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           A  VKA AT    V+ QL  ++    VI AY+  LR ++   + + ++ F+ SL M    
Sbjct: 475 AAIVKAGATEMRPVLTQLGQLDQLMNVIRAYMDGLRASYRVSLALVLVGFVVSLLM--EW 532

Query: 471 PSLRTTDT 478
            S++T + 
Sbjct: 533 KSVKTANN 540



>gi|491232580|ref|WP_005090812.1| MFS transporter [Mycobacterium abscessus]
 gi|382938517|gb|EIC62848.1| drug resistance transporter [Mycobacterium abscessus M94]
          Length = 670

 Score =  282 bits (722), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 171/486 (35%), Positives = 253/486 (52%), Gaps = 22/486 (4%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 26  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 85

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 86  GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 145

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSL--LQKLKR--IDY 177
              PLLGG FTDH+ WRW+FYINLP+  + ++VA          G++  L K  R  IDY
Sbjct: 146 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVA---------AGAIPALAKATRPVIDY 196

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            G +++     AL L  +WGG  YPWSSP               F  VE+ L  EP+ PP
Sbjct: 197 WGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVES-LVPEPILPP 255

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S 
Sbjct: 256 RLFRDPVFTICCMLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITST 315

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V RT +  Y+   + G A++AI   L++  D+++    Q  Y+          MQ
Sbjct: 316 GTGTLVGRTGR--YKRYPVAGTAIMAIALVLLSRMDDSTPFVLQSLYLFILGVGIGASMQ 373

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
              L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PPE   
Sbjct: 374 VLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPE--- 430

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
               S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  D
Sbjct: 431 -ATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGAD 487

Query: 478 TVVAFE 483
           T +A +
Sbjct: 488 TSLAVD 493



>gi|491255195|ref|WP_005113375.1| MFS transporter [Mycobacterium abscessus]
 gi|392115624|gb|EIU41393.1| squalene-hopene cyclase [Mycobacterium abscessus 6G-0125-R]
 gi|392124911|gb|EIU50670.1| squalene-hopene cyclase [Mycobacterium abscessus 6G-0125-S]
 gi|392130472|gb|EIU56218.1| squalene-hopene cyclase [Mycobacterium abscessus 6G-0728-S]
 gi|392140796|gb|EIU66523.1| squalene-hopene cyclase [Mycobacterium abscessus 6G-1108]
 gi|392173151|gb|EIU98820.1| squalene-hopene cyclase [Mycobacterium abscessus 6G-0212]
 gi|392177245|gb|EIV02903.1| squalene-hopene cyclase [Mycobacterium abscessus 6G-0728-R]
          Length = 670

 Score =  282 bits (721), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 169/486 (34%), Positives = 253/486 (52%), Gaps = 22/486 (4%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 26  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 85

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 86  GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 145

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSL--LQKLKR--IDY 177
              PLLGG FTDH+ WRW+FYINLP+  + ++VA          G++  L K  R  IDY
Sbjct: 146 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVA---------AGAIPALAKATRPVIDY 196

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            G +++     AL L  +WGG  YPWSSP               F  VE+++  EP+ PP
Sbjct: 197 WGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVP-EPILPP 255

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S 
Sbjct: 256 RLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITST 315

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V RT +  Y+   + G A++AI   L++  D+++    Q  Y+          M 
Sbjct: 316 GTGTLVGRTGR--YKRYPVAGTAIMAIALALLSRMDDSTPFVLQSLYLFILGVGIGASMP 373

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
              L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PPE   
Sbjct: 374 VLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPE--- 430

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
               S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  D
Sbjct: 431 -ATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGAD 487

Query: 478 TVVAFE 483
           T +A +
Sbjct: 488 TSLAVD 493



>gi|402226046|gb|EJU06106.1| MFS general substrate transporter [Dacryopinax sp. DJM-731 SS1]
          Length = 604

 Score =  282 bits (721), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 178/484 (36%), Positives = 251/484 (51%), Gaps = 20/484 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI ATA+P IASDF +LD I W+A+ Y LT   F   YG+   I   K  ++ A+  FE
Sbjct: 114 QTITATAIPRIASDFNSLDSITWIASGYFLTQAGFLMLYGQLLIIAPTKWVYITAITIFE 173

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+APN+  +I  RA AG+G  GI   ++ II+ I  L+DR              
Sbjct: 174 LGSLICGVAPNVNVLIFGRAFAGIGAAGIFVSILSIIAQITRLEDRPLLFGSFGAVFAVS 233

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK-GS-------LLQKL 172
               PLLGGAF+DHVTWRW FYINLP+GAI++ V I L+   RP  GS         Q+ 
Sbjct: 234 SVIGPLLGGAFSDHVTWRWCFYINLPIGAISIGV-ILLIIDARPAIGSDATDGMTTFQRW 292

Query: 173 KRIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIE 232
             +D+IG ++ +G  + LLLPL WGGN  PW+                 F   E  +   
Sbjct: 293 LYMDWIGALLSIGMVVTLLLPLQWGGNLKPWNDKSVIALFCVFGAVLIMFIAWEWHMGPR 352

Query: 233 PVAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGV 292
            V P  LFKR   +G     FF  +      YY+PL +Q  KG SAT SG++++P +L V
Sbjct: 353 AVLPLALFKRSTQIGTCLEAFFVMLGMLLATYYLPLQYQ-AKGHSATQSGIDILPFMLSV 411

Query: 293 VIASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXX 352
           V+ +  SG  ++ T +  Y         L  IG+GL+   + ++  A  I Y        
Sbjct: 412 VVVAAISGAVINFTGR--YWPFLFFAPLLTCIGAGLLFTLEADAPNARMIGYQILFGAGV 469

Query: 353 XXXMQTTLLCGQGIVEYKD----VASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN 408
              +Q  ++  Q   EY D    +   T+L+ F +L+G V G+ I GTIFSN L+  +  
Sbjct: 470 GGALQNVVIAIQA--EYHDNERMIPQATSLVTFSQLVGGVIGICIAGTIFSNQLSKELAI 527

Query: 409 IA--IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            A  +P ++   +K S TVV  LP + +GP+I AYV AL   +   +P G    L++L  
Sbjct: 528 YAPNLPADVIQGIKDSVTVVQTLPADQQGPIIQAYVKALDYVYLIGVPGGAFGSLSALLT 587

Query: 467 GNHK 470
            NH 
Sbjct: 588 KNHN 591



>gi|402219996|gb|EJU00069.1| MFS general substrate transporter [Dacryopinax sp. DJM-731 SS1]
          Length = 502

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 168/481 (34%), Positives = 254/481 (52%), Gaps = 14/481 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI +TA+P IAS+F +L+ + W+A+AY LT       YG+   I   K  ++ A+  FE
Sbjct: 12  QTITSTAIPRIASEFNSLNDVTWIASAYFLTQAGCLMLYGQLLVIAPTKWVYISAITLFE 71

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+CG+AP +  +I  RA AGVG  GI   V+ II+ I  +  R              
Sbjct: 72  IGSLICGVAPTVNVLIFGRAFAGVGAAGIFVAVLSIIAQITHISKRPLLFGSFAGVFALA 131

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGS-------LLQKLK 173
               PLLGGAF+DHVTWRW FYINLP+GA++V+V + L+      GS        LQ+  
Sbjct: 132 SVVGPLLGGAFSDHVTWRWCFYINLPIGAVSVVVILLLIEARPAIGSEVTDGMNQLQRWL 191

Query: 174 RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP 233
            +D+IG  + +G  + L+LPL WGGN  PW+ P               F L E ++    
Sbjct: 192 SLDWIGAFLSIGMVVCLILPLQWGGNSKPWNDPAVIATFCVFGALLIVFVLWEWRMGPRA 251

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
           + P  +F+R   VG     F+  +      YY+PL +Q  KG SAT SG++++P +L  V
Sbjct: 252 LMPLQMFRRRTQVGACLEAFWIMLCMLLATYYLPLLYQ-AKGHSATQSGIDILPFMLATV 310

Query: 294 IASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXX 353
           I++  SG  ++ T +  Y     T   L A+G+GL+   D ++  A  I +         
Sbjct: 311 ISAAGSGGIINATGR--YWPFIFTLPLLTAVGAGLLFTIDSSTSNAKLIGFQILYGAGIG 368

Query: 354 XXMQTTLLCGQG--IVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA- 410
             MQ T++  Q     E + +   T+++ F +LIG V G++I GT+F+N L + +   A 
Sbjct: 369 GSMQNTIIAVQAEYHAEERMIPQGTSMVNFTQLIGGVIGISIAGTVFANQLGSQLAQYAP 428

Query: 411 -IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNH 469
            + P +   +K S TVV  LP++ +GP+I AY  AL   +   +P G+L  L++L + N 
Sbjct: 429 GLDPSIVQTLKESVTVVATLPLDQQGPIIEAYTKALDYVYIIGVPAGVLGTLSALLIRNM 488

Query: 470 K 470
            
Sbjct: 489 N 489



>gi|388580591|gb|EIM20905.1| MFS general substrate transporter [Wallemia sebi CBS 633.66]
          Length = 586

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 166/439 (37%), Positives = 239/439 (54%), Gaps = 11/439 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QT+V+TA+P+I + F+A DK +WVAT+YLLT TA  P +G+ SD+FGRK      +  F 
Sbjct: 81  QTVVSTAIPSIGAYFQAADKSSWVATSYLLTTTAAMPVHGRLSDLFGRKYALFGCLTFFF 140

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL C ++  +  +IIFRAIAG+G GGI + V +IISDIV L++RGKYQ          
Sbjct: 141 LGSLACAVSQTIEQLIIFRAIAGIGNGGIKTHVHVIISDIVPLKERGKYQGILTAWTCLA 200

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F++ + WRW F+INLPL  I + V  FL+   +  G    K+KRIDY G+
Sbjct: 201 NGIGPLLGGVFSETIGWRWCFWINLPLVGIALAVLQFLVPFKKVTGDWRAKMKRIDYAGS 260

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVET--KLAIEPVAPPH 238
           I++  S + +L+ LNWGGN+Y W S                F LVE   ++   P+ P +
Sbjct: 261 IIMFTSAVLILISLNWGGNKYAWDSAPVLVCLIIGLLLMVVFVLVENCKRIVNLPIIPMY 320

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           LF+ + V   +   FF GM +F  ++Y+P Y QVV   S T SG  ++ L++   I S  
Sbjct: 321 LFRNVSVSASYICTFFGGMGYFGALFYLPQYLQVVHSYSGTVSGALMLALMVTQTIVSFL 380

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           +G  VS+T    Y ++  TG ++ A+G GL      NS  A  I Y            QT
Sbjct: 381 AGLVVSKTGH--YISIIRTGFSIYAVGCGLYISLTYNSSLAKFIGYSIIAGIGAGNTFQT 438

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGA 418
           TL+  Q  V+ +D+A  T    F R++G V  +A   TI  N L   +  +    EL  A
Sbjct: 439 TLISVQAAVKRQDMAVATGGRNFLRMLGGVMSLAFCDTILRNTLQKGLSKMGQTDELIAA 498

Query: 419 VKASATVVNQLPIEIRGPV 437
           + ++       PI+I+  V
Sbjct: 499 ITSN-------PIDIKNIV 510



>gi|501752047|emb|CCG83893.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 559

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 166/465 (35%), Positives = 250/465 (53%), Gaps = 6/465 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+ATA+P+I++ F+ ++ I W  +AY LT  A QPT+GK    F  K  F+ AV+ FE
Sbjct: 75  QTIIATAIPSISNQFRKINDIGWYGSAYFLTSCALQPTWGKIYQTFSVKWFFILAVVLFE 134

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+AP+   +II RA+AG+G  GI S  + II+  V L+ R  Y           
Sbjct: 135 LGSLICGVAPSSEVLIIGRAVAGLGVSGIFSGGLTIIAYSVPLEKRPAYMGIIGAMFGIA 194

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRI--PRPKGSLLQKLKRIDYI 178
               PLLGG FT+ +TWRW FYINLP+GAITV+  +FL+ I   R   +++++L+RID++
Sbjct: 195 SVAGPLLGGVFTEQITWRWCFYINLPVGAITVVSVVFLVHIKQKRETRTVMERLRRIDFL 254

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           G   ++ + I LLL L WGGN Y WSS                F  V+ KL      PP 
Sbjct: 255 GAACLLPAVICLLLALQWGGNTYAWSSSKIIGLFVGAGLLLLVFAGVQWKLQDRGTIPPK 314

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           + +   V          G +FF + YY+PLYFQ +KG SA  SGL+L+PL++ VV++S+ 
Sbjct: 315 IIRNRSVWASCAFGAAFGGSFFIMAYYIPLYFQAIKGSSAVKSGLQLLPLMISVVLSSIL 374

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SG  +++     Y  + + GA  + IG+GL+T W  NS       Y            Q 
Sbjct: 375 SGAVITKVGY--YTPILIGGAVFLTIGAGLVTSWKVNSPIGIWFSYQVIMGLGAGGSFQI 432

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN-IAIPPELAG 417
            ++  Q +++ +DV   TAL+ F + +G    +A+  ++FSN L   + + I  P  +  
Sbjct: 433 PIIAVQTVLDLEDVPVGTALISFAQSLGGAVFIAVAQSLFSNTLVKGLHSRIEDPSVVQT 492

Query: 418 AVKASATVVNQLPIEIRGPVI-SAYVGALRTAFTADIPIGILCFL 461
            V + AT    +      PVI  AY+ +L  ++   +  G    L
Sbjct: 493 VVSSGATGFRNVVEASYLPVIYDAYIHSLTASYKVALVAGAFSVL 537



>gi|115433719|ref|XP_001216996.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114189848|gb|EAU31548.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 547

 Score =  281 bits (718), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 173/475 (36%), Positives = 267/475 (56%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+  A+P I + FK+++ IAW  +AY LT TA QP+YG+   IF  K +FL A+  FE
Sbjct: 55  QTIIGVAIPEITNQFKSIEDIAWYGSAYFLTSTALQPSYGRLYKIFSVKWSFLAAIAFFE 114

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C +AP+ T +I+ RAIAG+G  GI S  M+II+  V L  R              
Sbjct: 115 IGSLICAVAPSSTVLIVGRAIAGIGVAGIFSGAMVIIALTVPLPKRPLVFGMFGMVWGVA 174

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGS----LLQKLKRID 176
               PLLGGAFTD V+WRW FYINLP+G I++ + +F+LR+P    +    L++++K++D
Sbjct: 175 SIVGPLLGGAFTDGVSWRWCFYINLPIGGISIAIVLFILRLPSNSDATTKPLIERIKQLD 234

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
           +IG  +++ + + LLL L WGGN+YPW++                    + +L      P
Sbjct: 235 FIGASILIPAIVCLLLALQWGGNQYPWNNSRIIGLFIGFGLMVIITIYTQIRLGDRATLP 294

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  VV   T   F G AFF LVYY+P++FQ V+G SA  SG++L+P++L  V++S
Sbjct: 295 PRIMKQRAVVAGATFAVFFGGAFFVLVYYLPIFFQSVRGASAMKSGIQLLPVMLATVVSS 354

Query: 297 VSSGQAVSRTDKFAYRTLSMTGA-ALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           V+ G  V+    F Y T  + G+ A+ AIG+GL+TL+ ++      I Y           
Sbjct: 355 VAVGILVT---VFGYYTPFLIGSTAIAAIGAGLVTLYSKDISSGKWIGYQILVGAGVGAG 411

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL 415
            Q  +   Q  +  +D+ + +A++MFF+ +G    +A+  ++F N L   I   A     
Sbjct: 412 FQIPITAVQTALPVEDIPTGSAVIMFFQTLGGALFIAVAQSVFQNGLIEGIVEYAPKVNP 471

Query: 416 AGAVKASAT----VVNQLPIEIR-GPVISAYVGALRTAFTADIPIGILCFLASLF 465
           A  VKA AT    V+ +L +E +   VI AY+  L+  +   + + ++ F+AS F
Sbjct: 472 ADIVKAGATEMREVLTRLHLEDQLSGVIDAYLSGLKDTYRVALALFLVSFVASCF 526



>gi|493092043|ref|WP_006130902.1| transmembrane efflux protein [Streptomyces gancidicus]
 gi|455651137|gb|EMF29889.1| transmembrane efflux protein [Streptomyces gancidicus BKS 13-15]
          Length = 833

 Score =  281 bits (718), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 175/494 (35%), Positives = 259/494 (52%), Gaps = 21/494 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  TAYLLT T   P YGK  D  GRK  F FA++ F 
Sbjct: 65  QMIVATALPKIVGELHGLDKMSWAITAYLLTATVGLPVYGKLGDQLGRKGVFQFAILVFV 124

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A  M  +I +RA+ GVG GG++  V  I++DIV  + RG++           
Sbjct: 125 VGSALAGRATTMDQLIAYRAVQGVGAGGLMIGVQAIMADIVPARQRGRFMGLIGAAFGLA 184

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY+N+P G +T++V   +L++P+P G      +R D +GT
Sbjct: 185 SVAGPLLGGYFTDHLSWRWCFYVNVPFGLVTMVVVALVLKLPKPTGR-----RRFDVLGT 239

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F +VE + A+EP+ P  LF
Sbjct: 240 LLLTAASTCLVLLTSWGGTEYAWDSRVVLGLGAGALAAAAAFLVVE-RFAVEPLIPLRLF 298

Query: 241 KR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    +V G        G+A F    Y+P Y Q+V G SAT SGL ++P++ G+V ASV 
Sbjct: 299 RDSVFNVTGL--VGLVIGVALFGAASYLPTYLQMVDGASATESGLLMLPMMGGIVGASVV 356

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ +SRT +  YR+  + GAAL  +G  L++  +  + R     +M          M  
Sbjct: 357 SGQMISRTGR--YRSHPVVGAALSVVGMWLLSRLETGTPRLHYSVWMFVLGAGIGMVMPV 414

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-ENIAIPPELAG 417
            +L  Q  V   D+ + T+   +FR IG   G A+ GT+F++ LT+ + E +      A 
Sbjct: 415 LVLAVQNSVRPADLGTATSANNYFRQIGGSVGAAVFGTLFADRLTDALAERLPADAAGAP 474

Query: 418 AVKASAT--VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM------GNH 469
           A   S T  +V+ LP E+R   + AY  A+   F   +P+ +L    + F+       +H
Sbjct: 475 ADAESITPQLVHSLPPELRDAYVQAYADAMPRIFLYLVPVLVLGLFIAFFLKEKPLVSHH 534

Query: 470 KPSLRTTDTVVAFE 483
            P+         FE
Sbjct: 535 TPTAEPAQEAPHFE 548



>gi|491207668|ref|WP_005066001.1| MFS transporter [Mycobacterium abscessus]
 gi|363999793|gb|EHM20995.1| drug resistance transporter [Mycobacterium massiliense CCUG 48898 =
           JCM 15300]
 gi|392084191|gb|EIU10016.1| squalene-hopene cyclase [Mycobacterium abscessus 5S-0304]
 gi|392091204|gb|EIU17015.1| squalene-hopene cyclase [Mycobacterium abscessus 5S-0421]
 gi|392093368|gb|EIU19166.1| squalene-hopene cyclase [Mycobacterium abscessus 5S-0422]
 gi|392097803|gb|EIU23597.1| squalene-hopene cyclase [Mycobacterium abscessus 5S-0817]
 gi|392106916|gb|EIU32700.1| squalene-hopene cyclase [Mycobacterium abscessus 5S-0708]
 gi|392109952|gb|EIU35725.1| squalene-hopene cyclase [Mycobacterium abscessus 5S-1212]
 gi|392117987|gb|EIU43755.1| squalene-hopene cyclase [Mycobacterium abscessus 5S-1215]
 gi|392167756|gb|EIU93438.1| squalene-hopene cyclase [Mycobacterium abscessus 5S-0921]
 gi|392241869|gb|EIV67356.1| squalene-hopene cyclase [Mycobacterium massiliense CCUG 48898]
          Length = 670

 Score =  280 bits (717), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 168/486 (34%), Positives = 254/486 (52%), Gaps = 22/486 (4%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 26  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 85

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 86  GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 145

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSL--LQKLKR--IDY 177
              PLLGG FTDH+ WRW+FYINLP+  + ++VA          G++  L K  R  IDY
Sbjct: 146 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVA---------AGAIPALAKATRPVIDY 196

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            G +++     AL L  +WGG  YPWSSP               F  VE+++  EP+ PP
Sbjct: 197 WGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVP-EPILPP 255

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S 
Sbjct: 256 RLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITST 315

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V RT +  Y+   + G A++AI   L++  ++++    Q  Y+          MQ
Sbjct: 316 GTGTLVGRTGR--YKRYPVAGTAIMAIALVLLSRMNDSTPFVLQSLYLFILGVGIGASMQ 373

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
              L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PP+   
Sbjct: 374 VLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPQ--- 430

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
               S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  D
Sbjct: 431 -ATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGAD 487

Query: 478 TVVAFE 483
           T +A +
Sbjct: 488 TSLAVD 493



>gi|256378876|ref|YP_003102536.1| EmrB/QacA subfamily drug resistance transporter [Actinosynnema
           mirum DSM 43827]
 gi|506283802|ref|WP_015803577.1| MFS transporter [Actinosynnema mirum]
 gi|255923179|gb|ACU38690.1| drug resistance transporter, EmrB/QacA subfamily [Actinosynnema
           mirum DSM 43827]
          Length = 685

 Score =  280 bits (717), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 169/460 (36%), Positives = 242/460 (52%), Gaps = 18/460 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I  +      ++WV T+Y+L  T      GKF D+FGRKA F  +V+ F 
Sbjct: 48  QTIVATALPTIVGEVGGAGHMSWVVTSYILAETVASVLAGKFGDLFGRKAVFQVSVVVFI 107

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS  CG A  M  +I  RA+ G+GGGGI      +I+D++ L++RGKYQ          
Sbjct: 108 VGSFFCGAADTMGGLIAMRALQGIGGGGIAVTATALIADVIPLRERGKYQGALGAVFGVT 167

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW+FY+N+PL A+ VIV +    IP   G+  +   RIDY G 
Sbjct: 168 TVVGPLLGGLFTDHLSWRWAFYVNVPL-ALAVIV-LAARAIP---GAGERGRPRIDYWGA 222

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L L   WGG EYPW S                F +VE ++  EP+ P  LF
Sbjct: 223 ALIALGASGLTLATTWGGTEYPWGSATIIGLFAGSAVALALFVVVENRVP-EPILPMRLF 281

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A    + ++P Y Q V G SAT+SGL  +P++LG++I ++ SG
Sbjct: 282 RGKVFAVASLLSFIVGFAMMGALTFLPSYLQYVSGASATSSGLRTLPMVLGLLITALLSG 341

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q V  T +  YR   + GAA+  +G  L++  D  S  A Q   M          MQ   
Sbjct: 342 QVVGATGR--YRPFPIAGAAVTGVGMYLLSTLDPRSSIAAQSLAMFVLGAGIGLVMQVLT 399

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q   +Y+D+ + T+ + FFR +G+ FG +I+GT+++N L        +PP LA    
Sbjct: 400 IVVQNTADYRDLGAATSGVTFFRSLGSSFGASIMGTVYANRLAET-----LPPALAQTRT 454

Query: 421 ASATV-----VNQLPIEIRGPVISAYVGALRTAFTADIPI 455
             A +     ++ LP   R P+I+AY  AL T F A +PI
Sbjct: 455 PPAAITTPEALHALPDAARQPIITAYADALHTVFLAAVPI 494



>gi|491268690|ref|WP_005126827.1| MFS transporter [Mycobacterium abscessus]
 gi|392190889|gb|EIV16517.1| squalene-hopene cyclase [Mycobacterium massiliense 2B-0307]
          Length = 667

 Score =  280 bits (716), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 168/486 (34%), Positives = 253/486 (52%), Gaps = 22/486 (4%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 23  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 82

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 83  GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 142

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSL--LQKLKR--IDY 177
              PLLGG FTDH+ WRW+FYINLP+  + ++VA          G++  L K     IDY
Sbjct: 143 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVA---------AGAIPALAKATHPVIDY 193

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            G +++     AL L  +WGG  YPWSSP               F  VE+++  EP+ PP
Sbjct: 194 WGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVP-EPILPP 252

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S 
Sbjct: 253 RLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITST 312

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V RT +  Y+   + G A++AI   L++  D+++    Q  Y+          MQ
Sbjct: 313 GTGTLVGRTGR--YKRYPVAGTAIMAIALVLLSRMDDSTPFVLQSLYLFILGVGIGASMQ 370

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
              L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PP+   
Sbjct: 371 VLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPQ--- 427

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
               S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  D
Sbjct: 428 -ATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGAD 484

Query: 478 TVVAFE 483
           T +A +
Sbjct: 485 TSLAVD 490



>gi|397678752|ref|YP_006520287.1| MFS-type transporter [Mycobacterium massiliense str. GO 06]
 gi|507419896|ref|YP_008021420.1| putative MFS-type transporter [Mycobacterium abscessus subsp.
           bolletii 50594]
 gi|504663204|ref|WP_014850306.1| MFS transporter [Mycobacterium abscessus]
 gi|395457017|gb|AFN62680.1| putative MFS-type transporter [Mycobacterium massiliense str. GO
           06]
 gi|506961175|gb|AGM27556.1| putative MFS-type transporter [Mycobacterium abscessus subsp.
           bolletii 50594]
          Length = 692

 Score =  280 bits (715), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 169/484 (34%), Positives = 252/484 (52%), Gaps = 18/484 (3%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 48  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 107

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 108 GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 167

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR--IDYIG 179
              PLLGG FTDH+ WRW+FYINLP+  + ++VA     IP      L K     IDY G
Sbjct: 168 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVAAGA--IP-----ALAKATHPVIDYWG 220

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
            +++     AL L  +WGG  YPWSSP               F  VE+++  EP+ PP L
Sbjct: 221 IVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVP-EPILPPRL 279

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S  +
Sbjct: 280 FRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITSTGT 339

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  V RT +  Y+   + G A++AI   L++  D+++    Q  Y+          MQ  
Sbjct: 340 GTLVGRTGR--YKRYPVAGTAIMAIALVLLSRMDDSTPFVLQSLYLFILGVGIGASMQVL 397

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV 419
            L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PP+     
Sbjct: 398 TLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPQ----A 453

Query: 420 KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTDTV 479
             S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  DT 
Sbjct: 454 TQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGADTS 511

Query: 480 VAFE 483
           +A +
Sbjct: 512 LAVD 515



>gi|491205209|ref|WP_005063548.1| MFS transporter [Mycobacterium abscessus]
 gi|353449466|gb|EHB97863.1| drug resistance transporter [Mycobacterium abscessus 47J26]
 gi|392140241|gb|EIU65971.1| squalene-hopene cyclase [Mycobacterium massiliense 1S-151-0930]
 gi|392142030|gb|EIU67755.1| squalene-hopene cyclase [Mycobacterium massiliense 1S-152-0914]
 gi|392156464|gb|EIU82166.1| squalene-hopene cyclase [Mycobacterium massiliense 1S-153-0915]
 gi|392158551|gb|EIU84247.1| squalene-hopene cyclase [Mycobacterium massiliense 1S-154-0310]
 gi|392160331|gb|EIU86022.1| squalene-hopene cyclase [Mycobacterium massiliense 2B-0626]
 gi|392190727|gb|EIV16357.1| squalene-hopene cyclase [Mycobacterium massiliense 2B-0912-R]
 gi|392203108|gb|EIV28704.1| squalene-hopene cyclase [Mycobacterium massiliense 2B-0912-S]
 gi|392256368|gb|EIV81827.1| squalene-hopene cyclase [Mycobacterium massiliense 2B-1231]
 gi|392256515|gb|EIV81972.1| squalene-hopene cyclase [Mycobacterium massiliense 2B-0107]
          Length = 670

 Score =  280 bits (715), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 168/486 (34%), Positives = 253/486 (52%), Gaps = 22/486 (4%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP + +D       +WV T+YLL  T      GKF D+FGR+  F+  ++ F  
Sbjct: 26  TIVATALPTVVADLGDAGHQSWVVTSYLLASTVATAVMGKFGDLFGRRTVFITCIVIFAG 85

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSLLCG+A +M  ++  RAI G+G GG++     +I +I+ +++RG+YQ           
Sbjct: 86  GSLLCGMAGSMAMLVGARAIQGLGSGGLMVTATALIGEIIPMRERGRYQGILGAVFGVTT 145

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSL--LQKLKR--IDY 177
              PLLGG FTDH+ WRW+FYINLP+  + ++VA          G++  L K     IDY
Sbjct: 146 VIGPLLGGLFTDHLGWRWAFYINLPISVVVIMVA---------AGAIPALAKATHPVIDY 196

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            G +++     AL L  +WGG  YPWSSP               F  VE+++  EP+ PP
Sbjct: 197 WGIVLIGLGASALTLATSWGGTTYPWSSPVIIGLFASSIAAIGTFVWVESRVP-EPILPP 255

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF+      C   +F  G A   ++ Y+P + Q V G SAT SGL  +P++ G++I S 
Sbjct: 256 RLFRDPVFTICCVLSFVVGFAMLGVMTYLPTFMQFVNGVSATVSGLRTLPMVAGMLITST 315

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V RT +  Y+   + G A++AI   L++  D+++    Q  Y+          MQ
Sbjct: 316 GTGTLVGRTGR--YKRYPVAGTAIMAIALVLLSRMDDSTPFVLQSLYLFILGVGIGASMQ 373

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
              L  Q    + D+   T+ + FFR IG+ FG AI G++FSN LT  + ++  PP+   
Sbjct: 374 VLTLIVQNTARFDDLGVATSGVTFFRTIGSSFGAAIFGSLFSNFLTRELSSVNTPPQ--- 430

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
               S   ++ LP +   PVI AY  +L   F    P+  + F+ +LF+   +  LR  D
Sbjct: 431 -ATQSPQALHALPHDAAVPVIHAYADSLDLVFLCAAPVAAVGFVLALFL--KEVPLRGAD 487

Query: 478 TVVAFE 483
           T +A +
Sbjct: 488 TSLAVD 493



>gi|300786491|ref|YP_003766782.1| major facilitator superfamily transporter [Amycolatopsis
           mediterranei U32]
 gi|384149815|ref|YP_005532631.1| major facilitator superfamily transporter [Amycolatopsis
           mediterranei S699]
 gi|399538374|ref|YP_006551036.1| major facilitator transporter [Amycolatopsis mediterranei S699]
 gi|502991473|ref|WP_013226449.1| MFS transporter [Amycolatopsis mediterranei]
 gi|299796005|gb|ADJ46380.1| major facilitator transporter [Amycolatopsis mediterranei U32]
 gi|340527969|gb|AEK43174.1| major facilitator transporter [Amycolatopsis mediterranei S699]
 gi|398319144|gb|AFO78091.1| major facilitator transporter [Amycolatopsis mediterranei S699]
          Length = 676

 Score =  280 bits (715), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 166/467 (35%), Positives = 252/467 (53%), Gaps = 10/467 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I  D      ++WV T+YLL  T      GK  D+FGRK  F  +VI F 
Sbjct: 40  QTIVGTALPTIVGDLGGAGHLSWVVTSYLLAETIMTVVVGKLGDLFGRKLMFQLSVIVFG 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS   G A +M  +I++RA+ G+GGGG++     +I+D+V L++RGKYQ          
Sbjct: 100 IGSFCAGFADSMVWLIVWRAVQGLGGGGLMVTSTALIADVVPLRERGKYQGVLGSVFGVV 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P+LGG F DH++WRW+FY+N+PL  + ++VA   +  P  + ++      IDY+G 
Sbjct: 160 TVAGPMLGGFFVDHLSWRWAFYVNIPLVVVVLVVASSAM--PNARAAVKPV---IDYLGI 214

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  +   L L  +WGG +Y W SP               F  VE + A EP+ P  LF
Sbjct: 215 LLIGLAATGLTLVTSWGGTQYAWGSPVIIGMAAGSVVLLAAFVFVELR-AQEPMLPMRLF 273

Query: 241 KR-LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           +  +  VG   + F  G A    + Y+P Y Q V+G SATTSG+ L+P++L +++AS+++
Sbjct: 274 RNPVFTVGGIMS-FVVGFAMLGALSYLPTYMQYVQGTSATTSGVRLLPMVLALLVASIAA 332

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G AVSRT +  Y+   + GAA + IG  L++  D ++G      YM          MQ  
Sbjct: 333 GNAVSRTGR--YKIFPLAGAAGMTIGLYLLSRLDTDTGFWEASAYMAVLGLGIGLGMQVL 390

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV 419
            +  Q  V+Y D+   T+ + F R IG+ FG AI GT+++N LT  +  + +P  +    
Sbjct: 391 TIAVQNTVDYADLGVATSGVTFLRSIGSSFGAAIFGTVYANQLTPQLAALPVPRGVDPRA 450

Query: 420 KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
               T ++ LP  +  PVI AY  +L   F A  P+G++ F  + F+
Sbjct: 451 LQVPTALHALPEAVSAPVIKAYSDSLHVVFLAAAPVGLVAFALAFFL 497



>gi|493393366|ref|WP_006349512.1| DSBA oxidoreductase [Streptomyces tsukubaensis]
 gi|385665922|gb|EIF89537.1| major facilitator superfamily permease [Streptomyces tsukubaensis
           NRRL18488]
          Length = 697

 Score =  280 bits (715), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 189/477 (39%), Positives = 263/477 (55%), Gaps = 17/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I S+   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 42  QTIVSTALPTIVSELGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKKLFQTAIVIFL 101

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ DIV  ++RG+YQ          
Sbjct: 102 IGSALCGVAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDIVPPRERGRYQGLFGAVFGAS 161

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIP-RPKGSLLQKLKRIDYIG 179
               PLLGG FT+H++WRW FYINLP+GA+ ++V   +LRIP RP          IDY+G
Sbjct: 162 SILGPLLGGFFTEHLSWRWVFYINLPIGAVALVVIAAVLRIPARP------TRHTIDYLG 215

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
           T ++     A +L  + GG  + W SP               F  VE + A EPV PPHL
Sbjct: 216 TFLIAAVATAFVLVASLGGTTWAWGSPQIIGLSVIGAVLLVWFVFVEFR-AAEPVLPPHL 274

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+          +F  G A F  + ++P + QVV+G S T SG+ ++P++LG++IAS  S
Sbjct: 275 FRIRTFTLVSVISFVIGFAMFGAMTFLPTFLQVVRGVSPTLSGVHMLPMVLGLLIASTGS 334

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           GQ VSRT +  ++   + G  + A+G  L+    E S       Y           MQ  
Sbjct: 335 GQLVSRTGR--WKVFPVLGTGITAVGLLLLHRLTEFSPDWEISLYFFVFGFGLGLVMQVL 392

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL 415
           +L  Q  V Y+D+   T+   FFR IGA FGVAI GTIFSN L + +  +     +PP  
Sbjct: 393 VLVVQNSVRYEDLGVATSGATFFRSIGASFGVAIFGTIFSNGLNDKLSAVLAGRPVPPG- 451

Query: 416 AGAVK--ASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AGA +  A    + QLP  +RGPV+ A+  A+   F   +P+ +L F+ S F+   K
Sbjct: 452 AGAAELAADPQAIAQLPPALRGPVLHAFASAITDVFLYAVPVVLLAFVISWFLREDK 508



>gi|328857443|gb|EGG06559.1| hypothetical protein MELLADRAFT_106478 [Melampsora larici-populina
           98AG31]
          Length = 628

 Score =  280 bits (715), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 184/501 (36%), Positives = 261/501 (52%), Gaps = 35/501 (6%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI++ ALP IAS+F +LD+I W+A+AY +T  +F   Y +    F R+  F+ AV  FE
Sbjct: 119 QTILSPALPVIASNFNSLDQIGWIASAYFITQVSFLLLYAQLLMTFNRRWVFIMAVSIFE 178

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C L+PN   +II RA+AGVG  GI    + II+DI  L+DR K            
Sbjct: 179 IGSLICALSPNAICLIIARAVAGVGAAGIFVSCLSIIADITELEDRPKLLGSFGAVFAAS 238

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLL--------------------- 159
               PLLGGAFTDH++WRW F+INLP GAIT I++IFL+                     
Sbjct: 239 SVIGPLLGGAFTDHLSWRWCFWINLPCGAIT-ILSIFLVIPDSTPPEVSEEMHGMVDLKW 297

Query: 160 ------RIPRPKGSLLQKLKRIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXX 213
                 R     GS L KL  +D+IG +++VG  + L+LPL WGGN+Y W SP       
Sbjct: 298 NRITFGRWTPMHGSFLHKLGTLDFIGALLMVGLIVLLVLPLQWGGNQYAWRSPVVIGTFC 357

Query: 214 XXXXXXXXFGLVETKLAIEPVA----PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLY 269
                   F L E K   E +     P  LF     +G     FF  +   + VY++P++
Sbjct: 358 GFGALLAVFLLWEWKGVDEKIGSSLFPFRLFANRTQIGTCLQAFFVMLTMLTAVYFLPIH 417

Query: 270 FQVVKGDSATTSGLELIPLILGVVIASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLI 329
           F+ VK  SAT SG++L+PL+L +V+++  +G A+S T    Y    + G  L+ +GSGL+
Sbjct: 418 FEAVKNASATKSGIDLLPLMLSIVVSAGCAGFAISSTGY--YWPALVVGPVLLTVGSGLL 475

Query: 330 TLWDENSGRAPQICYMXXXXXXXXXXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVF 389
              DE S     I +           +Q  ++  Q  V  +DV   T+++ F +LIG V 
Sbjct: 476 HTLDEFSSNGKLIGFQIIIGTGIGLVLQNVIVAIQANVREEDVPQATSMVTFAQLIGGVI 535

Query: 390 GVAIVGTIFSNVLTNNIENIAIPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAF 449
           G+A+V TIF N LT N+   A P      V++S   +  LP  +R  VI AY   LR  +
Sbjct: 536 GIAVVQTIFGNALTTNLIKFA-PNAPFALVQSSVESIATLPDSVRPGVIHAYTNTLRQVY 594

Query: 450 TADIPIGILCFLASLFMGNHK 470
              IP G+  FL+S  + +  
Sbjct: 595 ILGIPSGVGAFLSSFLVKSRN 615



>gi|271969842|ref|YP_003344038.1| arabinose efflux permease-like protein [Streptosporangium roseum
           DSM 43021]
 gi|502658881|ref|WP_012895024.1| DSBA oxidoreductase [Streptosporangium roseum]
 gi|270513017|gb|ACZ91295.1| Arabinose efflux permease-like protein [Streptosporangium roseum
           DSM 43021]
          Length = 666

 Score =  280 bits (715), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 173/488 (35%), Positives = 266/488 (54%), Gaps = 18/488 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L +++WV TAY+L+ T   P +GK  D +GRK+ F  A++ F 
Sbjct: 34  QTIVSTALPTIVSDLGGLGELSWVVTAYILSSTVSTPLWGKLGDQYGRKSLFQAAIVVFL 93

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGL+ NM  +I FRA+ G+GGGG++ L   I+ D+V +++RG+YQ          
Sbjct: 94  AGSALCGLSRNMGELIGFRALQGLGGGGLMVLAQAIVGDVVPVRERGRYQGFFGAVFAVS 153

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F DH++W W FY+NLP+G + +IV   +L    P G+   +   IDY+G 
Sbjct: 154 SVAGPLLGGLFVDHLSWHWVFYVNLPIGVLALIVISSVL----PSGTERTR-HTIDYLGM 208

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           + + G    L+L   WGG  YPW  P               +   E K A EPV PP LF
Sbjct: 209 VFLGGGAACLVLMATWGGTAYPWGDPVVVGLGVAAAALLALWWQAE-KRAAEPVLPPRLF 267

Query: 241 KRLHVVGCFT-TNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
            R+ V    +   F  G A F  + Y+PL+ QVV+G S T SG+ L+P++ G+++ S+ S
Sbjct: 268 -RMRVFNVASLIGFVVGFAMFGPLTYMPLFLQVVQGVSPTASGIHLLPMMGGMLVTSIVS 326

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           GQ ++R+ +  Y+   + G A++++G  L++   E+        Y+          MQ  
Sbjct: 327 GQIITRSGR--YKVFPILGTAIVSLGLYLLSHVHEDISTLRLSVYLLVLGVGIGLVMQVL 384

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI----ENIAIPPEL 415
           ++  Q  V ++D+   T+   FFRLIG  FGVAI G+IF++ LT+++      ++IPP +
Sbjct: 385 VIVVQNAVGFEDLGVATSGATFFRLIGGSFGVAIAGSIFTSRLTDDLVRLSRTVSIPPGM 444

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRT 475
              V++  T V +LP E     ++AY  A+   F    P+ ++ F A+  +    P L  
Sbjct: 445 ERTVQSDPTAVRRLPPETAAAFLAAYSDAIAHVFLFSAPVALVAFAAAWLL----PELPL 500

Query: 476 TDTVVAFE 483
            +T  A +
Sbjct: 501 RETTKAAD 508



>gi|490695857|ref|WP_004559526.1| major facilitator transporter [Amycolatopsis vancoresmycina]
 gi|486080246|gb|EOD63675.1| major facilitator transporter [Amycolatopsis vancoresmycina DSM
           44592]
          Length = 677

 Score =  279 bits (714), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 165/467 (35%), Positives = 252/467 (53%), Gaps = 11/467 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I  D      ++WV T+YLL  T      GK  D+FGRK  F  +VI F 
Sbjct: 40  QTIVGTALPTIVGDLGGAGHLSWVVTSYLLAETIMTVVVGKLGDLFGRKLLFQLSVIVFG 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS   G A +M  +I++RA+ G+GGGG++     +I+D+V L++RGKYQ          
Sbjct: 100 IGSFCAGFAGSMVWLIVWRAVQGLGGGGLMVTSTALIADVVPLRERGKYQGVLGSVFGVV 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P+LGG F DH++WRW+FY+N+P   + V++ +    +P  + ++      IDY+G 
Sbjct: 160 TVAGPMLGGFFVDHLSWRWAFYVNIP--LVVVVLVVASSAMPNARAAVKPV---IDYLGI 214

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  +   L L  +WGG +Y W SP               F   E + A EP+ P  LF
Sbjct: 215 LLIGLAATGLTLVTSWGGTQYAWGSPVIIGMAAGSLVLLAAFVFTELR-AKEPMLPMRLF 273

Query: 241 KR-LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           +  +  VG   + F  G A    + Y+P Y Q V+G SATTSG+ L+P++L +++AS+++
Sbjct: 274 RNPVFTVGGIMS-FVVGFAMLGALSYLPTYMQYVQGTSATTSGVRLLPMVLALLVASIAA 332

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G AVSRT +  Y+   + GAA + IG  L++  D ++G      YM          MQ  
Sbjct: 333 GNAVSRTGR--YKIFPLAGAAGMTIGLYLLSRLDTDTGFWEASAYMAVLGLGIGLGMQVL 390

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV 419
            +  Q  V+Y D+   T+ + F R IG+ FG AI GT+++N LT  +   A+PP +   V
Sbjct: 391 TIAVQNTVDYADLGVATSGVTFLRSIGSSFGAAIFGTVYANQLTPKLAA-AVPPGIDSRV 449

Query: 420 KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
               T ++ LP  +  PVI AY  +L   F A  P+G++  + + F+
Sbjct: 450 VQVPTALHALPEAVSAPVIKAYSDSLHVVFLAAAPVGLVALVLAFFL 496



>gi|494728857|ref|WP_007464723.1| transporter [Micromonospora lupini]
 gi|385883746|emb|CCH21133.1| Drug resistance transporter, emrB/qacA subfamily [Micromonospora
           lupini str. Lupac 08]
          Length = 527

 Score =  279 bits (713), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 160/456 (35%), Positives = 243/456 (53%), Gaps = 19/456 (4%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV+TALP I  +F  L+   WV TAY+L  T   P +GK  D++GRK+ FL +V  F +G
Sbjct: 33  IVSTALPRIVGEFGGLNHFTWVVTAYVLGTTVSTPIWGKLGDLYGRKSVFLTSVGIFLVG 92

Query: 63  SLLCGLA---------PNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXX 113
           S LCG+A           M  +I FRA+ G+G GG++  VM II D+V  ++RG+YQ   
Sbjct: 93  SALCGMAGSGMFGGPQDGMVQLIAFRAVQGLGAGGLMVGVMAIIGDLVPPRERGRYQGMI 152

Query: 114 XXXXXXXXXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLK 173
                      PL+GG  TD+++WRW+FY+NLPLG I ++V I  + +P+ +        
Sbjct: 153 AGIMAIAMVAGPLVGGFITDNLSWRWAFYVNLPLGGIALLVLITTMHLPKYRTE-----H 207

Query: 174 RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP 233
           RID++G  ++     A++L   WGGNEY W+SP               FGLVE ++  EP
Sbjct: 208 RIDWLGAALLSVGITAIVLITTWGGNEYDWTSPQILGLAVLALVALVAFGLVERRVP-EP 266

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
           + P  LF   +        F  G A F  + ++PLY Q V+G SAT SGL L+PL+ G++
Sbjct: 267 ILPLALFANRNFALISLIGFLLGFAMFGAMNFLPLYQQTVQGASATNSGLLLLPLMFGML 326

Query: 294 IASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXX 353
           + S+  G+A+++T K  YR   + G  ++  G  L+++ D ++ +     YM        
Sbjct: 327 VVSLVIGRAITKTGK--YRAYPIIGGVVMTGGMALLSMLDTDTSKLASSLYMVVLGAGMG 384

Query: 354 XXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPP 413
             MQT++L  Q  VE KD+ + +    FFR IG  FG+++ G IF+N L ++    A   
Sbjct: 385 FLMQTSMLIAQNSVEQKDLGAASGAATFFRSIGGSFGISLFGAIFANRLADSAAGRAFTG 444

Query: 414 ELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAF 449
              G +      + QLP + R  V++    A+   F
Sbjct: 445 GGEGGMDLEK--LKQLPAQARELVLTGLSDAISHVF 478



>gi|409044117|gb|EKM53599.1| hypothetical protein PHACADRAFT_186224 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 639

 Score =  279 bits (713), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 176/490 (35%), Positives = 262/490 (53%), Gaps = 19/490 (3%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP I++ F A   ++WV +AYLLT TAFQP YG+FSDIFGRKA    A+  +  
Sbjct: 97  TIVATALPTISAAFNAGSVVSWVPSAYLLTSTAFQPLYGRFSDIFGRKAAMCMAMGAYMF 156

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           G LL G + ++  +IIFR IAG GGGGI+S++ IIISD+VSL+DRGKYQ           
Sbjct: 157 GCLLAGFSKSIIQLIIFRGIAGAGGGGIVSVLQIIISDVVSLRDRGKYQGIIGGVISLGY 216

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTI 181
              P++GG      +WRW F++ LP+ A  V + + +L + R +G+  +KL  IDY G  
Sbjct: 217 ALGPVIGGLLAQKASWRWCFWVTLPVSAFAVAMVLLVLPLKRVEGNFRRKLMVIDYFGCA 276

Query: 182 VVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFK 241
           + + +   LLLPL WGG  +PW+S                F L E K A  P+ P ++FK
Sbjct: 277 LTLVACALLLLPLIWGGVTFPWTSAVVLAPLCSSAVVVGIFCLWEWKGAKLPIVPMYIFK 336

Query: 242 RLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQ 301
            + V G + T F  GM FFS +YY+P +FQV    S   SG+ L+P+++   +AS  +GQ
Sbjct: 337 HVTVTGVYITMFINGMIFFSALYYLPQFFQVALAYSPIRSGVFLLPVLVSQTVASFCAGQ 396

Query: 302 AVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLL 361
            +S+T +  YRT+   G ++ AIG G ++    ++ +   + +M          +QTT +
Sbjct: 397 IISKTGR--YRTVIHIGFSVWAIGCGCVSTIKPSTPKGLTVFFMLMTGTGGGQTLQTTTV 454

Query: 362 CGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIP--------- 412
             Q  V  +D++ VTA+  F RL+G    +AI  TI +N L +++  + +P         
Sbjct: 455 AAQASVSRRDMSVVTAVRNFVRLLGGTLALAIGSTIINNSLQHSMTELNLPSSTIKKIVD 514

Query: 413 -PELAGAVKASATVVNQLPIEIRG-------PVISAYVGALRTAFTADIPIGILCFLASL 464
            P L GA    A      P+   G        +++ Y    R  F  +  +  +  + S+
Sbjct: 515 DPTLLGARLTGAMNSTSNPLSAIGISPDAADHILNGYNNGFRVVFIMNAVLAAIATIVSI 574

Query: 465 FMGNHKPSLR 474
            M  HK   R
Sbjct: 575 LMIRHKELTR 584



>gi|117929097|ref|YP_873648.1| EmrB/QacA family drug resistance transporter [Acidothermus
           cellulolyticus 11B]
 gi|500040007|ref|WP_011720725.1| multidrug MFS transporter [Acidothermus cellulolyticus]
 gi|117649560|gb|ABK53662.1| drug resistance transporter, EmrB/QacA subfamily [Acidothermus
           cellulolyticus 11B]
          Length = 569

 Score =  278 bits (711), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 170/463 (36%), Positives = 244/463 (52%), Gaps = 17/463 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I  D      +AWV TAYLLT TA  P YGK SD++GR+  F  A++ F 
Sbjct: 39  QTIVATALPRITGDLGGQQHLAWVVTAYLLTSTASTPLYGKISDLYGRRKIFQLAIVIFL 98

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS L G + NM  +I+ RAI G+G GG+++L + I+ DI+  ++RG+YQ          
Sbjct: 99  IGSALAGASQNMAELIVTRAIQGLGAGGLITLALAIVGDIIPPRERGRYQGYFGAVFGLS 158

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTD ++WRW FYINLPLGA+ ++V   +L IP       ++  ++DY+G 
Sbjct: 159 SVIGPLLGGWFTDTISWRWVFYINLPLGALALVVTSAVLHIP-----FQRREHKVDYLGA 213

Query: 181 IVVVGSTIALLLPLNWGGNE----YPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            V+V +T A+LL L+ GG      Y W SP               F  VE + A EP+ P
Sbjct: 214 AVLVAATSAVLLALSLGGKAGNGGYAWGSPQIIGLFALSALLFAAFVAVEAR-AAEPILP 272

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
             LF+        +  F  G A F  V ++P+Y Q VKG S T SGL+L+PL+ GV+  S
Sbjct: 273 LRLFRNRVFTVANSAGFILGFALFGAVIFLPVYLQNVKGSSPTVSGLQLLPLMAGVLFTS 332

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + SG+ ++ T +  Y+   + G  L++I   +++     +  A     +          M
Sbjct: 333 IGSGRLITATGR--YKIYPIVGMVLVSIAFAMLSFLKAGTSYATLAGEIALLGAGMGLVM 390

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELA 416
           Q  +L  Q  V Y D+   T+   FFR +G+  GVA+ G I +N LT  + + A P   A
Sbjct: 391 QVLVLAIQNAVPYADLGVATSSNAFFRSMGSSLGVAVFGAIATNGLTAYVRSHATPDIRA 450

Query: 417 GAVKA-----SATVVNQLPIEIRGPVISAYVGALRTAFTADIP 454
           G + A      A     +P EI+    +A+V A+   F   IP
Sbjct: 451 GLLAALNKGQQAASQAAVPPEIKTLFANAWVHAIHLTFLWAIP 493



>gi|374990280|ref|YP_004965775.1| multidrug-efflux transporter [Streptomyces bingchenggensis BCW-1]
 gi|503946100|ref|WP_014180094.1| DSBA oxidoreductase [Streptomyces bingchenggensis]
 gi|297160932|gb|ADI10644.1| multidrug-efflux transporter [Streptomyces bingchenggensis BCW-1]
          Length = 691

 Score =  278 bits (710), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 183/483 (37%), Positives = 257/483 (53%), Gaps = 15/483 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I SD   L  ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 46  QTIVATALPTIVSDLGGLSHLSWVVTAYLLASTAATPLWGKLGDQYGRKKLFQAAIVIFL 105

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCGLA NM  +I+FR + G+GGGG++ L M I+ DIV+ ++RG+YQ          
Sbjct: 106 IGSALCGLARNMPELIVFRGLQGLGGGGLIVLSMAIVGDIVTPRERGRYQGLFGAVFGAT 165

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F DH++WRW FYIN+PLG I + V   +L IP     +      IDY+GT
Sbjct: 166 SVLGPLLGGLFVDHLSWRWVFYINIPLGIIALAVIATVLHIP-----VRGARHTIDYLGT 220

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++     AL+L  + GG  YPW S                F  VE + A EPV P +LF
Sbjct: 221 LLIASVAAALVLMTSLGGVTYPWGSWQIVGLALLGLVLLVTFVRVEGR-AAEPVLPLYLF 279

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C    F  G A F  + Y+P + QVV+G S T SG+ ++P++ G+++AS  SG
Sbjct: 280 RSRSFALCSVIGFVVGFAMFGSMTYLPTFLQVVQGVSPTLSGVHMLPMVFGMLLASTGSG 339

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT    Y+   + G  + AIG  L+     ++G A    Y           MQ  +
Sbjct: 340 QVVSRTGH--YKIFPILGTGITAIGLLLLHQLRPSTGVAETSVYFFVFGFGLGLVMQVLV 397

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL- 415
              Q  V Y+D+   T+   FFR IG  FGV++ GTIF+N L  ++ N+     +PP + 
Sbjct: 398 TIVQNSVRYQDLGVATSGNTFFRSIGGSFGVSVFGTIFANSLAPHLANVLAGQPLPPGVD 457

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRT 475
             A+ A    V  LP  +R  V+ AY  ++   F    P  ++ F+ + F+  H+  LR 
Sbjct: 458 PSALSADPRGVRLLPPGLRERVLDAYSVSITDVFLYAAPFVVIAFVLAWFL--HEEPLRA 515

Query: 476 TDT 478
           + T
Sbjct: 516 SVT 518



>gi|395323712|gb|EJF56172.1| MFS general substrate transporter [Dichomitus squalens LYAD-421
           SS1]
          Length = 569

 Score =  277 bits (709), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 173/483 (35%), Positives = 266/483 (55%), Gaps = 17/483 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TIVATALP I++ F A   ++WV +AY LT TAFQP YG+FSDIFGRKA    A+ TF 
Sbjct: 43  STIVATALPTISAAFNAGSVVSWVPSAYFLTSTAFQPLYGRFSDIFGRKAALCLAMGTFM 102

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL  G +  +  +I+ R +AG GGGGI+S+  I+ISD+VSL+DRGKYQ          
Sbjct: 103 VGSLAAGFSRTIIELIVLRGLAGAGGGGIVSMAQIVISDVVSLRDRGKYQGIIGVVVAFG 162

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG   +   WRW F++ LP+    +I  +++L +   +G++ +KL  +DY GT
Sbjct: 163 WAVGPLMGGILAEKAGWRWCFWVTLPVSLCALIFVLYVLPLKSVEGNIKKKLAVVDYFGT 222

Query: 181 -IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
            + +VG T+ ++LP+ WGG  +PWSSP               F + E K A  P+ P ++
Sbjct: 223 ALTLVGCTL-VILPIIWGGVTFPWSSPVVLAPLCSGAVVIAIFCIWEWKGARLPIIPMYI 281

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           FK++ V G +   F  G+ F+S ++Y+P YFQV    SA  SG+ L+P+++   + S  S
Sbjct: 282 FKQITVTGVYIAMFINGVVFYSSLFYIPQYFQVALSYSAIRSGVFLLPVLVSQTLGSFIS 341

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           GQ VSRT +  YRT    G A+  +G G ++    ++ +   + +M          +QTT
Sbjct: 342 GQMVSRTGR--YRTNIYCGFAVWTVGCGCLSTITPSTPKGLLVFFMLLAGFGAGGTLQTT 399

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVL----------TNNIENI 409
            +  Q  V  +D++ VTA+  F RL+G    +AI  TI +N L          ++ I  I
Sbjct: 400 TVAAQASVSRRDMSVVTAVRNFIRLLGGTLSLAIGATIINNSLRATMTSLGLASSTISQI 459

Query: 410 AIPPELAGA-VKASATVVNQLPI--EIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
              P + GA   AS + +  L I  +I   ++ +Y+   RT F  +  +  +  +A++ M
Sbjct: 460 VDDPTILGARTSASESSLTDLGISADIAQRILDSYIKGFRTVFIMNASLNAVATMAAITM 519

Query: 467 GNH 469
             H
Sbjct: 520 IRH 522



>gi|322702462|gb|EFY94108.1| MFS transporter [Metarhizium anisopliae ARSEF 23]
          Length = 587

 Score =  277 bits (709), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 165/470 (35%), Positives = 248/470 (52%), Gaps = 9/470 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   F A++ + W  +AYLLT  A Q  +GK    +  K  +LFA+  FE
Sbjct: 102 NTIIATAIPRITDQFHAIEDVGWYGSAYLLTTCAVQLIFGKLYTFYSVKWVYLFAIFLFE 161

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG  PN   +I+ RAIAG+G  G+ S  ++II+  V L+ R  Y           
Sbjct: 162 LGSLVCGATPNSVGLILGRAIAGLGAAGVFSGALLIINRSVPLRQRPMYMGIIGSMYGIA 221

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP-----KGSLLQKLKRI 175
               PL+GGAFTDHVTWRW FYINLP G +TV   I  LR+P+P     K S  ++L   
Sbjct: 222 SVAGPLMGGAFTDHVTWRWCFYINLPFGGVTVAFIIAFLRLPKPRVAKTKLSFKEQLMSF 281

Query: 176 DYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVA 235
           D +GT++ +   ++LLL L WGG +YPW                  F  V+  L  +   
Sbjct: 282 DLLGTVLFIPGIVSLLLALQWGGTKYPWKDGRIIALFVVFGVLIAGFLAVQVWLKEKATV 341

Query: 236 PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIA 295
           PP +F    V  C       G AFF +VYY+P++FQ V+G +A  SG++ +P+IL +VI 
Sbjct: 342 PPRVFLNRTVWSCAVFGACLGAAFFVMVYYLPIWFQAVQGTTAIDSGIKNLPMILSLVIF 401

Query: 296 SVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           S+ SG  V+    +A   ++ T   L+++G+G+++ +D N+G A  I Y           
Sbjct: 402 SLVSGGLVTTLGYYAPFMIAST--ILMSVGAGMLSTFDVNTGPAHWIGYQILFGIGVGLG 459

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPP-E 414
           MQ T++  Q  ++  DVA  TA+++F + +G    + +   +F N L +N+ +  I   +
Sbjct: 460 MQQTMVAIQASLDGADVAIGTAIIIFSQTLGGALFICVAQNVFQNKLVSNVADAHIQGLD 519

Query: 415 LAGAVKASAT-VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLAS 463
            A  V   AT + N +P E    V+ AY GA+   F     +  L  + S
Sbjct: 520 PASVVSVGATQIQNMIPKEFLPVVLEAYNGAVTNTFYVSAAMAALSIIGS 569



>gi|491090930|ref|WP_004952538.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           mobaraensis]
 gi|453049723|gb|EME97297.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           mobaraensis NBRC 13819 = DSM 40847]
          Length = 703

 Score =  277 bits (709), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 177/471 (37%), Positives = 259/471 (54%), Gaps = 13/471 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAY+L  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 58  QTIVSTALPTIVSDLGGLEHLSWVVTAYMLASTAATPLWGKLGDQYGRKKLFQTAIVIFL 117

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS+LCG+A NM  +I FRA+ G+GGGG++ L M I+ DIV  ++RG+YQ          
Sbjct: 118 VGSVLCGIARNMPELIAFRAVQGLGGGGLMVLSMAIVGDIVPPRERGRYQGLFGAVFGGT 177

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F DH++WRW FYIN+P+G I + V   +L IP     + +   RIDY+GT
Sbjct: 178 SVLGPLLGGLFVDHLSWRWVFYINVPVGIIALAVIAAVLHIP-----VRRTPHRIDYLGT 232

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++ G    L+L  + GG  YPWSS                F LVE + A EPV P  LF
Sbjct: 233 FLIAGVATCLVLMTSLGGVSYPWSSWQIIGLGVLGVLLLVPFVLVERR-AAEPVLPLGLF 291

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C    F  G A F  + Y+P + QVV G + T SG+ ++P++LG++I+S +SG
Sbjct: 292 RNHTFTLCSVIGFVVGFAMFGSMTYLPTFLQVVHGVTPTLSGVHMLPMVLGMLISSTASG 351

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  Y+   + G A++ +G  L+  +  ++                   MQ  +
Sbjct: 352 QIVSRTGR--YKVFPIAGTAVMCVGLLLLHQFRPSTSTTVMSLCFFVFGFGLGLVMQVLV 409

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVL----TNNIENIAIPPEL- 415
           L  Q  V Y+++   T+   FFR IGA FGV++ GTIFSN L    T+ +  + +PP L 
Sbjct: 410 LIVQNSVAYENLGVATSGATFFRSIGASFGVSVFGTIFSNKLAPRVTDALAGVPLPPGLD 469

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            G + A    V++LP   +  V++AY  ++   F   +P G+  F  + F+
Sbjct: 470 PGRLTADPRAVDRLPAAAKSGVLAAYSDSITDVFLYAVPAGLAAFALAWFL 520



>gi|182434844|ref|YP_001822563.1| major facilitator superfamily permease [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|501346633|ref|WP_012378268.1| MFS transporter [Streptomyces griseus]
 gi|178463360|dbj|BAG17880.1| putative permease of the major facilitator superfamily
           [Streptomyces griseus subsp. griseus NBRC 13350]
          Length = 697

 Score =  277 bits (709), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 174/477 (36%), Positives = 248/477 (51%), Gaps = 15/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD      ++WV TAYLL  T      GKF D+FGRK  F  + I F 
Sbjct: 44  QTIVGTALPTIVSDLGGAAHMSWVVTAYLLAETVATVLVGKFGDLFGRKLVFQVSAIIFI 103

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +II+R + G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 104 TGSFLCGLASDMLLLIIWRGMQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGIS 163

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P      +V      IP  K +       IDY G 
Sbjct: 164 TVIGPLLGGLFTDHLTWRWAFYVNVP--IAIAVVIAAARNIPSVKAA---GRPVIDYRGI 218

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W S                F +VET+ A EP+ P  LF
Sbjct: 219 ALVTVGASALILATSWGGNEYAWGSAVIIGLFVGGLIALALFCVVETR-AQEPMLPMRLF 277

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +PL+ G++ AS+ SG
Sbjct: 278 RNPVFTVCSILSFIVGFAMLGSMIFLPTYLQYVDGDSATLSGVRTLPLVAGLLAASIFSG 337

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  ++A G  L++     +G   +  YM          MQ   
Sbjct: 338 NVVSKTGR--YRVFPIVGTLVMAAGLFLLSRMGPGTGVWLESLYMVVLGIGIGLAMQVLT 395

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG--- 417
           +  Q  V+Y+D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ +       AG   
Sbjct: 396 IAVQNTVDYEDLGTATSGVTFFRTLGSAFGTAVFGTIYANALKPNLGDGVARAVAAGGDP 455

Query: 418 AVKASAT----VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AV A A+     ++ LP     P+  AY   L T F   +P+ ++ F+ +LF+   K
Sbjct: 456 AVLARASQSPQALHALPAAQSEPLAQAYADTLHTVFLWTVPVALIGFVVALFLKEVK 512



>gi|490062714|ref|WP_003964943.1| MFS transporter [Streptomyces griseus]
 gi|326655695|gb|EGE40541.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces
           griseus XylebKG-1]
          Length = 697

 Score =  277 bits (708), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 174/477 (36%), Positives = 248/477 (51%), Gaps = 15/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I SD      ++WV TAYLL  T      GKF D+FGRK  F  + I F 
Sbjct: 44  QTIVGTALPTIVSDLGGAAHMSWVVTAYLLAETVATVLVGKFGDLFGRKLVFQVSAIIFI 103

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +II+R + G+G GG++   M +I+D++ L++RGKYQ          
Sbjct: 104 TGSFLCGLASDMLLLIIWRGMQGIGAGGLMVTSMALIADVIPLRERGKYQGAIGAVFGIS 163

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+FY+N+P      +V      IP  K +       IDY G 
Sbjct: 164 TVIGPLLGGLFTDHLTWRWAFYVNVP--IAIAVVIAAARNIPSVKAA---GRPVIDYRGI 218

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     AL+L  +WGGNEY W S                F +VET+ A EP+ P  LF
Sbjct: 219 ALVTVGASALILATSWGGNEYAWGSAVIIGLFVGGLIALALFCVVETR-AREPMLPMRLF 277

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + ++P Y Q V GDSAT SG+  +PL+ G++ AS+ SG
Sbjct: 278 RNPVFTVCSILSFIVGFAMLGSMIFLPTYLQYVDGDSATLSGVRTLPLVAGLLAASIFSG 337

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  ++A G  L++     +G   +  YM          MQ   
Sbjct: 338 NVVSKTGR--YRVFPIVGTLVMAAGLFLLSRMGPGTGVWLESLYMVVLGIGIGLAMQVLT 395

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG--- 417
           +  Q  V+Y+D+ + T+ + FFR +G+ FG A+ GTI++N L  N+ +       AG   
Sbjct: 396 IAVQNTVDYEDLGTATSGVTFFRTLGSAFGTAVFGTIYANALKPNLGDGVARAVAAGGDP 455

Query: 418 AVKASAT----VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AV A A+     ++ LP     P+  AY   L T F   +P+ ++ F+ +LF+   K
Sbjct: 456 AVLARASQSPQALHALPAAQSEPLAQAYADTLHTVFLWTVPVALIGFVVALFLKEVK 512



>gi|118471119|ref|YP_887866.1| drug transporter [Mycobacterium smegmatis str. MC2 155]
 gi|399987891|ref|YP_006568240.1| Drug resistance transporter EmrB/QacA subfamily [Mycobacterium
           smegmatis str. MC2 155]
 gi|500048444|ref|WP_011729162.1| MFS transporter [Mycobacterium smegmatis]
 gi|118172406|gb|ABK73302.1| drug transporter [Mycobacterium smegmatis str. MC2 155]
 gi|399232452|gb|AFP39945.1| Drug resistance transporter EmrB/QacA subfamily [Mycobacterium
           smegmatis str. MC2 155]
          Length = 686

 Score =  277 bits (708), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 166/472 (35%), Positives = 249/472 (52%), Gaps = 19/472 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRK  F  AV+ F 
Sbjct: 40  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIVTAVVGKVGDLFGRKVVFQAAVLFFL 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCGL+ +MT ++  RA+ G+GGG ++     +I +++ L+DRG+YQ          
Sbjct: 100 AGSVLCGLSGSMTMLVAARALQGIGGGAMMVTATALIGEVIPLRDRGRYQGALGAVFGVT 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR--IDYI 178
               PLLGG FTDH++WRW+F+IN+P+G + +++A     IP    +L++  +R  IDY+
Sbjct: 160 TVIGPLLGGFFTDHMSWRWAFWINVPVGILVLVIAAG--AIP----ALVRSGRRPAIDYV 213

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           G + V      L L  +WGG EY W+SP               F   ET+ A EP+ P  
Sbjct: 214 GILFVGLGASGLTLATSWGGGEYAWTSPMIIGLFIGSITALVLFVRAETR-AAEPILPMR 272

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           LF+      C   +F  G A    + ++P + Q V G SAT SGL  +P++ G++I S  
Sbjct: 273 LFRSPVFTVCCVLSFIVGFAMLGALTFLPTFMQFVDGVSATESGLRTLPMVAGLLITSTG 332

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SG  V RT +  Y+   + G A++ +G  L++  D  +    Q  Y+          MQ 
Sbjct: 333 SGALVGRTGR--YKIFPVMGTAIMVVGFLLLSRMDATTPFVLQSLYLFILGTGIGLCMQV 390

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNN----IENIAIPPE 414
            +L  Q    + D+   T+ + FFR IG+ FG AI G++F+N L++     I     PP 
Sbjct: 391 LILTVQNTSRFDDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLSSRLVTAIAESGAPP- 449

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
              A   S  V+++LP EI  P++ AY  +L   F    P+ +L F+ SLF+
Sbjct: 450 ---AAGESPKVLHELPPEIAAPIVEAYADSLGLVFLCAAPVALLGFVVSLFL 498



>gi|489991957|ref|WP_003895014.1| squalene-hopene cyclase [Mycobacterium smegmatis]
 gi|440626976|gb|ELQ88798.1| squalene-hopene cyclase [Mycobacterium smegmatis MKD8]
          Length = 686

 Score =  277 bits (708), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 166/472 (35%), Positives = 249/472 (52%), Gaps = 19/472 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRK  F  AV+ F 
Sbjct: 40  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIVTAVVGKVGDLFGRKVVFQAAVLFFL 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCGL+ +MT ++  RA+ G+GGG ++     +I +++ L+DRG+YQ          
Sbjct: 100 AGSVLCGLSGSMTMLVAARALQGIGGGAMMVTATALIGEVIPLRDRGRYQGALGAVFGVT 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR--IDYI 178
               PLLGG FTDH++WRW+F+IN+P+G + +++A     IP    +L++  +R  IDY+
Sbjct: 160 TVIGPLLGGFFTDHMSWRWAFWINVPVGILVLVIAAG--AIP----ALVRSGRRPAIDYV 213

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           G + V      L L  +WGG EY W+SP               F   ET+ A EP+ P  
Sbjct: 214 GILFVGLGASGLTLATSWGGGEYAWTSPMIIGLFIGSIIALVLFVRAETR-AAEPILPMR 272

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           LF+      C   +F  G A    + ++P + Q V G SAT SGL  +P++ G++I S  
Sbjct: 273 LFRSPVFTVCCVLSFIVGFAMLGALTFLPTFMQFVDGVSATESGLRTLPMVAGLLITSTG 332

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SG  V RT +  Y+   + G A++ +G  L++  D  +    Q  Y+          MQ 
Sbjct: 333 SGALVGRTGR--YKIFPVMGTAIMVVGFLLLSRMDATTPFVLQSLYLFILGTGIGLCMQV 390

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNN----IENIAIPPE 414
            +L  Q    + D+   T+ + FFR IG+ FG AI G++F+N L++     I     PP 
Sbjct: 391 LILTVQNTSRFDDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLSSRLVTAIAESGAPP- 449

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
              A   S  V+++LP EI  P++ AY  +L   F    P+ +L F+ SLF+
Sbjct: 450 ---AAGESPKVLHELPPEIAAPIVEAYADSLGLVFLCAAPVALLGFVVSLFL 498



>gi|302869694|ref|YP_003838331.1| EmrB/QacA subfamily drug resistance transporter [Micromonospora
           aurantiaca ATCC 27029]
 gi|503053391|ref|WP_013288367.1| transporter [Micromonospora aurantiaca]
 gi|302572553|gb|ADL48755.1| drug resistance transporter, EmrB/QacA subfamily [Micromonospora
           aurantiaca ATCC 27029]
          Length = 529

 Score =  277 bits (708), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 158/459 (34%), Positives = 243/459 (52%), Gaps = 21/459 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
             IV+TALP I  +F   D   WV TAY+L  T   P +GK  D++GRK  FL AV+ F 
Sbjct: 31  NMIVSTALPRIVFEFGGADHFTWVVTAYVLGTTVSTPIWGKLGDLYGRKTVFLTAVVVFL 90

Query: 61  IGSLLCGLAPN---------MTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQX 111
           +GS LCG++ +         MT +I FRA+ G+G GG++  VM II D+V  ++RG+YQ 
Sbjct: 91  VGSALCGMSGSGVFGGADTGMTELIAFRAVQGLGAGGLMVGVMAIIGDLVPPRERGRYQG 150

Query: 112 XXXXXXXXXXXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQK 171
                        PL+GG  TD+++WRW+FY+NLPLG   +++    + +P+ +      
Sbjct: 151 MIAGIMAIAMVAGPLVGGFITDNLSWRWAFYVNLPLGGAALLILATTMHLPKYRTE---- 206

Query: 172 LKRIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAI 231
             +ID++G  ++     A++L   WGGNEY W SP               F +VE ++  
Sbjct: 207 -HKIDWLGAALLSVGITAIVLVTTWGGNEYDWVSPQILGLAVLAVLALGAFAVVERRVP- 264

Query: 232 EPVAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILG 291
           EP+ P  LF   +        F  G A F  + ++PLY Q V+G SAT SGL L+PL+ G
Sbjct: 265 EPILPLSLFANRNFALISVIGFLLGFAMFGAMNFLPLYQQTVQGASATNSGLLLLPLMFG 324

Query: 292 VVIASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXX 351
           +++ S+  G+ ++RT +  YR   + G  ++  G GL++L D ++ +A    YM      
Sbjct: 325 MLVVSLVVGRTITRTGR--YRVFPIVGGVVMVAGMGLLSLLDVDTSKAQSSIYMIVLGVG 382

Query: 352 XXXXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAI 411
               MQT++L  Q  VE KD+ + +    FFR IG  FGV++ G IF+N L ++    A 
Sbjct: 383 MGFLMQTSMLIAQNSVEQKDLGAASGAATFFRSIGGSFGVSLFGAIFANRLADSAAGSA- 441

Query: 412 PPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFT 450
               AG+      +  +   ++ GP+  A +G L  A +
Sbjct: 442 ---FAGSGGEGGAMDLEALKKLTGPMREAVLGGLSDAIS 477



>gi|357390341|ref|YP_004905181.1| putative drug resistance protein [Kitasatospora setae KM-6054]
 gi|503902538|ref|WP_014136532.1| transporter [Kitasatospora setae]
 gi|311896817|dbj|BAJ29225.1| putative drug resistance protein [Kitasatospora setae KM-6054]
          Length = 530

 Score =  276 bits (707), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 155/468 (33%), Positives = 244/468 (52%), Gaps = 8/468 (1%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV TA+P I  +    + ++WV T+Y L   A  P +GK  D++GRK +FL ++  F +G
Sbjct: 51  IVGTAMPTIVGELHGAEHMSWVVTSYTLATAASTPIWGKVGDLYGRKGSFLVSIAIFLLG 110

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L GL+ +MT +I FRA+ G+G GG++  VM I+  +V  +DRGKYQ            
Sbjct: 111 SALSGLSQSMTQLIAFRAVQGLGAGGLMVGVMSIMGALVLPRDRGKYQGMFAAVMALATV 170

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TDH+ WRW+FY+NLPLGAI +   + +L++P+ + +      +IDY G ++
Sbjct: 171 GGPLIGGFITDHLNWRWTFYVNLPLGAIALAFIVVVLKLPKIRSN-----AKIDYFGALL 225

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +    ++ +L   WGG+EY W S                F  VE ++A EP+ P  LF+ 
Sbjct: 226 LTVGIVSAVLVTTWGGHEYAWGSKQILGLGTLGLASLIGFCYVEQRVA-EPIIPLSLFRN 284

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G A F  V ++P Y Q+V+  SAT SGL L+P++ G+++ S+  GQA
Sbjct: 285 RNFTMVSIIGFIVGFAMFGAVTFLPTYQQIVQNASATNSGLLLMPMMFGMLVVSLVVGQA 344

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
           +++T K  YR   + G  ++A GS L++    ++      CYM          MQ T+L 
Sbjct: 345 ITKTGK--YRIFPIIGTTVMAGGSLLLSTLAVDTKTFTSSCYMVVLGAGMGFLMQVTMLV 402

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR IG  FGVA+ GT++ N L + +++  +P         S
Sbjct: 403 AQNSVEMKDMGVASSSATLFRTIGGSFGVALFGTLYINRLNDTLKDAGMPAGGESTGSMS 462

Query: 423 ATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
              +  +P E    +       + T F     + ++   ASLF+   K
Sbjct: 463 PETLKHMPPEAVAVLRHGIANGMHTVFLWGTVVSVVAIAASLFIREVK 510



>gi|315503824|ref|YP_004082711.1| EmrB/QacA subfamily drug resistance transporter [Micromonospora sp.
           L5]
 gi|503240608|ref|WP_013475269.1| transporter [Micromonospora sp. L5]
 gi|315410443|gb|ADU08560.1| drug resistance transporter, EmrB/QacA subfamily [Micromonospora
           sp. L5]
          Length = 529

 Score =  276 bits (707), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 158/459 (34%), Positives = 243/459 (52%), Gaps = 21/459 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
             IV+TALP I  +F   D   WV TAY+L  T   P +GK  D++GRK  FL AV+ F 
Sbjct: 31  NMIVSTALPRIVFEFGGADHFTWVVTAYVLGTTVSTPIWGKLGDLYGRKTVFLTAVVVFL 90

Query: 61  IGSLLCGLAPN---------MTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQX 111
           +GS LCG++ +         MT +I FRA+ G+G GG++  VM II D+V  ++RG+YQ 
Sbjct: 91  VGSALCGMSGSGVFGGADTGMTELIAFRAVQGLGAGGLMVGVMAIIGDLVPPRERGRYQG 150

Query: 112 XXXXXXXXXXXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQK 171
                        PL+GG  TD+++WRW+FY+NLPLG   +++    + +P+ +      
Sbjct: 151 MIAGIMAIAMVAGPLVGGFITDNLSWRWAFYVNLPLGGAALLILATTMHLPKYRTE---- 206

Query: 172 LKRIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAI 231
             +ID++G  ++     A++L   WGGNEY W SP               F +VE ++  
Sbjct: 207 -HKIDWLGAALLSVGITAIVLVTTWGGNEYDWVSPQILGLAVLAVLALGAFAVVERRVP- 264

Query: 232 EPVAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILG 291
           EP+ P  LF   +        F  G A F  + ++PLY Q V+G SAT SGL L+PL+ G
Sbjct: 265 EPILPLSLFANRNFALISVIGFLLGFAMFGAMNFLPLYQQTVQGASATNSGLLLLPLMFG 324

Query: 292 VVIASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXX 351
           +++ S+  G+ ++RT +  YR   + G  ++  G GL++L D ++ +A    YM      
Sbjct: 325 MLVVSLVVGRTITRTGR--YRLFPIVGGVVMVAGMGLLSLLDVDTSKAQSSIYMIVLGVG 382

Query: 352 XXXXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAI 411
               MQT++L  Q  VE KD+ + +    FFR IG  FGV++ G IF+N L ++    A 
Sbjct: 383 MGFLMQTSMLIAQNSVEQKDLGAASGAATFFRSIGGSFGVSLFGAIFANRLADSAAGSA- 441

Query: 412 PPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFT 450
               AG+      +  +   ++ GP+  A +G L  A +
Sbjct: 442 ---FAGSGGEGGAMDLEALKKLTGPMREAVLGGLSDAIS 477



>gi|386843525|ref|YP_006248583.1| transmembrane efflux protein [Streptomyces hygroscopicus subsp.
           jinggangensis 5008]
 gi|474985733|ref|YP_007696199.1| transmembrane efflux protein [Streptomyces hygroscopicus subsp.
           jinggangensis TL01]
 gi|504488893|ref|WP_014675995.1| MFS transporter [Streptomyces hygroscopicus]
 gi|374103826|gb|AEY92710.1| transmembrane efflux protein [Streptomyces hygroscopicus subsp.
           jinggangensis 5008]
 gi|451796816|gb|AGF66865.1| transmembrane efflux protein [Streptomyces hygroscopicus subsp.
           jinggangensis TL01]
          Length = 799

 Score =  276 bits (707), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 169/484 (34%), Positives = 251/484 (51%), Gaps = 16/484 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  T+YLLT T   P YGK  D+ GRK  F FA+  F 
Sbjct: 57  QMIVATALPKIVGELHGLDKMSWAITSYLLTSTIGLPVYGKLGDLVGRKGVFQFAIAVFV 116

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A  M  +I FRA+ GVG GG++  V  II+DIV  ++RG+Y           
Sbjct: 117 LGSALAGRAGTMDQLIAFRAVQGVGAGGLMIGVQAIIADIVPPRERGRYMGLIGAVFGLA 176

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY+N+P G +T+ V   +L++PRP+        R+D +GT
Sbjct: 177 SVAGPLLGGYFTDHLSWRWCFYVNVPFGLVTLAVIAVVLKLPRPRAR-----ARLDVLGT 231

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F LV  + A EP+ P  LF
Sbjct: 232 LLLAAASTCLVLLTSWGGTEYAWGSRQILGLGAGALLATVLF-LVAERFAAEPLIPLRLF 290

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P + Q+V G SAT SGL ++P++ G+V ASV  G
Sbjct: 291 RDSVFALSGLVGLVIGVALFGAASYLPTFLQMVDGASATESGLLMLPMMAGIVGASVIGG 350

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +S T +  Y+   + G A+  +G  L++    ++ R     +M          M   +
Sbjct: 351 QLISHTGR--YKIYPVLGCAVATVGMWLLSRLQTDTPRLHYSVWMAVLGAGIGLVMPVLV 408

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           L  Q  V   D+ + T+   +FR IG   G A+ GT+F++ LT+++    +PP     + 
Sbjct: 409 LAVQNSVRPADLGTATSANNYFRQIGGSVGAAVFGTLFADRLTSSLRE-ELPPRAGSGLP 467

Query: 421 ASATV----VNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKP--SLR 474
           A+ ++    V+ LP  +R   I AY  A+   F   +P+  L  L + F+   KP  S  
Sbjct: 468 AADSITPQLVHALPPALRDAYIRAYADAMPRIFLYLVPVLALGLLIAFFL-KEKPLVSHN 526

Query: 475 TTDT 478
           T +T
Sbjct: 527 TAET 530



>gi|491061221|ref|WP_004922854.1| drug resistance transporter, EmrB/QacA subfamily, partial
           [Streptomyces griseoflavus]
 gi|302474938|gb|EFL38031.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces
           griseoflavus Tu4000]
          Length = 494

 Score =  276 bits (706), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 165/451 (36%), Positives = 240/451 (53%), Gaps = 18/451 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  TAYLLT T   P YGK  D+ GRK  F FA++ F 
Sbjct: 54  QMIVATALPKIVGELHGLDKMSWAITAYLLTSTVGLPVYGKLGDLLGRKGVFQFAILVFV 113

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A  M  +I FRA+ GVG GG++  V  I++DIV  + RG++           
Sbjct: 114 VGSALAGRASTMDQLIAFRAVQGVGAGGLMIGVQAIMADIVPARQRGRFMGLIGAAFGLA 173

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY+N+P G +T+ V   +L++P+P         R D +GT
Sbjct: 174 SVAGPLLGGYFTDHLSWRWCFYVNVPFGIVTMAVVALVLKLPKPAAR-----PRFDVLGT 228

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F +VE + A EP+ P  LF
Sbjct: 229 LLLAAASTCLVLLTSWGGTEYAWDSEVVLGLGAGAAAAAVLFLVVE-RFAAEPLIPLRLF 287

Query: 241 KR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    +V G        G+A F    Y+P Y Q+V G SAT SGL ++P++ G+V+AS+ 
Sbjct: 288 RDSVFNVTGL--VGLVTGVALFGAASYLPTYLQMVDGASATESGLLMLPMMGGIVVASIV 345

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ +SRT +  YR   + G AL   G  L++  +  + R     +M          M  
Sbjct: 346 SGQLISRTGR--YRRHPLVGTALSVAGMWLLSRLETGTPRLHYSIWMAVLGTGIGMVMPV 403

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGA 418
            +L  Q  V   D+ + T+   +FR IG   G A+ GT+F+  LT+ ++     P  AGA
Sbjct: 404 LILAVQNSVRPADLGTATSANNYFRQIGGSVGAAVFGTLFAGRLTDALDERL--PAHAGA 461

Query: 419 VKASATV----VNQLPIEIRGPVISAYVGAL 445
           V  + ++    V+ LP E+R   + AY  A+
Sbjct: 462 VPEAESITPELVHALPPELRDAYVQAYADAM 492



>gi|491850440|ref|WP_005632508.1| MFS transporter [Mycobacterium hassiacum]
 gi|407372186|gb|EKF21253.1| H+ antiporter-2 family protein [Mycobacterium hassiacum DSM 44199]
          Length = 694

 Score =  276 bits (706), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 167/466 (35%), Positives = 245/466 (52%), Gaps = 12/466 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRKA FL AV+ F 
Sbjct: 50  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIVTAVVGKLGDLFGRKAMFLAAVVVFL 109

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS+ CG A +MT ++  RA+ G+GGG ++   M +I +++ L+DRG+YQ          
Sbjct: 110 LGSVACGAAGSMTALVAARAVQGIGGGAVMVTSMALIGEVIPLRDRGRYQGALGAVFGVT 169

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR--IDYI 178
               PLLGG FTDH++WRW+FY+NLPLG   V++A+  + IP      L +  R  IDY 
Sbjct: 170 TVIGPLLGGFFTDHLSWRWAFYVNLPLG--VVVLAVTAVSIP-----ALARSGRAVIDYA 222

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           G + +      L L  +WGG+ YPWSSP               F  VE + A EP+ P  
Sbjct: 223 GIVFIGLGAAGLTLATSWGGSSYPWSSPVIIGLFAGSAVALAVFAAVERR-AAEPILPLR 281

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           LF    + GC   +F  G A    + ++P Y Q V G SAT SGL  +P++ G+++ S  
Sbjct: 282 LFTNRVIAGCCALSFIVGFAMLGALTFLPTYMQFVDGVSATVSGLRTLPMVAGLLLTSTG 341

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SG  V RT +  Y+   + G AL+AIG  L++     +    +  Y+          MQ 
Sbjct: 342 SGAVVGRTGR--YKVFPVVGTALMAIGFVLMSRMAAETPVVVESAYLFVLGAGIGMCMQV 399

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGA 418
            ++  Q   ++ D+   T+ + FFR IG+ FG AI G++F+N L++ I           A
Sbjct: 400 LVITVQSTADFDDLGVATSAVTFFRSIGSSFGAAIFGSLFANFLSHRIGPALAAGGAPPA 459

Query: 419 VKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASL 464
              S  V+++LP     P+++AY  AL   F    P+  + FL +L
Sbjct: 460 AAKSPQVLHELPAATAAPIVAAYADALGLVFLCAAPVAFVGFLVAL 505



>gi|392560801|gb|EIW53983.1| MFS general substrate transporter [Trametes versicolor FP-101664
           SS1]
          Length = 580

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 173/486 (35%), Positives = 263/486 (54%), Gaps = 15/486 (3%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATALP I++ F A   ++WV +AY LT TAFQP YG+FSDIFGRKA    A+  F +
Sbjct: 56  TIVATALPTISAAFNAGSVVSWVPSAYFLTSTAFQPLYGRFSDIFGRKAALCMAMGIFML 115

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSL  G + ++T +I+ R +AG GGGGI+S+  I+ISD+VSL+DRGKYQ           
Sbjct: 116 GSLAAGFSRSITQLIVLRGLAGAGGGGIVSMAQIVISDVVSLRDRGKYQGIIGVVVAFGF 175

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTI 181
              PLLGG   +   WRW F++ LP+ A  V V I ++ +   +G++ +KL  +DY+GT 
Sbjct: 176 AVGPLLGGVLAEKAGWRWCFWVTLPVSACAVAVVILVVPLKPVEGNIGKKLAVVDYVGTA 235

Query: 182 VVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFK 241
           + + S   ++LPL WGG  +PWSSP               F L E K A  P+ P ++FK
Sbjct: 236 LTLVSCTLVILPLIWGGVTFPWSSPIVLAPLFAGAVTVAFFCLWEWKGARLPIVPMYIFK 295

Query: 242 RLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQ 301
           ++ V G + T    G  F+S ++Y+P YFQV  G SA  SG+ L+P+++   +AS  SGQ
Sbjct: 296 QVTVTGVYITMLINGFVFYSSLFYLPQYFQVGLGYSAIRSGIFLLPVLVSQTLASFISGQ 355

Query: 302 AVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLL 361
            ++ T +  YR     G  +  I  G ++    ++ +   + +M          +QTT +
Sbjct: 356 IITWTGR--YRATIYVGFGIWTIACGCLSTVTPDTAKGLLVFFMLLAGTGAGGTLQTTTV 413

Query: 362 CGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIP--------- 412
             Q  V  +D++ VTA+  F RL+G    +AI  TI +N L +++ ++ +P         
Sbjct: 414 AAQASVSRRDMSVVTAVRNFIRLLGGTLSLAIGATIINNSLRHSMTSLGLPSYTISTILD 473

Query: 413 -PELAGA-VKASATVVNQLPIE--IRGPVISAYVGALRTAFTADIPIGILCFLASLFMGN 468
            P + GA   AS      L +   +   ++ AYV   RT F  +  +  +  LA++ +  
Sbjct: 474 DPTILGARTSASDASFASLGVSPAVAERILGAYVRGFRTVFILNASLNAVATLAAILLIR 533

Query: 469 HKPSLR 474
           H    R
Sbjct: 534 HTELTR 539



>gi|169772321|ref|XP_001820629.1| MFS toxin efflux pump [Aspergillus oryzae RIB40]
 gi|83768490|dbj|BAE58627.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 542

 Score =  275 bits (704), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 172/458 (37%), Positives = 247/458 (53%), Gaps = 11/458 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+  A+P I   FK+++ IAW  +AY LT TA QP+YG+   IF  K  FL AV+ FE
Sbjct: 49  QTIIGVAIPKITDQFKSIEDIAWYGSAYFLTSTALQPSYGRIYKIFSVKWGFLIAVLIFE 108

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C +AP+ T +I+ RA+AG+G  GI S  ++IIS  V L +R              
Sbjct: 109 IGSLICAVAPSSTVLIVGRAVAGIGVAGIFSGALVIISMTVPLPERPLVFGMFGMVWGIA 168

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKG----SLLQKLKRID 176
               PLLGGAFTD V+WRW FYINLP+G +++ V IF+LR+P+        +L ++K++D
Sbjct: 169 SIAGPLLGGAFTDGVSWRWCFYINLPIGGLSIAVIIFILRVPKKSEFSGTPVLDRIKQLD 228

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IG  +++ + + LLL L WGGN+YPW+S                F   + KL      P
Sbjct: 229 LIGASLLIPAIVCLLLALQWGGNKYPWNSSRVIGLFVGFGLMIIIFTFSQIKLGDRATLP 288

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + KR  V+       F G AFF LVYYVP++FQ VKG SA  SG++L+PL+L  VI+S
Sbjct: 289 PGILKRRSVLSATMFALFFGGAFFLLVYYVPIFFQSVKGSSAMKSGIQLLPLMLATVISS 348

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           V  G  V+      Y    + G A+ AIG+GLIT +  +      I Y            
Sbjct: 349 VLVGAFVTAAGY--YTPFLIGGTAIAAIGTGLITTYSVDISTGKWIGYQILVGAGVGAGF 406

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELA 416
           Q  +   Q ++  +D+   TA +MFF+ +G    +A+  ++F N L + I   A   +  
Sbjct: 407 QIPMTAVQTVLPPEDIPVGTAAVMFFQTLGGALFIAVGQSVFQNGLIDGIREFAPTVDPR 466

Query: 417 GAVKASATVVNQL-----PIEIRGPVISAYVGALRTAF 449
             V A AT +  +      ++    VI AY+  LR A+
Sbjct: 467 AIVGAGATEMRHVLAALGQLDQLDAVIRAYMSGLRDAY 504



>gi|291299820|ref|YP_003511098.1| EmrB/QacA subfamily drug resistance transporter [Stackebrandtia
           nassauensis DSM 44728]
 gi|502782600|ref|WP_013017576.1| MFS transporter [Stackebrandtia nassauensis]
 gi|290569040|gb|ADD42005.1| drug resistance transporter, EmrB/QacA subfamily [Stackebrandtia
           nassauensis DSM 44728]
          Length = 678

 Score =  275 bits (704), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 167/471 (35%), Positives = 247/471 (52%), Gaps = 17/471 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I +D      +AWV TAYLL  T      GKF D+FGRK  F  + I F 
Sbjct: 37  QTIVATALPTIVADLGGAGHMAWVVTAYLLAETIATAVVGKFGDLFGRKIVFQISAIVFV 96

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS L GL+ +M  +I+ RAI G+GGGG++   M +I+D++ L+DRG+YQ          
Sbjct: 97  AGSALAGLSGDMVFLIVARAIQGLGGGGLMVTAMALIADVIPLRDRGRYQGAMGAVFGVT 156

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P +GG FTDH++WRW FY+N+P+  + V +A +   IP  K +       +DY+G 
Sbjct: 157 TVLGPTMGGLFTDHLSWRWCFYVNVPVAVVMVAMAAW--TIPSVKAA---ARPLVDYVGL 211

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           I+V   +  L+L L WGG EY W S                F   E + A EP+ P HLF
Sbjct: 212 ILVALGSSGLILALEWGGEEYAWDSVEIIGLFAGSALMLVLFVFAELR-AAEPILPMHLF 270

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A    + Y+P Y Q V G SAT SGL  +PL+ G++  S+ SG
Sbjct: 271 RSRVFTVSAILSFIVGFAMLGAMTYLPTYLQYVDGVSATASGLRTLPLVAGLLATSMLSG 330

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VSRT +  Y+   + G A++A+G  L++  + ++G   +  YM          MQ   
Sbjct: 331 SVVSRTGR--YKVFPIAGTAVMALGLYLMSTMNADTGVYLESVYMLILGLGIGLAMQVLT 388

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI-----AIPPEL 415
           +  Q  V Y ++ + T+ + FFR +G+ FG AI GT++SN L++ + +       + PE 
Sbjct: 389 IAVQNTVPYHEMGAATSGVTFFRTLGSAFGTAIFGTLYSNDLSSRLADAYRQTPGVNPE- 447

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
                AS   +++LP +   P++ AY   +   F   +P+ IL F  S F+
Sbjct: 448 ---AVASPEALHKLPDDTIRPIVDAYADTVDYVFFWVVPVAILGFAVSWFL 495



>gi|353238458|emb|CCA70404.1| probable DHA14-like major facilitator; ABC transporter
           [Piriformospora indica DSM 11827]
          Length = 601

 Score =  275 bits (704), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 179/491 (36%), Positives = 248/491 (50%), Gaps = 18/491 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP +AS+F+ALD++ WV +AY LT        G+   I   K  +L  ++ FE
Sbjct: 110 QTIVATALPKLASEFQALDQLTWVVSAYFLTQAGLMLALGQVLTICPSKWVYLTCILIFE 169

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+AP+M  +I  RA  G+G  G+   ++ I + IV L+ R              
Sbjct: 170 VGSLICGVAPSMNVLIFGRAFQGIGASGMFISILTIFAQIVKLETRPLLFASFGGVFAVS 229

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLL-------QKLK 173
               PLLGG FTDH TWRW FYINLP GA ++   +F +    P  S L       QK  
Sbjct: 230 SVVGPLLGGVFTDHSTWRWCFYINLPFGAFSIAAVVFFIPSKPPPPSPLYEGKTTFQKWL 289

Query: 174 RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP 233
            +D++G  + VG   ALLLPL WGG   PW+                 F   E  +    
Sbjct: 290 ALDWVGAFLSVGMITALLLPLQWGGVTKPWNDRVVIALFVVFAVLLILFVGWEVYMGKRA 349

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
           + P  LF+R   VG     FF    F    YY+P ++Q  KG S + SG+ +IP +L +V
Sbjct: 350 MMPLELFRRRTQVGGGIAMFFIMGTFLGATYYLPFFYQ-AKGRSPSQSGINIIPFMLAIV 408

Query: 294 IASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXX 353
           IAS  SG AV+ T    Y+++ + G  + A+G+GL+   DE +     I Y         
Sbjct: 409 IASFLSGGAVNGTGH--YKSMMVIGPLVAAVGAGLLYTIDEFTPNPKLIGYQIIFGFGLG 466

Query: 354 XXMQTTLLCGQGIVEYKD----VASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI 409
              Q  ++  Q   EY D    +   ++LL F +L+G V  +AI GTI +N L   +   
Sbjct: 467 LAFQLPVMAIQA--EYADQPDLIPQGSSLLTFLQLLGGVVAIAICGTIVNNQLVKFLAQY 524

Query: 410 A--IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMG 467
           A  +PPE+  AVK S T + QLP E R  VI AYV AL   F   IP  +L  +A++F+ 
Sbjct: 525 ASDLPPEVVQAVKQSVTAIFQLPEEQRQGVIRAYVQALVYVFVFCIPAAVLAGIAAMFVK 584

Query: 468 NHKPSLRTTDT 478
           N     R  DT
Sbjct: 585 NWNVKQRGADT 595



>gi|494765497|ref|WP_007500905.1| DSBA oxidoreductase [Streptomyces zinciresistens]
 gi|345634961|gb|EGX56580.1| multidrug-efflux transporter [Streptomyces zinciresistens K42]
          Length = 694

 Score =  275 bits (704), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 175/475 (36%), Positives = 257/475 (54%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  +  A++ F 
Sbjct: 50  QTIVSTALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKRLYQLAIVLFL 109

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A +MT +I FRA+ G+GGGG++ L M I+ DIVS ++RG+YQ          
Sbjct: 110 IGSALCGMAQDMTQLIAFRALQGLGGGGLIVLSMAIVGDIVSPRERGRYQGLFGAVFGAT 169

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FY+NLP+G + + V   +L IPR KG+       IDY+GT
Sbjct: 170 SVLGPLLGGVFTEHLSWRWVFYVNLPVGVVALAVIAVVLHIPR-KGT----RHVIDYLGT 224

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++     AL+L  + GG  + W SP               F  VE + A EPV P  LF
Sbjct: 225 FLIAAVATALVLTASLGGTTWSWGSPQIVGLALLAVLLTLVFVAVERR-AAEPVLPLKLF 283

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV+G S T SG+ ++P++ G++++S  SG
Sbjct: 284 RVRTFTLSAVISFIVGFAMFGAMTYLPTFLQVVRGVSPTVSGVHMLPMVAGMLLSSTGSG 343

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G  + AIG  L+   D +S       Y           MQ  +
Sbjct: 344 QIVSRTGR--WKVFPIAGTGVTAIGLLLLHQLDTDSSTTEMSLYFFVFGLGLGLVMQVLV 401

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI----ENIAIPPELA 416
           L  Q  V Y+D+   T+   FFR IGA FGVAI GT+F+  L + +      + +PP L 
Sbjct: 402 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAIFGTVFAGRLDDKLVDAFRGVTLPPGLT 461

Query: 417 -GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
              +++    +  LP  +R   + AY  A+   F   +P+ +L F+ + F+   +
Sbjct: 462 LDGLESDPRGIAALPDPLRSAALQAYATAITDVFLYAVPVALLGFVLAWFLREDR 516



>gi|296805221|ref|XP_002843435.1| major facilitator superfamily transporter [Arthroderma otae CBS
           113480]
 gi|238844737|gb|EEQ34399.1| major facilitator superfamily transporter [Arthroderma otae CBS
           113480]
          Length = 580

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 163/472 (34%), Positives = 254/472 (53%), Gaps = 9/472 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   F AL+ I W  ++YLLT+ AFQ  +GK    F  K  FL A+  FE
Sbjct: 97  NTIIATAIPKITDQFHALEDIGWYGSSYLLTICAFQLIFGKIYTFFPVKWVFLTAITIFE 156

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS +CG APN T +I+ RAIAG+G  GI S  +III+  + L+ R  Y           
Sbjct: 157 IGSAVCGAAPNSTALIVGRAIAGIGSAGIFSGALIIIAYSIPLEKRPMYTGAIGGMYGIA 216

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK----GSLLQKLKRID 176
               PL+GGAFTDHV+WRW FYINLP+GA+T++  +  L+ P+ K     +   +L ++D
Sbjct: 217 SVAGPLMGGAFTDHVSWRWCFYINLPIGAVTILSILIFLKHPKQKLDNNHTWKVRLMKLD 276

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IGT V + S I LLL L WGG +YPW +                F  ++ +   E   P
Sbjct: 277 PIGTAVFMPSIICLLLALQWGGTKYPWRNGRIIALFVLFAVLISIFIYIQIRAGDEATVP 336

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  +       F  G AFF +VYY+P++FQ +KG +AT+SG+  IP++L +V+ S
Sbjct: 337 PRILKQRSIASGAFFLFMLGSAFFIMVYYLPIWFQAIKGATATSSGVMNIPMVLSLVVLS 396

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + SG  V+      Y  L    + + +IG+GL+T +   + +   I +           +
Sbjct: 397 ILSGIIVTAVGY--YSPLYYVSSVITSIGAGLLTTFTTETSKGKWIGFQIIFGAGVGTGL 454

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA--IPPE 414
           Q +++  Q +++ +DVA  T ++MF + +G    V++   +F+N+LT+ + + A  + P+
Sbjct: 455 QLSIIAAQAVLDLEDVAVGTVIMMFCQTLGGALFVSVAQNVFTNLLTSGVVDAAPGLDPQ 514

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           L   V A+  + + +P E    V  AY  AL   +     +  L  L ++ M
Sbjct: 515 LVLRVGAT-QLKSMIPPEYLDGVQVAYNNALTNTWYVATALAALSILGAIGM 565



>gi|489988093|ref|WP_003891150.1| MFS transporter [Mycobacterium phlei]
 gi|383330280|gb|EID08808.1| EmrB/QacA subfamily drug resistance transporter [Mycobacterium
           phlei RIVM601174]
          Length = 689

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 172/491 (35%), Positives = 251/491 (51%), Gaps = 26/491 (5%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRK  F  AV+ F 
Sbjct: 49  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIVTAIAGKLGDLFGRKTVFAAAVLFFL 108

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS+LCGLA +MT ++  R + G+GGG I+   M +I +++ L+DRG+YQ          
Sbjct: 109 VGSVLCGLASSMTMLVASRTLQGIGGGAIMVTAMALIGEVIPLRDRGRYQGALGAVFGVT 168

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLG----AITVIVAIFLLRIPRPKGSLLQKLKRID 176
               PLLGG FTDH++WRW+F+IN+P+G    A+  +    L R  RP          ID
Sbjct: 169 TVIGPLLGGFFTDHLSWRWAFWINVPVGIVVLAVAAVAIPALARTGRPV---------ID 219

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
           Y G + V      L L  +WGG+ YPWSSP               F  VE + A EP+ P
Sbjct: 220 YAGILFVGLGASGLTLATSWGGSTYPWSSPTIIGLFAASAVALAVFVWVEIR-AAEPILP 278

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
             LF       C    F  G A    + ++P + Q V G SAT SGL  +P++ G+++ S
Sbjct: 279 IRLFASPVFTVCCILGFIVGFAMLGALTFMPTFMQFVNGVSATVSGLRTLPMVAGMLLTS 338

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + SGQ V RT +  YR   + G A +A+   L++     +    Q  Y+          M
Sbjct: 339 IGSGQIVGRTGR--YRIFPIAGTATMAVAFYLLSGMTAATPTWQQSVYLFVLGAGIGLCM 396

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAI----P 412
           Q  +L  Q    + D+   T+ + FFR IG+ FG AI GT+F+N L + + +  I    P
Sbjct: 397 QVLVLVVQNTASFADLGVATSGVTFFRTIGSSFGAAIFGTLFANFLASRVGSALIASGAP 456

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPS 472
           P  A + +A    +++LP  +  P++ AY  AL   F   +P+ +L F+ SLF+   +  
Sbjct: 457 PRAAESPQA----LHELPPAVAAPIVDAYADALGRVFLCVVPVAVLGFVVSLFLKEVR-- 510

Query: 473 LRTTDTVVAFE 483
           LR  + V A +
Sbjct: 511 LRDLEAVSATD 521



>gi|501750018|emb|CCG85018.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 585

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 168/482 (34%), Positives = 253/482 (52%), Gaps = 21/482 (4%)

Query: 1   QTIVATALPAIASDFKALDKI-AWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITF 59
           QTIVA ALP I  +  +   + +W+ +AYLLT  AF P +G+ SD+ GRK     +++ F
Sbjct: 99  QTIVAVALPTIVRELDSPGNLYSWIGSAYLLTSAAFIPLWGRLSDLIGRKPILYGSILVF 158

Query: 60  EIGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXX 119
            IGS LCG + ++  +I  RA+ G+GGGG++S++ I ISDI SL +RGKY          
Sbjct: 159 LIGSALCGASQSVGMLIASRAVQGLGGGGLISMIQITISDITSLAERGKYGGLIGSTFGI 218

Query: 120 XXXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRI-PRPKGSLLQKLKRIDYI 178
                P+LGG  T HV+WRW F+INLP G   V++  F L++ P P+ +  +  +  DYI
Sbjct: 219 ASVLGPILGGLLTQHVSWRWCFFINLPSGGAAVVLLFFSLKLNPTPRKTFAEVSRTFDYI 278

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           G + +VG+ +  L+ LN G +   W S                  + E +    P+ PP 
Sbjct: 279 GLVTIVGAVVCFLVGLNEGTSARGWVSFEGLGLLLIAGALLAVCLVNEFRTTRMPILPPR 338

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           LFK        T+  F  M FF+  YY+P+YFQ V G SAT SG+E++P  LG  I +V 
Sbjct: 339 LFKNRTSASILTSVPFHAMPFFAATYYLPIYFQAVYGASATLSGVEMLPFSLGAAIVAVF 398

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SG AV++  +  Y+ +S+ G A++ +G GL+      S RA Q  Y+           QT
Sbjct: 399 SGLAVAKLGR--YKAISVGGYAVMTLGFGLMCDLSSTSSRAKQEIYILVAALGVGCNFQT 456

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGA 418
            L+  Q  +  KD+A  T+ ++  R IG   G+ I G I+++ L   +      P  AG 
Sbjct: 457 PLITLQAAMPLKDMAVATSAMVLLRAIGGSVGITIGGVIYASELGRRV------PPAAGP 510

Query: 419 VKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNH--KPSLRTT 476
           +            ++ G V++A+  +LRT +    PI  L  LASLFM  +  K ++ + 
Sbjct: 511 LDTQ---------DVAGLVLAAFADSLRTFWIVLTPICALALLASLFMKEYSLKRTIVSN 561

Query: 477 DT 478
           DT
Sbjct: 562 DT 563



>gi|409075615|gb|EKM75993.1| hypothetical protein AGABI1DRAFT_79214 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 638

 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 167/481 (34%), Positives = 258/481 (53%), Gaps = 8/481 (1%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           +VATALP I+S F A    +WV +AYLLT T+F P YG+FSDIFGRKAT   A++ F +G
Sbjct: 81  VVATALPTISSHFNAGSVSSWVPSAYLLTSTSFLPLYGRFSDIFGRKATLTVAMLIFLVG 140

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           +L  G + ++  +I+ R +AG GGG ILSL  IIISDIVSL++RGKYQ            
Sbjct: 141 NLAAGFSKSIVELIVLRGVAGAGGGAILSLAQIIISDIVSLRERGKYQGIMGGVITLGYA 200

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             P+ GG   +  +WRW F+I LP+  + + V  F+L +    G + +KLK +DY+G+++
Sbjct: 201 IGPITGGVLAEKASWRWCFWICLPISVLAIAVVNFVLPLKSVGGDIKRKLKVVDYVGSLL 260

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
            + +   ++LPL WGG  +PW S                F + E K A  P+ P  +FK 
Sbjct: 261 TLVACTLIILPLIWGGVTFPWKSAVVIAPFLCGAFTFVLFTMWEWKGARLPIVPMRIFKH 320

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
             V G +   F  G+  FSL+YY+P +FQV    S   +GL LIP++ G V+ S  +G A
Sbjct: 321 STVCGVYIVMFINGLITFSLIYYLPQFFQVALAYSPIHAGLFLIPVLGGQVVISWCAGLA 380

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
           VSRT +  YRT+  +G A+ ++  GLI+     +     + YM          +QTT + 
Sbjct: 381 VSRTGR--YRTIVHSGFAIWSLACGLISTMTPQTKEGVMVVYMLLSAVGSGQTLQTTTVA 438

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV--- 419
            Q  V  KD++ VTA   F R++G    +A+  T+ +N L +++ ++++P +L   +   
Sbjct: 439 AQASVPRKDMSVVTAFRNFVRMLGGTLALAVGATLINNTLRSSMTSLSLPEQLIKKIIDD 498

Query: 420 ---KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTT 476
               ++ + +N    + R  + + Y    R  F  +  +     + S+ M  HK   R  
Sbjct: 499 PILLSNPSSLNISVEQARSILENGYTKGFRAVFILNASLSAFATVISIVMIKHKNLNRDD 558

Query: 477 D 477
           D
Sbjct: 559 D 559



>gi|120404021|ref|YP_953850.1| EmrB/QacA family drug resistance transporter [Mycobacterium
           vanbaalenii PYR-1]
 gi|500104242|ref|WP_011780249.1| MFS transporter [Mycobacterium vanbaalenii]
 gi|119956839|gb|ABM13844.1| drug resistance transporter, EmrB/QacA subfamily [Mycobacterium
           vanbaalenii PYR-1]
          Length = 685

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 167/468 (35%), Positives = 244/468 (52%), Gaps = 16/468 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       AWV T+YLL  T      GK  D+FGR+  F  AV+ F 
Sbjct: 43  QTIVATALPTMVADLGGAGHQAWVVTSYLLASTIVTAVVGKLGDLFGRRTIFAAAVVFFL 102

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS+LCG+A +M  ++  RA+ GVGGG ++     +I +++ L+DRG+YQ          
Sbjct: 103 IGSVLCGIASSMEMLVASRALQGVGGGALMVTAAALIGEVIPLRDRGRYQGALGAVFGVT 162

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+F+IN+P+G + +IVA+  +   R  G  +     IDY G 
Sbjct: 163 TVVGPLLGGYFTDHLTWRWAFWINVPIGIVVLIVALTTIPALRRGGRPV-----IDYAGI 217

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++      L L  +WGG+ YPWSSP               F  VE + A EPV P  LF
Sbjct: 218 VLIGLGASGLTLATSWGGSTYPWSSPVIIGLFVGSGVALALFVRVELR-AEEPVLPIRLF 276

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + ++P + Q V G SAT SGL  +P++ G+++ S+ SG
Sbjct: 277 ASPVFTVCCILSFIVGFAMLGALTFLPTFMQFVDGVSATESGLRTLPMVGGLLLTSMGSG 336

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VSRT +  Y+   + G A++ +G  L++  D  +    Q  Y+          MQ  +
Sbjct: 337 VLVSRTGR--YKIFPVAGTAVMVVGFVLLSQMDATTPMLQQSAYLFILGTGIGMCMQVLI 394

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPELA 416
           L  Q    + D+   T+ + FFR IG+ FG AI G++F+N L   I         PPE A
Sbjct: 395 LIVQSTATFSDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLDARIVTALAGGGAPPEAA 454

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASL 464
                S  V+++LP  +  P++ AY  +L   F    P+ +L FL +L
Sbjct: 455 ----QSPQVLHRLPDAVAAPIVEAYSDSLGLVFLYAAPVALLGFLVAL 498



>gi|145596221|ref|YP_001160518.1| EmrB/QacA family drug resistance transporter [Salinispora tropica
           CNB-440]
 gi|500901101|ref|WP_012014915.1| transporter [Salinispora tropica]
 gi|145305558|gb|ABP56140.1| drug resistance transporter, EmrB/QacA subfamily [Salinispora
           tropica CNB-440]
          Length = 522

 Score =  274 bits (701), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 149/412 (36%), Positives = 227/412 (55%), Gaps = 17/412 (4%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV+TALP I  +F  LD   WV TAY+L  T   P +GK  D+FGRK  FL +V+ F +G
Sbjct: 33  IVSTALPRIVGEFGGLDHFTWVVTAYVLGTTVSTPIWGKLGDLFGRKPIFLTSVVIFLLG 92

Query: 63  SLLCGLA-------PN--MTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXX 113
           S LCG+A       P+  M  +I FRA+ G+G GG++  V+ II D+V  ++RG+YQ   
Sbjct: 93  SALCGMAGSRLLGGPDDGMAELIAFRAVQGLGAGGLMVGVLAIIGDLVPPRERGRYQGMI 152

Query: 114 XXXXXXXXXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLK 173
                      PL+GG  TDH++WRW+FY+NLPLG   +++ +  LR+PR +        
Sbjct: 153 AGIMAIALVAGPLVGGFITDHLSWRWAFYVNLPLGGAALVLLVATLRLPRHRTE-----H 207

Query: 174 RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP 233
           RID++G  ++     A++L   WGGNEY W SP               FG+VE + A+EP
Sbjct: 208 RIDWLGAALLAVGITAIVLITTWGGNEYAWRSPQIVGLIVLALASLAAFGVVERR-AVEP 266

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
           V P  LF   +        F  G A +  + ++PLY Q V+G SAT SGL L+PL+ G++
Sbjct: 267 VLPLSLFANRNFALISVIGFLLGFAMYGAMSFLPLYQQTVQGASATESGLLLLPLMFGML 326

Query: 294 IASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXX 353
           + S+  G+ ++RT +  YR   + G  +++    L+T  D  +       Y+        
Sbjct: 327 VVSLLVGRTITRTGR--YRAFPIIGGVVMSAAMVLLTRLDAQTDVVESSLYLLVLGVGMG 384

Query: 354 XXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNN 405
             MQTT+L  Q  V+ +D+ + +    FFR IG  FG+++ G +F++ L+++
Sbjct: 385 FLMQTTMLIAQNSVDQRDLGAASGAATFFRSIGGSFGISLFGAVFASRLSDS 436



>gi|472588203|gb|EMS25675.1| MFS drug transporter [Rhodosporidium toruloides NP11]
          Length = 641

 Score =  274 bits (701), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 167/460 (36%), Positives = 242/460 (52%), Gaps = 21/460 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+ ALP I++ F A    A+V  AYLLT +A QP +G+ SDIFGRK T +  V+ F 
Sbjct: 119 QTIVSVALPYISAYFNAGRSSAFVTAAYLLTSSAMQPVWGRLSDIFGRKYTLMLCVLIFA 178

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL C LA  M  +I+FR + GVGG G+L+LV+II+SDIVSL++RGKYQ          
Sbjct: 179 IGSLACALARTMVQLIVFRGMQGVGGAGLLTLVLIIVSDIVSLKERGKYQGVTEITIMVG 238

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG    HV+        LP  A  + V  + L +   KGS  +KLK+IDY G 
Sbjct: 239 NGVGPLIGGVLVQHVS--------LPCCAAAIAVIAYFLPLKAVKGSAKEKLKKIDYGGA 290

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           ++ V +T+ L+LPLNWGG  +PW S                F L E K A  P+ PP +F
Sbjct: 291 VLTVAATVLLILPLNWGGTSFPWVSGPVLGCLVASFFAFAVFFLWEWKAARIPIVPPFIF 350

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K   V   F + F  G      +YY+P YFQVV+GDS T SG+ +IP ++   +    SG
Sbjct: 351 KNQTVAAIFASTFLSGSTILCQLYYLPQYFQVVRGDSPTRSGVLIIPQLITTTVFVFLSG 410

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  Y+   + G A+ A+G GL++  D+ S  A  + Y           +QT++
Sbjct: 411 QLVSRTGE--YKPSIVVGYAIWAVGLGLLSTLDQQSSTARIVGYQLLNGAGQGQTLQTSM 468

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV- 419
           +  Q  VE  +++ VT++  F R +G    + +  TI +N L++ +  +        A+ 
Sbjct: 469 VAAQAAVERSEMSVVTSVRNFMRSLGGTVFLVVAATILNNNLSSKLTPLGYSHSTISAIV 528

Query: 420 ----------KASATVVNQLPIEIRGPVISAYVGALRTAF 449
                        A+++  L    +  ++ AYV    T F
Sbjct: 529 DDPVGIWQPSSRDASILYDLSSTQKAQIVEAYVVGFNTVF 568



>gi|490067247|ref|WP_003969433.1| DSBA oxidoreductase [Streptomyces griseus]
 gi|326659945|gb|EGE44791.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces
           griseus XylebKG-1]
          Length = 727

 Score =  274 bits (700), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 180/475 (37%), Positives = 264/475 (55%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I S+   LD ++WV TAYLL  TA  P +GKF D +GRK  F  A++ F 
Sbjct: 39  QTIVSTALPTIVSELGGLDHLSWVVTAYLLAATAATPLWGKFGDQYGRKRLFQTAIVIFL 98

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+V+ ++RGKYQ          
Sbjct: 99  IGSALCGVAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDLVTPRERGKYQGLFGAVFGVT 158

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FYINLP+G + ++V   +L IP     + ++   IDY+GT
Sbjct: 159 SVLGPLLGGFFTEHLSWRWVFYINLPIGIVALVVIAAVLHIP-----VRREKHTIDYLGT 213

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++     AL+L  + GG  + WSSP               F  VE + A+EPV P  LF
Sbjct: 214 FLIAAVATALVLVASLGGTTWAWSSPRIIGLAVLAVLLLVAFVAVERR-AVEPVLPLKLF 272

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV   + T SG+ ++P++ G++I S  SG
Sbjct: 273 RIRTFALVAVISFVIGFAMFGAMTYLPTFLQVVHDITPTMSGVHMLPMVFGLLITSTGSG 332

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+ A+G  L+   DENS       +           MQ  +
Sbjct: 333 QIVSRTGR--WKVFPILGTAITAVGLLLLHQLDENSSTWLMSAFFFVFGSGLGLVMQVLV 390

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL- 415
           L  Q  V Y+D+   T+ + FFR IG+ FGVAI GTIF+N LT  + +      +PP + 
Sbjct: 391 LVAQNSVSYEDLGVATSGVTFFRSIGSAFGVAIFGTIFANRLTGQLTDALAGQPLPPGVD 450

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AG + A    + QLP ++R  V+ AY  ++   F   +P+ +L F+ + F+   +
Sbjct: 451 AGRLAADPRAIGQLPADLRPGVLGAYSTSITDVFLYAVPVVLLAFVLAWFLREDR 505



>gi|322697672|gb|EFY89449.1| MFS transporter [Metarhizium acridum CQMa 102]
          Length = 588

 Score =  274 bits (700), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 163/456 (35%), Positives = 244/456 (53%), Gaps = 9/456 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   F+A++ + W  +AYLLT  A Q  +GK    +  K  +LFA+  FE
Sbjct: 103 NTIIATAIPRITDQFQAIEDVGWYGSAYLLTTCAVQLIFGKLYTFYSVKWVYLFAIFLFE 162

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG  PN   +I+ RAIAG+G  G+ S  ++II+  V L+ R  Y           
Sbjct: 163 LGSLVCGATPNSVGLILGRAIAGLGAAGVFSGALLIINRSVPLRQRPMYMGIIGSMYGIA 222

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP-----KGSLLQKLKRI 175
               PL+GGAFTDHVTWRW FYINLP G +TV   I  LR+P+P     K S  ++L   
Sbjct: 223 SVAGPLMGGAFTDHVTWRWCFYINLPFGGVTVAFIIAFLRLPKPRIAKTKLSFKEQLMSF 282

Query: 176 DYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVA 235
           D +GT + +   ++LLL L WGG +YPW                  F  V+  L  +   
Sbjct: 283 DLLGTFLFIPGIVSLLLALQWGGTKYPWKDGRIIALFVVFGLLIAGFLAVQAWLKEKATV 342

Query: 236 PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIA 295
           PP +F    V  C       G AFF +VYY+P++FQ V+G SA  SG++ +P+IL +VI 
Sbjct: 343 PPRVFLNRTVWSCAVFGACLGAAFFVMVYYLPIWFQAVQGTSAIDSGIKNLPMILSLVIF 402

Query: 296 SVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           S+ SG  V+    +A   ++ T   L+++G+G+++ +D ++G A  I Y           
Sbjct: 403 SLVSGGLVTTIGYYAPFMIAST--ILMSVGAGMLSTFDVHTGPAHWIGYQILFGIGVGLG 460

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPP-E 414
           MQ T++  Q  ++  DVA  TA+++F + +G    + +   +F N L +N+ +  I   +
Sbjct: 461 MQQTMVAIQASLDGADVAIGTAIIIFSQTLGGALFICVAQNVFQNKLVSNVADARIQGLD 520

Query: 415 LAGAVKASATVV-NQLPIEIRGPVISAYVGALRTAF 449
            A  V   AT + N +P E    V+ AY GA+   F
Sbjct: 521 PASVVSVGATQIRNLIPKEFLPVVLEAYNGAVTNTF 556



>gi|494723406|ref|WP_007459272.1| DSBA oxidoreductase [Streptomyces sp. W007]
 gi|364003290|gb|EHM24444.1| major facilitator superfamily permease [Streptomyces sp. W007]
          Length = 695

 Score =  273 bits (698), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 181/475 (38%), Positives = 263/475 (55%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I S+   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 17  QTIVSTALPTIVSELGGLDHLSWVVTAYLLAATAATPLWGKLGDQYGRKKLFQTAIVIFL 76

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+V+ ++RGKYQ          
Sbjct: 77  IGSALCGVAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDLVTPRERGKYQGLFGAVFGVT 136

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FYINLP+G + ++V   +L IP     + ++   IDY+GT
Sbjct: 137 SVLGPLLGGFFTEHLSWRWVFYINLPIGVVALVVIAAVLHIP-----VRREKHTIDYLGT 191

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++     AL+L  + GG  + WSSP               F  VE + A+EPV P  LF
Sbjct: 192 FLIASVATALVLVASLGGTTWAWSSPQIIGLAVLAVVLLVAFIAVERR-AVEPVLPLKLF 250

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV   + T SG+ ++P++ G++I S  SG
Sbjct: 251 RMRTFALVAVISFVIGFAMFGAMTYLPTFLQVVHDITPTMSGVHMLPMVFGLLITSTGSG 310

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+ A+G  L+   DENS       Y           MQ  +
Sbjct: 311 QIVSRTGR--WKVFPILGTAITAVGLLLLHQLDENSSTWLMSAYFFVFGAGLGLVMQVLV 368

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL- 415
           L  Q  V Y+D+   T+ + FFR IG+ FGVAI GTIF+N LT  + +      +PP + 
Sbjct: 369 LVAQNSVSYQDLGVATSGVTFFRSIGSAFGVAIFGTIFANRLTGQLTDALAGQPLPPGVD 428

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AG + A    + QLP ++R  V+ AY  ++   F   +P+ +L F+ + F+   K
Sbjct: 429 AGRLAADPRAIGQLPADLRPGVLGAYSTSITDVFLYAVPVVLLAFVLAWFLREDK 483



>gi|426198780|gb|EKV48706.1| hypothetical protein AGABI2DRAFT_203654 [Agaricus bisporus var.
           bisporus H97]
          Length = 618

 Score =  273 bits (698), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 167/481 (34%), Positives = 259/481 (53%), Gaps = 9/481 (1%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           +VATALP I+S F A    +WV +AYLLT T+F P YG+FSDIFGRKAT   A++ F +G
Sbjct: 81  VVATALPTISSHFNAGSVSSWVPSAYLLTSTSFLPLYGRFSDIFGRKATLTVAMLIFLVG 140

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           +L  G + ++  +I+ R +AG GGG ILSL  IIISDIVSL++RGKYQ            
Sbjct: 141 NLAAGFSKSIVELIVLRGVAGAGGGAILSLAQIIISDIVSLRERGKYQGIMGGVITLGYA 200

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             P+ GG   +  +WRW F+I LP+  + + V  F+L + +  G + +KLK +DY+G+++
Sbjct: 201 IGPITGGVLAEKASWRWCFWICLPISVLAIAVVNFVLPL-KSVGDIKRKLKVVDYVGSLL 259

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
            + +   ++LPL WGG  +PW S                F + E K A  P+ P  +FK 
Sbjct: 260 TLVACTLIILPLVWGGVTFPWKSAVVIAPFLCGALTFVLFTMWEWKGARLPIVPMRIFKH 319

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
             V G +   F  G+  FSL+YY+P +FQV    S   +GL LIP++ G V+ S  +G A
Sbjct: 320 STVCGVYIVMFINGLITFSLIYYLPQFFQVALAYSPIHAGLFLIPVLGGQVVISWCAGMA 379

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
           VSRT +  YRT+  +G A+ ++  GLI+     +     + YM          +QTT + 
Sbjct: 380 VSRTGR--YRTIVHSGFAIWSLACGLISTMTPQTKEGVMVVYMLLSAVGSGQTLQTTTVA 437

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV--- 419
            Q  V  KD++ VTA   F R++G    +A+  T+ +N L +++ ++++P +L   +   
Sbjct: 438 AQASVPRKDMSVVTAFRNFVRMLGGTLALAVGATLINNTLRSSMTSLSLPEQLIKKIIDD 497

Query: 420 ---KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTT 476
               ++ + +N    + R  + + Y    R  F  +  +     + S+ M  HK   R  
Sbjct: 498 PILLSNPSSLNISVEQARSILENGYTKGFRAVFILNASLSAFATVISIVMIKHKNLNRDD 557

Query: 477 D 477
           D
Sbjct: 558 D 558



>gi|296422936|ref|XP_002841013.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295637243|emb|CAZ85204.1| unnamed protein product [Tuber melanosporum]
          Length = 581

 Score =  273 bits (698), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 166/475 (34%), Positives = 256/475 (53%), Gaps = 19/475 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+ATA+P I   F AL+ + W  +AY+LT+ +FQ  YGK    F  K  FL A+  FE
Sbjct: 97  QTIIATAIPKITDQFGALNDVGWYGSAYMLTICSFQLVYGKIYTFFSLKWVFLAAIGIFE 156

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+AP    +I+ RAIAG+G  GI S  +II++  V L+ R  Y           
Sbjct: 157 LGSLVCGVAPTSKALIVGRAIAGLGCAGIFSGALIILAHSVPLRKRPMYTGFIGAMYGIA 216

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPR----PKGSLLQKLKRID 176
               PL+GGAFTDH TWRW FYINLP+GAITV V I     P+     K +L +KLK++D
Sbjct: 217 SVAGPLMGGAFTDHATWRWCFYINLPIGAITVAVMILYFTPPKRAKADKLTLTEKLKQVD 276

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
           ++GT +++   ++LLL L WGG  Y W S                F   +     +   P
Sbjct: 277 FVGTGLLLPGVVSLLLALQWGGTTYKWGSGRIIGLLVTAFVLLTGFVATQFWRQEKATIP 336

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  +       F  G AF  LV+Y+P++ Q +K  SAT SG+  +PLILGVV+ S
Sbjct: 337 PRIVKQRSIAFSSMLAFSVGSAFMLLVFYIPIWLQAIKSVSATKSGIMNLPLILGVVVLS 396

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + +G  ++      Y    + GA++ AIG+GL+T ++ ++G A  I Y           M
Sbjct: 397 ILAGILITICGY--YTPFMIVGASICAIGAGLLTTFEVDTGHAKWIGYQFICGAGIGLCM 454

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTN-------NIENI 409
           Q  ++  Q +++ +DV + TA+++FF+ +G    +++   +FSN L         NI+ +
Sbjct: 455 QQPMIAAQTVLKLEDVPTGTAVIVFFQTLGGALFISVGQNVFSNKLVAGLAESLPNIDPV 514

Query: 410 AIPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASL 464
           AI    A ++K++       P ++   ++ AY  AL   F   + + ++  +ASL
Sbjct: 515 AILNTGATSLKST------FPADMHPAILKAYNHALVECFYPAVAMAVVGVIASL 563



>gi|345014730|ref|YP_004817084.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           violaceusniger Tu 4113]
 gi|503826282|ref|WP_014060276.1| DSBA oxidoreductase [Streptomyces violaceusniger]
 gi|344041079|gb|AEM86804.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces
           violaceusniger Tu 4113]
          Length = 697

 Score =  273 bits (698), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 181/471 (38%), Positives = 255/471 (54%), Gaps = 13/471 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 49  QTIVSTALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKRLFQTAIVIFL 108

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCGLA NM  +I FRA+ G+GGGG++ L M I+ DIV  +DRG+YQ          
Sbjct: 109 IGSALCGLAGNMAELIAFRALQGLGGGGLMVLSMAIVGDIVPPRDRGRYQGLFGAVFSAA 168

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F DH++WRW FYINLP+G + ++V    L+IP  + S       IDY+GT
Sbjct: 169 SVLGPLLGGVFVDHLSWRWVFYINLPVGIVALLVVASALQIPVRRTS-----HTIDYLGT 223

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++     AL+L  + GG  Y W S                F  VE + A EPV P  LF
Sbjct: 224 FLIAAVAAALVLMTSLGGVTYGWGSWQIIGLAVVGMALLAAFVRVEFR-AAEPVLPLTLF 282

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C    F  G A F  + Y+P + Q+V+G S TTSGL L+PL+LG +++S  SG
Sbjct: 283 RSRTFTLCAVIGFIVGFAMFGSMTYLPTFLQIVQGVSPTTSGLHLLPLVLGTLVSSTVSG 342

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VSRT +  Y+   + G A+ A+G  L+    E+SG A    Y           +Q  +
Sbjct: 343 HLVSRTGR--YKVFPVLGTAITAVGLLLLHQLRESSGVAEMSAYFFVFGCGLGLVIQVLV 400

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPELA 416
           L  Q  V Y+D+   T+   FFR IGA FGV++ GTIF+N L  +I +      +PP + 
Sbjct: 401 LIVQNSVSYRDLGVATSGATFFRSIGASFGVSVFGTIFANNLGPHIADALAGRRLPPGIT 460

Query: 417 -GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            GA+ +    + +L    R  V  A+  ++   F   +P+ +L F+ + ++
Sbjct: 461 PGALTSDPRSLGRLSPVDRAAVRHAFSVSITDVFLYAVPVVLLAFVLAWYL 511



>gi|380474638|emb|CCF45667.1| major facilitator superfamily transporter [Colletotrichum
           higginsianum]
          Length = 570

 Score =  273 bits (698), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 176/483 (36%), Positives = 253/483 (52%), Gaps = 13/483 (2%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATA+P I  +F+ LD++AW  +A+ + + AFQ T+GK    F  K +FL ++  FE+
Sbjct: 89  TIVATAIPKITDEFRGLDQVAWYGSAFFMCVAAFQSTWGKAYKYFPLKTSFLLSIFIFEV 148

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSL+CG+APN   +I+ RAIAGVG  GI S    II        R  +            
Sbjct: 149 GSLICGVAPNSVALIVGRAIAGVGAAGIGSGAYTIIGFSAPPDKRPTFTGIIGASYGIAS 208

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP----KGSLLQKLKRIDY 177
              PL+GGAFTDHV+WRW FYINLP+G I+  + +F    P      K SLL+K  ++D 
Sbjct: 209 VIGPLIGGAFTDHVSWRWCFYINLPVGGISAAIILFYFTTPPQAVPVKASLLEKFLQMDL 268

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
           IGT +++G+TI+ LL L WGG+ +PW+S                F ++E       +  P
Sbjct: 269 IGTALIMGATISFLLALQWGGHTHPWNSSTVIGLFVGFFLIIIAFVVLEWYQGERSMIAP 328

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            L     V       FF   ++F LVYY+P+YFQ V   S T SG+  +PLI+ V IA++
Sbjct: 329 RLISDRTVYISSIYAFFFAGSYFVLVYYLPIYFQSVDNASPTQSGVRNLPLIIAVTIATI 388

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIA-IGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
            SG ++S+T  +   T  + G+A++A +G+GLI   D  +G    I Y            
Sbjct: 389 VSGVSISKTGIY---TPILVGSAVVATVGAGLIYTLDIGTGSGKWIGYQIIAGLGWGAGF 445

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIF-SNVLTNNIENI-AIPPE 414
           Q  ++  QG V   D+AS TA+L+FF+ +G  F VA   + F   VL    EN+  I P 
Sbjct: 446 QVPIIAIQGTVGESDLASATAVLLFFQTVGGAFYVAAAQSGFLVTVLKKVTENVPGIDPA 505

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLR 474
           L  A+  +  + +  P E    VI AY+  L+ AF   I    +  L SL  G+    L 
Sbjct: 506 LV-AITGATQIRSAFPAEFVPGVIQAYMDGLKIAFALAIAGAGVSVLVSL--GSRWGKLN 562

Query: 475 TTD 477
           T +
Sbjct: 563 TQN 565



>gi|391865494|gb|EIT74774.1| permease of the major facilitator superfamily [Aspergillus oryzae
           3.042]
          Length = 542

 Score =  273 bits (697), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 173/459 (37%), Positives = 248/459 (54%), Gaps = 13/459 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+  A+P I   FK+++ IAW  +AY LT TA QP+YG+   IF  K  FL AV+ FE
Sbjct: 49  QTIIGVAIPKITDQFKSIEDIAWYGSAYFLTSTALQPSYGRIYKIFSVKWGFLIAVLIFE 108

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C +AP+ T +I+ RA+AG+G  GI S  ++IIS  V L  R              
Sbjct: 109 IGSLICAVAPSSTVLIVGRAVAGIGVAGIFSGALVIISMTVPLPKRPLVFGMFGMVWGIA 168

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKG----SLLQKLKRID 176
               PLLGGAFTD V+WRW FYINLP+G +++ V IF+LR+P+        +L ++K++D
Sbjct: 169 SIAGPLLGGAFTDGVSWRWCFYINLPIGGLSIAVIIFILRVPKKSELSGTPVLDRIKQLD 228

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IG  +++ + + LLL L WGGN+YPW+S                F   + KL      P
Sbjct: 229 LIGASLLIPAIVCLLLALQWGGNKYPWNSSRVIGLFVGFGLMIIIFTFSQIKLGDRATLP 288

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + KR  V+       F G AFF LVYYVP++FQ VKG SA  SG++L+PL+L  VI+S
Sbjct: 289 PGILKRRSVLSATMFALFFGGAFFLLVYYVPIFFQSVKGSSAMKSGIQLLPLMLATVISS 348

Query: 297 VSSGQAVSRTDKFAYRTLSMTGA-ALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           V  G  V+      Y T  + G+ A+ AIG+GLIT +  +      I Y           
Sbjct: 349 VLVGAFVTAA---GYYTPFLIGSTAIAAIGTGLITTYSVDISTGKWIGYQILVGAGVGAG 405

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL 415
            Q  +   Q ++  +D+   TA +MFF+ +G    +A+  ++F N L + I   A   + 
Sbjct: 406 FQIPMTAVQTVLPPEDIPVGTAAVMFFQTLGGALFIAVGQSVFQNGLIDGIREFAPTVDP 465

Query: 416 AGAVKASATVVNQL-----PIEIRGPVISAYVGALRTAF 449
              V A AT +  +      ++    VI AY+  LR A+
Sbjct: 466 RAIVGAGATEMRHVLAALGQLDQLDAVIRAYMSGLRDAY 504



>gi|238490224|ref|XP_002376349.1| MFS toxin efflux pump (AflT), putative [Aspergillus flavus
           NRRL3357]
 gi|220696762|gb|EED53103.1| MFS toxin efflux pump (AflT), putative [Aspergillus flavus
           NRRL3357]
          Length = 542

 Score =  273 bits (697), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 173/459 (37%), Positives = 248/459 (54%), Gaps = 13/459 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+  A+P I   FK+++ IAW  +AY LT TA QP+YG+   IF  K  FL AV+ FE
Sbjct: 49  QTIIGVAIPKITDQFKSIEDIAWYGSAYFLTSTALQPSYGRIYKIFSVKWGFLIAVLIFE 108

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C +AP+ T +I+ RA+AG+G  GI S  ++IIS  V L  R              
Sbjct: 109 IGSLICAVAPSSTVLIVGRAVAGIGVAGIFSGALVIISMTVPLPKRPLVFGMFGMVWGIA 168

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKG----SLLQKLKRID 176
               PLLGGAFTD V+WRW FYINLP+G +++ V IF+LR+P+        +L ++K++D
Sbjct: 169 SIAGPLLGGAFTDGVSWRWCFYINLPIGGLSIAVIIFILRVPKKSEFSGTPVLDRIKQLD 228

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IG  +++ + + LLL L WGGN+YPW+S                F   + KL      P
Sbjct: 229 LIGASLLIPAIVCLLLALQWGGNKYPWNSSRVIGLFVGFGLMIIIFTFSQIKLGDRATLP 288

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + KR  V+       F G AFF LVYYVP++FQ VKG SA  SG++L+PL+L  VI+S
Sbjct: 289 PGILKRRSVLSATMFALFFGGAFFLLVYYVPIFFQSVKGSSAMKSGIQLLPLMLATVISS 348

Query: 297 VSSGQAVSRTDKFAYRTLSMTGA-ALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           V  G  V+      Y T  + G+ A+ AIG+GLIT +  +      I Y           
Sbjct: 349 VLVGAFVTAA---GYYTPFLIGSTAIAAIGTGLITTYSVDISTGKWIGYQILVGAGVGAG 405

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL 415
            Q  +   Q ++  +D+   TA +MFF+ +G    +A+  ++F N L + I   A   + 
Sbjct: 406 FQIPMTAVQTVLPPEDIPVGTAAVMFFQTLGGALFIAVGQSVFQNGLIDGIREFAPTVDP 465

Query: 416 AGAVKASATVVNQL-----PIEIRGPVISAYVGALRTAF 449
              V A AT +  +      ++    VI AY+  LR A+
Sbjct: 466 RAIVGAGATEMRHVLAALGQLDQLDAVIRAYMSGLRDAY 504



>gi|493113487|ref|WP_006142963.1| MFS transporter [Streptomyces griseoaurantiacus]
 gi|329300402|gb|EGG44299.1| efflux protein [Streptomyces griseoaurantiacus M045]
          Length = 793

 Score =  273 bits (697), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 171/475 (36%), Positives = 249/475 (52%), Gaps = 14/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  TAYLLT T   P YGK  D++GRK  F FA++ F 
Sbjct: 53  QMIVATALPRIVGELHGLDKMSWTVTAYLLTATVGLPVYGKAGDLYGRKGVFQFAILVFV 112

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A NM  +I +RA+ GVG GG++  V  II+DIV  + RG+Y           
Sbjct: 113 LGSALAGRAGNMDQLIAYRAVQGVGAGGLMIGVQAIIADIVPPRARGRYMGAIGAAFGLA 172

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FYIN+P G +T+ V   +L++PRP      +  R+D  GT
Sbjct: 173 SVAGPLLGGYFTDHLSWRWCFYINVPFGLVTLAVVAVVLKLPRP-----DRRARLDVPGT 227

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F L E + A EP+ P  LF
Sbjct: 228 LLLAAASTCLVLLTSWGGTEYAWGSRVVLGLGAGAVAAILLFLLAE-RYAAEPLIPLRLF 286

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P + Q+V G SAT SGL ++P++ G+V AS+  G
Sbjct: 287 RDPVFNVTALVGLVIGVALFGAASYLPTFLQMVDGVSATESGLLMLPMMAGIVGASIVCG 346

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +SRT +  Y+   + G+AL A+G  L++    ++ R     +M          M   +
Sbjct: 347 QLISRTGR--YKPYPLLGSALSALGMWLLSGLGTDTPRLQYSIWMAVLGTGIGMVMPVLV 404

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           L  Q  V   D+ + T+   +FR IG   G A+ GT+F+  LT  +    +P   AGA+ 
Sbjct: 405 LAVQNAVRPADLGTATSANNYFRQIGGSVGAAVFGTLFARRLTEALSE-RLPSTAAGALP 463

Query: 421 ASATVVNQ----LPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKP 471
              ++  Q    LP E+R   + AY  A+   F   +PI +L  + + F+   KP
Sbjct: 464 DPESLTPQLVRTLPPELREAYVRAYADAMPRIFLYLVPILVLGLVLACFL-KEKP 517



>gi|317036407|ref|XP_001397319.2| efflux pump antibiotic resistance protein [Aspergillus niger CBS
           513.88]
          Length = 620

 Score =  273 bits (697), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 175/480 (36%), Positives = 273/480 (56%), Gaps = 7/480 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + + F   D ++WV TAYLLT TA QP YG+ +DIFGRK   L ++  F 
Sbjct: 104 QTIVATALPTLGAVFNQADIVSWVGTAYLLTCTACQPLYGRLTDIFGRKVILLGSLFLFL 163

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS++ G++  MT +II RA+AG+GGGGI+++V I++SD+VSLQDRGKYQ          
Sbjct: 164 IGSVISGVSRGMTMLIIARAVAGIGGGGIVTVVSIVVSDVVSLQDRGKYQGIIGIVVAAG 223

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG FT+ ++WRW FYI++PL  + ++V  F L + + +G  L+K+K+ID  G 
Sbjct: 224 TALGPLIGGLFTEKISWRWCFYISVPLSGVAMVVVAFALPLRKVEGHALEKIKQIDGWGC 283

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           ++   ++IA+LLP++W G +Y W+S                F  VE K+A  P+ P H+F
Sbjct: 284 LISFSASIAILLPISWAGTQYSWTSAAVIAPLLLGVALIGVFLFVEFKVARLPLIPLHMF 343

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K  HV  C  T+F  G   F  +YY+P ++QV +GDSA  SG+ ++PLIL  ++ S +SG
Sbjct: 344 KNSHVSICILTSFLTGFMTFVNLYYLPQFYQVARGDSALRSGILILPLILSQIVTSFTSG 403

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+     YR   + G AL  I SGL T+   ++  A  + +           +QTTL
Sbjct: 404 FLVSKYS--CYRINLIVGYALWTIASGLFTMVTPSTSAAVLVVFQLLTGLGSGQTLQTTL 461

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V+ +++A +T    + R++G+   VA    I +N++   +E I  P  +   + 
Sbjct: 462 VAIQAAVKREEMAVITGARNYLRMMGSTLAVAASAAIVNNIVRTKLEAINFPRSIISEII 521

Query: 421 ASATVVNQLPIEI--RGPVISAYVGALR-TAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
           A  T +  + +    +   ++AY   ++ T +      GI  FL   F+ ++  +L+  D
Sbjct: 522 ADPTKIASMSLSAAQKTDALNAYAHGVQVTYYMMTALAGIQFFLCVFFVKDY--TLKRDD 579



>gi|494133040|ref|WP_007072801.1| transporter [Micromonospora sp. ATCC 39149]
 gi|237882697|gb|EEP71525.1| drug resistance transporter, emrB/qacA subfamily [Micromonospora
           sp. ATCC 39149]
          Length = 530

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/458 (33%), Positives = 237/458 (51%), Gaps = 17/458 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
             IV+TALP I  +F  +D   WV TAY+L  T   P +GK  D++GRKA FL +V+ F 
Sbjct: 32  NMIVSTALPRIVGEFGGVDHFTWVVTAYVLGTTVSTPIWGKLGDLYGRKAIFLTSVLVFL 91

Query: 61  IGSLLCGLA---------PNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQX 111
           +GS LCG+A           M  +I FRA+ G+G GG++  VM II D+V  ++RG+YQ 
Sbjct: 92  VGSALCGMAGSGVFGGADSGMIELIAFRAVQGLGAGGLMVGVMAIIGDLVPPRERGRYQG 151

Query: 112 XXXXXXXXXXXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQK 171
                        PL+GG  TD+++WRW+FY+NLPLG + ++V    + +P+ +      
Sbjct: 152 MIAGIMAIAMVAGPLVGGFITDNLSWRWAFYVNLPLGGVALLVLATTMHLPKYRTE---- 207

Query: 172 LKRIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAI 231
             RID++G  ++     A++L   WGGN Y W+SP               FG VE + A 
Sbjct: 208 -HRIDWLGAGLLSVGITAIVLITTWGGNSYDWTSPQILGLAALALVSLVVFGFVERR-AA 265

Query: 232 EPVAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILG 291
           EP+ P  LF   +        F  G + F  + ++PLY Q V+G SAT SGL L+PL+ G
Sbjct: 266 EPILPLGLFANRNFALISVIGFLLGFSMFGAMNFLPLYQQTVQGASATNSGLLLLPLMFG 325

Query: 292 VVIASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXX 351
           ++  S+  G+A+++T +  YR   + G  ++  G  L+T  + ++ +     YM      
Sbjct: 326 MLAVSLVVGRAITKTGR--YRVFPIVGGVVMTAGLALLTRLELDTSKLESSLYMIVLGVG 383

Query: 352 XXXXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAI 411
               MQT++L  Q  VE KD+ + +    FFR IG  FG+++ G IF+N L ++    A 
Sbjct: 384 MGFLMQTSMLIAQNSVEQKDLGAASGAATFFRSIGGSFGISLFGAIFANRLADSPAGPAF 443

Query: 412 PPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAF 449
                   +     + +LP + R  V+     A+   F
Sbjct: 444 SGGGGEGGQVDLDKLKELPAQARELVLGGLADAVSHVF 481



>gi|390600521|gb|EIN09916.1| transporter [Punctularia strigosozonata HHB-11173 SS5]
          Length = 613

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 176/492 (35%), Positives = 249/492 (50%), Gaps = 21/492 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+ TALP I S F ALD++ WVA+AY LT   F  + G+   +   K  FL ++  FE
Sbjct: 116 QTIIGTALPRIVSHFNALDQVTWVASAYFLTDAGFMLSAGQLLAVAPTKWVFLASITIFE 175

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSLLCG+AP M  +I+ RAIAG+GG GI   V+ II+ +  L+DR              
Sbjct: 176 IGSLLCGVAPTMDVLILGRAIAGMGGAGITIAVISIIAQVTRLEDRPVLFGAFGAFFALA 235

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP------KGSLLQKLKR 174
               PL+GGAFTDHV+WRW FYINLP+GA T+++   +L    P       G+   K  R
Sbjct: 236 SVIGPLMGGAFTDHVSWRWCFYINLPIGACTIVLVSIMLEARPPIDDSNFAGTGRSKWLR 295

Query: 175 IDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPV 234
           +D+ GTI+ +G T ALLLPL WGG   PW+ P               F   E ++    +
Sbjct: 296 LDWAGTILDIGMTTALLLPLQWGGATKPWTDPSVYALFPVFAVLCAAFIYCEYRMGPRAI 355

Query: 235 APPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVI 294
            P  +FKR  ++GC    FF  M      YY+PL++Q  +G SATTSGL+++P +L VV 
Sbjct: 356 IPLKMFKRRGMLGCALVAFFVYMGMLVATYYLPLWYQATRGHSATTSGLDILPFMLSVVG 415

Query: 295 ASVSSGQAVSRTDKF--------AYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMX 346
            +  SG  +S+T +             +       +   +    L  E+S +     Y  
Sbjct: 416 FAAISGVVISKTGRVMPWLFGSPLLLAIGGGLLYTVDAHTSTAKLIGESSPQTRSNSYQI 475

Query: 347 XXXXXXXXXMQTTLLCGQGIVEYKD----VASVTALLMFFRLIGAVFGVAIVGTIFSNVL 402
                    MQ T+L  Q   E+ D    +   T++  F +L+G +  +AI GT+F N L
Sbjct: 476 LFGCGIGGAMQNTILGVQ--TEFADDEKLIPQATSIAQFMQLLGGIIAIAIAGTVFDNQL 533

Query: 403 TNNIENIAIPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLA 462
             NI +  +P ELA  +  S +V+  L    R  VI AY  +LR  F   +P G L  L 
Sbjct: 534 RANIPS-TLPAELAKQISQSVSVIKTLDPADRAIVIEAYTKSLRPVFMIGVPAGALASLC 592

Query: 463 SLFMGNHKPSLR 474
           +L + N+    R
Sbjct: 593 ALIVPNYNLKER 604



>gi|310795207|gb|EFQ30668.1| major facilitator superfamily transporter [Glomerella graminicola
           M1.001]
          Length = 565

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 176/484 (36%), Positives = 253/484 (52%), Gaps = 15/484 (3%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATA+P I  +F+ LD++AW  +A+ + + AFQ T+GK    F  K +FL ++  FEI
Sbjct: 84  TIVATAIPKITDEFRGLDQVAWYGSAFFMCVAAFQSTWGKAYKYFPLKTSFLLSIFIFEI 143

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSL+C +APN   +II RAIAGVG  G+ S    II        R  +            
Sbjct: 144 GSLICAVAPNSVALIIGRAIAGVGAAGVASGAYTIIGFSAPPDKRPTFTGIVGAAYGIAS 203

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP------KGSLLQKLKRI 175
              PL+GGAFTDHV+WRW FYINLP+G ++  VAI LL    P      K SL +K  ++
Sbjct: 204 VIGPLIGGAFTDHVSWRWCFYINLPIGGVS--VAIILLYFTTPPHAVPVKASLREKFLQM 261

Query: 176 DYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVA 235
           D IGT +++G+TI+ LL L WGG+ +PW+S                F ++E       + 
Sbjct: 262 DLIGTFLIMGATISFLLALQWGGHTHPWNSSTVIGLFVGFFVILIAFIILEWYQGERSMI 321

Query: 236 PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIA 295
            P L     V+      FF G A+F LVYY+P+YFQ V   S T SG+  +PLIL V IA
Sbjct: 322 APRLISDRTVLISSVYAFFFGGAYFILVYYLPIYFQSVDNASPTQSGVRNLPLILAVTIA 381

Query: 296 SVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           ++ SG ++S T    Y  + +  AA+  +G+GL+   D  +G    I Y           
Sbjct: 382 TIVSGVSISATG--IYTPILVGSAAIATVGAGLLYTLDVGTGSDKWIGYQILAGLAWGAG 439

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIF-SNVLTNNIENI-AIPP 413
            Q  ++  QG V   D+AS TA+L+FF+ +G  F VA   + F   +L    EN+ ++ P
Sbjct: 440 FQVPIIAVQGTVSADDLASSTAVLLFFQTVGGAFYVAAAQSGFLITILKEVAENLPSVDP 499

Query: 414 ELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSL 473
            +  A+  +  +    P E+   +I AY+  L+ AF   I    + FL SL  G+    L
Sbjct: 500 AVV-ALTGATQIRTAFPAEVVPGIIRAYMEGLKIAFALAITGAGVAFLVSL--GSRWNKL 556

Query: 474 RTTD 477
            T +
Sbjct: 557 NTKN 560



>gi|21221795|ref|NP_627574.1| exporter [Streptomyces coelicolor A3(2)]
 gi|499339230|ref|WP_011028938.1| transporter [Streptomyces coelicolor]
 gi|4585598|emb|CAB40866.1| putative exporter [Streptomyces coelicolor A3(2)]
          Length = 531

 Score =  272 bits (696), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 159/467 (34%), Positives = 242/467 (51%), Gaps = 13/467 (2%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           I+ TA+P I  +   L+ ++WV TAY L   A  P +GK  D++GRK  F+ +++ F  G
Sbjct: 41  IIGTAMPTIVGELGGLEHLSWVVTAYTLATAASTPLWGKLGDMYGRKGVFMTSIVIFLAG 100

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 101 SALSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMIAGVMALSMI 160

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TDH  WRWSFYIN+PLG I +I    +L +P+ +        RIDY+G  +
Sbjct: 161 GGPLVGGTITDHWGWRWSFYINIPLGVIALIAISAVLHLPKKRSE-----ARIDYLGAAL 215

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     A++L   WGG EY W+S                F   +T+ A EP+ P H+F+ 
Sbjct: 216 LTIGITAIVLVTTWGGTEYAWTSARIMELIGIGVAALVGFVFWQTR-AAEPILPLHIFRS 274

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F    ++PLY Q V+G SAT SGL L+P++  +++ S+ +G+ 
Sbjct: 275 RNFTLMSVIGFIVGFVMFGATLFLPLYQQSVQGASATNSGLLLLPMLGAMLVTSMVAGRV 334

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T +  Y+   + G AL+ +G  L++  D ++ R     YM          MQ T+L 
Sbjct: 335 TTSTGR--YKIFPVAGGALMTVGLYLLSTMDTDTTRFTSGLYMAVVGLGMGCLMQITMLV 392

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR +G+ FGVAI+G +F+N + + +   A     A A + S
Sbjct: 393 AQNSVEMKDMGVASSSTTLFRTLGSSFGVAIMGALFNNRVQDVMAERAAGSG-AKATEQS 451

Query: 423 ATV----VNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
           AT+    +N LP  IR     A      TAF     + +L  +AS F
Sbjct: 452 ATLTADALNALPAAIRDAYQHAVSAGTHTAFLLGSAVAVLALVASFF 498



>gi|493422764|ref|WP_006378535.1| drug resistance transporter, EmrB/QacA family protein [Streptomyces
           turgidiscabies]
 gi|440278318|gb|ELP66374.1| drug resistance transporter, EmrB/QacA family protein [Streptomyces
           turgidiscabies Car8]
          Length = 685

 Score =  272 bits (696), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 175/475 (36%), Positives = 259/475 (54%), Gaps = 14/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   +D ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 47  QTIVSTALPTIVSDLGGMDHLSWVVTAYLLASTAATPLWGKLGDQYGRKRLFQAAIVIFL 106

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+V  ++RG+YQ          
Sbjct: 107 IGSALCGMAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDLVPPRERGRYQGLFGAVFGAT 166

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FY+NLP+GA+ + V   +LRIPR     +     IDY+GT
Sbjct: 167 SVLGPLLGGLFTEHLSWRWVFYVNLPVGAVALAVIATVLRIPRRSARHV-----IDYLGT 221

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++      L+L  + G + + W S                F LVE + A EPV P  LF
Sbjct: 222 LLIASVATCLILVTSLGAS-WGWGSARIVGLAVLGVVLAVVFVLVERR-AAEPVLPLKLF 279

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV G S T SG+ ++P++LG+++AS  SG
Sbjct: 280 RLRTFTLTAVISFIVGFAMFGAMTYLPTFLQVVHGVSPTMSGVHMLPMVLGLLVASTVSG 339

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G  + A+G  L+   DE+S       Y           MQ  +
Sbjct: 340 QIVSRTGR--WKVFPIAGTGVTALGLLLLHQLDEHSSTGEMSAYFLVFGLGLGLVMQVLV 397

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFS----NVLTNNIENIAIPPEL- 415
           L  Q  V Y+D+   T+   FFR IGA FGVA+ GT+F+    + LT+    + +P  + 
Sbjct: 398 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAVFGTVFAGRLGDKLTDAFRGVRLPAGVS 457

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           A A+++    +  LP  +R P + AY  A+   F   +P+ +L F+ + F+   +
Sbjct: 458 ADALESDPRGIAALPSALRPPALHAYASAITDVFLYAVPVAVLGFVLAWFLREDR 512



>gi|326472732|gb|EGD96741.1| MFS transporter [Trichophyton tonsurans CBS 112818]
 gi|326482020|gb|EGE06030.1| MFS transporter [Trichophyton equinum CBS 127.97]
          Length = 583

 Score =  272 bits (696), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 165/472 (34%), Positives = 250/472 (52%), Gaps = 9/472 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   F AL+ I W  ++YLLT+ AFQ  +GK    F  K  FL A+  FE
Sbjct: 100 NTIIATAIPKITDQFHALEDIGWYGSSYLLTICAFQLIFGKIYTFFPVKWVFLIAITIFE 159

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS +CG APN T +II RA+AG+G  GI S  +III+  + L+ R  Y           
Sbjct: 160 IGSAICGAAPNSTALIIGRAVAGIGSAGIFSGALIIIAYSIPLEKRPAYTGAIGGMYGIA 219

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK----GSLLQKLKRID 176
               PL+GGAFTDH++WRW FYINLP+GA+T++  +  L+ P+ K     S   +L ++D
Sbjct: 220 SVAGPLMGGAFTDHISWRWCFYINLPIGAVTILSILVFLKHPKQKLDNNQSWKARLMKLD 279

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IGT   + S I LLL L WGG +YPW++                F   + +       P
Sbjct: 280 PIGTAFFMPSIICLLLALQWGGTKYPWNNGRIIALFVVFALLISGFIYFQIRGGDSATVP 339

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  +       F  G AFF +VYY+P++FQ +KG SAT+SG+  IP++L +VI S
Sbjct: 340 PRILKKRSIASGAFFLFTIGSAFFIMVYYLPIWFQAIKGASATSSGIMNIPMVLSLVILS 399

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           ++SG  V+    +A   L      L AIG+GL+T +   + +   I Y           +
Sbjct: 400 IASGITVTAIGYYA--PLYYVSTVLTAIGAGLLTTFTTETSKGKWIGYQIIFGAGVGTGL 457

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA--IPPE 414
           Q +++  Q ++  +DVA  T ++MF + +G    V++   +F+N+L   + N A  + P+
Sbjct: 458 QLSIIAAQAVLPLEDVAVGTVIMMFCQTLGGALFVSVGQNVFTNLLVKGVVNAAPGLDPQ 517

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           L   V A+  + + +P +    V  AY  AL   +     +  L  + S+ M
Sbjct: 518 LVLRVGAT-QLKSMIPPQFLDGVQVAYNDALTKTWYVATALAALSVIGSVGM 568



>gi|490073293|ref|WP_003975468.1| transporter [Streptomyces lividans]
 gi|289701120|gb|EFD68549.1| exporter [Streptomyces lividans TK24]
 gi|509519109|gb|EOY48422.1| putative exporter [Streptomyces lividans 1326]
          Length = 533

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 159/467 (34%), Positives = 242/467 (51%), Gaps = 13/467 (2%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           I+ TA+P I  +   L+ ++WV TAY L   A  P +GK  D++GRK  F+ +++ F  G
Sbjct: 41  IIGTAMPTIVGELGGLEHLSWVVTAYTLATAASTPLWGKLGDMYGRKGVFMTSIVIFLAG 100

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 101 SALSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMIAGVMALSMI 160

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TDH  WRWSFYIN+PLG I +I    +L +P+ +        RIDY+G  +
Sbjct: 161 GGPLVGGTITDHWGWRWSFYINIPLGVIALIAISAVLHLPKKRSE-----ARIDYLGAAL 215

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     A++L   WGG EY W+S                F   +T+ A EP+ P H+F+ 
Sbjct: 216 LTIGITAIVLVTTWGGTEYAWTSARIMELIGIGVAALVGFVFWQTR-AAEPILPLHIFRS 274

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F    ++PLY Q V+G SAT SGL L+P++  +++ S+ +G+ 
Sbjct: 275 RNFTLMSVIGFIVGFVMFGATLFLPLYQQSVQGASATNSGLLLLPMLGAMLVTSMVAGRV 334

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T +  Y+   + G AL+ +G  L++  D ++ R     YM          MQ T+L 
Sbjct: 335 TTSTGR--YKIFPVAGGALMTVGLYLLSTMDTDTTRFTSGLYMAVVGLGMGCLMQITMLV 392

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR +G+ FGVAI+G +F+N + + +   A     A A + S
Sbjct: 393 AQNSVEMKDMGVASSSTTLFRTLGSSFGVAIMGALFNNRVQDVMAERAAGSG-AKATEQS 451

Query: 423 ATV----VNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
           AT+    +N LP  IR     A      TAF     + +L  +AS F
Sbjct: 452 ATLTADALNALPAAIRDAYQHAVSAGTHTAFLLGSAVAVLALVASFF 498



>gi|496369744|ref|WP_009078734.1| MFS transporter [Streptomyces sp. AA4]
 gi|302436407|gb|EFL08223.1| major facilitator superfamily transporter permease [Streptomyces
           sp. AA4]
          Length = 679

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 164/470 (34%), Positives = 246/470 (52%), Gaps = 12/470 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I  D      ++WV TAYLL  T      GK  D+FGRK  F  +V+ F 
Sbjct: 40  QTIVGTALPTIVGDLGGAGHLSWVVTAYLLAETIMTVVVGKLGDLFGRKLMFQLSVLVFG 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS  CG A +MT +II+RA+ G+GGGG++     +I+D+V L++RGKYQ          
Sbjct: 100 AGSFFCGFADSMTWLIIWRAVQGLGGGGLMVTSTALIADVVPLRERGKYQGALGSVFGVV 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P+LGG F DH++WRW+FY+N+PL  + + VA   +  P  + ++      IDY+G 
Sbjct: 160 TVAGPMLGGLFVDHLSWRWAFYVNIPLAVVVLAVAASAM--PSVRAAVKPV---IDYLGI 214

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  +   L L  +WGG  Y W SP               F  VE + A EP+ P  LF
Sbjct: 215 LLIGLAATGLTLVTSWGGTTYAWGSPVILGMAAGSVVLLGAFVAVELR-APEPMLPMRLF 273

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A    + Y+P Y Q V+G SATTSG+ L+P++L +++AS+ SG
Sbjct: 274 RNPVFTVAGIMSFVVGFAMLGALSYLPTYMQYVQGVSATTSGVRLLPMVLALLVASILSG 333

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VSRT K  Y+   + G+A++ +G  L++    ++G      YM          MQ   
Sbjct: 334 TLVSRTGK--YKIYPLAGSAVMTVGLYLLSRLGAHTGFWESALYMAVLGLGIGLGMQVLT 391

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPELA 416
           +  Q  V+YKD+   T+ + F R IG+ FG AI GT+++N L  N+        +PP + 
Sbjct: 392 IAVQNTVDYKDLGVATSGVTFLRSIGSSFGAAIFGTVYANQLGPNLAKALAEHPLPPGVD 451

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
                    ++ LP  +  PVI AY  +L   F    P+G++ F+ + F+
Sbjct: 452 PKAVQVPQALHHLPATVSEPVIGAYADSLHVVFLYAAPVGLVAFVLAFFL 501



>gi|490077502|ref|WP_003979650.1| putative drug-resistance transporter [Streptomyces rimosus]
 gi|440621714|gb|ELQ84673.1| putative drug-resistance transporter [Streptomyces rimosus subsp.
           rimosus ATCC 10970]
          Length = 680

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 166/471 (35%), Positives = 246/471 (52%), Gaps = 17/471 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I +D      +AWV TAYLL  T      GKF D+FGRK  F  + + F 
Sbjct: 43  QTIVSTALPTIVADLGGGGHMAWVVTAYLLAETVSTVLVGKFGDLFGRKIIFQVSAVVFV 102

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+L G + +M  +++ RA+ GVGGGG++   M +I+D++ L++RGKYQ          
Sbjct: 103 GGSVLAGASTSMLMLVVARAVQGVGGGGLMVTAMALIADVIPLRERGKYQGALGAVFGVT 162

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P LGG FTDH +WRW FY+N+P+  + V +A   + + R     L     IDY+G 
Sbjct: 163 TVVGPTLGGLFTDHASWRWCFYVNIPIAIVMVAMAARTIPVVRAAVRPL-----IDYLGI 217

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           ++V      L+L L WGGNEY W S                F +VE + A EP+ P HLF
Sbjct: 218 VLVALGASGLVLGLEWGGNEYAWGSAVIIGLFAGSVVLLAAFVVVELR-AREPMLPMHLF 276

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + Y+P Y Q V G SAT SG+  +P++ G++  S+ SG
Sbjct: 277 RNPVFTICSVLSFIVGFAMLGAMTYLPTYLQFVDGVSATMSGVRTLPMVAGLLGTSMLSG 336

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VSRT +  YR   + G  ++ +G  L++    ++G   +  YM          MQ   
Sbjct: 337 VVVSRTGR--YRVFPIIGTGVMVLGLYLMSTMGADTGVWLESLYMFVLGLGIGLAMQVLT 394

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-----ENIAIPPEL 415
           +  Q  V Y ++ S T+ + FFR +G+ FG A+ GT++SN L  N+     ++  +PPE 
Sbjct: 395 IAVQNTVNYHELGSATSGVTFFRTLGSSFGTAVFGTLYSNRLEPNLKAALAKSPGVPPEA 454

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           A    AS   +++LP     PVI AY   +   F   +P+ +  FL + F+
Sbjct: 455 A----ASPQALHRLPDAQARPVIDAYADTVNHVFQWVVPVALAGFLVAWFL 501



>gi|182438958|ref|YP_001826677.1| major facilitator superfamily permease [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|501349490|ref|WP_012381125.1| DSBA oxidoreductase [Streptomyces griseus]
 gi|178467474|dbj|BAG21994.1| putative permease of the major facilitator superfamily
           [Streptomyces griseus subsp. griseus NBRC 13350]
          Length = 727

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 179/475 (37%), Positives = 263/475 (55%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I S+   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 39  QTIVSTALPTIVSELGGLDHLSWVVTAYLLAATAATPLWGKLGDQYGRKRLFQTAIVIFL 98

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+V+ ++RGKYQ          
Sbjct: 99  IGSALCGVAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDLVTPRERGKYQGLFGAVFGVT 158

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FYINLP+G + ++V   +L IP     + ++   IDY+GT
Sbjct: 159 SVLGPLLGGFFTEHLSWRWVFYINLPIGIVALVVIAAVLHIP-----VRREKHTIDYLGT 213

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++     AL+L  + GG  + WSSP               F  VE + A+EPV P  LF
Sbjct: 214 FLIAAVATALVLVASLGGTTWAWSSPQIIGLAVLAVLLLVAFVAVERR-AVEPVLPLKLF 272

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV   + T SG+ ++P++ G++I S  SG
Sbjct: 273 RIRTFALVAVISFVIGFAMFGAMTYLPTFLQVVHDITPTMSGVHMLPMVFGLLITSTGSG 332

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+ A+G  L+   DENS       +           MQ  +
Sbjct: 333 QIVSRTGR--WKVFPILGTAITAVGLLLLHQLDENSSTWLMSAFFFVFGSGLGLVMQVLV 390

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL- 415
           L  Q  V Y+D+   T+ + FFR IG+ FGVAI GTIF+N LT  + +      +PP + 
Sbjct: 391 LVAQNSVSYEDLGVATSGVTFFRSIGSAFGVAIFGTIFANRLTGQLTDALAGQPLPPGVD 450

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AG + A    + QLP ++R  V+ AY  ++   F   +P+ +L F+ + F+   +
Sbjct: 451 AGRLAADPRAIGQLPADLRPGVLGAYSTSITDVFLYAVPVVLLAFVLAWFLREDR 505



>gi|302662872|ref|XP_003023086.1| hypothetical protein TRV_02776 [Trichophyton verrucosum HKI 0517]
 gi|291187064|gb|EFE42468.1| hypothetical protein TRV_02776 [Trichophyton verrucosum HKI 0517]
          Length = 583

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 163/472 (34%), Positives = 251/472 (53%), Gaps = 9/472 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   F AL+ I W  ++YLLT+ AFQ  +GK    F  K  FL A+  FE
Sbjct: 100 NTIIATAIPKITDQFHALEDIGWYGSSYLLTICAFQLIFGKIYTFFPVKWVFLIAITIFE 159

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS +CG APN T +II RA+AG+G  GI S  +III+  + L+ R  Y           
Sbjct: 160 IGSAICGAAPNSTALIIGRAVAGIGSAGIFSGALIIIAYSIPLEKRPAYTGAIGGMYGIA 219

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQ----KLKRID 176
               PL+GGAFTDH++WRW FYINLP+GA+T++  +  L+ P+ K    Q    +L ++D
Sbjct: 220 SVAGPLMGGAFTDHISWRWCFYINLPIGAVTILSILIFLKHPKQKLDNNQTWKARLLKLD 279

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IGT   + S I LLL L WGG +YPW++                F   + +       P
Sbjct: 280 PIGTAFFMPSIICLLLALQWGGTKYPWNNGRIIALFVVFAVLISGFIYFQIRGGDSATVP 339

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  +       F  G AFF +VYY+P++FQ +KG SAT+SG+  IP++L +V+ S
Sbjct: 340 PRILKKRSIASGAFFLFTIGSAFFIMVYYLPIWFQAIKGASATSSGIMNIPMVLSLVVLS 399

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           ++SG  V+    +A   L      L +IG+GL+T +   + +   I Y           +
Sbjct: 400 IASGITVTAIGYYA--PLYYVSTVLTSIGAGLLTTFTTETSKGKWIGYQIIFGAGVGTGL 457

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA--IPPE 414
           Q +++  Q ++  +DVA  T ++MF +++G    V++   +F+N+L   + N A  + P+
Sbjct: 458 QLSIIAAQAVLPLEDVAVGTVIMMFCQILGGALFVSVGQNVFTNLLVKGVVNAAPGLDPQ 517

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           +   V A+  + N +P +    V  AY  AL   +     +  L  + S+ M
Sbjct: 518 VVLRVGAT-QLKNMIPPQFLDGVQVAYNDALTKTWYVATALAALSVIGSVGM 568



>gi|496479797|ref|WP_009188367.1| DSBA oxidoreductase [Streptomyces sp. e14]
 gi|292832441|gb|EFF90790.1| conserved hypothetical protein [Streptomyces sp. e14]
          Length = 721

 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 181/475 (38%), Positives = 258/475 (54%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 81  QTIVSTALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKKLFQTAIVIFL 140

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+VS ++RG+YQ          
Sbjct: 141 IGSALCGMAQNMPQLIAFRALQGLGGGGLMVLSMAIVGDVVSPRERGRYQGLFGAVFGAT 200

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FY+NLP+G I + V    L IPR       +   IDY+GT
Sbjct: 201 SVLGPLLGGLFTEHLSWRWVFYVNLPVGVIALAVIAAALHIPRKA-----QHHVIDYLGT 255

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++      L+L  + GG  + W SP               F  VE + A EPV P  LF
Sbjct: 256 LLIASVATCLVLVASLGGTTWGWGSPQIIGLAVLGVVLAVAFVAVERR-AAEPVLPLKLF 314

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV G S T SG+ ++P+++G+++AS  SG
Sbjct: 315 RIRTFSLSAVISFIVGFAMFGAMTYLPTFLQVVHGISPTLSGVHMLPMVVGMLLASTGSG 374

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+  IG  L+   DE+S  A    Y           MQ  +
Sbjct: 375 QIVSRTGR--WKVFPVAGTAVTTIGLLLLHRLDEHSSTAEMSGYFFVFGLGLGLVMQVLV 432

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI----ENIAIPPEL- 415
           L  Q  V Y+D+   T+   FFR IGA FGVAI GT+F++ L + +    +  A+PP + 
Sbjct: 433 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAIFGTVFASRLADKLAAAFKGAALPPGVS 492

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           A A+K+    +  LP  +R   + AY  A+   F    P+ +L FL S F+   +
Sbjct: 493 ADALKSDPRGIGALPAALRPAALHAYASAITDVFLYAAPVALLAFLLSWFLKEDR 547



>gi|491130309|ref|WP_004988737.1| DSBA oxidoreductase [Streptomyces ghanaensis]
 gi|291342821|gb|EFE69777.1| integral membrane transport protein [Streptomyces ghanaensis ATCC
           14672]
          Length = 701

 Score =  271 bits (694), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 177/475 (37%), Positives = 253/475 (53%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 56  QTIVATALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKKLFQTAIVIFL 115

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS LCG A +M  +I FRA+ G+GGGG++ L M I+ D+V  ++RG+YQ          
Sbjct: 116 VGSALCGTAQDMFQLIAFRALQGLGGGGLIVLSMAIVGDLVPPRERGRYQGLFGAVFGTT 175

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT H++WRW FY+NLPLG + + V   +L IPR     +     IDY+GT
Sbjct: 176 SVLGPLLGGLFTQHLSWRWVFYVNLPLGIVALAVIATVLHIPRRPTKHV-----IDYLGT 230

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++      L+L  + GG  + W SP               F  VE + A EPV P  LF
Sbjct: 231 LLIASVATCLVLVASLGGTTWGWGSPRIVGLAVLGVVLAVAFVAVERR-AAEPVLPLKLF 289

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +           F  G A F  + Y+P Y QVV+G S T SG+ ++P++ G+++AS  SG
Sbjct: 290 RVRTFTLSAVIGFIVGFAMFGAMTYLPTYLQVVRGVSPTVSGVHMLPMVAGMLLASTGSG 349

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+  +G  L+   D +S  A    +           MQ  +
Sbjct: 350 QIVSRTGR--WKVFPVAGTAVTTLGLLLLHQLDAHSSTAVTSLFFFVFGSGLGLVMQVLV 407

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFS----NVLTNNIENIAIPPEL- 415
           L  Q  V Y+D+   T+   FFR IGA FGVAI GTIF+    + LT+     A+PP + 
Sbjct: 408 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAIFGTIFAGRLGDALTDAFRGTALPPGVS 467

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           A A++A    +  LP  +R   + AY  A+   F    P+ +L F+ + F+   +
Sbjct: 468 ADALEADPRGIGALPSALRASAVDAYASAITDVFLYAAPVALLGFVLAWFLKEDR 522



>gi|403416244|emb|CCM02944.1| predicted protein [Fibroporia radiculosa]
          Length = 626

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 176/489 (35%), Positives = 262/489 (53%), Gaps = 18/489 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            T+VATALP I++ F A   ++WV + YLLT TAFQP YG+FSDIFGRKA+   A+  F 
Sbjct: 75  STMVATALPTISNVFDAGTVVSWVPSGYLLTSTAFQPLYGRFSDIFGRKASLSLAMGIFM 134

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            G +L G + ++  +IIFRAIAG GGG I+S+  IIISDIV+L++RGKYQ          
Sbjct: 135 FGCILAGFSRSIIQLIIFRAIAGAGGGAIVSMGQIIISDIVTLRERGKYQGIIGVVVAFG 194

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GGA ++ V+WRW F++  P+  + +   + +L     +G+  +KL  +DY G 
Sbjct: 195 FAIGPLIGGALSEKVSWRWCFWVTPPISCVALCAVLLILPAKPVEGNFRRKLLAVDYFGA 254

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            + +     +LLPL WGG  +PWSS                F   E K A  P+ P ++F
Sbjct: 255 ALTLTGCTLVLLPLIWGGVTFPWSSAVVLAPLCSGFLVVSIFCFWEWKGARLPIVPMYIF 314

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K + V G + T F  GM F+  ++Y+P +FQV  G S   SG+ L P+++    AS  +G
Sbjct: 315 KHITVTGVYITMFVNGMIFYCALFYLPQFFQVALGYSPIRSGVFLFPVLVSQTTASFFAG 374

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  YRT+  TG ++ A+G GL++    ++ +   + YM          +QTT 
Sbjct: 375 QIVSRTGR--YRTIIHTGFSVWAVGCGLLSTVTSSTPKGLLVFYMLLSGLGAGQTLQTTT 432

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNN----------IENIA 410
           +  Q  V  KD++ VTA+  F RL+G    +A+  TI +N L ++          I  I 
Sbjct: 433 VAAQASVSRKDMSVVTAVRNFARLLGGTLSLALSATIINNSLRDSMTSAGLSASTITTII 492

Query: 411 IPPELAGAVKASATVVNQLPI-----EIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
             P L GA + S+   + L        +   ++  Y    RT F  +  +  +  LAS+F
Sbjct: 493 DDPTLLGA-RLSSDSSDPLAALGVTPALAAKILDGYTHGFRTVFILNACLAAVATLASIF 551

Query: 466 MGNHKPSLR 474
           M +HK   R
Sbjct: 552 MIHHKELTR 560



>gi|350633269|gb|EHA21634.1| hypothetical protein ASPNIDRAFT_183745 [Aspergillus niger ATCC
           1015]
          Length = 570

 Score =  271 bits (693), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 166/432 (38%), Positives = 252/432 (58%), Gaps = 2/432 (0%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + + F   D ++WV TAYLLT TA QP YG+ +DIFGRK   L ++  F 
Sbjct: 45  QTIVATALPTLGAVFNQADIVSWVGTAYLLTCTACQPLYGRLTDIFGRKLILLGSLFLFL 104

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS++ G++  MT +II RA+AG+GGGGI+++V I++SD+VSLQDRGKYQ          
Sbjct: 105 IGSVISGVSRGMTMLIIARAVAGIGGGGIVTVVSIVVSDVVSLQDRGKYQGIIGIVVAAG 164

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG FT+ V+WRW FYI++PL  + ++V  F L + + +G  L+K+K+ID  G 
Sbjct: 165 TALGPLIGGLFTEKVSWRWCFYISVPLSGVAMVVVAFALPLRKVEGHALEKIKQIDGWGC 224

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           ++   ++IA+LLP++W G +Y W+S                F  VE K+A  P+ P H+F
Sbjct: 225 LISFSASIAILLPISWAGTQYSWASAAVLAPLLLGVALIGVFLFVEFKVARLPLIPLHMF 284

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K  HV  C  T+F  G   F  +YY+P ++QV +GDSA  SG+ ++PLIL  ++ S +SG
Sbjct: 285 KSSHVSICILTSFLTGFMTFVNLYYLPQFYQVARGDSALRSGILILPLILSQIVTSFTSG 344

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+     YR   + G AL  I SGL T+   ++  A  + +           +QTTL
Sbjct: 345 FLVSKYS--CYRINLIVGYALWTIASGLFTMVTPSTSAAVLVVFQLLTGLGSGQTLQTTL 402

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V+ +++A +T    + R++G+   VA    I +N++   +E I  P  +   + 
Sbjct: 403 VAIQAAVKREEMAVITGARNYLRMMGSTLAVAASAAIVNNIVRTKLEAINFPRSIISEII 462

Query: 421 ASATVVNQLPIE 432
           A  T +  + + 
Sbjct: 463 ADPTKIASMSLS 474



>gi|302501568|ref|XP_003012776.1| hypothetical protein ARB_01027 [Arthroderma benhamiae CBS 112371]
 gi|291176336|gb|EFE32136.1| hypothetical protein ARB_01027 [Arthroderma benhamiae CBS 112371]
          Length = 583

 Score =  271 bits (692), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 163/472 (34%), Positives = 250/472 (52%), Gaps = 9/472 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   F AL+ I W  ++YLLT+ AFQ  +GK    F  K  FL A+  FE
Sbjct: 100 NTIIATAIPKITDQFHALEDIGWYGSSYLLTICAFQLIFGKIYTFFPVKWVFLIAITIFE 159

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS +CG APN T +II RA+AG+G  GI S  +III+  + L+ R  Y           
Sbjct: 160 IGSAICGAAPNSTALIIGRAVAGIGSAGIFSGALIIIAYSIPLEKRPAYTGAIGGMYGIA 219

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQ----KLKRID 176
               PL+GGAFTDH++WRW FYINLP+GA+T++  +  L+ P+ K    Q    +L ++D
Sbjct: 220 SVAGPLMGGAFTDHISWRWCFYINLPIGAVTILSILIFLKHPKQKLDNNQTWKARLLKLD 279

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IGT   + S I LLL L WGG +YPW++                F   + +       P
Sbjct: 280 PIGTAFFMPSIICLLLALQWGGTKYPWNNGRIIALFVVFAVLISGFIYFQIRGGDSATVP 339

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  +       F  G AFF +VYY+P++FQ +KG SAT+SG+  IP++L +V+ S
Sbjct: 340 PRILKKRSIASGAFFLFTIGSAFFIMVYYLPIWFQAIKGASATSSGIMNIPMVLSLVVLS 399

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           ++SG  V+    +A   L      L +IG+GL+T +   + +   I Y           +
Sbjct: 400 IASGITVTAIGYYA--PLYYVSTVLTSIGAGLLTTFTTETSKGKWIGYQIIFGAGVGTGL 457

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA--IPPE 414
           Q +++  Q ++  +DVA  T ++MF + +G    V++   +F+N+L   + N A  + P+
Sbjct: 458 QLSIIAAQAVLPLEDVAVGTVIMMFCQTLGGALFVSVGQNVFTNLLVKGVVNAAPGLDPQ 517

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           +   V A+  + N +P +    V  AY  AL   +     +  L  + S+ M
Sbjct: 518 VVLRVGAT-QLKNMIPPQFLDGVQVAYNDALTKTWYVATALAALSVIGSVGM 568



>gi|327304411|ref|XP_003236897.1| MFS transporter [Trichophyton rubrum CBS 118892]
 gi|326459895|gb|EGD85348.1| MFS transporter [Trichophyton rubrum CBS 118892]
          Length = 583

 Score =  271 bits (692), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 163/472 (34%), Positives = 250/472 (52%), Gaps = 9/472 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   F AL+ I W  ++YLLT+ AFQ  +GK    F  K  FL A+  FE
Sbjct: 100 NTIIATAIPKITDQFHALEDIGWYGSSYLLTICAFQLIFGKIYTFFPVKWVFLIAITIFE 159

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS +CG APN T +II RA+AG+G  GI S  +III+  + L+ R  Y           
Sbjct: 160 IGSAICGAAPNSTALIIGRAVAGIGSAGIFSGALIIIAYSIPLEKRPAYTGAIGGMYGIA 219

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQ----KLKRID 176
               PL+GGAFTDH++WRW FYINLP+GA+T++  +  L+ P+ K    Q    +L ++D
Sbjct: 220 SVAGPLMGGAFTDHISWRWCFYINLPIGAVTILSILIFLKHPKQKLDNNQTWKARLLKLD 279

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IGT   + S I LLL L WGG +YPW++                F   + +       P
Sbjct: 280 PIGTAFFMPSIICLLLALQWGGTKYPWNNGRIIALFVVFAVLISGFIYFQIRGGDSATVP 339

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  +       F  G AFF +VYY+P++FQ +KG SAT+SG+  IP++L +V+ S
Sbjct: 340 PRILKKRSIASGAFFLFTIGSAFFIMVYYLPIWFQAIKGASATSSGIMNIPMVLSLVVLS 399

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           ++SG  V+    +A   L      L +IG+GL+T +   + +   I Y           +
Sbjct: 400 IASGITVTAIGYYA--PLYYVSTVLTSIGAGLLTTFTTETSKGKWIGYQIIFGAGVGTGL 457

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA--IPPE 414
           Q +++  Q ++  +DVA  T ++MF + +G    V++   +F+N+L   + N A  + P+
Sbjct: 458 QLSIIAAQAVLPLEDVAVGTVIMMFCQTLGGALFVSVGQNVFTNLLVKGVVNAAPGLDPQ 517

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           +   V A+  + N +P +    V  AY  AL   +     +  L  + S+ M
Sbjct: 518 VVLRVGAT-QLKNMIPPQFLDGVQVAYNDALTKTWYVATALAALSVIGSVGM 568



>gi|409042671|gb|EKM52155.1| hypothetical protein PHACADRAFT_262666 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 591

 Score =  270 bits (691), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 158/453 (34%), Positives = 241/453 (53%), Gaps = 6/453 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           +T+VA ALP ++S F A  +I+WVA A+ +T T+FQ  YG+ SDI+ RK+  L  +  F 
Sbjct: 59  ETMVAVALPIMSSHFNAGSQISWVANAFFVTSTSFQLIYGRLSDIWARKSVLLVLMFIFF 118

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +G++   ++     +++FRAIAGVGGGG+ ++  +I+SD+VSL++RGKYQ          
Sbjct: 119 VGNVASSVSRTFIELLVFRAIAGVGGGGLPTIAQVIVSDVVSLRERGKYQGILGVSVALA 178

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P++GGAF  HVTWRW F++ LP+   +  +  F + +   +G    K+KR+D++G 
Sbjct: 179 NGIGPVIGGAFASHVTWRWIFWLTLPMTIFSAFMVCFFMPLKPVEGDWRMKVKRVDWLGV 238

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +++ S+  ++L L W G EY W S                F L E K    P+ P H+F
Sbjct: 239 GLILASSTLIVLSLTWAGAEYAWDSAHVLVTLILGIFIGIGFVLWEWKGPQFPLLPLHIF 298

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K   VVG   T F  G      V+Y+P ++Q+  G SAT SG  L+PL +     S  SG
Sbjct: 299 KSSIVVGAAITQFINGFLTMVQVFYLPTFYQMAYGYSATRSGAMLLPLTVVQTFTSTFSG 358

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             ++ T +  YR + + G A+ A+G GL+     +S  + QI Y            Q +L
Sbjct: 359 LIITWTGR--YREMILIGWAIWAVGLGLLATLKADSPVSRQIGYSILTGFGVGQTFQPSL 416

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIE----NIAIPPELA 416
           +  QG +E KD+A VTA+  F R +G   G+AI GT+ +NVL++ +     +I  P +L 
Sbjct: 417 IAVQGALERKDMAVVTAMRSFARNLGGTIGLAIAGTMINNVLSSRLHALPSSIISPEQLR 476

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAF 449
             V      V  L   +R  VI  Y    R  F
Sbjct: 477 AIVNNPVETVYSLSDPLRADVIDGYRQGFRDVF 509



>gi|496012801|ref|WP_008737380.1| transporter [Streptomyces sp. Mg1]
 gi|194340850|gb|EDX21816.1| transmembrane efflux protein [Streptomyces sp. Mg1]
          Length = 535

 Score =  270 bits (691), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 162/466 (34%), Positives = 248/466 (53%), Gaps = 12/466 (2%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           I+ TA+P I  +   L+ ++WV TAY L   A  P +GK  D++GRK  FL +++ F IG
Sbjct: 36  IIGTAMPTIVGELGGLEHLSWVVTAYTLATAASTPIWGKIGDMYGRKGAFLTSIVIFLIG 95

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 96  SALSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMMAGVMALAMI 155

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TDH+ WRWSFYINLPLGA+ + +   +L +P+ +        +IDY+G  +
Sbjct: 156 GGPLVGGTITDHMGWRWSFYINLPLGAVALAMVTAVLHLPKKRAQ-----GKIDYLGAAL 210

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +  +  + +L   WGG EY W S                F   ETK A EPV P H+F+ 
Sbjct: 211 LTLAITSTVLVTTWGGTEYAWGSAEILGLIAVGVLSTAAFLYAETK-AAEPVMPLHIFRS 269

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G A F  V Y+PL+ Q V+G SAT SGL L+P++L +++ S+ +G+ 
Sbjct: 270 RNFTLMSVIGFLVGFAMFGGVLYLPLFQQSVQGASATNSGLLLLPMLLSMMLVSLIAGRI 329

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + + K  Y+   + G AL+ +G  L+   D  + R     YM          MQ T+L 
Sbjct: 330 TTSSGK--YKMFPIMGGALMVVGMFLLAQMDTGTSRLMSGVYMGILGAGLGFLMQITMLV 387

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  V+ KD+   ++    FR +G  FGVA++G++F+  +TN + +  + PE AGA  ++
Sbjct: 388 AQNSVDMKDMGVASSSATLFRTLGGSFGVALMGSLFTTQVTNTMAD-RLGPEAAGAAGSA 446

Query: 423 ---ATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
              A  + +LP  IR     A      +AF     + +L F+A+ F
Sbjct: 447 QLDAASLAKLPEAIREAYQYAVAAGTHSAFLLGAGVAVLGFVAAWF 492



>gi|497743353|ref|WP_010057537.1| major facilitator superfamily permease [Streptomyces globisporus]
          Length = 709

 Score =  270 bits (690), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 178/475 (37%), Positives = 261/475 (54%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I S+   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 41  QTIVSTALPTIVSELGGLDHLSWVVTAYLLAATAATPLWGKLGDQYGRKKLFQTAIVIFL 100

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+V+ ++RGKYQ          
Sbjct: 101 IGSALCGVAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDLVTPRERGKYQGLFGAVFGVT 160

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FYINLP+G + + V   +L IP     + ++   IDY+GT
Sbjct: 161 SVLGPLLGGFFTEHLSWRWVFYINLPIGVVALGVIAAVLHIP-----VRREKHTIDYLGT 215

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++     +L+L  + GG  + W+SP               F   E + A+EPV P  LF
Sbjct: 216 FLIAAVATSLVLIASLGGTTWAWTSPQIIALAVLAVVLLVAFIAAERR-AVEPVLPLKLF 274

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV   + T SG+ ++P++ G++I S +SG
Sbjct: 275 RIRTFTLVAVISFVIGFAMFGAMTYLPTFLQVVHDITPTMSGVHMLPMVFGLLITSTASG 334

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G AL  +G  L+   DE+S       Y           MQ  +
Sbjct: 335 QIVSRTGR--WKVFPVLGTALTTVGLLLLHRLDESSSTWLMSFYFFVFGAGLGLVMQVLV 392

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL- 415
           L  Q  V Y+D+   T+   FFR IGA FGVA+ GTIF+N LT  + +      +PP + 
Sbjct: 393 LVAQNSVSYQDLGVATSGATFFRSIGAAFGVAVFGTIFTNRLTGQLTDALAGQPLPPGID 452

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AG++ A    + QLP ++R  V+SAY  ++   F    P+ +L F+ + F+   K
Sbjct: 453 AGSLAADPRALGQLPADLRPGVLSAYSTSITDVFLYAAPVVLLAFVLAWFLREDK 507



>gi|494299468|ref|WP_007170081.1| MFS transporter [Mycobacterium parascrofulaceum]
 gi|295899728|gb|EFG79178.1| drug resistance MFS transporter, drug:H+ antiporter-2 family
           [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 690

 Score =  270 bits (690), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 167/467 (35%), Positives = 248/467 (53%), Gaps = 10/467 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I ++       +WV T+YLL  T      GKF D+FGRK  F  AV+ F 
Sbjct: 47  QTIVATALPTIVANLGGAGHQSWVVTSYLLASTIITALVGKFGDLFGRKRVFQAAVVFFV 106

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCGL+ +M  ++  RA+ G+GGGG++   M +I +++ L+DRG+YQ          
Sbjct: 107 AGSVLCGLSGSMGMLVASRALQGIGGGGLMVTAMALIGEVIPLRDRGRYQGAMGAVFGVT 166

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FTDH TWRW+F+IN+P+  +   VA     IP    SL ++ K  IDY G
Sbjct: 167 TVIGPLLGGYFTDHFTWRWAFWINVPISVVVFFVAAAA--IP----SLSERTKPVIDYTG 220

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
            ++V      L L  +WGG  YPW SP               F  VE++ A  P+ P  L
Sbjct: 221 IMLVGLGAAGLTLATSWGGTTYPWGSPTIIGLFAGSVIALCLFAWVESR-AAAPILPTRL 279

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F       C   +F  G A    + ++P Y Q V G SATTSGL  +P+++G++  S+ S
Sbjct: 280 FGSPVFTVCCVLSFVVGFAMLGALTFLPTYMQFVDGVSATTSGLRTLPMVIGMLTTSMGS 339

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  V RT K  Y+   + G A++A+   L++  D ++    Q  ++          MQT 
Sbjct: 340 GVIVGRTGK--YKVFPVAGTAVMAVAFFLMSRMDPSTSVFVQSLFLVILGAGIGMCMQTL 397

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV 419
           +L  Q  V + D+   T+ + FFR IG+ FG AI G++F+N L + I    +      A 
Sbjct: 398 VLIVQNTVGFDDLGVATSGVTFFRTIGSSFGAAIFGSLFTNFLHSRIGPAMVASRAPAAA 457

Query: 420 KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            AS   +++LP E   P+++AY  +L   F   +P+ ++ F+ +LF+
Sbjct: 458 AASPEALHRLPREAAAPIVAAYSESLTQVFLWAVPVALVGFVLALFL 504



>gi|494763111|ref|WP_007498519.1| MFS transporter [Streptomyces zinciresistens]
 gi|345636081|gb|EGX57648.1| transmembrane efflux protein [Streptomyces zinciresistens K42]
          Length = 792

 Score =  270 bits (690), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 167/474 (35%), Positives = 245/474 (51%), Gaps = 14/474 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  + + LD+++W  TAYLLT T   P YGK  D+ GRK  F FA++ F 
Sbjct: 52  QMIVATALPRIVGELRGLDRMSWAITAYLLTSTIGLPVYGKLGDLLGRKRVFQFAIVVFV 111

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A  M  +I +RA+ G G GG++  V  II+DIV  ++RG++           
Sbjct: 112 VGSALAGRAGTMDQLIAYRAVQGAGAGGLMIGVQAIIADIVPPRERGRHMGLIGAAFGLA 171

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FYIN+P G +T+ V   +L++PRP         R+D +G+
Sbjct: 172 SVAGPLLGGYFTDHLSWRWCFYINVPFGLLTLAVVSVVLKLPRPAAR-----ARLDVLGS 226

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F LV  + A EP+ P  LF
Sbjct: 227 LLLAAASTCLVLLTSWGGTEYAWGSRVVLGLGAGALVAGLLF-LVAERFAAEPLIPLRLF 285

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P + Q+V G SAT SGL ++P++ GVV AS+  G
Sbjct: 286 RDSVFNVTALVGLVIGVALFGAASYLPTFLQMVDGASATESGLLMLPMMGGVVGASILCG 345

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +SRT +  YR   + G+AL  +G GL++  + ++ R     +M          M   +
Sbjct: 346 QLISRTGR--YRIYPVLGSALAVLGMGLLSRLETDTPRLQYSLWMAVLGAGIGMVMPVLV 403

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           L  Q  V   D+ + T+   +FR IG   G A+ GT+ +  LT+ +   A  P  AG   
Sbjct: 404 LAVQNSVRPADLGTATSANTYFRQIGGSVGAAVFGTLLAGRLTDALA--ARLPAGAGLPD 461

Query: 421 ASA---TVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKP 471
             A    +V  LP  +R   + AY  A+   F   +P+  L  L + F+   KP
Sbjct: 462 PQAVTPQLVRSLPPAVRDAYVLAYADAMPRIFLYLVPVLALGLLIACFL-KEKP 514



>gi|508093090|gb|EOT03404.1| EmrB/QacA subfamily drug resistance transporter, partial
           [Streptomyces albulus CCRC 11814]
          Length = 681

 Score =  270 bits (689), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 178/474 (37%), Positives = 253/474 (53%), Gaps = 13/474 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I SD   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 38  QTIVATALPTIVSDLGGLDHLSWVVTAYLLASTAATPLWGKLGDQYGRKKLFQAAIVIFL 97

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS+LCGLA NM  +I FRA+ G+GGGG++ L M I+ DIV  ++RGKYQ          
Sbjct: 98  IGSVLCGLARNMGELIGFRALQGLGGGGLIVLSMAIVGDIVPPRERGKYQGLFGAVFGGT 157

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F DH++WRW FY+N+P+G + + V   +L IP  +        RIDY+GT
Sbjct: 158 SVLGPLLGGLFVDHLSWRWVFYVNVPIGIVALAVIAAVLHIPARRTP-----HRIDYLGT 212

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  YPW S                F +VE + A EPV P  LF
Sbjct: 213 ALIAAVAACLVLMTSLGGVSYPWGSWQTALLAGLGVVLLAAFVVVERR-AAEPVIPLRLF 271

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C    F  G A F  + Y+P + QVV+  S T SG+ ++P++ G++++S +SG
Sbjct: 272 TSRTFTLCAVIGFVIGFAMFGSMTYLPTFLQVVQRVSPTMSGVHMLPMVFGMLLSSTASG 331

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT    Y+   + G A++A+G  L+   D  SG A    Y           MQ  +
Sbjct: 332 QIVSRTGH--YKVFPIAGTAVVALGLLLLHQLDPTSGVALMSTYFFVFGFGLGLVMQVLV 389

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPELA 416
           L  Q  V Y+D+   T+   FFR IGA FGV+I GT+F+N L   I ++     +PP ++
Sbjct: 390 LIVQNAVPYEDLGVATSGATFFRSIGASFGVSIFGTLFANRLGPRIADVLAGQPLPPGVS 449

Query: 417 -GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNH 469
             A+      + +LP      V+ AY  ++   F   +P+ ++ F  + F+   
Sbjct: 450 PTAIAQDPRAITKLPPAQAAGVLGAYSSSITDVFLYAVPVVLVAFALAWFLKEE 503



>gi|496014507|ref|WP_008739086.1| DSBA oxidoreductase [Streptomyces sp. Mg1]
 gi|194341720|gb|EDX22686.1| multidrug-efflux transporter [Streptomyces sp. Mg1]
          Length = 689

 Score =  270 bits (689), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 169/454 (37%), Positives = 246/454 (54%), Gaps = 14/454 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   +D ++WV TAY+L  TA  P +GK  D +GRK  F +A++ F 
Sbjct: 48  QTIVSTALPTIVSDLGGMDHLSWVVTAYILASTAATPLWGKLGDQYGRKKLFQYAIVIFL 107

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS+LCG+A +M  +I FRA+ G+GGGG++ L M I+ DIV  ++RG+YQ          
Sbjct: 108 IGSVLCGIAQDMPQLIGFRALQGLGGGGLIVLSMAIVGDIVPPRERGRYQGLFGAVFGAA 167

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F D ++WRW FYINLP+G + ++V   +LRIP        +   IDY+GT
Sbjct: 168 SVLGPLLGGLFVDQLSWRWVFYINLPIGLVALVVIAAVLRIPARS-----EKHTIDYLGT 222

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++ G    L+L  + GG  + W S                F  VE + A+EPV P  LF
Sbjct: 223 FLIAGVATCLVLVASLGGT-WGWGSTRIIGLAVLGVLFLGAFLFVERR-AVEPVLPLSLF 280

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
            R     C   +F  G A F  + Y+P + Q+V+G S T SG+ ++P++ G++IAS  SG
Sbjct: 281 GRRTFTLCSVISFIVGFAMFGAMVYLPTFLQIVRGVSPTMSGVHMLPMVFGMLIASTGSG 340

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT    ++   + G  + AIG  L+      S       Y           MQ  +
Sbjct: 341 QIVSRTGH--WKVFPIAGTGVTAIGLLLLHQLQRTSSDWEVGAYFFVFGFGLGLVMQVLV 398

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFS----NVLTNNIENIAIPPELA 416
           L  Q  V Y D+   T+   FFR IGA FGVAI GT+F+    ++L+ ++  + +PP ++
Sbjct: 399 LAVQNAVSYADLGVATSGATFFRSIGASFGVAIFGTVFNHRLGDMLSTSLAGVTLPPGMS 458

Query: 417 -GAVKASATVVNQLPIEIRGPVISAYVGALRTAF 449
              ++A    + QLP  ++  V+ AY  A+   F
Sbjct: 459 IDQLEADPRSIAQLPANLQPQVLDAYSSAITGVF 492



>gi|324029091|gb|ADY16699.1| TqaJ [Penicillium aethiopicum]
          Length = 552

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 174/467 (37%), Positives = 246/467 (52%), Gaps = 6/467 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TIVATA+P I S+F +L  + W  +AY+LT  A    +GK   ++  K TF+ A+  FE
Sbjct: 73  NTIVATAIPKITSEFDSLADMGWYGSAYMLTTCAVTLIFGKLYTLYSIKWTFMTALALFE 132

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GSL+CG+ P  T +II RA+AGVG GG+ S  M++I+++V L+ R  Y           
Sbjct: 133 FGSLICGVTPTSTGLIIGRALAGVGAGGLFSGAMLVIANLVPLRKRPIYTGILGAIFGVS 192

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLL--RIPRPKGSLLQKLKRIDYI 178
               PLLGGA TDH TWRW FYINLP GA+T I   F    + P  + +  +KL+ +D I
Sbjct: 193 SVAGPLLGGALTDHATWRWCFYINLPFGAVTAIAIAFFFQDKPPLKETTTREKLQSLDLI 252

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           GT + + + I LLL L WGG +YPWS+                +  V+         PP 
Sbjct: 253 GTAIFLPAIICLLLALQWGGQKYPWSNVRIIVLFVLFGVGLCVWLYVQHVKQDLATVPPR 312

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           + K  +V G    N   G AFF  VYY+PL+FQ +KG SATTSG+  +PLILGV I ++ 
Sbjct: 313 IIKNRNVWGALAYNTCLGGAFFVSVYYLPLWFQGIKGASATTSGIMNLPLILGVTIFAMV 372

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           S  AV  T    Y    +T   L +IG+GL+T  + +SG A  I Y           MQ 
Sbjct: 373 S--AVLVTVSGYYNPFMLTATVLFSIGNGLLTTLEPDSGPAKWIGYQAMTGIGAGMGMQL 430

Query: 359 TLLCGQGIVEYKDVASVTALLMFFR-LIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
             +  Q  V+  D+   T L++F + L GA+F ++I   +F N L  NI  +A   + A 
Sbjct: 431 PAIVVQAAVQEADIPVATTLVVFSQSLSGAIF-ISIAQNVFQNRLLANIRKLAPMIDPAE 489

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASL 464
            V+A AT + +   E    V+ AY  A+  +F   + +  L    +L
Sbjct: 490 VVQAGATKLREAFPENIKLVLQAYNNAVTQSFYIAVAMSALSIFGAL 536



>gi|242212674|ref|XP_002472169.1| predicted protein [Postia placenta Mad-698-R]
 gi|220728727|gb|EED82615.1| predicted protein [Postia placenta Mad-698-R]
          Length = 533

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 171/488 (35%), Positives = 260/488 (53%), Gaps = 16/488 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            T+VATALP I++ F A   ++WV + YLLT TAFQP YG+FSDIFGRKA+   ++  F 
Sbjct: 29  STMVATALPTISNAFNAGSIVSWVPSGYLLTSTAFQPLYGRFSDIFGRKASLCLSMSIFM 88

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS+L G + ++  +I+FR IAG GGG I+S+  IIISDIVSL+DRGKYQ          
Sbjct: 89  IGSILAGFSRSIIQLIVFRGIAGAGGGAIVSIGQIIISDIVSLRDRGKYQGIIGVVVAFG 148

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GG  ++  +WRW F++  P+    +   + +L +   +G+   KL  +DY G 
Sbjct: 149 FAIGPLIGGVLSEKASWRWCFWVTPPISFTALCAVLVVLPVKPVEGNFRTKLLAVDYFGA 208

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           ++ +     +LLPL WGG  +PW+S                F   E K A  P+ P ++F
Sbjct: 209 VLTLAGCTLVLLPLIWGGVTFPWTSAVVLAPLFSGFLVVSLFCFWEWKGARLPIVPMYIF 268

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K + V G + T F  GM F+S ++Y+P +FQV    S   SG+ L P+++    AS  +G
Sbjct: 269 KHVTVTGVYVTMFINGMIFYSALFYLPQFFQVALAYSPIRSGVFLFPVLVSQTTASFVAG 328

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT K  YRT+  TG ++ AIG G ++    N+ +   + +M          +QTT 
Sbjct: 329 QLVSRTGK--YRTIIHTGFSVWAIGCGCLSTVTSNTPKGLLVFFMLLSGLGAGQTLQTTT 386

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIP-------- 412
           +  Q  V  +D++ VTA+  F RL+G    +A+  TI +N L +++ ++ +P        
Sbjct: 387 VAAQASVSRRDMSVVTAVRNFVRLLGGTLSLALGATIINNSLRSSMSSLGLPSATIKKIV 446

Query: 413 --PELAGAVKASATVVNQLPIEIR----GPVISAYVGALRTAFTADIPIGILCFLASLFM 466
             P L G   +S +  +   + I       ++  Y    RT F  +  +  +  LAS+ M
Sbjct: 447 DDPTLLGVRFSSPSDSSLAALGITPAMAADILDGYTRGFRTVFILNACLAAVATLASILM 506

Query: 467 GNHKPSLR 474
             HK   R
Sbjct: 507 IRHKELSR 514



>gi|353234598|emb|CCA66622.1| probable DHA14-like major facilitator; ABC transporter
           [Piriformospora indica DSM 11827]
          Length = 622

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 168/486 (34%), Positives = 253/486 (52%), Gaps = 19/486 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+ATALP IAS F AL+ + WV +AY  T       +G+   I   K +    V    
Sbjct: 135 QTIIATALPVIASKFNALNDLTWVVSAYFFTQCGLVLFFGQVLTIMDTKESPTSHVSR-- 192

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
             SL CG+A NM  +I  RAIAGVG  GI   ++ IIS +  L+DR              
Sbjct: 193 --SLFCGVAWNMPFLIFGRAIAGVGAAGIFISILTIISRVTRLEDRPILFGAFGAVFAVS 250

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLR------IPRPKG-SLLQKLK 173
               PL+GGAFTDH++WRW FYINLP GA++++  IF L+      +P   G + LQK  
Sbjct: 251 SVAGPLMGGAFTDHLSWRWCFYINLPFGAVSILAVIFFLKAQPTRELPGNAGKTKLQKWI 310

Query: 174 RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP 233
            ID+IGT + +G  + LLL L WGGN  PW+                 F   + KL    
Sbjct: 311 GIDWIGTTLCLGMIMPLLLALQWGGNTRPWNDKVVIALFCVFAVMLPSFVAWQWKLGPRA 370

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
           + P  L+KR   +G    +FF  M      YY+P Y+Q  +G + T SG++++P +L ++
Sbjct: 371 IMPLSLYKRRTQIGTSACSFFVMMNLILGTYYLPFYYQASRGRTPTQSGIDILPFMLTII 430

Query: 294 IASVSSGQAVSRTDKFAYRTLSMTGAALI-AIGSGLITLWDENSGRAPQICYMXXXXXXX 352
           +A+  SG  ++ T ++ Y    +  A L+ AIG+GL+   D ++  A  I Y        
Sbjct: 431 LAAAISGAIINFTGRYIY---FLRYATLVSAIGAGLLYTLDLHTSNAKLIGYQIIFGLGI 487

Query: 353 XXXMQTTLLCGQGIVEYKD--VASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA 410
              +Q  ++  Q     KD  +   T+++ FF+L+G + G+AI G++F+N L  NI   A
Sbjct: 488 GCALQNAIIAVQAEWADKDELIPQATSIVTFFQLMGGILGIAIAGSVFANQLRKNIAIFA 547

Query: 411 --IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGN 468
             + P +A AV+ + +V+  LP E++G VI AY+ AL   F   IP  +L  +++  + +
Sbjct: 548 PGLDPRIAEAVRQTLSVLEMLPQEVQGQVIQAYLRALNYVFIVAIPTSVLASISAFLIKD 607

Query: 469 HKPSLR 474
           H    R
Sbjct: 608 HNVKER 613



>gi|315045508|ref|XP_003172129.1| hypothetical protein MGYG_04720 [Arthroderma gypseum CBS 118893]
 gi|311342515|gb|EFR01718.1| hypothetical protein MGYG_04720 [Arthroderma gypseum CBS 118893]
          Length = 583

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 161/472 (34%), Positives = 251/472 (53%), Gaps = 9/472 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   F AL+ I W  ++YLLT+ AFQ  +GK    F  K  FL A+  FE
Sbjct: 100 NTIIATAIPKITDQFHALEDIGWYGSSYLLTICAFQLIFGKIYTFFPVKWVFLIAITIFE 159

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS +CG APN T +II RA+AG+G  GI S  +III+  + L+ R  Y           
Sbjct: 160 IGSAVCGAAPNSTALIIGRAVAGIGSAGIFSGALIIIAYSIPLEKRPAYTGAIGGMYGIA 219

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK----GSLLQKLKRID 176
               PL+GGAFTDH++WRW FYINLP+GA+T++  +  L+ P+ K     +  ++L ++D
Sbjct: 220 SVAGPLMGGAFTDHISWRWCFYINLPIGAVTILSILIFLKHPKQKLDNNHTWKERLMKLD 279

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IGT   + S I LLL L WGG +YPW +                F  ++ +       P
Sbjct: 280 PIGTAFFMPSIICLLLALQWGGTKYPWGNGRIIALFVVFAILISGFIYIQIRGGDSATVP 339

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  +       F  G AFF +VYY+P++FQ +KG SAT+SG+  IP++L +V+ S
Sbjct: 340 PRILKKRSIASGAFFLFTIGSAFFIMVYYLPIWFQAIKGASATSSGIMNIPMVLSLVVLS 399

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + SG  V+    +A   L    + L AIG+GL+T +   + +   I Y           +
Sbjct: 400 ILSGITVTVIGYYA--PLYYISSILTAIGAGLLTTFTTETSKGKWIGYQILFGAGVGTGL 457

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA--IPPE 414
           Q +++  Q ++  +DVA  T ++MF + +G    V++   +F+N+L   + N A  + P+
Sbjct: 458 QLSIIAAQAVLPLEDVAVGTVIMMFCQTLGGALFVSVGQNVFTNLLVKGVVNAAPGLDPQ 517

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           +   V A+  + + +P +    V  AY  AL   +     +  L  + ++ M
Sbjct: 518 IVLRVGAT-QLKSMIPPQFLDGVQVAYNDALTKTWYVATALAALSIIGAIGM 568



>gi|379707444|ref|YP_005262649.1| putative drug-resistance transporter [Nocardia cyriacigeorgica
           GUH-2]
 gi|504115488|ref|WP_014349474.1| MFS transporter [Nocardia cyriacigeorgica]
 gi|374844943|emb|CCF62007.1| putative drug-resistance transporter [Nocardia cyriacigeorgica
           GUH-2]
          Length = 684

 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 167/471 (35%), Positives = 243/471 (51%), Gaps = 17/471 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I +D      +AWV T+YLL         GK  D+FGRK  F  + + F 
Sbjct: 24  QTIVSTALPTIVADLGGAGHMAWVVTSYLLAEAVATALAGKLGDLFGRKLIFQLSALIFI 83

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS++ GLA  M  +II RAI GVG GG++   M +I+DI+ L++RGKYQ          
Sbjct: 84  VGSMVAGLANGMLLLIIARAIQGVGAGGLMVTSMALIADIIPLRERGKYQGALGAVFGVT 143

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P LGG FTDH +WRW FY+N+PL    +++A+    IP  K ++ + +  IDY G 
Sbjct: 144 TVIGPTLGGLFTDHASWRWCFYVNVPLA--ILMIALAARTIPHVK-AMAKPI--IDYAGI 198

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V     +L+L L WGG EYPW S                F  VE + A EP+ P  LF
Sbjct: 199 GLVALGVSSLILGLEWGGTEYPWGSAQIIGLFVAAAVLLTAFVWVELR-AQEPMLPMGLF 257

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + Y+P Y Q V G SAT SG+  +PL+ G+   S+ SG
Sbjct: 258 RSQVYTVCSILSFIVGFAMLGSMTYLPAYLQYVDGVSATASGVRTLPLVFGLFATSILSG 317

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q V +T +  YR   + G A++AIG  L++    N+    +  YM          MQ   
Sbjct: 318 QVVGKTGR--YRWFPIAGTAVMAIGLFLMSTMGRNTSIWLESLYMLILGLGIGLAMQVLT 375

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-----ENIAIPPEL 415
           +  Q  V Y  + + T+ + FFR +G+ FG A+ GT+++N L   +     E   +PPE+
Sbjct: 376 IVVQNTVPYAQLGTATSGVTFFRTLGSAFGTAVFGTLYTNKLDPELAGALTEVRVVPPEV 435

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           A    A+   +  LP E   P+I AY  A+   F   +P+ +  F+ + F+
Sbjct: 436 A----ANPEALRALPPEQADPIIDAYAAAIDHVFLWVVPVALAGFVVAWFL 482



>gi|490080897|ref|WP_003982983.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           rimosus]
 gi|440618128|gb|ELQ81208.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           rimosus subsp. rimosus ATCC 10970]
          Length = 537

 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 168/467 (35%), Positives = 242/467 (51%), Gaps = 11/467 (2%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV TA+P I  +   L  ++WV TAY L   A  P +GK  D++GRK  FL +++ F IG
Sbjct: 48  IVGTAMPTIVGELGGLSHLSWVVTAYTLATAASTPIWGKLGDLYGRKGVFLTSIVIFLIG 107

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 108 SALSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMMAGVMAVAMI 167

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TDH+ WRWSFYINLPLGAI +++   +L +P+ +        RIDY+G  +
Sbjct: 168 GGPLVGGTITDHLGWRWSFYINLPLGAIALVMVTAVLHLPKKRSQ-----ARIDYVGAAL 222

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     +L+L   WGG EY W S                F  VETK+  EPV P H+F+ 
Sbjct: 223 LTAGITSLVLITTWGGTEYDWLSGQIIGLGAVGVVALLAFVFVETKVR-EPVLPLHIFRN 281

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F  + ++PL+ Q V+G SAT SGL L+P++L ++  S+ +G+ 
Sbjct: 282 RNFSLVTVIGFLVGFVMFGSMTFLPLFQQTVQGASATNSGLLLLPMLLAMMAVSLVAGRV 341

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T K  Y+   + G ALI  G  L++L D  + R     YM          MQTT+L 
Sbjct: 342 TTNTGK--YKIFVVGGGALITAGLALLSLMDTGTTRFTSGLYMAVLGAGMGFLMQTTMLI 399

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN---IAIPPELAGAV 419
            Q  VE KD+   ++    FR IG  FGVAI G IF+N + + ++     A     AG  
Sbjct: 400 AQNSVEMKDMGVGSSSATLFRTIGGSFGVAIFGAIFNNQVQDVMKERLGAAGAKATAGGG 459

Query: 420 KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           +     + QLP  I+   + A  G     F     I I+ F A+ F+
Sbjct: 460 QMDPKKLEQLPAAIKDAYMHAVSGGTHQVFIWGALISIIGFAAAWFL 506



>gi|512500114|ref|WP_016435524.1| drug:H+ antiporter-2 (14 Spanner) (DHA2) family drug resistance MFS
           transporter [Streptomyces sp. HGB0020]
 gi|512059207|gb|EPD58683.1| drug:H+ antiporter-2 (14 Spanner) (DHA2) family drug resistance MFS
           transporter [Streptomyces sp. HGB0020]
          Length = 693

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 173/475 (36%), Positives = 256/475 (53%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  +  A++ F 
Sbjct: 54  QTIVATALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKKLYQTAIVLFL 113

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+V+ ++RG+YQ          
Sbjct: 114 IGSALCGMAQNMPQLIAFRAVQGLGGGGLIVLSMAIVGDVVAPRERGRYQGLFGAVFGAT 173

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FY+NLP+G I + V    L IPR     +     IDY+GT
Sbjct: 174 SVLGPLLGGLFTEHLSWRWVFYVNLPVGVIALAVIATALHIPRKSTRHV-----IDYLGT 228

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  + W S                F  VE + A EPV P  LF
Sbjct: 229 FLIASVATCLILVASLGGTTWGWGSAQIIGLIVLGVVLAVAFVAVERR-AAEPVLPLKLF 287

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV+G + T SG+ ++P++ G++++S  SG
Sbjct: 288 RIRTFTLSAVISFIIGFAMFGAMTYLPTFLQVVQGVTPTMSGVHMLPMVFGMLLSSTGSG 347

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+ A+G  L+   DENS  A                MQ  +
Sbjct: 348 QIVSRTGR--WKVFPVAGTAITALGLLLLHQLDENSSTAVMSVDFFVFGLGLGLVMQVLV 405

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL- 415
           L  Q  V Y+D+   T+   FFR IGA FGVA+ GT+F++ LT+ + +      +PP + 
Sbjct: 406 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAVFGTVFASRLTDRLADAFSGRRLPPGVT 465

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           A ++K+    +  LP  +R   + AY  ++   F    P+ +L F+ + F+   K
Sbjct: 466 ADSLKSDPRGIGSLPPALRPDALHAYASSITDVFLYAAPVALLGFVLAWFLKEDK 520



>gi|491460468|ref|WP_005318244.1| DSBA oxidoreductase [Streptomyces pristinaespiralis]
 gi|297152366|gb|EFH31701.1| major facilitator superfamily transporter permease [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 699

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 178/476 (37%), Positives = 259/476 (54%), Gaps = 15/476 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I S+   +D ++WV TAY+L  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 52  QTIVATALPTIVSELGGMDHLSWVVTAYMLAATAATPLWGKLGDQYGRKKLFQTAIVIFL 111

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS LCG++ NM  +I FRA+ G+GGGG++ L M I+ D+VS ++RGKYQ          
Sbjct: 112 VGSALCGISQNMPQLIAFRAVQGLGGGGLMVLSMAIVGDLVSPRERGKYQGLFGAVFGAT 171

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FYINLP+G + ++V   +L IP     + +    IDY+GT
Sbjct: 172 SVLGPLLGGFFTEHLSWRWVFYINLPIGVVALLVIAAVLHIP-----VRRTRHTIDYLGT 226

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  + W S                F  VE K A EPV P  LF
Sbjct: 227 FLIASVATCLVLVASLGGTTWAWGSARIIGLAVLGAVLLVAFVAVERK-AAEPVLPLKLF 285

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV+G S T SG+ ++P++ G+++ S +SG
Sbjct: 286 RIRTFTLVAVISFIIGFAMFGAMTYLPTFLQVVQGISPTMSGVHMLPMVFGLLLTSTASG 345

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+ A+G  L+   + NS       Y           MQ  +
Sbjct: 346 QIVSRTGR--WKVFPIAGTAVTALGLLLLHQLEANSSTWQMSLYFFVFGAGLGLVMQVLV 403

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPELA 416
           L  Q  V Y+D+   T+   FFR IGA FGVAI GTIF+N L + + +      +PP  A
Sbjct: 404 LVVQNAVGYEDLGVATSGATFFRSIGASFGVAIFGTIFTNRLEHKLTDALAGQRVPPG-A 462

Query: 417 GAVK--ASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           GA +  A    + +LP ++R  V++AY  A+   F   +P+  L FL + F+   K
Sbjct: 463 GAAELAADPRAIAELPADLRPSVLNAYSTAITDVFLYALPVVALAFLIAWFLKEDK 518



>gi|494623743|ref|WP_007381687.1| multidrug-efflux transporter, partial [Streptomyces sviceus]
 gi|297147374|gb|EFH28608.1| multidrug-efflux transporter [Streptomyces sviceus ATCC 29083]
          Length = 650

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 172/475 (36%), Positives = 255/475 (53%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   ++ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 42  QTIVSTALPTIVSDLGGMEHLSWVVTAYLLASTAATPLWGKLGDQYGRKRLFQTAIVIFL 101

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG++ +MT +I FRA+ G+GGGG++ L M I+ D+V  ++RG+YQ          
Sbjct: 102 IGSALCGMSQDMTQLIAFRALQGLGGGGLMVLSMAIVGDLVPPRERGRYQGLFGAVFGAT 161

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FY+NLP+G + + V   +LRIPR     +     IDY+GT
Sbjct: 162 SVLGPLLGGLFTEHLSWRWVFYVNLPVGVVALAVIAVVLRIPRKSTKHV-----IDYLGT 216

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GGN + W SP               F  VE + A EPV P  LF
Sbjct: 217 FLIAAVATCLVLVASLGGNTWGWGSPQIVGLAVLGVLLAVAFVAVERR-AAEPVLPLKLF 275

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV G S T SG+ ++P++ G++ +S  SG
Sbjct: 276 RVRTFTLSAVISFIVGFAMFGAMTYLPTFLQVVHGVSPTMSGVHMLPMVFGLLFSSTLSG 335

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+  +G  L+   DE+S       Y           MQ  +
Sbjct: 336 QIVSRTGR--WKVFPVAGTAVTTLGLLLLHRLDESSSTWVMSLYFCVFGLGLGLVMQVLV 393

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNN----IENIAIPPELA 416
           L  Q  V Y+D+   T+   FFR IGA FGVAI GT+F+N L +     +    +PP ++
Sbjct: 394 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAIFGTVFANRLGDKLAEALHGAQLPPGVS 453

Query: 417 -GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
              ++A +  + QLP  +R   + AY  ++   F    P+  L F+ + F+   +
Sbjct: 454 VSGIEADSRGLAQLPGSLRPEALHAYASSITDVFLYAAPVAFLGFVLAWFLKEDR 508



>gi|345000379|ref|YP_004803233.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces sp.
           SirexAA-E]
 gi|503812682|ref|WP_014046676.1| transporter [Streptomyces sp. SirexAA-E]
 gi|344316005|gb|AEN10693.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces sp.
           SirexAA-E]
          Length = 526

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 165/476 (34%), Positives = 245/476 (51%), Gaps = 13/476 (2%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV TA+P I  D   L+ ++WV TAY L   A  P +GK  D++GRK  FL +++ F IG
Sbjct: 40  IVGTAMPTIVGDLGGLEHLSWVVTAYTLATAASTPIWGKLGDMYGRKGIFLTSIVIFLIG 99

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S+L G+A +M  +I FRA+ G+G GG++  VM II D+V  ++RG+YQ            
Sbjct: 100 SVLSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAIIGDLVPPRERGRYQGMMAGVMAIAMI 159

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TDH+ WRWSFYINLPLGA+ + +   +L +PR      +   R+DY+G  +
Sbjct: 160 GGPLVGGTITDHLGWRWSFYINLPLGAVALAMVGAVLHLPRKA----RTEHRVDYLGAAL 215

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     A++L   WGG EY W S                F  VETK A EP+ P H+F+ 
Sbjct: 216 LTVGITAIVLVTTWGGTEYAWGSAVIMELVALGVASLVGFLFVETK-AAEPIMPLHIFRS 274

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F  V ++PLY Q V+G SAT SGL L+P++L ++I S+ +G+ 
Sbjct: 275 RNFTLMSLVGFMAGFVMFGAVLFLPLYQQSVQGASATNSGLLLLPMLLAMMIVSLIAGRV 334

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T K  Y+   + G+AL+  G  L+   D  + R     YM          MQ T+L 
Sbjct: 335 TTSTGK--YKVFPIAGSALMVAGLFLLASMDTETTRLTSGVYMAVLGAGMGFLMQITMLV 392

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR +G+ FGVAI+G +F+  + + +           + +  
Sbjct: 393 AQNSVELKDMGVASSSTTLFRTLGSSFGVAIMGALFTGRVQDEMAARGGGGVTERSAQLD 452

Query: 423 ATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM------GNHKPS 472
           A  + +LP   R     A       AF     + I+ F+A+LF+      G  KP+
Sbjct: 453 AASLAKLPDAAREAYEYAVSSGTHLAFLVGGSVAIVAFVAALFVKEVPLRGAGKPT 508



>gi|212541614|ref|XP_002150962.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
 gi|210068261|gb|EEA22353.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
          Length = 607

 Score =  268 bits (685), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 159/471 (33%), Positives = 244/471 (51%), Gaps = 9/471 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   F A++ + W   AYLLT    Q  +GK    +  K  +L A+  FE
Sbjct: 122 NTIIATAIPRITDQFNAVNDVGWYGAAYLLTTCCLQLIFGKLYTFYSVKWVYLTALFIFE 181

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS +CG+ PN   +I+ RA+AG+G  GI S  ++I+S  V L  R  Y           
Sbjct: 182 LGSFVCGITPNSVGLIMGRAVAGIGAAGIFSGALLIVSRTVPLAQRPMYMGLIGGMWGIA 241

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK-----GSLLQKLKRI 175
               PL+GGAFTD VTWRW FYINLP GAIT +  IF  + P  K      +  +++K +
Sbjct: 242 SVAGPLMGGAFTDKVTWRWCFYINLPFGAITGLFIIFFFQPPGGKTKAVASTWQEQIKLL 301

Query: 176 DYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVA 235
           D  GT   +   I LLL L WGG +YPWS                 F  ++         
Sbjct: 302 DLEGTFFFIPGVICLLLALQWGGTKYPWSDGRIIALFVLFGVLIIAFVAIQIWKGELATV 361

Query: 236 PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIA 295
           PP +FK  ++ GC     FQG AFF  +YY+P++FQ +KG SA  SG+  +PLIL +V  
Sbjct: 362 PPRIFKNRNIWGCALYAAFQGAAFFIFIYYIPIWFQAIKGASAVRSGIMNLPLILSLVAI 421

Query: 296 SVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           S+ SG  VS      Y    +  + L ++G+GL+T ++ ++ ++  I Y           
Sbjct: 422 SMLSGGLVSYLGY--YTPFMIISSILTSVGAGLMTTFNVDTPQSQWIGYQFIFGAGVGFG 479

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPP-E 414
           MQ T++  Q  ++ KD+A  TA++MF + +G    +A+   +F+N L +N+    +P  +
Sbjct: 480 MQQTMVAVQACLKGKDIAVGTAIVMFSQTLGGALFIAVAENVFANKLVSNVIAANLPGLD 539

Query: 415 LAGAVKASATVVNQ-LPIEIRGPVISAYVGALRTAFTADIPIGILCFLASL 464
            A  + A AT + + +P +    +++AY  AL  A+   + +  L  + +L
Sbjct: 540 AATVLNAGATQIQKVIPAQFLPAILAAYNDALTNAYYVSVAMSCLTLIGAL 590



>gi|315444237|ref|YP_004077116.1| EmrB/QacA subfamily drug resistance transporter [Mycobacterium
           gilvum Spyr1]
 gi|503236965|ref|WP_013471626.1| MFS transporter [Mycobacterium gilvum]
 gi|315262540|gb|ADT99281.1| drug resistance transporter, EmrB/QacA subfamily [Mycobacterium
           gilvum Spyr1]
          Length = 700

 Score =  268 bits (685), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 168/488 (34%), Positives = 253/488 (51%), Gaps = 20/488 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRK  F  A++ F 
Sbjct: 58  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIATAIVGKLGDLFGRKMIFGVAILFFL 117

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCG+A  M  ++  RA+ G+GGG ++     +I +++ L+DRG+YQ          
Sbjct: 118 AGSVLCGIASTMEMLVASRALQGIGGGALMVTATALIGEVIPLRDRGRYQGALGAVFGVT 177

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FTDH+TWRW+F+IN+P+G + +IVA  L  IP    +L ++ K  IDY G
Sbjct: 178 TVIGPLLGGYFTDHLTWRWAFWINVPIGIVVLIVA--LATIP----ALSRRGKPVIDYAG 231

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
            +++     AL L  +WGG+ Y WSSP               F  VE + A EPV P  L
Sbjct: 232 IVLIGLGASALTLATSWGGSTYAWSSPMIIGLFVGSAVALAVFVRVELR-ATEPVLPIRL 290

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F       C   +F  G A    + ++P + Q V G SAT SGL  +P++ G+++ S+ S
Sbjct: 291 FASPVFTVCCVLSFIVGFAMLGALTFLPTFMQFVDGVSATESGLRTLPMVGGLLLTSMGS 350

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  VSRT +  Y+   + G A++ +G  L++  D  +    Q  Y+          MQ  
Sbjct: 351 GVLVSRTGR--YKIFPVLGTAVMTVGFVLLSQMDATTPVWQQSAYLFVLGTGIGMCMQVL 408

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL 415
           +L  Q    + D+   T+ + FFR IG+ FG AI G++F+N L + I         PPE 
Sbjct: 409 VLIVQSTANFSDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLDSRIGGALAASGAPPEA 468

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRT 475
           A     S  V+++LP  +  P++ AY  +L   F    P+ ++ F+ +L +   +  LR 
Sbjct: 469 A----QSPQVLHRLPDAVAAPIVEAYSDSLGLVFLCAAPVAVIGFVVALTL--KQVPLRE 522

Query: 476 TDTVVAFE 483
            +   A +
Sbjct: 523 IEATAALD 530



>gi|145223907|ref|YP_001134585.1| EmrB/QacA family drug resistance transporter [Mycobacterium gilvum
           PYR-GCK]
 gi|500224088|ref|WP_011894181.1| MFS transporter [Mycobacterium gilvum]
 gi|145216393|gb|ABP45797.1| drug resistance transporter, EmrB/QacA subfamily [Mycobacterium
           gilvum PYR-GCK]
          Length = 650

 Score =  268 bits (684), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 164/487 (33%), Positives = 250/487 (51%), Gaps = 18/487 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRK  F  A++ F 
Sbjct: 8   QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIATAIVGKLGDLFGRKMIFGVAILFFL 67

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCG+A  M  ++  RA+ G+GGG ++     +I +++ L+DRG+YQ          
Sbjct: 68  AGSVLCGIASTMEMLVASRALQGIGGGALMVTATALIGEVIPLRDRGRYQGALGAVFGVT 127

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH+TWRW+F+IN+P+G + +IVA+  +     +G  +     IDY G 
Sbjct: 128 TVIGPLLGGYFTDHLTWRWAFWINVPIGIVVLIVALATIPALSRRGKPV-----IDYAGI 182

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++     AL L  +WGG+ Y WSSP               F  VE + A EPV P  LF
Sbjct: 183 VLIGLGASALTLATSWGGSTYAWSSPMIIGLFVGSAVALAVFVRVELR-ATEPVLPIRLF 241

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + ++P + Q V G SAT SGL  +P++ G+++ S+ SG
Sbjct: 242 ASPVFTVCCVLSFIVGFAMLGALTFLPTFMQFVDGVSATESGLRTLPMVGGLLLTSMGSG 301

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VSRT +  Y+   + G A++ +G  L++  D  +    Q  Y+          MQ  +
Sbjct: 302 VLVSRTGR--YKIFPVLGTAVMTVGFVLLSQMDATTPVWQQSAYLFVLGTGIGMCMQVLV 359

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPELA 416
           L  Q    + D+   T+ + FFR IG+ FG AI G++F+N L + I         PPE A
Sbjct: 360 LIVQSTANFSDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLDSRIGGALAASGAPPEAA 419

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTT 476
                S  V+++LP  +  P++ AY  +L   F    P+ ++ F+ +L +   +  LR  
Sbjct: 420 ----QSPQVLHRLPDAVAAPIVEAYSDSLGLVFLCAAPVAVIGFVVALTL--KQVPLREI 473

Query: 477 DTVVAFE 483
           +   A +
Sbjct: 474 EATAALD 480



>gi|340519656|gb|EGR49894.1| predicted protein [Trichoderma reesei QM6a]
          Length = 532

 Score =  268 bits (684), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 152/435 (34%), Positives = 228/435 (52%), Gaps = 10/435 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q I+ATA+P I  +F +L+ + W  TAYLLTM +FQ   GK    +  K  FL  +I FE
Sbjct: 39  QNILATAIPRITDEFNSLNDVGWYGTAYLLTMCSFQLMMGKVYKFYPAKPVFLSGIILFE 98

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS +CG AP+    I+ RAIAG+G  G+ S +M+I+ +I+ LQ R  YQ          
Sbjct: 99  VGSAICGAAPSSDAFIVGRAIAGLGSSGMFSGLMVIMFNIIPLQQRPLYQGFFGAVFAVA 158

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK-----GSLLQKLKRI 175
               P++GG FTD VTWRW FYINLP+G +++IV   +L +P  K        L K++++
Sbjct: 159 SVIGPIIGGTFTDKVTWRWCFYINLPIGGVSLIVTFLILHLPNQKLDPAAEGWLAKIQQL 218

Query: 176 DYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVA 235
           D IG +      + L+L L WGG EYPW S                F  ++     E   
Sbjct: 219 DPIGNLAFFPGIVCLVLALQWGGTEYPWDSARIIVLLVLCGVFVLIFIGIQVWKGEEATL 278

Query: 236 PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIA 295
           PP + K+  +       FF G +    +YY+P++FQ +KG SA  SG+ L+P++L  V+ 
Sbjct: 279 PPRIMKQRSIAAVVWFGFFNGGSMMVAMYYLPIWFQAIKGVSAIDSGISLLPMVLATVVG 338

Query: 296 SVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           S+SSG  +SR     Y        AL AIG GL+++ +  +G +  I Y           
Sbjct: 339 SLSSGVIISRIGY--YTPFFYLSTALAAIGGGLLSMLEPGTGHSKWIAYQFLFGLGLGFG 396

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI-AIPPE 414
            Q  L   Q ++E  D+A+ +AL+MF R +G+   + +  ++F + L   + NI +I P 
Sbjct: 397 AQQALNVVQTVLERSDIATGSALVMFTRFLGSAIFLPVAQSVFLSTLVKKVSNISSIDP- 455

Query: 415 LAGAVKASATVVNQL 429
            +  V A AT +  L
Sbjct: 456 -SKVVTAGATDLKNL 469



>gi|496693124|ref|WP_009334667.1| drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner)
           (DHA2) family protein [Streptomyces ipomoeae]
 gi|428662108|gb|EKX61567.1| drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner)
           (DHA2) family protein [Streptomyces ipomoeae 91-03]
          Length = 724

 Score =  268 bits (684), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 172/475 (36%), Positives = 257/475 (54%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   LD ++WV TAY+L  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 67  QTIVSTALPTIVSDLGGLDHLSWVVTAYMLAATAATPLWGKLGDQYGRKKLFQTAIVIFL 126

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+V  ++RG+YQ          
Sbjct: 127 MGSALCGMAQNMPQLIGFRAVQGLGGGGLMVLSMAIVGDLVPPRERGRYQGLFGAVFGAT 186

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FY+NLP+GA+ ++V   +L IPR       +   IDY GT
Sbjct: 187 SVLGPLLGGLFTEHLSWRWVFYVNLPVGAVALVVIAAVLSIPR-----RAERHTIDYPGT 241

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  + W SP               F  VE + A EPV P  LF
Sbjct: 242 FLIASVATCLVLVASLGGTTWDWGSPQIVLLAVLAVLLAVAFVAVERR-AAEPVLPLKLF 300

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV+G S T SG+ ++P++ G++++S  SG
Sbjct: 301 RVRTFTLSAVISFVVGFAMFGAMTYLPTFLQVVQGVSPTMSGVHMLPMVFGLLLSSTVSG 360

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+  +G  L+   D +SG      Y           MQ  +
Sbjct: 361 QIVSRTGR--WKVFPVAGTAVTTLGLLLLHQLDADSGDGEMAAYFFVFGLGLGLVMQVLV 418

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFS----NVLTNNIENIAIPPELA 416
           L  Q  V Y+D+   T+   FFR IGA FGVA+ GT+F+    + L+N ++   +PP ++
Sbjct: 419 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAVFGTVFAGRLGDKLSNALDGDRLPPGVS 478

Query: 417 -GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
              +KA    + +LP  +R   + AY  A+   F    P+ +L F+ + F+   +
Sbjct: 479 VDGLKADPREIAELPPALRPSALDAYASAITDVFIYAAPVAVLGFVLAWFLREDR 533



>gi|328854855|gb|EGG03985.1| hypothetical protein MELLADRAFT_108871 [Melampsora larici-populina
           98AG31]
          Length = 627

 Score =  267 bits (683), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 257/503 (51%), Gaps = 44/503 (8%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI++ ALP IAS+F ALD+I W+A+AYL+T  +F   Y +    + R+  F+ A+  FE
Sbjct: 123 QTILSPALPVIASNFNALDQIGWIASAYLITQVSFLLLYAQLLVTYNRRWIFVVAIFIFE 182

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C ++P++  +II RA++G+G  GI    + II+DI  LQDR K            
Sbjct: 183 IGSLICAVSPDVICLIIGRAVSGIGAAGIFISCLSIIADITELQDRPKLLGSFGAVFAAA 242

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPR----------------- 163
               PLLGGA TDH++WRW F+INLP GAIT I +IF++ IP                  
Sbjct: 243 SVVGPLLGGALTDHLSWRWCFWINLPCGAIT-IFSIFMV-IPNKPALPLSDKLLELVDRR 300

Query: 164 -----------PKGSLLQKLKRIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXX 212
                      P  S+L KL  +D +G  ++VG  I L+LPL WGGN+YPW S       
Sbjct: 301 WSAITFGKWIPPHQSVLHKLGSLDVVGAFLMVGLIILLVLPLQWGGNQYPWKSGVVIGTF 360

Query: 213 XXXXXXXXXFGLVETKLAIEP-----VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVP 267
                    F L E K  ++      +    L +    VG     F     F  L  ++P
Sbjct: 361 CGFGVMLGAFLLWEWK-GVDARNGRGLLSFRLLRNQTQVGACLQAF-----FIKLSNFLP 414

Query: 268 LYFQVVKGDSATTSGLELIPLILGVVIASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSG 327
           +YFQV++  SAT SG++L+PL+L +V+++ + G  +S T    Y    + G+ ++ +G+G
Sbjct: 415 IYFQVIQHASATKSGIDLLPLMLSIVVSAAAIGFLISHTGY--YWPALIVGSVILTVGTG 472

Query: 328 LITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGA 387
           L+   DE S  A    +           +Q  ++  Q  V+  D+   T+L  F +LIG 
Sbjct: 473 LLYTLDEFSSNAKISGFQVLVGTGLGLVLQNVVVAIQANVDDHDIPQATSLSSFAQLIGG 532

Query: 388 VFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRT 447
           V G+A+  TIF N L+ N+   A P   A  +++S   + QL   ++  VI AY  +LR 
Sbjct: 533 VIGIAVAQTIFGNALSQNLAKYA-PDAPASVIRSSVQSIAQLSDSLKPGVIHAYTESLRQ 591

Query: 448 AFTADIPIGILCFLASLFMGNHK 470
            +   I  G+  F A+  + N  
Sbjct: 592 VYMLGIVCGVASFFAAFLVTNKN 614



>gi|21224787|ref|NP_630566.1| efflux protein [Streptomyces coelicolor A3(2)]
 gi|499341246|ref|WP_011030954.1| efflux protein [Streptomyces coelicolor]
 gi|4154078|emb|CAA22731.1| putative efflux protein [Streptomyces coelicolor A3(2)]
          Length = 815

 Score =  267 bits (682), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 168/453 (37%), Positives = 237/453 (52%), Gaps = 13/453 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 65  QMIVATALPKIVGELHGLDKMSWAITAYLLTSTVGLPIYGKLGDLFGRKGVFQFAILVFV 124

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A  M  +I FRA+ GVG GG++  V  II+DIV  ++R +Y           
Sbjct: 125 VGSALAGRAQTMDQLIAFRAVQGVGAGGLMIGVQAIIADIVPPRERARYMGLIGASFGLA 184

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FYIN+P G +T+ V   +L++PRP+        R+D +G 
Sbjct: 185 SVAGPLLGGYFTDHLSWRWCFYINVPFGLVTMAVVAVVLKLPRPR-----VKPRLDILGA 239

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F LV    A EP+ P  LF
Sbjct: 240 LLLAAASTCLVLLTSWGGTEYAWGSRVILGLAAGAVAATLLF-LVAEHFAPEPLIPLRLF 298

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P + Q+V G SAT SGL ++P++ GVV AS+ SG
Sbjct: 299 RDSIFNVTALVGLVVGVALFGAASYLPTFLQMVDGASATESGLLMLPMMGGVVGASIISG 358

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +SRT    YR   + G+AL  +G  L++  D ++ R     +M          M   +
Sbjct: 359 QLISRTGH--YRIHPILGSALSVVGMWLLSRLDADTSRLHYSIWMAVLGAGIGLVMPVLV 416

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPE----LA 416
           L  Q  V   D+ + T+   +FR IG   G A+ GT+F+  LT+ + +  IP E    L 
Sbjct: 417 LAVQNSVRPTDLGTATSANNYFRQIGGSVGAAVFGTLFAGRLTDALAD-RIPAEAGVGLP 475

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAF 449
            A   +  +V+ LP  +R   I AY  A+   F
Sbjct: 476 DAEAITPQLVHSLPPALRDAYIGAYADAMPRIF 508



>gi|388858155|emb|CCF48223.1| uncharacterized protein [Ustilago hordei]
          Length = 689

 Score =  267 bits (682), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 176/463 (38%), Positives = 263/463 (56%), Gaps = 7/463 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q+I++TALP I + F A +  +W++T+YLLT TA  P YG+FSDIFGRK   +FA+  F 
Sbjct: 150 QSIISTALPTITASFHAGNNASWLSTSYLLTSTASSPLYGRFSDIFGRKTCIIFALTGFL 209

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LC  A ++T +I+FRA+AG  GGGI+SLVM+++ D+VSL++RG YQ          
Sbjct: 210 IGSALCAAAQSVTQLIVFRALAGAFGGGIVSLVMVVVGDVVSLRERGTYQGLLGVVVALA 269

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GGA    V WRW F I++P+  + ++  I LL + + +GS+  KL +IDY+GT
Sbjct: 270 NSGGPLIGGALAT-VGWRWCFIISVPIIIVALVSVIILLPLKKVEGSVKSKLAKIDYLGT 328

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V+  T+ LLL LNWGG +YPWSSP               F +VE + A  P+ P  LF
Sbjct: 329 ALVLAGTVLLLLGLNWGGQQYPWSSPHVLVSLILGGLIFLVFAIVEARFATLPLVPMRLF 388

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K   V          G  FF L+++VP + QVVKG S   +G+ LIPL+    + S  +G
Sbjct: 389 KIGTVCSVLVQTMCSGGIFFLLLFFVPQFTQVVKGYSGVKAGVTLIPLMALQALTSTIAG 448

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T K  Y+ + + G  + +IG GL++L +E+S     I ++          +Q TL
Sbjct: 449 IIVSKTGK--YKIIIVLGFGIFSIGVGLLSLLNEHSNIGMIIGFLLLSGFGAGGTLQVTL 506

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPE-LAGAV 419
           +  Q  VE +D+A +T+   F RL G    +AI  TI +N + N ++N  +P + +A  V
Sbjct: 507 VAAQNAVERRDIAVLTSTRNFIRLFGGTLCLAISYTILNNSVRNQVKN--LPSQVIAQVV 564

Query: 420 KASATVVN-QLPIEIRGPVISAYVGALRTAFTADIPIGILCFL 461
           +    + N +        ++ AYV A R  F   + + +L FL
Sbjct: 565 RNPKLITNGEFDAATSAQLLQAYVHAFRNVFRFGLGLTLLAFL 607



>gi|511097274|ref|WP_016327744.1| putative efflux protein [Streptomyces lividans]
 gi|509522223|gb|EOY51536.1| putative efflux protein [Streptomyces lividans 1326]
          Length = 815

 Score =  266 bits (681), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 168/453 (37%), Positives = 237/453 (52%), Gaps = 13/453 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 65  QMIVATALPKIVGELHGLDKMSWAITAYLLTSTVGLPIYGKLGDLFGRKGVFQFAILVFV 124

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A  M  +I FRA+ GVG GG++  V  II+DIV  ++R +Y           
Sbjct: 125 VGSALAGRAQTMDQLIAFRAVQGVGAGGLMIGVQAIIADIVPPRERARYMGLIGASFGLA 184

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FYIN+P G +T+ V   +L++PRP+        R+D +G 
Sbjct: 185 SVAGPLLGGYFTDHLSWRWCFYINVPFGLVTMAVVAVVLKLPRPR-----VKPRLDILGA 239

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F LV    A EP+ P  LF
Sbjct: 240 LLLAAASTCLVLLTSWGGTEYAWGSRVILGLAAGAVAATLLF-LVAEHFAPEPLIPLRLF 298

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P + Q+V G SAT SGL ++P++ GVV AS+ SG
Sbjct: 299 RDSIFNVTALVGLVVGVALFGAASYLPTFLQMVDGASATESGLLMLPMMGGVVGASIISG 358

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +SRT    YR   + G+AL  +G  L++  D ++ R     +M          M   +
Sbjct: 359 QLISRTGH--YRIHPILGSALSVVGMWLLSRLDADTSRLHYSIWMAVLGAGIGLVMPVLV 416

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPE----LA 416
           L  Q  V   D+ + T+   +FR IG   G A+ GT+F+  LT+ + +  IP E    L 
Sbjct: 417 LAVQNSVRPTDLGTATSANNYFRQIGGSVGAAVFGTLFAGRLTDALAD-RIPAEAGVGLP 475

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAF 449
            A   +  +V+ LP  +R   I AY  A+   F
Sbjct: 476 DAEAITPQLVHSLPPALRDAYIGAYADAMPRIF 508



>gi|490070320|ref|WP_003972495.1| MFS transporter [Streptomyces lividans]
 gi|289698132|gb|EFD65561.1| efflux protein [Streptomyces lividans TK24]
          Length = 809

 Score =  266 bits (681), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 168/453 (37%), Positives = 237/453 (52%), Gaps = 13/453 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 59  QMIVATALPKIVGELHGLDKMSWAITAYLLTSTVGLPIYGKLGDLFGRKGVFQFAILVFV 118

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A  M  +I FRA+ GVG GG++  V  II+DIV  ++R +Y           
Sbjct: 119 VGSALAGRAQTMDQLIAFRAVQGVGAGGLMIGVQAIIADIVPPRERARYMGLIGASFGLA 178

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FYIN+P G +T+ V   +L++PRP+        R+D +G 
Sbjct: 179 SVAGPLLGGYFTDHLSWRWCFYINVPFGLVTMAVVAVVLKLPRPR-----VKPRLDILGA 233

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F LV    A EP+ P  LF
Sbjct: 234 LLLAAASTCLVLLTSWGGTEYAWGSRVILGLAAGAVAATLLF-LVAEHFAPEPLIPLRLF 292

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P + Q+V G SAT SGL ++P++ GVV AS+ SG
Sbjct: 293 RDSIFNVTALVGLVVGVALFGAASYLPTFLQMVDGASATESGLLMLPMMGGVVGASIISG 352

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +SRT    YR   + G+AL  +G  L++  D ++ R     +M          M   +
Sbjct: 353 QLISRTGH--YRIHPILGSALSVVGMWLLSRLDADTSRLHYSIWMAVLGAGIGLVMPVLV 410

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPE----LA 416
           L  Q  V   D+ + T+   +FR IG   G A+ GT+F+  LT+ + +  IP E    L 
Sbjct: 411 LAVQNSVRPTDLGTATSANNYFRQIGGSVGAAVFGTLFAGRLTDALAD-RIPAEAGVGLP 469

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAF 449
            A   +  +V+ LP  +R   I AY  A+   F
Sbjct: 470 DAEAITPQLVHSLPPALRDAYIGAYADAMPRIF 502



>gi|393214384|gb|EJC99877.1| MFS general substrate transporter [Fomitiporia mediterranea MF3/22]
          Length = 628

 Score =  266 bits (680), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 155/410 (37%), Positives = 237/410 (57%), Gaps = 2/410 (0%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           T+VATALP+I+++F A    +++ +AYLLT TAFQP YG+FSDIFGRK     A+  F +
Sbjct: 76  TLVATALPSISAEFHAGSVSSFIPSAYLLTSTAFQPLYGRFSDIFGRKVALCLAMAVFML 135

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           G+L  G +  ++  I+FR IAG GGGGI+S+  II+SD+VSL+DRGKYQ           
Sbjct: 136 GNLAAGFSRKISEAIVFRGIAGAGGGGIVSMAQIIMSDVVSLRDRGKYQGIIGVVVALGY 195

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTI 181
              PL+GGA ++ V+WRW F+I LP+    +++  ++L +   +G + +KL  IDY+GT 
Sbjct: 196 GVGPLIGGALSEKVSWRWCFWITLPVSLCGIVIVTYILPLKSVEGDIKRKLLAIDYVGTA 255

Query: 182 VVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFK 241
           + +     ++LPL WGG  +PW S                F L E K+A  P+ P ++F+
Sbjct: 256 LTLSGCTLVILPLIWGGVTFPWRSAIVLATLFSGICVVSIFCLWEWKVAKLPIVPMYIFR 315

Query: 242 RLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQ 301
            + V G + T F  G  F S +YY+P +FQ+  G S   SG+ L+P+++   +AS  +G 
Sbjct: 316 HVTVSGVYITMFVNGFVFNSSLYYLPQFFQIALGYSPIRSGVFLLPVLVSQTLASFIAGV 375

Query: 302 AVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLL 361
            VSRT +  YR++   G  + A+G GL++  + +SG    + YM          +QTT +
Sbjct: 376 IVSRTGR--YRSIIYIGFGVWAVGCGLLSTVNASSGTVRPVVYMLLAGIGAGQTLQTTTV 433

Query: 362 CGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAI 411
             Q  V  +D++ VTA+  F RL+G    +AI  TI +N L   +  + I
Sbjct: 434 AAQASVSRRDMSVVTAVRNFVRLLGGTLSLAIGSTIINNSLRAKMSALKI 483



>gi|29832374|ref|NP_827008.1| multidrug-efflux transporter [Streptomyces avermitilis MA-4680]
 gi|499295975|ref|WP_010987233.1| multidrug-efflux transporter [Streptomyces avermitilis]
 gi|29609493|dbj|BAC73543.1| putative multidrug-efflux transporter [Streptomyces avermitilis
           MA-4680]
          Length = 695

 Score =  266 bits (680), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 176/483 (36%), Positives = 259/483 (53%), Gaps = 15/483 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 51  QTIVSTALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKKLFQTAIVLFL 110

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ DIV  ++RGKYQ          
Sbjct: 111 IGSALCGMARNMPELIAFRAVQGLGGGGLIVLSMAIVGDIVPPRERGKYQGLFGAVFGAT 170

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FY+NLP+G   + V    L IP+     +     IDY+GT
Sbjct: 171 SVLGPLLGGLFTEHLSWRWVFYVNLPVGVAALAVIATALHIPKRSARHV-----IDYLGT 225

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  + WSSP               F   E + A EPV P  LF
Sbjct: 226 FLIASVATCLVLVASLGGTTWGWSSPQIIGLAVLGVVLVAAFVAAERR-AAEPVLPLKLF 284

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV+G + T SG+ ++P++ G++I+S +SG
Sbjct: 285 RVRTFTLAAVISFIVGFAMFGAMTYLPTFLQVVQGVTPTMSGVHMLPMVAGMLISSTASG 344

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   +TG  + A+G  L+   DE+S       Y           MQ  +
Sbjct: 345 QIVSRTGR--WKVFPVTGTGVTALGLLLLHQLDEHSSTGRMSVYFFVFGLGLGLVMQVLV 402

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-ENIAIPPELAG-- 417
           L  Q  V Y+D+   T+   FFR IGA FGVAI G++F++ L + +   ++  P  AG  
Sbjct: 403 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAIFGSVFASRLGDKLTAALSGRPLPAGIT 462

Query: 418 --AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRT 475
              +K+    +  LP  +R  V+ A+  ++   F    P+ +L F+ + F+  H+  LR 
Sbjct: 463 PDTLKSDPRGIANLPSSLRPSVLQAFAASITDVFLYAAPVALLGFVLAWFL--HEDRLRG 520

Query: 476 TDT 478
           + T
Sbjct: 521 SVT 523



>gi|212541604|ref|XP_002150957.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
 gi|210068256|gb|EEA22348.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
          Length = 581

 Score =  266 bits (680), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 160/477 (33%), Positives = 247/477 (51%), Gaps = 15/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+ TA+P I   F ++  + W  +AY LT TA QPTYG+   I   K  FL A+  FE
Sbjct: 90  QTIIGTAIPKITDQFHSVQDVGWYGSAYFLTSTALQPTYGRIYKIMNVKWAFLAAIFVFE 149

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+APN +T+I  RAIAG G  GI S  ++I+S  + L+ R              
Sbjct: 150 LGSLICGVAPNSSTLIGGRAIAGCGVAGIFSGALVILSFSIPLRQRPMVFGLFGAVWGVA 209

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKG----SLLQKLKRID 176
               PLLGGAFTDH++WRW FYINLP+G +   + + +L +P  K     +  Q L  +D
Sbjct: 210 SVVGPLLGGAFTDHISWRWCFYINLPIGGVAAAIVVLILHLPARKNDKTQTWSQTLLELD 269

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            +G  +++ + + LLL L WGGN+YPWS                 FG+ + KL  +   P
Sbjct: 270 LVGAALIIPAIVCLLLALQWGGNKYPWSDSRIIGLFVGFGLIAILFGISQWKLGDQATLP 329

Query: 237 PHLFKRLHV--VGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVI 294
           P + K+  V  V  F  +F  G AFF  +YY+P+YFQ VK  SAT SG++L+P++L  VI
Sbjct: 330 PRILKKRTVWSVSIFAVSF--GGAFFLFMYYLPIYFQSVKDHSATKSGIDLLPILLATVI 387

Query: 295 ASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXX 354
           +SV  G  ++      Y    +    L  IGSGL+T +         I Y          
Sbjct: 388 SSVFFGGLITAVGY--YTPFLILSTVLFCIGSGLLTTYSTTISTPKWIGYQILAGAGVGA 445

Query: 355 XMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPE 414
             Q  +   Q I+  +D+   +A +MFF+ +G    +++  ++F N L++ +++     E
Sbjct: 446 GFQVPMTAVQTILSQEDIPIGSAAVMFFQNLGGALFISVGQSVFQNGLSSYMQSHVQDIE 505

Query: 415 LAGAVKASATVVNQLPIEIRG-----PVISAYVGALRTAFTADIPIGILCFLASLFM 466
            +  + A AT +  +  +I        V+ AY+  L  A+   + +  +  +A+LF+
Sbjct: 506 PSVIISAGATAIRDVLSKIGKLDELPAVVEAYMAGLVNAYRVSLALTCVALVATLFV 562



>gi|495046461|ref|WP_007771297.1| MFS transporter [Mycobacterium colombiense]
 gi|400332855|gb|EJO90350.1| drug transporter [Mycobacterium colombiense CECT 3035]
          Length = 690

 Score =  266 bits (680), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 166/467 (35%), Positives = 248/467 (53%), Gaps = 10/467 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I ++       +WV T+YLL  T      GKF D+FGRK  F  AV+ F 
Sbjct: 47  QTIVATALPTIVANLGGAGHQSWVVTSYLLASTIITALVGKFGDLFGRKRVFQAAVVFFV 106

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCGL+ +M  ++  RA+ G+GGGG++   M +I +++ L+DRG+YQ          
Sbjct: 107 AGSVLCGLSSSMGMLVASRALQGIGGGGLMVTAMALIGEVIPLRDRGRYQGAMGAVFGVT 166

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLK-RIDYIG 179
               PLLGG FTDH TWRW+F+IN+P+  +   VA     IP    +L ++ K  IDY G
Sbjct: 167 TVIGPLLGGYFTDHFTWRWAFWINVPISVVVFFVAAAA--IP----ALTERTKPAIDYTG 220

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
            + V      L L  +WGG  YPW SP               F  VE++ A EP+ P  L
Sbjct: 221 ILFVGLGAAGLTLATSWGGTTYPWGSPMIIGLFVGSVIALCIFAWVESR-AAEPILPIRL 279

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+      C   +F  G A    + ++P Y Q V G SATTSGL  +P++LG++  S+ S
Sbjct: 280 FRSSVFSVCCGLSFVVGFAMLGALTFLPTYMQFVDGVSATTSGLRTLPMVLGMLTTSMGS 339

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  V RT +  Y+   + G A++A+   L++  D ++    Q  ++          MQT 
Sbjct: 340 GVIVGRTGR--YKVFPIAGTAVMAVAFFLMSRMDPSTSAVVQSVFLVILGAGIGMCMQTL 397

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV 419
           +L  Q    + D+   T+ + FFR IG+ FG AI G++F+N L + I    +      A 
Sbjct: 398 VLIVQNTSSFDDLGVATSGVTFFRTIGSSFGAAIFGSLFTNFLHSRIGPAMMTGHAPAAG 457

Query: 420 KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
            AS   +++LP E   P+++AY  +L   F   +P+ ++ F+ +LF+
Sbjct: 458 AASPEALHRLPREAAAPIVAAYADSLTQVFFWAVPVALVGFVLALFL 504



>gi|491122653|ref|WP_004981093.1| MFS transporter [Streptomyces ghanaensis]
 gi|291339076|gb|EFE66032.1| transmembrane efflux protein [Streptomyces ghanaensis ATCC 14672]
          Length = 806

 Score =  266 bits (680), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 164/457 (35%), Positives = 245/457 (53%), Gaps = 21/457 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LD+++W  TAYLLT T   P YGK  D+ GRK  F FA++ F 
Sbjct: 60  QMIVATALPKIVGELHGLDRMSWAITAYLLTATIGLPVYGKLGDLLGRKGVFQFAIVVFV 119

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A  M  +I +RA+ GVG GG++  V  II+DIV  ++R ++           
Sbjct: 120 VGSALAGRASTMDQLIAYRAVQGVGAGGLMIGVQAIIADIVPARERARFMGLIGAAFGLA 179

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY+N+P G +T+ V   +L++P+P         R+D +G 
Sbjct: 180 SVAGPLLGGYFTDHLSWRWCFYVNVPFGIVTLAVVAVVLKLPKPAAR-----PRLDVLGC 234

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F +VE + A+EP+ P  LF
Sbjct: 235 LLLATASTCLVLLTSWGGTEYAWDSRVVLGLGAGAASATVLFLVVE-RFAVEPLIPLRLF 293

Query: 241 KR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    +V G        G+A F    Y+P Y Q+V G +AT SGL ++P++ G+V AS+ 
Sbjct: 294 RDSVFNVTGLV--GLVVGVALFGAASYLPTYLQMVDGATATESGLLMLPMMAGIVGASIV 351

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ +SRT +  YR   + G+AL  +G  L++  + ++ R     +M          M  
Sbjct: 352 SGQLISRTGR--YRAHPVLGSALSVVGMWLLSRLEPDTPRLHYSIWMAVLGTGIGMVMPV 409

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-ENIAIPPELAG 417
            +L  Q  V   D+ + T+   +FR IG   G A+ GT+F++ LT+ + E++   P  AG
Sbjct: 410 LVLAVQNSVRPADLGTATSAHNYFRQIGGSVGAAVFGTLFADRLTDALGEHL---PAHAG 466

Query: 418 AVKASAT-----VVNQLPIEIRGPVISAYVGALRTAF 449
           A    A      +V+ LP E+R   I AY  A+   F
Sbjct: 467 AAPPDAESITPQLVHALPPELRDAYIRAYADAMPRIF 503



>gi|490082187|ref|WP_003984238.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           rimosus]
 gi|440616943|gb|ELQ80063.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           rimosus subsp. rimosus ATCC 10970]
          Length = 683

 Score =  266 bits (680), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 178/479 (37%), Positives = 251/479 (52%), Gaps = 14/479 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I SD   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 38  QTIVATALPTIVSDLGGLDHLSWVVTAYLLASTAATPLWGKLGDQYGRKRLFQTAIVIFL 97

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A +M  +I FRA+ G+GGGG++ L M I+ DIV  +DRG+YQ          
Sbjct: 98  IGSALCGIAQDMPQLIAFRAVQGLGGGGLIVLSMAIVGDIVPPRDRGRYQGLFGAVFGAT 157

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F DH++WRW FYINLP+G + + V   +L IP  +        RIDY GT
Sbjct: 158 SVLGPLLGGLFVDHLSWRWVFYINLPIGIVALAVIAAVLHIPARRTP-----HRIDYPGT 212

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++       +L  + GG  Y W S                F  VE + A EPV P  LF
Sbjct: 213 VLIAAVAACFVLMTSLGGVSYGWGSWQIIGLGVLGLVLLAVFIAVERR-AAEPVLPLRLF 271

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +           F  G A F  + Y+P + QVVKG S T SG+ ++P+++G++++S  SG
Sbjct: 272 RLRSFTLTAVIGFVIGFAMFGSMTYLPTFLQVVKGVSPTMSGVHMLPMVIGMLLSSTGSG 331

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  Y+   + G A+ A+G  L+     +SG A    +           MQ  +
Sbjct: 332 QLVSRTGR--YKVFPIAGTAVTAVGLLLLHQLGLSSGTAVMSVFFFVFGFGLGLVMQVLV 389

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL- 415
           L  Q  V Y+D+   T+   FFR IG+ FGV+I GTIF+N L   I +      +PP   
Sbjct: 390 LIVQNAVAYEDLGVATSGATFFRSIGSSFGVSIFGTIFANKLGPRIADALAGQRLPPGTD 449

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLR 474
              +      V QLP +    V+ AY  ++   F   +P+ ++ F+ + F+   +P  R
Sbjct: 450 PSKIAEDPRTVGQLPPDAASGVLDAYSTSITDVFLYAVPVVLIAFVLAWFL-REEPLRR 507



>gi|497724578|ref|WP_010038762.1| MFS transporter [Streptomyces chartreusis]
          Length = 761

 Score =  266 bits (680), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 163/476 (34%), Positives = 239/476 (50%), Gaps = 16/476 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LD+++W  TAYLLT T   P YGK  D+ GRK  F FA++ F 
Sbjct: 17  QMIVATALPKIVGELHGLDRMSWAITAYLLTATVGLPIYGKLGDLLGRKGVFQFAIVVFV 76

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS L G A  M  +I FRA+ G G GG++  V  II+DIV  + RG+Y           
Sbjct: 77  AGSALAGRAQTMDQLIAFRALQGAGAGGLMIGVQAIIADIVPARRRGRYMGLIGAAFGLA 136

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY+N+P G +T+ V    L++P+P G       R+D +G 
Sbjct: 137 SVAGPLLGGYFTDHLSWRWCFYVNVPFGLVTLAVVAVALKLPKPAGR-----ARLDILGA 191

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F LV    A EP+ P  LF
Sbjct: 192 LLLTAASTCLVLLTSWGGTEYAWDSRMILGLGAGAAVATVLF-LVAEHFAAEPLIPLRLF 250

Query: 241 KR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    +V G        G   F    Y+P Y Q+  G SAT SGL ++P++ G+V AS+ 
Sbjct: 251 RDSVFNVTGLV--GLVTGAGLFGAASYLPTYLQMADGASATESGLLMLPMMGGIVGASII 308

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           +GQ +S T +  Y+   + G AL   G  L++  D ++ R     +M          M  
Sbjct: 309 AGQLISHTGR--YKAYPILGGALSVAGMWLLSRLDADTPRLHYSLWMAVLGAGIGMVMPV 366

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN---IAIPPEL 415
            +L  Q  V   D+ + T+   +FR IG   G A+ GT+F++ L + + +         L
Sbjct: 367 LILAVQNSVRPADLGTATSANNYFRQIGGSVGAAVFGTLFADRLADALAHHLPTGAGDRL 426

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKP 471
                 +  +V+ LP E+R   I AY  A+   F   +P+  +  + +LF+   KP
Sbjct: 427 PDPESITPQLVHSLPPELRDGYIGAYAEAMPRIFLYLVPVLAVGLVIALFL-KEKP 481



>gi|242783058|ref|XP_002480123.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218720270|gb|EED19689.1| efflux pump antibiotic resistance protein, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 562

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 169/476 (35%), Positives = 255/476 (53%), Gaps = 14/476 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           +TI+ATA+P I  DF ALD IAW  +AYLLT  +FQ  YG+    +  K  FL A+I FE
Sbjct: 64  RTIIATAIPRITDDFHALDDIAWYGSAYLLTSCSFQLLYGRIYTFYSPKWVFLCAIILFE 123

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS +CG AP  T  I+ RAIAG+G  GI S  ++II+D V LQ R              
Sbjct: 124 IGSAVCGGAPTSTAFIVGRAIAGLGSCGIFSGCIVIITDAVPLQKRPMLTGLMGSLFGIA 183

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLR-----IPRPKGSLLQKLKRI 175
               PL+GGAFT+ VTWRW FYINLP+GA+T++V +F+L+      P P  +L ++L ++
Sbjct: 184 SVVAPLIGGAFTEKVTWRWCFYINLPIGALTILVILFILKASPPPNPSPAHTLKERLHQL 243

Query: 176 DYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVA 235
           D  GT   +   I LLL L WGG  YPW++                F L++         
Sbjct: 244 DPFGTGTFLPGMICLLLALTWGGVTYPWNNGRIIALFVLSGVLLIAFVLIQVWEGETASV 303

Query: 236 PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIA 295
           PP L K+  +   F   F  G     +VYY+P++FQ +KG +A  SG+  IPL+L +V+ 
Sbjct: 304 PPRLVKKRTMSAGFFFTFCVGGTMLLVVYYLPVWFQAIKGANAVKSGIMNIPLVLSLVVG 363

Query: 296 SVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           ++ +G AV+    F      + G+ ++AIG+GL+T +  N+G +  I Y           
Sbjct: 364 TILAGAAVTNIGYFT--PFMIAGSVVMAIGAGLLTTFTTNTGHSKWIGYQVIFGLGIGIG 421

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL 415
           MQ   +  Q I+E KDV +  +++M  + +G    +A+  T+FSN L++++++    PE 
Sbjct: 422 MQQGSVAAQTILERKDVPTGASIMMLAQSLGGSIFLAVGQTVFSNGLSSHLQSYVQGPEA 481

Query: 416 AGAV----KASAT---VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASL 464
           A  +    +A AT    ++ L  E    ++SAY  A+   F   + +  +  + SL
Sbjct: 482 ANIISMVTQAGATGFRRLSGLSPEDLSAILSAYNKAIVDTFYVCVGLASVSIIGSL 537



>gi|67902216|ref|XP_681364.1| hypothetical protein AN8095.2 [Aspergillus nidulans FGSC A4]
 gi|40740527|gb|EAA59717.1| hypothetical protein AN8095.2 [Aspergillus nidulans FGSC A4]
 gi|259480854|tpe|CBF73873.1| TPA: MFS toxin efflux pump (AflT), putative (AFU_orthologue;
           AFUA_1G12620) [Aspergillus nidulans FGSC A4]
          Length = 539

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 169/478 (35%), Positives = 252/478 (52%), Gaps = 16/478 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTI+  A+P I + FK+++ IAW  +AY LT TA QP+YG+   IF  K  FL AV  FE
Sbjct: 45  QTIIGVAIPEITNQFKSIEDIAWYGSAYFLTSTALQPSYGRLYKIFSAKWAFLCAVFLFE 104

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+C +AP+ T +I+ RA+AG+G  GI S  ++II+  V L  R              
Sbjct: 105 LGSLICAVAPSSTVLIVGRAVAGIGVAGIFSGALVIIALCVPLPKRPLVFGMFGMVWGIA 164

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGS-----LLQKLKRI 175
               PLLGGAFTD V+WRW FYINLP+G +++ +  F+L++P    S     LL ++K+I
Sbjct: 165 SIAGPLLGGAFTDSVSWRWCFYINLPIGGVSMAIVAFILQLPEQNLSSKATPLLDRIKQI 224

Query: 176 DYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVA 235
           D+IG  +++   I LLL L WGGN+Y WS+                    + KL      
Sbjct: 225 DFIGAALLIPCIICLLLALQWGGNKYAWSNGRIIGLFVTFGVLAILTIFSQIKLGDRATL 284

Query: 236 PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIA 295
           PP +  +  V+         G +FF LVYY+P++FQ V+G SA TSG++L+PL+L  V++
Sbjct: 285 PPRIMTQRTVITSTIYALLFGGSFFVLVYYLPIFFQSVRGSSAMTSGIQLLPLMLATVVS 344

Query: 296 SVSSGQAVSRTDKFAYRT-LSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXX 354
           SV +G  V+    F Y T   +   A+ +IG GLITL+  +      I Y          
Sbjct: 345 SVLTGILVT---IFGYYTPFLIASTAIASIGGGLITLYSIDISSGKWIGYQILLGAGVGA 401

Query: 355 XMQTTLLCGQGIVEYK--DVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIP 412
             Q  +   Q  +  K  D+   TA +MFF+ +G    +A+  ++F N L   +   A  
Sbjct: 402 GFQVPMTAVQTSLASKPDDIPQGTAAVMFFQTLGGALFIAVAQSLFQNGLIEGVVEYAPS 461

Query: 413 PELAGAVKASAT----VVNQL-PIEIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
            + A  V+A AT    V+ QL  ++    VI A++  LR  +   + + +  F+ S F
Sbjct: 462 VDPAAIVEAGATEMRHVLEQLGQLDQLENVILAFLDGLRDTYRLSLALFLAAFVVSCF 519



>gi|392590836|gb|EIW80164.1| MFS general substrate transporter [Coniophora puteana RWD-64-598
           SS2]
          Length = 669

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 251/479 (52%), Gaps = 6/479 (1%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           ++AT LP I+  F A   IAWV +AY L  TAF P YG+ SDIFGRKA     +  F +G
Sbjct: 85  VIATGLPLISQAFSAGSVIAWVPSAYFLASTAFMPLYGRLSDIFGRKAAMATGMTIFVLG 144

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           +L  G + N+  +II RAIAG GGGGI+S+  IIISD+V+L++RGK+Q            
Sbjct: 145 ALGSGFSRNIMELIICRAIAGAGGGGIISMAQIIISDVVTLRERGKFQGIIIAVNALGFA 204

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             P +GGA ++ V+W+W F+IN+P   I + +  F+L     +G++  K+KRIDY+GT +
Sbjct: 205 IGPPIGGALSEKVSWKWCFWINIPYSVIAITIITFILPFKPVQGNMKDKIKRIDYMGTFL 264

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
            +  ++ +LLPL WGG  Y W S                F + E   A+ P+ P ++FK 
Sbjct: 265 TLAGSVMVLLPLTWGGVSYSWYSGPVLGPLIGGLAVIVLFCVWEAYGALLPIIPMYIFKH 324

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
             VVG +   F  G  F+S +YY+P +FQV  G S   SG+ L+PL+L    +S S+G  
Sbjct: 325 TTVVGVYIAMFANGFIFYSAMYYLPQFFQVGMGWSPIRSGVSLLPLLLAQAFSSWSTGLM 384

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
           VS T +F  R L  TG  +  IGSG + +      R     YM          MQTT + 
Sbjct: 385 VSWTGRF--RALIYTGFTVWTIGSGCLMMLSSTINRPAMSFYMILSGFGAGLTMQTTTVA 442

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  V  KD++ VTA+  F RL+G   G+AI  T  +N L +++  + + P     +  +
Sbjct: 443 AQASVPRKDMSVVTAIRNFVRLLGGTLGLAIGSTFINNELRDSLTTLGLSPSTVSTIVDT 502

Query: 423 ATVVNQ----LPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
            ++++     L  E     +  Y   +R  F  +        +A++F+  H+   R  D
Sbjct: 503 PSLLSTNAAGLTAEQTSIALGGYTKGIRLLFAINTAWSAFALIATIFLIKHQNLTRGDD 561



>gi|433648045|ref|YP_007293047.1| arabinose efflux permease family protein [Mycobacterium smegmatis
           JS623]
 gi|505120119|ref|WP_015307221.1| arabinose efflux permease family protein [Mycobacterium smegmatis]
 gi|433297822|gb|AGB23642.1| arabinose efflux permease family protein [Mycobacterium smegmatis
           JS623]
          Length = 684

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 246/487 (50%), Gaps = 18/487 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRK  F  A++ F 
Sbjct: 43  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIVTAVVGKLGDLFGRKVVFAAAIVFFL 102

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCGLA +MT ++  RA+ G+GGG I+     +I +++ L+DRG+YQ          
Sbjct: 103 GGSVLCGLAGSMTMLVASRALQGIGGGAIMVTATALIGEVIPLRDRGRYQGALGAVFGVT 162

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIF----LLRIPRPKGSLLQKLKRID 176
               PLLGG FTDH++WRW+F+IN+P+  +   VAI     L R  RP          ID
Sbjct: 163 TVVGPLLGGFFTDHLSWRWAFWINVPVAVVVFFVAIAAIPSLGRTGRPL---------ID 213

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
           Y G + V      L L  +WGG EY W SP               F  VE++ A EP+ P
Sbjct: 214 YAGIVFVGVGASGLTLATSWGGTEYAWGSPVIIGLFVASAAALAVFVWVESR-AAEPILP 272

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
             LF+      C   +F  G A    + ++P + Q V G SAT SGL  +P++ G+++ S
Sbjct: 273 IRLFRSPVFTVCCVLSFIVGFAMLGALTFLPTFMQFVDGVSATVSGLRTLPMVAGLLLTS 332

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + SG  VSRT +  Y+   + G A++ +G  L++  D  +    Q  Y+          M
Sbjct: 333 MGSGVLVSRTGR--YKIFPVVGTAVMVLGFVLLSRMDATTPIMLQSLYLFILGTGIGMCM 390

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELA 416
           Q  +L  Q    + D+   T+ + FFR IG+ FG AI G++F+N L + I          
Sbjct: 391 QVLILIVQNTSNFADLGVATSGVTFFRTIGSSFGAAIFGSLFTNFLQDRIGPALAASGAP 450

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTT 476
            A   S  V++QLP ++  P++ AY  +L   F    P+  + F+ +L +   +  LR  
Sbjct: 451 PAAAQSPQVLHQLPHDVAAPIVDAYADSLGMVFLCAAPVAFVGFIVALLL--KEVPLREM 508

Query: 477 DTVVAFE 483
           D V A +
Sbjct: 509 DAVNAVD 515



>gi|443927365|gb|ELU45864.1| transporter [Rhizoctonia solani AG-1 IA]
          Length = 806

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 171/457 (37%), Positives = 244/457 (53%), Gaps = 13/457 (2%)

Query: 25  ATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIGSLLCGLAPNMTTMIIFRAIAGV 84
           A+ Y LT      TYG+   I   K  +L AV+ FEIGSL C +APNM  +I  RA AGV
Sbjct: 199 ASGYFLTQAGLMLTYGQLLSIASTKWVYLAAVVLFEIGSLFCAVAPNMEFLIFGRAFAGV 258

Query: 85  GGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXXXXPLLGGAFTDHVTWRWSFYIN 144
           G  GI   V+ II+ +  L+ R                  PLLGGAFTDHV+WRW FYIN
Sbjct: 259 GAAGIFVSVLSIIAQVTRLEQRPALFGTFGAVFALSSVVGPLLGGAFTDHVSWRWCFYIN 318

Query: 145 LPLGAITVIVAIFLLRIPRPKG-------SLLQKLKRIDYIGTIVVVGSTIALLLPLNWG 197
           LP GAITV+  IFL     P G       + LQK   +D+ G+I+ +G   ALLLPL WG
Sbjct: 319 LPFGAITVVTIIFLTPNRAPLGGDQYEGKTTLQKWISLDWAGSILALGMVTALLLPLQWG 378

Query: 198 GNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKRLHVVGCFTTNFFQGM 257
           GNE PW+                 F   E KL    +    +F+R   +G     FF  +
Sbjct: 379 GNERPWNDKVVIALFCVFGVLLPAFIAWEYKLGDRAIMRTSMFRRRTQIGTCLEAFFVML 438

Query: 258 AFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQAVSRTDKFAYRTLSMT 317
           A     YY+P+YFQV KG SAT SG++++P +L VVIA+  SG  ++ T +  Y    + 
Sbjct: 439 ALLLGTYYLPIYFQVAKGHSATRSGIDILPFMLSVVIAAGGSGGVINSTGR--YWPFLVG 496

Query: 318 GAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLCGQGIVEYKD--VASV 375
              LI++GSGL+   D NSG   +I +           +Q T++  Q    +++  +   
Sbjct: 497 SPLLISVGSGLLYTLDINSGSGKEIGFQILLGVGIGGALQNTVIAIQAEYAHEEELIPQG 556

Query: 376 TALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA--IPPELAGAVKASATVVNQLPIEI 433
           ++L+ F +LIG + G+AI G+I +N +   +   A  +P E+A AV+ S +++  LP E 
Sbjct: 557 SSLVTFTQLIGGIIGIAIAGSILANQMIKYLAIYAPDLPQEVANAVRQSVSLIFTLPAEQ 616

Query: 434 RGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           + PVI AY+ AL + F   +P G+L  L++LF+ N+ 
Sbjct: 617 QEPVIRAYLKALNSVFLIGVPTGVLASLSALFVKNYN 653



>gi|512199834|gb|EPE28667.1| MFS general substrate transporter [Glarea lozoyensis ATCC 20868]
          Length = 570

 Score =  266 bits (679), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 171/479 (35%), Positives = 243/479 (50%), Gaps = 11/479 (2%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATA+P I  +F+ LD + W  +A+ LT+ AFQ T+GK    F  K  FL A+  FE+
Sbjct: 88  TIVATAIPKITDEFRGLDLVGWYGSAFFLTVGAFQSTWGKAYKYFPLKLAFLAAIFVFEV 147

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSL+CG+APN T +I+ RAIAG+GG GI S    II+       R  Y            
Sbjct: 148 GSLICGVAPNSTALIVGRAIAGLGGAGIASGAYTIIAFSAPPAQRAAYTGLMGAAYGLAS 207

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP----KGSLLQKLKRIDY 177
              PLLGG F + VTWRW FYINLP+G ++  + +F  + P      + SL +KL ++D 
Sbjct: 208 VVGPLLGGVFAEKVTWRWCFYINLPIGGVSAAIIVFFFKTPSQAVPVEASLKEKLLQMDL 267

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            GT  ++ + +  +L L WGG    WS                 FG+VE       +   
Sbjct: 268 PGTFTIMAAIVCYILALQWGGQTKSWSDSSVIGTLVGFVLILILFGVVEWWQGERAMVNG 327

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            L K  ++       FF G AFF L+YY+P+YFQVV G SA+ SG+  +PLI+ VV+A++
Sbjct: 328 RLLKTRNIALGMAFIFFLGGAFFLLLYYLPIYFQVVNGVSASQSGIRNLPLIIAVVLATI 387

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
           +SG  +S T  F    L   G  +  IGS L+   D +S  A  I Y            Q
Sbjct: 388 TSGGTISATGHFVPWML--VGGVMATIGSALLFTLDVHSTSAHWIGYQVLAGLGLGAAFQ 445

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
             ++ GQ IVE  D+ASVTA+++F + IG  F V+     F+N+L   +   A     A 
Sbjct: 446 VPIIVGQAIVEPTDLASVTAMILFCQTIGGAFFVSAGQVAFANILVARLVETAPAVSPAE 505

Query: 418 AVKASATVV-NQLPIEIRGPVISAYVGALRTAFTADI-PIGILCFLASLFMGNHKPSLR 474
            V    T + N         ++ AY+  L+ A+   I   GI  F+A   MG+   +L+
Sbjct: 506 VVTIGVTEIRNHFAASDVPGIVLAYMDGLQVAYAIAIASAGISVFIA---MGSKWTNLK 561



>gi|491083836|ref|WP_004945450.1| transmembrane efflux protein [Streptomyces mobaraensis]
 gi|453052192|gb|EME99679.1| transmembrane efflux protein [Streptomyces mobaraensis NBRC 13819 =
           DSM 40847]
          Length = 859

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 174/474 (36%), Positives = 246/474 (51%), Gaps = 14/474 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I  D   +D++ W  TAYLLT T   P YGK  D+ GRK  F+FA++ F 
Sbjct: 59  QTIVATALPRIVGDLHGVDRMTWAVTAYLLTSTVVLPLYGKVGDLLGRKTVFVFAIVVFV 118

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G +  M   I FRA+ GVG GG+L  V  II+DIV  ++RG++           
Sbjct: 119 LGSGLAGWSRTMDQFIAFRALQGVGAGGLLIGVQAIIADIVPPRERGRFMGVISAAFGLA 178

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH +WRW FY+N+P G +T+ V +  L +PRP         R D +G 
Sbjct: 179 SVAGPLLGGFFTDHTSWRWCFYVNVPFGLVTLAVVLKALDLPRPTAR-----GRFDVLGA 233

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  S   L+L  +WGG EY W+                 F +VE + A EP+ PPHLF
Sbjct: 234 LLLSASATCLVLLTSWGGTEYAWTDRVTLGLAAGALGTALLFLVVE-QYAAEPIIPPHLF 292

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +    V         G+  F    Y+P + Q+V G  AT SGL ++P++ GVV AS+ +G
Sbjct: 293 RDSVFVVTGLIGAVVGVGLFGAASYLPTFLQMVDGAGATESGLLMLPMMGGVVAASLVAG 352

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT    Y+ L + G AL A G  L++  D  +GR     +M          +   +
Sbjct: 353 QLVSRTGH--YKLLPVLGCALAAEGMYLLSHLDAGTGRLVYSLWMAVLGTGIGLSLPVLI 410

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           L  Q  V   D+ + T+   FFR IG   G A+ GT+F++ L + +   A  P  AG   
Sbjct: 411 LAVQNSVHPADLGTATSANNFFRQIGGSVGAAVFGTLFAHRLAHRLA--AELPRRAGLPD 468

Query: 421 ASA---TVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKP 471
           A +    +V+ LP  +R   + AY  A+   F   +P+ +L FL + F+   KP
Sbjct: 469 ADSLTPGLVHALPAALRDGYVRAYADAMPRIFLYLVPVFVLGFLLA-FLLKEKP 521



>gi|111220691|ref|YP_711485.1| integral membrane multidrug-efflux transport protein [Frankia alni
           ACN14a]
 gi|499921699|ref|WP_011602433.1| multidrug MFS transporter [Frankia alni]
 gi|111148223|emb|CAJ59893.1| Putative integral membrane multidrug-efflux transport protein
           (partial) [Frankia alni ACN14a]
          Length = 593

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 168/485 (34%), Positives = 260/485 (53%), Gaps = 19/485 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I  D      ++WV TAYLL  T   P +GK  D++GRK  F  +++ F 
Sbjct: 46  QTIVSTALPTIVGDLGGATHLSWVVTAYLLASTVSTPVWGKLGDLYGRKILFQVSIVLFL 105

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS+L G   +M  +I FRA+ G+GGGG++   M IISD+V  +DRG+YQ          
Sbjct: 106 VGSVLAGACTSMGQLIGFRALQGLGGGGLMIGAMTIISDLVPPRDRGRYQGLFGAVFGVS 165

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG F DH++WRW FY+NLP+GA+ ++V    L +P    +   ++K  IDY+G
Sbjct: 166 SVIGPLLGGLFVDHLSWRWVFYVNLPVGAVALVVTA--LALP----ATTNRIKHVIDYLG 219

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
           T+++ G+T +L+L  + GG  Y W SP               F   E + A+EPV P  L
Sbjct: 220 TVLLAGATTSLVLLTSLGGTTYGWGSPEIIGLGVAGAVLLVAFVFAERR-AVEPVLPLSL 278

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+           F  G A F  + ++PL+ QVVKG   T SGL+++P++ G++++S+ S
Sbjct: 279 FRNRVFSAAGAIGFVVGFAMFGAIVFLPLFLQVVKGVDPTESGLQMLPVMGGLLLSSIIS 338

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G+ +S+  +  Y+   + G A++ IG  L++    +         M          MQ  
Sbjct: 339 GRLISQWGR--YKVFPIVGTAVMTIGLFLLSFISPDIATWQLALSMFVLGVGIGSVMQVL 396

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN----IAIPPEL 415
           ++  Q  V+++ +   T+   FFR IG  FG A+ G IF+NVL  NI      + +PP L
Sbjct: 397 VIAVQNSVDHRQMGVATSGATFFRSIGGSFGTAVFGAIFANVLAGNISERLAGLPLPPGL 456

Query: 416 AGA-VKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLR 474
           A +    S  V++ LP  IR   + A+  +++T F   +PIG++ F  +  +    P +R
Sbjct: 457 AASGANISPKVIDALPPAIRDGFVQAFSDSMQTVFLVAVPIGLVAFALTWLL----PEIR 512

Query: 475 TTDTV 479
              TV
Sbjct: 513 MRHTV 517



>gi|490029870|ref|WP_003932347.1| MFS transporter [Mycobacterium vaccae]
 gi|403651151|gb|EJZ06314.1| EmrB/QacA family drug resistance transporter [Mycobacterium vaccae
           ATCC 25954]
          Length = 685

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/467 (34%), Positives = 245/467 (52%), Gaps = 10/467 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRK  F  AV+ F 
Sbjct: 43  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIVTAIVGKLGDMFGRKVIFAVAVLFFL 102

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS++CG++ +M  ++  RA+ G+GGG ++     +I +++ L+DRG+YQ          
Sbjct: 103 AGSVMCGISSSMEMLVASRALQGIGGGALMVTSAALIGEVIPLRDRGRYQGALGAVFGVT 162

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FTDH++WRW+F+IN+P+G + ++VA  L  IP    +L ++ K  ID+ G
Sbjct: 163 TVIGPLLGGYFTDHLSWRWAFWINVPIGIVVLVVA--LTTIP----ALSRRGKPVIDFAG 216

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
             ++      L L  +WGG  Y WSSP               F  VE + A EP+ P  L
Sbjct: 217 IALIGVGASGLTLATSWGGGTYAWSSPTIIGLFVGSVIALALFVRVELR-AAEPILPIRL 275

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F       C   +F  G A    + ++P + Q V G SAT SGL  +P++ G+++ S+ S
Sbjct: 276 FASPVFTVCCILSFIVGFAMLGALTFLPTFMQFVDGVSATESGLRTLPMVGGLLLTSMGS 335

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           G  VSRT +  Y+   +TG A++ +G  L++  D ++    Q  Y+          MQ  
Sbjct: 336 GVLVSRTGR--YKIFPVTGTAVMVLGFVLLSQMDASTPLLQQSAYLFVLGIGIGMCMQVL 393

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV 419
           +L  Q  V++ D+   T+ + FFR IG+ FG AI G++F+N L   I             
Sbjct: 394 ILVVQSTVKFSDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLHVRIATALAAGGAPPQA 453

Query: 420 KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
             S  V++QLP E+  P+++AY  +L   F    P+  + F+ +L +
Sbjct: 454 AESPQVLHQLPPEVAAPIVTAYADSLGLVFLCAAPVAAIGFVVALML 500



>gi|493652523|ref|WP_006604011.1| transporter [Streptomyces auratus]
 gi|396995717|gb|EJJ06727.1| exporter [Streptomyces auratus AGR0001]
          Length = 509

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 166/467 (35%), Positives = 246/467 (52%), Gaps = 11/467 (2%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV TA+P I  +   +D ++WV TAY L   A  P +GK  D++GRK  FL +++ F IG
Sbjct: 19  IVGTAMPTIVGELGGMDHLSWVVTAYTLATAASTPIWGKLGDMYGRKGVFLSSIVLFLIG 78

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 79  SALSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMMAGVMAVAMI 138

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG+ TDH+ WRWSFYINLPLGAI +++   +L +P+ +        RIDY+G  +
Sbjct: 139 GGPLVGGSITDHLGWRWSFYINLPLGAIALVMVTAVLHLPKKRSQ-----TRIDYVGAAL 193

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     +L+L   WGG EY W S                F LVE K++ EPV P H+F+ 
Sbjct: 194 LTLGITSLVLITTWGGTEYDWLSGQIIGLGVLGLVALALFVLVERKVS-EPVLPLHIFRN 252

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F  + ++PL+ Q V+G SAT SGL L+P++L ++  S+ +G+ 
Sbjct: 253 GNFSLVTVIGFLVGFVMFGSMTFLPLFQQTVQGASATNSGLLLLPMLLAMMAVSLFAGRV 312

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            ++T K  Y+   + G  LI  G  L++L D  + R     YM          MQTT+L 
Sbjct: 313 TTKTGK--YKIFVVVGGGLITAGLALLSLMDTGTTRFTSGVYMAVLGAGMGFLMQTTMLI 370

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSN-VLTNNIENI-AIPPELAGA-V 419
            Q  V+ KD+   ++    FR IG  FGVAI G IF++ V T  +E I A   ++ GA  
Sbjct: 371 AQNSVQMKDMGVGSSSATLFRTIGGSFGVAIFGAIFTHQVQTTMVERIGAAGAKVTGAGA 430

Query: 420 KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           +     + +LP  I+     A        F     + I+ F A+ F+
Sbjct: 431 QMDPKGLAKLPPAIKDAYDHAVAAGTHHVFLWGAAVSIIGFAAAWFL 477



>gi|345566691|gb|EGX49633.1| hypothetical protein AOL_s00078g122 [Arthrobotrys oligospora ATCC
           24927]
          Length = 612

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 152/481 (31%), Positives = 244/481 (50%), Gaps = 9/481 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALPAI  D       +WV ++YL+  +AF P++GKFSDI+GRK   +   + F 
Sbjct: 89  QTIVSTALPAIIEDLGGNVAYSWVGSSYLIASSAFIPSWGKFSDIWGRKPIIMVGSVIFM 148

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS+L   A +M T+I  R I G GGGGI+ LV I +SDIV++++RGKY           
Sbjct: 149 VGSILTAAAKDMGTLIAGRTIQGFGGGGIMVLVNITVSDIVTMRERGKYLAAVGATWAIS 208

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P++GGAF  H +WRW F IN+P+G I ++V  + L +  PK  +++ LK++D++G+
Sbjct: 209 SAIGPIIGGAFATHASWRWCFIINIPIGLIAMVVIWYFLHLHSPKIGVMEGLKQVDWLGS 268

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +  VG T   L+ ++ GG   PW+SP                  +E K+   P+ PP +F
Sbjct: 269 LFAVGGTTLFLVGIDSGGVTEPWNSPLVLSCLIIGSTMLVSLIFIEWKVTANPIMPPRVF 328

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                +  +   F     F +  +Y+PLYFQ   G +   SG+  +P +  + I S+ +G
Sbjct: 329 GHKTALASYVICFLHAQTFIAGAFYLPLYFQSALGKTPLMSGVLNLPFVFMLSIGSMGTG 388

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             +++T    YR +   G   +A G+G    WD  S     + +            Q+ L
Sbjct: 389 IVIAKTGN--YRPIMRIGLVFMAAGAGAFVDWDRTSSMVKIVFFQFIAGFGLGPNFQSPL 446

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI--AIPPE---- 414
           +     ++  D+A  T    F R +    GV++   IF+N     I +I  ++ PE    
Sbjct: 447 IAIHSTIQPADIAVATGAFAFIRNLACAIGVSVGNVIFANEFNRRIPSIMQSLSPETVRL 506

Query: 415 LAGAVKASAT-VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSL 473
           ++G   AS+T  V++LP   R P+  AY  +L   +   + + +   L SL +G H  S 
Sbjct: 507 ISGNGGASSTGAVSRLPANERIPIQDAYAESLSVMWWYFVGVSVAALLFSLLVGKHTLST 566

Query: 474 R 474
           +
Sbjct: 567 K 567



>gi|353244942|emb|CCA76069.1| probable DHA14-like major facilitator; ABC transporter
           [Piriformospora indica DSM 11827]
          Length = 584

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 175/481 (36%), Positives = 237/481 (49%), Gaps = 18/481 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP +AS F ALD++ WV +AY LT       +G+   I   K  +L  ++ FE
Sbjct: 94  QTIVATALPKLASQFNALDELTWVVSAYFLTQAGLMLAFGQVLTIAPAKWVYLTCIVLFE 153

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+C LAP+M  +I  RA  GVG  G+   ++ I+S I  L+ R              
Sbjct: 154 IGSLICALAPSMNVLIFGRAFQGVGASGMFISILTILSQITKLEQRPLLFGSFGGVFALA 213

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLL-------QKLK 173
               PL+GGA TDH TWRW FYINLP GA++V  A        P  + L       QK  
Sbjct: 214 SVAGPLMGGALTDHATWRWCFYINLPFGAVSVAAAFLFQPSNPPPPNPLYEGKTTAQKWL 273

Query: 174 RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP 233
            +D++G  + VG  I LLLPL WGG   PW+                 F   E       
Sbjct: 274 SLDWVGAFISVGMIICLLLPLQWGGVTRPWNDKVVIILFVVFAVLLGAFLTWEFFQGERA 333

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
           + P   FK    VG         + F S  YY+P ++Q  KG +A+ SG+++IP +L  +
Sbjct: 334 MLPLGFFKNRTQVGGGIAIMLMMIPFLSATYYLPFFYQ-AKGRTASQSGIDIIPFMLSAI 392

Query: 294 IASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXX 353
           +AS  SG  V+ T    Y T+ + G  + ++G+GL+    E       I Y         
Sbjct: 393 LASFVSGGIVNGTGH--YLTMLLVGPLVSSVGAGLLFTITEYMSSKQLIGYQILFGVGLG 450

Query: 354 XXMQTTLLCGQGIVEYKD----VASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI 409
              Q  L+  Q   EY D    +   ++LL F +LIG V G+AI GTIF+N L   +   
Sbjct: 451 VAFQIPLMAIQA--EYADKPELIPQASSLLSFLQLIGGVIGIAISGTIFNNKLNTELATY 508

Query: 410 A--IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMG 467
           A  +PPE    VK S TV+  LP E++G V+ AYV AL   F  DIP  IL  +A  F+ 
Sbjct: 509 ASGLPPETLELVKQSVTVIFMLPKEMQGMVVHAYVKALDYVFILDIPACILATVAGAFVR 568

Query: 468 N 468
           N
Sbjct: 569 N 569



>gi|386839924|ref|YP_006244982.1| multidrug-efflux transporter [Streptomyces hygroscopicus subsp.
           jinggangensis 5008]
 gi|474982135|ref|YP_007692601.1| multidrug-efflux transporter [Streptomyces hygroscopicus subsp.
           jinggangensis TL01]
 gi|504485339|ref|WP_014672441.1| DSBA oxidoreductase [Streptomyces hygroscopicus]
 gi|374100225|gb|AEY89109.1| multidrug-efflux transporter [Streptomyces hygroscopicus subsp.
           jinggangensis 5008]
 gi|451793218|gb|AGF63267.1| multidrug-efflux transporter [Streptomyces hygroscopicus subsp.
           jinggangensis TL01]
          Length = 679

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 174/460 (37%), Positives = 246/460 (53%), Gaps = 13/460 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 40  QTIVSTALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKRLFQTAIVIFL 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A +M  +I FRA+ G+GGGG++ L M I+ D+V  ++RG+YQ          
Sbjct: 100 IGSALCGMARDMPQLIAFRALQGLGGGGLMVLSMAIVGDLVPPRERGRYQGLFGAVFGTT 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FY+NLP+G I + V    LRIPR     +     IDY+GT
Sbjct: 160 SVLGPLLGGLFTEHLSWRWVFYVNLPIGVIALAVIATALRIPRRTAHHV-----IDYLGT 214

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  +PW S                F  VE + A EPV P  LF
Sbjct: 215 FLIAAVATCLVLVASLGGTTWPWGSAQIIGLAVLGVVLAVAFVAVERR-AAEPVLPLGLF 273

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV G S T SG+ ++P++ G++++S  SG
Sbjct: 274 RIRTFTLAAVISFIVGFAMFGALTYLPTFLQVVHGISPTLSGVHMLPMVFGLLLSSTLSG 333

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   +TG A+  +G  L+   DE+S  A                MQ  +
Sbjct: 334 QIVSRTGR--WKVFPITGTAVTTLGLLLLHRLDEHSSTAVMSVCFFVFGTGLGLVMQVLV 391

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFS----NVLTNNIENIAIPP-EL 415
           L  Q  V Y+D+   T+   FFR IGA FGVAI GT+F+    + LT+    + +PP   
Sbjct: 392 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAIFGTVFASRLGDKLTDAFRGVRLPPGAT 451

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPI 455
            GA+KA    +  LP  +R   + AY  A+   F    P+
Sbjct: 452 PGALKADPRGIAALPPPLRPAALHAYASAITDVFLYAAPV 491



>gi|269793916|ref|YP_003313371.1| EmrB/QacA subfamily drug resistance transporter [Sanguibacter
           keddieii DSM 10542]
 gi|502628955|ref|WP_012865606.1| MFS transporter [Sanguibacter keddieii]
 gi|269096101|gb|ACZ20537.1| drug resistance transporter, EmrB/QacA subfamily [Sanguibacter
           keddieii DSM 10542]
          Length = 528

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 165/486 (33%), Positives = 245/486 (50%), Gaps = 12/486 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP +  +   ++ +AWV TAY+L MT   P YGK  D+ GRK  FLFA+  F 
Sbjct: 38  QTIVGTALPTVVGELDGVNHMAWVVTAYVLAMTIAMPVYGKVGDLVGRKKLFLFAIAVFL 97

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS LCG+A +M  +I FRA+ G+GG G++     I++D+V  ++R KY           
Sbjct: 98  LGSALCGVAQDMVQLIGFRALQGLGGAGLMITSQAILADLVPARERAKYMAPMGAVFGVA 157

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG  TD V WRW F++NLPLG     VA  ++ +PR   +      RIDY+G 
Sbjct: 158 SVAGPLLGGWLTDSVDWRWIFWVNLPLGVAAFAVAATMIHLPRRTST-----ARIDYLGI 212

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
             +  +   ++L   WGG EY WSSP               F +VE + A EP+ P  LF
Sbjct: 213 ATMAVAVTGIVLVCTWGGTEYAWSSPTILGLGAVGVLATAAFLVVEHR-AAEPIIPLALF 271

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +    V   T   F G   F  + Y+P + Q+  G +AT SGL LIP+ +G++  S+ SG
Sbjct: 272 RNRTFVVATTLGLFVGAGMFGALAYMPTFLQMAYGVNATESGLLLIPMTVGMLAGSLFSG 331

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             VS+T +  YR   + G  + A    L++   + +G       +           Q  +
Sbjct: 332 AMVSKTGR--YRVYPVVGTVIAAAAMLLLSRVSDQTGLWSVCGILALMGLGIGLFFQLLV 389

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPE---LAG 417
           L  Q  V  +++ + T+   FFR IG   G AI+GT+F++ LT+ + ++    E   L G
Sbjct: 390 LTVQNAVPPREIGTATSSNNFFREIGVTLGTAILGTVFASRLTSGLADVLSGTEGLDLPG 449

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTD 477
           A   +  +V  LP  ++  V+ AY  AL   F   +P+ +   + +LF+  H P     D
Sbjct: 450 ATSLTPAIVRSLPDAVQSGVVDAYTDALIPLFAFLVPMFLAGSVVALFL-PHIPLAGKAD 508

Query: 478 TVVAFE 483
              A E
Sbjct: 509 VEGALE 514



>gi|291303668|ref|YP_003514946.1| EmrB/QacA subfamily drug resistance transporter [Stackebrandtia
           nassauensis DSM 44728]
 gi|502786448|ref|WP_013021424.1| multidrug MFS transporter [Stackebrandtia nassauensis]
 gi|290572888|gb|ADD45853.1| drug resistance transporter, EmrB/QacA subfamily [Stackebrandtia
           nassauensis DSM 44728]
          Length = 535

 Score =  265 bits (677), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 170/489 (34%), Positives = 256/489 (52%), Gaps = 28/489 (5%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP I  D   L++ AWV TAYLL  TA  P YGK SD++GR+   L A++ F 
Sbjct: 32  QTIVGTALPTIVGDLGGLNEYAWVVTAYLLAATASTPLYGKLSDLYGRRPILLSAIVIFL 91

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSLL G++ NM  +I FR + G+G GG+++L   ++SD+VS ++RG+YQ          
Sbjct: 92  VGSLLAGMSQNMMQLIFFRGLQGLGAGGLMTLAFTVVSDVVSPRERGRYQGFFGAVFGFS 151

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG   D V WRW FYINLP G + +++   +L++ + +    ++  +IDY+G 
Sbjct: 152 SVAGPLLGGWLAD-VDWRWIFYINLPGGIVALVMIDRMLKLVKTE----RRQHKIDYVGA 206

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
             +V S + LLL  +WGG EY W SP               F  VET+ A EP+ P  LF
Sbjct: 207 AFLVASVVCLLLATSWGGKEYDWDSPVIIGLFVAGGVLAAIFLFVETR-AEEPILPLRLF 265

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           KR         +   G+A F  + YVPLY Q+V+G S T SGL ++P++LG+VI S+ SG
Sbjct: 266 KRGTFSLANAGSLVLGVAMFGGIIYVPLYLQIVRGYSPTESGLLMLPMMLGIVITSIVSG 325

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           +A+S   +  Y+   + GA L+  G  L T    ++      C+M          MQ  +
Sbjct: 326 RAISAIGR--YKWFIVVGAVLVTTGLALFTQLHTDTPLWQTFCFMAVLGVGLGLFMQPLV 383

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN------IAIPPE 414
           L  Q  V  KD+ + T+   FFR +G  FGVA +G + +  +  ++          +PPE
Sbjct: 384 LAVQNSVAPKDLGAGTSTATFFRSLGGAFGVAAMGAVMTAQVAESMSTSIPEAVKQLPPE 443

Query: 415 LA-------------GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFL 461
            A             G ++  A+++  LP  +R  +  A+V  L   F     I  L  +
Sbjct: 444 QAKEFAEKSHTAGADGIMQDPASIL-ALPAPLRDAIQQAFVTGLDQIFIVAACIAALAVV 502

Query: 462 ASLFMGNHK 470
            ++ + N++
Sbjct: 503 IAVLLPNYE 511



>gi|490051799|ref|WP_003954136.1| DSBA oxidoreductase [Streptomyces clavuligerus]
 gi|197702857|gb|EDY48669.1| integral membrane transport protein [Streptomyces clavuligerus ATCC
           27064]
 gi|294325001|gb|EFG06644.1| Putative permease of the major facilitator superfamily
           [Streptomyces clavuligerus ATCC 27064]
          Length = 683

 Score =  265 bits (677), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 177/470 (37%), Positives = 254/470 (54%), Gaps = 12/470 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 42  QTIVSTALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKKLFQTAIVIFL 101

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A +M  +I FRA+ G+GGGG++ L M I+ DIVS ++RGKYQ          
Sbjct: 102 IGSALCGIAQDMPQLIGFRALQGLGGGGLMVLSMAIVGDIVSPRERGKYQGLFGGVFGAS 161

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTD+++WRW FYINLP+GA+ ++V   +L IP     +      IDY+GT
Sbjct: 162 SVLGPLLGGFFTDNLSWRWVFYINLPIGAVALLVIAAVLHIP-----VRSTPHTIDYLGT 216

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  + W SP               F  VE + A EPV P  LF
Sbjct: 217 FLIAAVATCLVLVASLGGTTWAWDSPQIIGLTLLGLILLAVFIPVERR-AAEPVLPLRLF 275

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV G + T SG+ ++P++ G+++AS +SG
Sbjct: 276 RIRTFTLVAVISFIVGFAMFGAMTYLPTFLQVVHGITPTLSGVHMLPMVAGLLLASTASG 335

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G  + AIG  L+    E S       Y+          MQ  +
Sbjct: 336 QIVSRTGR--WKVFPILGTGITAIGLLLLHRLTEYSTTWEMSVYLFVFGTGLGLVMQVLV 393

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSN----VLTNNIENIAIPPELA 416
           L  Q  V Y+D+   T+   FFR IGA FGVA+ GTIFSN    +L + +    +P   A
Sbjct: 394 LVVQNSVRYEDLGVATSGATFFRSIGAAFGVAVFGTIFSNGLRGLLADALAGRPVPAGAA 453

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
             + A    + +LP  +R PV  A+  A+   F   +P+ +L F+ + F+
Sbjct: 454 AEIAADPKAIAKLPPGLRMPVKHAFAEAITNVFLDAVPVVLLAFVVAWFL 503



>gi|54023068|ref|YP_117310.1| transporter [Nocardia farcinica IFM 10152]
 gi|499520991|ref|WP_011207631.1| MFS transporter [Nocardia farcinica]
 gi|54014576|dbj|BAD55946.1| putative transporter [Nocardia farcinica IFM 10152]
          Length = 678

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 168/488 (34%), Positives = 243/488 (49%), Gaps = 19/488 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I +D      +AWV TAYLL         GK  D+FGRK  F  + + F 
Sbjct: 38  QTIVSTALPTIVADLGGAGHMAWVVTAYLLAEAVATALAGKLGDLFGRKLVFQLSGLIFI 97

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+L GLA  M  +I+ R + G+G GG++   M +I+DI+ L++RGKYQ          
Sbjct: 98  AGSMLAGLANGMLLLILARGVQGIGAGGLMVTSMALIADIIPLRERGKYQGALGAVFGVT 157

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P LGG FTDH  WRW FY+N+PL  + ++ A     IPR + +       +DY G 
Sbjct: 158 TVVGPTLGGLFTDHAGWRWCFYVNVPLAILMILAAA--RTIPRVRAA---AKPIVDYAGI 212

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V      L+L L WGG EY W S                F  VE++ A EP+ P  LF
Sbjct: 213 GLVALGVSCLILGLEWGGQEYAWGSWQILGLFAAAVVLLAGFVAVESR-AAEPMLPMRLF 271

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C   +F  G A    + Y+P Y Q V G SAT SG+  +PL+ G+ + S+ SG
Sbjct: 272 RSNVFTVCSILSFIVGFAMLGAMTYLPAYLQYVDGISATMSGVRTLPLVAGLFLTSIISG 331

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q V RT +  YR   + G A++A+G  L++     +    +  YM          MQ   
Sbjct: 332 QVVGRTGR--YRYFPIAGTAVMALGLLLMSTMGRETSTWLESLYMLILGLGIGLAMQVLT 389

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI-----ENIAIPPEL 415
           +  Q  V Y D+ + T+ + FFR +G+ FG A+ GT++SN LT N+     E   + PE 
Sbjct: 390 IVVQNTVPYADLGTATSGVTFFRTLGSAFGTAVFGTLYSNQLTPNLTAALTEVRVVSPEA 449

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRT 475
           A    A    +  LP E   P+I AY  ++   F   +P+ ++ F+ + F+   +  LR 
Sbjct: 450 A----ADPETLRGLPAEQAVPIIDAYAMSIEHVFRWVVPVALIGFVVAWFL--KEVPLRD 503

Query: 476 TDTVVAFE 483
           +    A E
Sbjct: 504 SARTAAGE 511



>gi|452981657|gb|EME81417.1| hypothetical protein MYCFIDRAFT_81471 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 506

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 163/470 (34%), Positives = 240/470 (51%), Gaps = 11/470 (2%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TI++TA+P I  DF+ALD + W A++Y+LT++AFQ  YGK    F +K  FL A   FEI
Sbjct: 22  TIISTAIPRITDDFQALDDVGWYASSYMLTLSAFQLFYGKLYTFFSKKWIFLMAFAWFEI 81

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GS +CG APN T +I+ RAIAG G  G+ S  ++II++   L  R  Y            
Sbjct: 82  GSAICGAAPNSTCLIVGRAIAGFGSAGLFSGALLIIANSAPLAKRPTYIGIVGSMYGLAS 141

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIP-RPKGSLLQ-----KLKRI 175
              PL+GGAFTDH++WRW FYINLP+GA+TV+  +   +   R +  +LQ     + K+ 
Sbjct: 142 VTGPLMGGAFTDHLSWRWCFYINLPIGAMTVLFIVLCYKESHRSRAQVLQTSWKARAKQF 201

Query: 176 DYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVA 235
           D  G  + +   I LLL + WGG+ YPWS                 F  V+         
Sbjct: 202 DLEGLAIFLPMVICLLLAMQWGGSTYPWSDGRIIALLTLFAVALVAFIGVQIWKKDNATV 261

Query: 236 PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIA 295
           P  + K+  +       F  G +FF L YY+P++FQ +KG S   SG+  IP++L VV++
Sbjct: 262 PLRVLKQRSIAAASWFAFTLGASFFILTYYIPIWFQAIKGASPVKSGINNIPMVLAVVLS 321

Query: 296 SVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           S  +G AV+      Y   ++  + L+AIG+GL+T W+ N+G A  I Y           
Sbjct: 322 STPTGIAVTYIGY--YTPFAILSSILLAIGTGLLTTWETNTGSAEWIGYQILCGLGVGFG 379

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI--AIPP 413
            Q T+L  Q  +   DV   TA+++FF+ +G    V+    IF+N L + I  +   + P
Sbjct: 380 FQQTMLAAQTCLPKADVPIGTAIVVFFQTLGGALFVSAANNIFNNKLLSGIAGVVPGLSP 439

Query: 414 ELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLAS 463
           +      A+A + N +P      V+  Y  AL   F     +G    L S
Sbjct: 440 QTILETGATA-LRNVIPDGYLPAVLEIYNDALVGTFYVATALGAFSILGS 488



>gi|108799722|ref|YP_639919.1| EmrB/QacA family drug resistance transporter [Mycobacterium sp.
           MCS]
 gi|119868832|ref|YP_938784.1| EmrB/QacA family drug resistance transporter [Mycobacterium sp.
           KMS]
 gi|499879415|ref|WP_011560149.1| MFS transporter [Mycobacterium sp. KMS]
 gi|108770141|gb|ABG08863.1| Drug resistance transporter EmrB/QacA subfamily [Mycobacterium sp.
           MCS]
 gi|119694921|gb|ABL91994.1| drug resistance transporter, EmrB/QacA subfamily [Mycobacterium sp.
           KMS]
          Length = 682

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 164/483 (33%), Positives = 243/483 (50%), Gaps = 10/483 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRK  F  AV+ F 
Sbjct: 42  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIVTAIVGKLGDMFGRKTVFQAAVVFFL 101

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCGLA +M  ++  RA+ GVGGG ++   M +I +++ L+DRG+YQ          
Sbjct: 102 AGSVLCGLAGSMGMLVAARALQGVGGGALMVTAMALIGEVIPLRDRGRYQGALGAVFGVT 161

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW+F+IN+P+G    IV  F+     P  S + + K IDY G 
Sbjct: 162 TVIGPLLGGFFTDHLSWRWAFWINVPVG----IVVFFVAAAAIPALSRVGRAK-IDYAGI 216

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           + V      L L  +WGG EY W+SP               F  VE + A EP+ P  LF
Sbjct: 217 VFVGLGASGLTLATSWGGAEYAWTSPVIIGLFVASALALAVFIQVERR-AAEPILPMRLF 275

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + ++P + Q V G SAT SGL  +P++ G++I S  SG
Sbjct: 276 ASPVFTVCCILSFIVGFAMLGALTFLPTFMQFVDGVSATESGLRTLPMVAGLLITSTGSG 335

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             V RT +  Y+   + G A++ +   L++  D  +    Q  Y+          MQ  +
Sbjct: 336 AIVGRTGR--YKIFPVLGTAIMTVAFVLLSRMDATTHLLQQSLYLFILGTGIGLCMQVLV 393

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           L  Q    ++D+   T+ + FFR IG+ FG AI G++F+N L + I    +         
Sbjct: 394 LTVQNTATFEDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLDDRIGAALLSSGAPPVAA 453

Query: 421 ASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTDTVV 480
            S   +++L  ++  P++ AY  +L   F    PI  + FL +L +   +  LR  +T  
Sbjct: 454 ESPQALHRLAPDVAAPIVDAYADSLGLVFLCAAPIAAVGFLVALLL--KEVPLREMETGA 511

Query: 481 AFE 483
           A +
Sbjct: 512 AVD 514



>gi|189193587|ref|XP_001933132.1| MFS transporter [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187978696|gb|EDU45322.1| MFS transporter [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 586

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 169/474 (35%), Positives = 249/474 (52%), Gaps = 13/474 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I  DFKAL+ + W  ++YLLT  A Q  YGK    F  K  +L A+  FE
Sbjct: 103 NTIIATAIPRITDDFKALNDVGWYGSSYLLTTCATQLFYGKLYTFFSIKWVYLIALFIFE 162

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+APN   +II RAI+GVG  GI S  ++IIS  V L+ R  Y           
Sbjct: 163 LGSLICGVAPNSIALIIGRAISGVGAAGIFSGAILIISVTVPLRQRPTYMGLIGGMYGIA 222

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP----KGSLLQKLKRID 176
               PL+GGAFTDH++WRW FYINLP GA+T    +  L + R     + +  Q+L++ D
Sbjct: 223 SVAGPLMGGAFTDHLSWRWCFYINLPFGAVTAAFIVPFLNVKRRGAKVQATWKQQLQKFD 282

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
             GT   + + I LLL L WGG++Y W S                F  ++     +   P
Sbjct: 283 LPGTACFLPAIICLLLALQWGGSKYAWGSARIIVLLVLFVLLVCGFIAIQWWKQEDATVP 342

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P +F   +V G        G AFF +VYY+P++FQ VKG SAT SG+  +P ILG+VI S
Sbjct: 343 PRVFLNRNVWGSAWFGAMLGAAFFLIVYYLPIWFQAVKGASATKSGIMNLPAILGLVIIS 402

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + +G AV+      Y    +  + L+AIG+GL++  +  SG A  I Y           M
Sbjct: 403 MLAGGAVTTLGY--YTPFMLLSSVLMAIGAGLLSTLEVGSGSALWIGYQFIFGAGVGFGM 460

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELA 416
           Q TL+  Q ++   D+   TA++MF + +G    +++   +F+N L  N+ ++   PEL 
Sbjct: 461 QQTLVAVQTVLPVDDIPIGTAIMMFCQTLGGALFISVGQNVFTNQLIKNLSSVV--PELN 518

Query: 417 GAVKAS--ATVVNQL--PIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
             +  S  AT +  +  P  + G V++AY   L   F   +  G +  + + F+
Sbjct: 519 AHIVLSVGATELKHVIDPRFLPG-VLTAYNTTLTQTFYVSVACGAMSIVGAAFV 571



>gi|302881493|ref|XP_003039659.1| hypothetical protein NECHADRAFT_55819 [Nectria haematococca mpVI
           77-13-4]
 gi|256720522|gb|EEU33946.1| hypothetical protein NECHADRAFT_55819 [Nectria haematococca mpVI
           77-13-4]
          Length = 507

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 168/473 (35%), Positives = 249/473 (52%), Gaps = 14/473 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+A A+P I   F  L+ + W A+AYLLT  A Q  +GK   +F  K  FL A+  FE
Sbjct: 23  NTIIAVAIPHITDQFHNLNDVGWYASAYLLTTCALQLLFGKLYALFSVKIVFLSALFVFE 82

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+AP  T +II RAIAG+G  GI +  ++ I+  V+ + R  +           
Sbjct: 83  LGSLICGIAPTSTALIIGRAIAGLGSAGIFTGALVTIAHTVAREKRPIFFGLLGGMYGIA 142

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIP-RP---KGSLLQKLKRID 176
               PL+GGAFTDH +WRW FYINLPLG +T  V + +L++P +P   + S LQ LK +D
Sbjct: 143 SVAGPLMGGAFTDHASWRWCFYINLPLGGVTAAVILLILKLPAKPASKRASFLQVLKGLD 202

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            IGT V + S I LLL L WGG +Y WS+                F  V+  +  +   P
Sbjct: 203 PIGTAVFIPSIICLLLALQWGGVKYQWSNARIIVLFVLFGALLVGFVAVQLIMKDDATVP 262

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P +     +       F  G +FF L YY+P++FQV+K  SA  SG+  +P+IL  V+  
Sbjct: 263 PRIAGNRTIASAALFGFCIGGSFFILTYYIPIWFQVIKNTSAVRSGIYSLPMILANVVGI 322

Query: 297 VSSGQAVSRTDKFA-YRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
           V +G   S T KF  Y    +  A +++IG+GLIT +  ++ +A  + Y+          
Sbjct: 323 VGAG---SLTTKFGHYAPFFIASAVIMSIGAGLITTFTVHTAQAKWVGYLFIYGFGVGLG 379

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIP--- 412
            Q   +  Q ++  KDV+  TA++MF +++G    V++   +F+N L NN+  + IP   
Sbjct: 380 FQQGGVAAQAVLPLKDVSIGTAMVMFVQMLGGALFVSVAQNLFTNQLVNNLMALDIPDLH 439

Query: 413 PELAGAVKASATVVNQL-PIEIRGPVISAYVGALRTAFTADIPIGILCFLASL 464
           PE    V A AT +  +   E    V++AY  AL   F   + +  L  L +L
Sbjct: 440 PE--AIVHAGATSLRSMIDPEALPEVLTAYNMALVKTFQLALIMSCLSILGAL 490



>gi|479320134|ref|YP_007860185.1| putative exporter [Streptomyces sp. PAMC26508]
 gi|505390584|ref|WP_015577686.1| putative exporter [Streptomyces sp. PAMC26508]
 gi|478747121|gb|AGJ55701.1| putative exporter [Streptomyces sp. PAMC26508]
          Length = 529

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 153/432 (35%), Positives = 232/432 (53%), Gaps = 7/432 (1%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV TA+P I  D   L+ ++WV T+Y L   A  P +GK  D++GRK  FL +++ F +G
Sbjct: 39  IVGTAMPTIVGDLGGLEHLSWVVTSYTLATAASTPIWGKLGDLYGRKGIFLTSIVVFLVG 98

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S+L G+A +M  +I FRA+ G+G GG++  VM I+ D+V  ++RGKYQ            
Sbjct: 99  SVLSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAILGDLVPPRERGKYQGMMAGVMAFAMI 158

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GGA TDH+ WRWSFYINLPLGAI + +   +L +PR +    +   +IDY+G  +
Sbjct: 159 GGPLVGGAITDHLGWRWSFYINLPLGAIALAMVTTVLHLPRKE----RSEAKIDYLGAAL 214

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     A++L   WGG+EY W S                F  VETK A EP+ P H+F+ 
Sbjct: 215 LTVGITAIVLVTTWGGSEYAWDSAVIMELIALGVASLVGFVFVETK-AAEPIMPLHIFRN 273

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F  V ++PLY Q V+G SAT SGL L+P++L ++I S+ +G+ 
Sbjct: 274 RNFSLMSVVGFMAGFVMFGAVLFLPLYQQTVQGASATNSGLLLLPMLLAMMIVSLVAGRV 333

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T K  Y+   + G+ L+  G  L+   D  + R     YM          MQ T+L 
Sbjct: 334 TTSTGK--YKIFPILGSILMVAGLFLLATMDTGTTRFTSGVYMAVLGAGMGFLMQITMLV 391

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR +G+ FGVAI+G +F+  + + +           + +  
Sbjct: 392 AQNSVELKDMGVASSATTLFRTLGSSFGVAIMGALFTGRVQDEMAARGGGGATEKSAQLD 451

Query: 423 ATVVNQLPIEIR 434
           A+ + +LP  +R
Sbjct: 452 ASSLAKLPDAVR 463



>gi|126435366|ref|YP_001071057.1| EmrB/QacA family drug resistance transporter [Mycobacterium sp.
           JLS]
 gi|500181429|ref|WP_011855786.1| MFS transporter [Mycobacterium sp. JLS]
 gi|126235166|gb|ABN98566.1| drug resistance transporter, EmrB/QacA subfamily [Mycobacterium sp.
           JLS]
          Length = 682

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 164/483 (33%), Positives = 243/483 (50%), Gaps = 10/483 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRK  F  AV+ F 
Sbjct: 42  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIVTAIVGKLGDMFGRKTVFQAAVVFFL 101

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCGLA +M  ++  RA+ GVGGG ++   M +I +++ L+DRG+YQ          
Sbjct: 102 AGSVLCGLAGSMGMLVAARALQGVGGGALMVTAMALIGEVIPLRDRGRYQGALGAVFGVT 161

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW+F+IN+P+G    IV  F+     P  S + + K IDY G 
Sbjct: 162 TVIGPLLGGFFTDHLSWRWAFWINVPVG----IVVFFVAAAAIPALSRVGRAK-IDYAGI 216

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           + V      L L  +WGG EY W+SP               F  VE + A EP+ P  LF
Sbjct: 217 VFVGLGASGLTLATSWGGAEYAWTSPVIIGLFVASALALAVFIQVERR-AAEPILPMRLF 275

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
                  C   +F  G A    + ++P + Q V G SAT SGL  +P++ G++I S  SG
Sbjct: 276 ASPVFTVCCILSFIVGFAMLGALTFLPTFMQFVDGVSATESGLRTLPMVAGLLITSTGSG 335

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             V RT +  Y+   + G A++ +   L++  D  +    Q  Y+          MQ  +
Sbjct: 336 AIVGRTGR--YKIFPVLGTAIMTVAFVLLSRMDATTHLLQQSLYLFILGTGIGLCMQVLV 393

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           L  Q    ++D+   T+ + FFR IG+ FG AI G++F+N L + I    +         
Sbjct: 394 LTVQNTATFEDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLDDRIGAALLSSGAPPVAA 453

Query: 421 ASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTTDTVV 480
            S   +++L  ++  P++ AY  +L   F    PI  + FL +L +   +  LR  +T  
Sbjct: 454 ESPQALHRLAPDVAAPIVDAYADSLGLVFLCAAPIAAVGFLVALLL--KEVPLREMETGT 511

Query: 481 AFE 483
           A +
Sbjct: 512 AVD 514



>gi|357412699|ref|YP_004924435.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           flavogriseus ATCC 33331]
 gi|503921544|ref|WP_014155538.1| transporter [Streptomyces flavogriseus]
 gi|320010068|gb|ADW04918.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces
           flavogriseus ATCC 33331]
          Length = 529

 Score =  265 bits (676), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 153/432 (35%), Positives = 232/432 (53%), Gaps = 7/432 (1%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV TA+P I  D   L+ ++WV T+Y L   A  P +GK  D++GRK  FL +++ F +G
Sbjct: 39  IVGTAMPTIVGDLGGLEHLSWVVTSYTLATAASTPIWGKLGDLYGRKGIFLTSIVVFLVG 98

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S+L G+A +M  +I FRA+ G+G GG++  VM I+ D+V  ++RGKYQ            
Sbjct: 99  SVLSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAILGDLVPPRERGKYQGMMAGVMAFAMI 158

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GGA TDH+ WRWSFYINLPLGAI + +   +L +PR +    +   +IDY+G  +
Sbjct: 159 GGPLVGGAITDHLGWRWSFYINLPLGAIALAMVTTVLHLPRKE----RSEAKIDYLGAAL 214

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     A++L   WGG+EY W S                F  VETK A EP+ P H+F+ 
Sbjct: 215 LTVGITAIVLVTTWGGSEYAWDSAVIMELIALGVASLVGFVFVETK-AAEPIMPLHIFRN 273

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F  V ++PLY Q V+G SAT SGL L+P++L ++I S+ +G+ 
Sbjct: 274 RNFSLMSVVGFMAGFVMFGAVLFLPLYQQTVQGASATNSGLLLLPMLLAMMIVSLVAGRV 333

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T K  Y+   + G+ L+  G  L+   D  + R     YM          MQ T+L 
Sbjct: 334 TTSTGK--YKIFPILGSILMVAGLFLLATMDTGTTRFTSGVYMAVLGAGMGFLMQITMLV 391

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR +G+ FGVAI+G +F+  + + +           + +  
Sbjct: 392 AQNSVELKDMGVASSATTLFRTLGSSFGVAIMGALFTGRVQDEMAARGGGGATEKSAQLD 451

Query: 423 ATVVNQLPIEIR 434
           A+ + +LP  +R
Sbjct: 452 ASSLAKLPDAVR 463



>gi|297563090|ref|YP_003682064.1| EmrB/QacA subfamily drug resistance transporter [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
 gi|502920189|ref|WP_013155165.1| DSBA oxidoreductase [Nocardiopsis dassonvillei]
 gi|296847538|gb|ADH69558.1| drug resistance transporter, EmrB/QacA subfamily [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
          Length = 676

 Score =  264 bits (675), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 172/481 (35%), Positives = 255/481 (53%), Gaps = 15/481 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAYLL +TA  P +GK  D FGRK  FL  +  F 
Sbjct: 37  QTIVSTALPTIVSDLGGLNHLSWVITAYLLAVTAVTPLWGKLGDQFGRKQFFLVCIAVFV 96

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCG A +M  +I+FRA+ GVGGGG++ L   II D+VS ++RGKYQ          
Sbjct: 97  AGSALCGTAQSMLQLILFRALQGVGGGGLMVLASAIIGDVVSPRERGKYQGLFGAVFGIS 156

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F DH++WRW FY+NLPLG +  +  + +L   +P G      + IDY G 
Sbjct: 157 SVAGPLLGGLFVDHLSWRWVFYVNLPLGVLAFVTVLVVLPRRQPTGR-----QSIDYSGI 211

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  + I L L  +WGG+ YPW+SP               + L   + A +PV P  LF
Sbjct: 212 VLLAATAICLTLVASWGGSLYPWTSPQVLGLGAVAVVLGVGWWL-SARRAQDPVMPLSLF 270

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +   +V      F  G A    + ++PL+ QVV G S T SGL L+P++LG+ + S++SG
Sbjct: 271 RDPTIVVAMAIGFCVGFAMMGSMAFLPLFLQVVHGLSPTASGLHLLPMVLGLFLTSITSG 330

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           + V+RT    Y+   + G A+ ++G  L++     S       Y           MQ  +
Sbjct: 331 RLVTRTGH--YKVYPVLGMAVTSLGLFLLSRLGPESSMTQMGFYFFVLGLGLGLVMQVVV 388

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI----ENIAIPPEL- 415
           +  Q    Y ++   T+   FFR IG  FG A+ G +FS  L  N+      I +PP + 
Sbjct: 389 VVVQNAASYANLGVATSAATFFRSIGGSFGTAVFGAVFSGQLAANLAERAAQIQLPPGVD 448

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRT 475
             A+++    ++QL  + +   + AY  A+ T F   +P+ +  F+ +LF+   +  LRT
Sbjct: 449 PAALESDPRSLDQLAPQAQASFLQAYADAVDTVFLCAVPVALAGFVLALFL--RQIPLRT 506

Query: 476 T 476
           T
Sbjct: 507 T 507



>gi|494716423|ref|WP_007452289.1| transporter [Streptomyces coelicoflavus]
 gi|371543155|gb|EHN71989.1| exporter [Streptomyces coelicoflavus ZG0656]
          Length = 532

 Score =  264 bits (675), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 151/436 (34%), Positives = 233/436 (53%), Gaps = 14/436 (3%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           I+ TA+P I  +   L+ ++WV TAY L   A  P +GK  D++GRK  F+ +++ F  G
Sbjct: 41  IIGTAMPTIVGELGGLEHLSWVVTAYTLATAASTPLWGKLGDMYGRKGVFMTSIVIFLAG 100

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRAI G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 101 SALSGMAQDMGQLIGFRAIQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMIAGVMALSMI 160

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TD+  WRWSFYIN+PLG I +I    +L +P+ +        RIDY G ++
Sbjct: 161 GGPLVGGTITDNWGWRWSFYINIPLGVIALIAISAVLHLPKKRSK-----ARIDYPGAVL 215

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     A++L   WGG EY W+S                F   +T+ A EP+ P H+F+ 
Sbjct: 216 LTVGITAIVLVTTWGGTEYAWTSARIMELIGIGVAALVGFVFWQTR-AAEPILPLHIFRS 274

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F    ++PLY Q V+G SAT SGL L+P++  +++ S+ +G+ 
Sbjct: 275 RNFTLMSVIGFIVGFVMFGATLFLPLYQQSVQGASATNSGLLLLPMLGAMLVTSMVAGRV 334

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T +  Y+   + G AL+ +G  L++  D ++ R     YM          MQ T+L 
Sbjct: 335 TTNTGR--YKIFPVAGGALMTVGLFLLSTMDTDTTRFTSGLYMAVVGLGMGCLMQITMLV 392

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR +G+ FGVAI+G +F++ + + +   A  PE A A + S
Sbjct: 393 AQNSVEMKDMGVASSSTTLFRTLGSSFGVAIMGALFNSRVQDAMAERA--PEGARATEQS 450

Query: 423 ATV----VNQLPIEIR 434
           AT+    +N LP  +R
Sbjct: 451 ATLTADALNALPAAVR 466



>gi|29828445|ref|NP_823079.1| transmembrane efflux protein [Streptomyces avermitilis MA-4680]
 gi|499292084|ref|WP_010983342.1| transmembrane efflux protein [Streptomyces avermitilis]
 gi|29605548|dbj|BAC69614.1| putative transmembrane efflux protein [Streptomyces avermitilis
           MA-4680]
          Length = 792

 Score =  264 bits (675), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 167/453 (36%), Positives = 244/453 (53%), Gaps = 21/453 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LD+++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 52  QMIVATALPKIVGELHGLDRMSWAITAYLLTATVALPVYGKCGDLFGRKGVFQFAIVVFV 111

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS+L G A  M  +I FRAI G+G GG++  V  II+DIV  ++RG++           
Sbjct: 112 VGSVLAGRARTMDQLIAFRAIQGLGAGGLMIGVQAIIADIVPPRERGRFMGLIGAAFGLA 171

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FYIN P G +T+ V    L++P+P    L K  R+D +G 
Sbjct: 172 SVAGPLLGGYFTDHLSWRWCFYINAPFGLVTLAVVTVALKLPKP----LTK-ARLDVLGA 226

Query: 181 IVV-VGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
           +++ V ST A+LL  +WGG EY W S                F +VE   A EP+ P  L
Sbjct: 227 LLLAVASTCAVLL-TSWGGTEYAWDSRIILGLGAGACVAAVLFLVVE-HFAPEPLIPLRL 284

Query: 240 FKR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
           F+    +V G        G+A F    Y+P + Q+V G SAT SGL ++P++ G+V AS+
Sbjct: 285 FRDSVFNVTGL--VGLVIGVALFGAASYLPTFLQMVDGASATESGLLMLPMMAGIVGASI 342

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +GQ +S T +  YR   + G+ L A+G  L++  + ++ R     +M          M 
Sbjct: 343 IAGQLISHTGR--YRMWPILGSVLAAVGMWLLSRLEADTPRLQYSIWMAVLGAGIGMVMP 400

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
             +L  Q  V   D+ + T+   +FR IG   G A+ GT+F++ L + +E     P  AG
Sbjct: 401 VLVLAVQNSVRPADLGTATSANNYFRQIGGSVGAAVFGTLFAHRLADALEERL--PTRAG 458

Query: 418 A-----VKASATVVNQLPIEIRGPVISAYVGAL 445
           A        +  +V+ LP ++R   ++AY  A+
Sbjct: 459 ARLPDPESLTPQLVHALPPDLRDGYVAAYADAM 491



>gi|353238456|emb|CCA70402.1| probable DHA14-like major facilitator; ABC transporter
           [Piriformospora indica DSM 11827]
          Length = 567

 Score =  264 bits (675), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 170/487 (34%), Positives = 243/487 (49%), Gaps = 18/487 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP +AS F ALD++ WV +AY LT      T+G+   +   K  +L  +  FE
Sbjct: 77  QTIVATALPKLASQFNALDQLTWVVSAYFLTQAGLMLTFGQILVVAPSKWVYLTCIFLFE 136

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+CG+AP+M  +I  RA  GVG  G+   ++ I++ I  L+ R              
Sbjct: 137 IGSLICGVAPSMNVLIFGRAFQGVGASGMFISILTILAQITKLETRPILFGSFGGVFALA 196

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPR-------PKGSLLQKLK 173
               PLLGGAFTD V+WRW FYINLP GAI+V   IF                + LQK  
Sbjct: 197 SVVGPLLGGAFTDKVSWRWCFYINLPFGAISVAAVIFFQPSNPPPSNPLYDGKTTLQKWL 256

Query: 174 RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP 233
            +D++G ++ V    ALLLPL WGG    W+                 F   +  +    
Sbjct: 257 SLDWVGAVISVAMITALLLPLQWGGVTKAWNDRSVIALFVVFGVLLIAFIAWQFYMGERA 316

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
           + P  LFKR   VG     FF  ++F +  YY+P ++Q  KG +A+ SG+++IP +L  V
Sbjct: 317 MMPLQLFKRRTQVGAGIAMFFMMISFLAATYYLPFFYQ-AKGRTASQSGIDIIPFMLSAV 375

Query: 294 IASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXX 353
           IAS  SG  V+ T    Y +  + G    A+G+GL+   DE++     I Y         
Sbjct: 376 IASFGSGAFVNVTGH--YLSPLIAGPLFAAVGAGLLFTIDEHTRNPVLIGYQILFGFGLG 433

Query: 354 XXMQTTLLCGQGIVEYKD----VASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI 409
              Q  ++  Q   EY D    +   ++LL F +L+G V G+AI GTIF+N L   +   
Sbjct: 434 LSFQLPVMAIQA--EYADTPNLIPQASSLLTFLQLLGGVVGIAIAGTIFNNQLVKELARF 491

Query: 410 A--IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMG 467
              + P++  AVK S TV+  LP +I+  V+ +YV AL   F   +P   L   A++ + 
Sbjct: 492 GGTLEPDVLQAVKQSVTVIFTLPADIQTVVVHSYVKALDYTFILSVPTCALASFAAVLVK 551

Query: 468 NHKPSLR 474
           N     R
Sbjct: 552 NWNIKQR 558



>gi|169601798|ref|XP_001794321.1| hypothetical protein SNOG_03774 [Phaeosphaeria nodorum SN15]
 gi|111067859|gb|EAT88979.1| hypothetical protein SNOG_03774 [Phaeosphaeria nodorum SN15]
          Length = 589

 Score =  264 bits (675), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 166/473 (35%), Positives = 245/473 (51%), Gaps = 11/473 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I   FKAL+ + W  ++YLLT  A Q  YGKF   +  K  +L A+  FE
Sbjct: 106 NTIIATAIPRITDQFKALNDVGWYGSSYLLTTCATQLIYGKFYTFYSIKWVYLIALAIFE 165

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+APN T +II RA+AGVG  GI S  ++II+  V L+ R  Y           
Sbjct: 166 LGSLICGVAPNSTALIIGRAVAGVGAAGIFSGAILIIASTVPLRKRPTYMGLIGGMYGIA 225

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP----KGSLLQKLKRID 176
               PL+GGAFTDH+TWRW FYINLP GA+T    I  L + R       +  Q+LK+ D
Sbjct: 226 SVAGPLMGGAFTDHLTWRWCFYINLPFGALTAAFIIPFLSVQRRGKKVDATWKQQLKKFD 285

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
             GT++ + + I LLL L WGG++Y W +                F  ++         P
Sbjct: 286 LEGTVLFLPAIICLLLALQWGGSKYDWGNGRIIALFVIFSLLIIGFIAIQWYKQENATVP 345

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P +F   +V G        G AFF +VYY+P++FQ +KG SAT SG+  +P ILG+VI S
Sbjct: 346 PRIFLNRNVWGSAWFGAMLGAAFFVMVYYLPIWFQAIKGVSATKSGIMNLPCILGLVIVS 405

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           +SSG  V+      Y    +  + L+AIG+GL++ ++ +S     I Y           M
Sbjct: 406 MSSGILVTVIGY--YTPFMLISSVLMAIGAGLLSTFETDSNSPRWIGYQFLFGAGVGFGM 463

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELA 416
           Q TL+  Q  +   DV   TA++MF + +G    +++   +F+N L  N+  +   PEL 
Sbjct: 464 QQTLVAVQTALPAGDVPIGTAIMMFTQTLGGALFISVGQNVFTNQLIKNLGTLV--PELD 521

Query: 417 GAV---KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
             +     +  + N +  +    V++AY  AL   F   +    +  L + F+
Sbjct: 522 TKIVLAVGATELKNAIEEKFLPGVLTAYNLALTQTFYVSVATASMSILGAAFV 574



>gi|386841651|ref|YP_006246709.1| exporter [Streptomyces hygroscopicus subsp. jinggangensis 5008]
 gi|474983863|ref|YP_007694329.1| exporter [Streptomyces hygroscopicus subsp. jinggangensis TL01]
 gi|504487047|ref|WP_014674149.1| transporter [Streptomyces hygroscopicus]
 gi|374101952|gb|AEY90836.1| exporter [Streptomyces hygroscopicus subsp. jinggangensis 5008]
 gi|451794946|gb|AGF64995.1| exporter [Streptomyces hygroscopicus subsp. jinggangensis TL01]
          Length = 503

 Score =  264 bits (675), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 153/469 (32%), Positives = 243/469 (51%), Gaps = 17/469 (3%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV TA+P I  +   L+ ++WV T Y L   A  P +GK  D++GRK  FL +++ F +G
Sbjct: 19  IVGTAMPTIVGELGGLEHLSWVVTGYTLATAASTPIWGKIGDMYGRKGAFLSSIVIFLLG 78

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 79  SALSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMMAGVMALAMI 138

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TD+  WRW+FYINLPLGA+ + +   +L +P+ +         IDY+G ++
Sbjct: 139 GGPLVGGTITDNWGWRWAFYINLPLGAVALALVTAVLHLPKKRSK-----AGIDYLGVLL 193

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     +++L   WGG EY W+S                F   +TK A EPV P H+FK 
Sbjct: 194 LTVGITSIVLVTTWGGTEYAWTSARIMELTGIGVAALVGFVFWQTK-AAEPVVPLHIFKS 252

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F    ++PLY Q V+G SAT SGL L+P++  +++ S+ +G+ 
Sbjct: 253 RNFTLMSVIGFITGFVMFGATLFLPLYQQAVQGASATNSGLLLLPMLGAMLVTSMVAGRV 312

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + + +  Y+   + G  L+ +G  L++L D  + R     YM          MQ T+L 
Sbjct: 313 TTNSGR--YKIFPIVGGVLMTVGLYLLSLMDTGTTRLTSGLYMAVVGAGMGCLMQITMLV 370

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGA---- 418
            Q  V+ KD+   ++    FR +G+ FGVAI+G +F++ + + + + A     AGA    
Sbjct: 371 AQNSVQMKDMGVASSSTTLFRTLGSSFGVAIMGALFNHRVQDVMADRA---GAAGAKMTE 427

Query: 419 --VKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
              +  A  + +LP+ +R     A      +AF     I +L  +A+LF
Sbjct: 428 QSAQLDAKSLAKLPVMVREAYQHAVSSGTHSAFLLGAGISVLVLIAALF 476



>gi|315040395|ref|XP_003169575.1| SGE1 [Arthroderma gypseum CBS 118893]
 gi|311346265|gb|EFR05468.1| SGE1 [Arthroderma gypseum CBS 118893]
          Length = 532

 Score =  264 bits (675), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 154/415 (37%), Positives = 222/415 (53%), Gaps = 7/415 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           +TI+ATA+P I   F ++D I W  ++YLLT  +F   +GKF  ++  K  +L A++ FE
Sbjct: 52  RTIIATAIPRITDQFHSIDDIGWYGSSYLLTGCSFMLLFGKFYQLYSPKWVYLIAIVIFE 111

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS +CG APN T  II RAIAG+G  G  S  +III   V L+ R  Y           
Sbjct: 112 IGSAVCGAAPNSTAFIIGRAIAGLGSAGAFSGTVIIIVHAVPLRKRPMYTGLMGGMFGIA 171

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGS-----LLQKLKRI 175
               PLLGG FTD VTWRW FYINLP+GA+T+I+  FLLRI  P+ S     L Q+  ++
Sbjct: 172 SVAGPLLGGLFTDKVTWRWCFYINLPIGAVTLIIVTFLLRINIPRKSTENLTLYQQFLKL 231

Query: 176 DYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVA 235
           D +GT+  + S I LLL L WGG  YPWSS                F  ++     E   
Sbjct: 232 DPLGTLCFLPSIICLLLALQWGGTTYPWSSGRIIALFVIFGILLIAFIAIQIWRNEEATV 291

Query: 236 PPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIA 295
           PP +F +  V+  F      G +  +++YY+PL+FQ +KG SA  SG+  +P IL +VI 
Sbjct: 292 PPRIFVQRSVLSAFWFTICLGSSMMTIIYYLPLWFQAIKGVSAVKSGIMNLPTILSLVIG 351

Query: 296 SVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXX 355
            + SG  V+    +A     +    L ++G+GL+T +  N+G A  I Y           
Sbjct: 352 VIMSGGLVTAIGYYA--PFMIACCVLSSVGAGLLTTFQTNTGHAKWIGYQVIYGIGLGMG 409

Query: 356 MQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA 410
           MQ   +  Q ++   DV   ++L+ F + +G    +A+   IFSN LT+ + +I+
Sbjct: 410 MQQGSVACQTVLSKSDVPIGSSLIFFAQQLGGTIFIAVAQNIFSNELTSGLHHIS 464



>gi|392418951|ref|YP_006455556.1| drug resistance transporter, EmrB/QacA subfamily [Mycobacterium
           chubuense NBB4]
 gi|504631240|ref|WP_014818342.1| MFS transporter [Mycobacterium chubuense]
 gi|390618727|gb|AFM19877.1| drug resistance transporter, EmrB/QacA subfamily [Mycobacterium
           chubuense NBB4]
          Length = 730

 Score =  264 bits (674), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 162/470 (34%), Positives = 240/470 (51%), Gaps = 16/470 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       AWV T+YLL  T      GK  D FGRK  F  A++ F 
Sbjct: 42  QTIVATALPTVVADLGGAGHQAWVVTSYLLASTIVTAVVGKLGDTFGRKRVFQVAILLFL 101

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCG+A +M  ++  RA+ G+GGG I    + +I +++ L++RG+YQ          
Sbjct: 102 AGSVLCGMATSMGMLVASRALQGLGGGAITVTAVAVIGEVIPLRERGRYQGALGAVFGVT 161

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIF----LLRIPRPKGSLLQKLKRID 176
               PLLGG FTDH++WRW+F+IN+P+  + + +A      L R  RP          +D
Sbjct: 162 TVIGPLLGGLFTDHLSWRWAFWINVPVAVVVLAIAAVAIPELARTARPV---------LD 212

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
           Y G ++V      L L  +WGG  YPW S                F  VE + A EP+ P
Sbjct: 213 YAGIVLVGVGAAGLTLATSWGGTTYPWGSATIIGMFVGSVAVLVAFVFVELR-ATEPILP 271

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
             LF       C   +F  G A    + ++P Y Q V G SAT SGL  +P++LG++  S
Sbjct: 272 IRLFGNPVFTVCCVLSFVVGFAMLGALTFLPTYMQFVDGVSATASGLRTLPMVLGLLATS 331

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           +SSG  V RT +  Y+   + G A++A+G  L++L D  +    Q   +          M
Sbjct: 332 LSSGVIVGRTGR--YKIFPIAGTAIMAVGFVLLSLMDAGTSTLVQSLDLLVLGAGIGLSM 389

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELA 416
           Q  +L  Q  V++ D+   T+ + FFR IG+ FG AI G+IF+NVL +++ +        
Sbjct: 390 QVLILVVQNTVDFTDLGVATSGVTFFRTIGSSFGAAIFGSIFANVLDDHLPSAMAQSRAP 449

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
                S   +++LP E+  P+I AY  +L   F    P  I+ F+ +LF+
Sbjct: 450 AEAATSPQALHRLPAEMAAPIIHAYADSLTRVFLFAAPFAIVGFVLALFL 499



>gi|498037322|ref|WP_010351478.1| transporter [Streptomyces acidiscabies]
          Length = 545

 Score =  263 bits (673), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 156/472 (33%), Positives = 241/472 (51%), Gaps = 23/472 (4%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV TA+P I  D   L+ ++WV TAY L   A  P +GK  D++GRKATF+ +++ F IG
Sbjct: 59  IVGTAMPTIVGDLGGLEHLSWVVTAYTLATAASTPIWGKLGDMYGRKATFMTSIVIFLIG 118

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRA+ G+G GG++  VM II D+V  ++RGKYQ            
Sbjct: 119 SALSGMAQDMGQLIAFRAVQGLGAGGLMVGVMAIIGDLVPPRERGKYQGMMAGVMALAMI 178

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TDH  WRW+FYINLPLG + + +   +L +PR +        RIDY+G  +
Sbjct: 179 GGPLVGGTITDHWGWRWAFYINLPLGVVALGLISVVLHLPRKRSQ-----ARIDYLGAAL 233

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     + +L   WGG EY W+S                F   + K A EP+ P H+F+ 
Sbjct: 234 LTVGITSTVLVTTWGGTEYAWTSARIMELIAIGVASLVGFVFWQKK-AAEPILPLHIFRS 292

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F    ++PLY Q V+G SAT SGL L+P++  +++ S+ +G+ 
Sbjct: 293 RNFTLMSVIGFVTGFVMFGATLFLPLYQQSVQGASATNSGLLLLPMLGAMLVTSMVAGRI 352

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T +  Y+   + G+ L+ +G  L++  D  + R     +M          MQ T+L 
Sbjct: 353 TTSTGR--YKIFPVAGSVLMIVGLYLLSTMDTGTSRLMSGVFMAVVGLGMGCLMQITMLV 410

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR +G+ FGVAI+G +F+N + +      +  E AGA+ + 
Sbjct: 411 AQNSVEMKDMGVASSSATLFRTLGSSFGVAIMGALFNNRVQD------VMSERAGALGSK 464

Query: 423 ATVVN---------QLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
            T  +         +LP   R     A      +AF     I ++  +A++F
Sbjct: 465 VTEASAQLDAASLAKLPAAAREAYQYAVSSGSHSAFLLGAVIAVISLVAAVF 516



>gi|493111663|ref|WP_006142112.1| transporter [Streptomyces griseoaurantiacus]
 gi|329301711|gb|EGG45605.1| exporter [Streptomyces griseoaurantiacus M045]
          Length = 540

 Score =  263 bits (673), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 152/456 (33%), Positives = 236/456 (51%), Gaps = 23/456 (5%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           I+ TA+P I  +   L+ ++WV TAY L   A  P +GK  D++GRK  F+ +++ F IG
Sbjct: 50  IIGTAMPTIVGELGGLEHLSWVVTAYTLATAASTPLWGKLGDMYGRKGVFMTSIVVFLIG 109

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 110 SALSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMMAGVMALAMI 169

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TDH+ WRWSFYINLPLGA+ +I    +L +P+ +        RIDY+G  +
Sbjct: 170 AGPLVGGTITDHLGWRWSFYINLPLGAVALIAISVVLHLPKKRAQ-----TRIDYLGAGL 224

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     +++L   WGG EY W S                F   +TK A EP+ P H+F+ 
Sbjct: 225 LTLGITSIVLVTTWGGTEYAWGSARIMELIGIGVAALVGFLFWQTK-AAEPIMPLHIFRN 283

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F  V ++PLY Q V+G SAT SGL L+P++  +++ S+ +G+ 
Sbjct: 284 RNFSLMSIIGFITGFVMFGAVLFLPLYQQAVQGASATNSGLLLLPMLGAMLVVSMVAGRV 343

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + + +  Y+   + G  LI  G  L+   D  + R     YM          MQ T+L 
Sbjct: 344 TTNSGR--YKVFPLAGGVLIIAGLFLLAQMDTETTRLTSGIYMAVLGAGMGCLMQITMLV 401

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV--- 419
            Q  VE KD+   ++    FR +G+ FGVAI+G +F+    + ++++ +  E AGA+   
Sbjct: 402 AQNSVEMKDMGVASSSTTLFRTLGSSFGVAIMGALFN----HRVQDVMV--ERAGALGGK 455

Query: 420 ------KASATVVNQLPIEIRGPVISAYVGALRTAF 449
                 +  A  + +LP++ R     A      +AF
Sbjct: 456 MTEQSAQLDAASLAKLPVQAREAYQYAVSAGTHSAF 491



>gi|497971326|ref|WP_010285482.1| transmembrane efflux protein, partial [Streptomyces sp. SA3_actF]
          Length = 502

 Score =  263 bits (673), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 167/471 (35%), Positives = 242/471 (51%), Gaps = 15/471 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LD+++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 11  QMIVATALPKIVGELHGLDRMSWAITAYLLTSTVGLPIYGKLGDLFGRKGVFQFAILVFV 70

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G + +M  +I FRAI G+G GG++  V  II DIV  ++RGKY           
Sbjct: 71  VGSALAGWSRSMDQLIAFRAIQGIGAGGLMIGVQAIIGDIVPPRERGKYMGLIGAAFGLA 130

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDHV+WRW FY N+P G +T++V   +L++PRP+     +  ++D +G 
Sbjct: 131 SVAGPLLGGFFTDHVSWRWCFYFNVPFGLLTLVVVTLVLKLPRPR-----RKAKLDVLGA 185

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++  ++  L+L  +WGG EY W S                F L E   A EP+ P  LF
Sbjct: 186 TLLAIASACLVLLTSWGGTEYAWGSRMIIGLGAGAVVSAALFLLAE-HYAAEPLIPLRLF 244

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P Y Q+V G SAT SGL ++P++ GVVIAS+ +G
Sbjct: 245 RERAFNVTGLVGAVVGIALFGAASYLPTYLQMVDGASATESGLLMLPMMGGVVIASIVAG 304

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q ++RT    YR   + G  L  +G  L++  +  + R     +M          M   +
Sbjct: 305 QLITRTGH--YRVYPILGGVLSTLGMWLLSRLEIGTSRFTYSVWMAVLGAGIGLIMPVLV 362

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV- 419
           L  Q  V   D+ + T+   +FR IG   G AI GT+F++ L + + +    P  AG   
Sbjct: 363 LAVQNAVRPGDLGTATSANNYFRQIGGSVGAAIFGTLFASRLADALADRL--PAGAGDTL 420

Query: 420 ----KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
                 +  +V+ LP  +R   I AY  A+   F   +P+  L  L + F+
Sbjct: 421 PDPESVTPQLVHHLPAPLRDGFIQAYADAMPRIFLYLVPVLALGLLIACFL 471



>gi|491070138|ref|WP_004931763.1| DSBA oxidoreductase [Streptomyces griseoflavus]
 gi|302478480|gb|EFL41573.1| drug transporter [Streptomyces griseoflavus Tu4000]
          Length = 699

 Score =  263 bits (672), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 172/475 (36%), Positives = 253/475 (53%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I S+   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 59  QTIVATALPTIVSELGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKRLFQTAIVIFL 118

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS LCG A +M+ +I FRA+ G+GGGG++ L M I+ D+V  ++RG+YQ          
Sbjct: 119 VGSALCGAAQDMSQLIAFRALQGLGGGGLIVLSMAIVGDLVPPRERGRYQGLFGAVFGAT 178

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT H+ WRW FY+NLP+G + + V   +L IPR +   L     IDY+GT
Sbjct: 179 SVLGPLLGGLFTQHLNWRWVFYVNLPVGIVALAVIAAVLHIPRRRTKHL-----IDYLGT 233

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  + W+SP               F  VE + A EPV P  LF
Sbjct: 234 FLIASVATCLVLVASLGGTTWEWASPQIVGLALLGAVLAVAFVAVERR-AAEPVLPLKLF 292

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV G + T SG+ ++P++ G++++S  SG
Sbjct: 293 RVRTFTLSAVISFIIGFAMFGAMTYLPTFLQVVHGITPTMSGVHMLPMVAGMLLSSTGSG 352

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+  +G  L+   D +S  A    Y           MQ  +
Sbjct: 353 QIVSRTGR--WKVFPIAGTAVTTLGLLLLHQLDAHSSTAGMSAYFFVFGLGLGLVMQVLV 410

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI----ENIAIPPEL- 415
           L  Q  V Y+D+   T+   FFR IGA FGVAI GTIF++ L + +        +PP + 
Sbjct: 411 LIVQNAVPYEDLGVATSGATFFRSIGASFGVAIFGTIFASRLGSELTAAFRGARLPPGVS 470

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           A +++A    +  LP  +R   I AY  A+   F   +P+ +L F  + F+   +
Sbjct: 471 ADSLEADPRGIGALPPALRPTAIDAYATAITDVFLYAVPVALLGFALAWFLKEDR 525



>gi|449295431|gb|EMC91453.1| hypothetical protein BAUCODRAFT_39638 [Baudoinia compniacensis UAMH
           10762]
          Length = 597

 Score =  263 bits (672), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 161/472 (34%), Positives = 252/472 (53%), Gaps = 9/472 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI++TA+P I  +FKA+D + W  ++YLLT  AFQ  +GK       K  +L A++ FE
Sbjct: 114 NTIISTAIPKITDEFKAIDDVGWYGSSYLLTTCAFQLFFGKLYTFLSVKYIYLAALVVFE 173

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS++CG APN   +I+ RAIAG+G  GI S  ++I+S  V L+ R  Y           
Sbjct: 174 VGSVICGAAPNSNALIVGRAIAGLGCAGIFSGAILIVSLTVPLKQRPTYMGMIGGMYGIA 233

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVI-VAIFLLRIPRPK---GSLLQKLKRID 176
               PL+GGAFTD +TWRW FYINLP+GA+T+I + +F     R K    SL+QKL++ D
Sbjct: 234 SVAGPLMGGAFTDKLTWRWCFYINLPIGAVTLIFITLFYKPGKRAKPMASSLMQKLEQFD 293

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
            +G IV +   + LLL L WGG++YPW +                F  ++         P
Sbjct: 294 ILGLIVFIPMIVCLLLALQWGGSKYPWHNGRIIALLVIFAVLAIAFVGIQIWKQDNATVP 353

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P + K+  V      +   G AFF  VYY+P++FQ +K  SA  SG+  IP++L +VI S
Sbjct: 354 PRVLKQRSVAAGAWFSATLGAAFFVFVYYLPIWFQAIKEVSAVGSGIRNIPMVLSLVIFS 413

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + SG AV+      Y    +  +  +AIG+G++     +SG    I Y           M
Sbjct: 414 MISGIAVTALGY--YTPFIIVSSFFMAIGAGMLATLTTHSGSGAWIGYQILFGAGVGFGM 471

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA--IPPE 414
           Q TL+  Q ++   D+A  TA++MF + +G    +++   +F+N L +N++ +   + P 
Sbjct: 472 QNTLVAVQAVLPQVDIAIGTAIIMFSQTLGGALFISVAQNVFTNRLLSNLKQVVPDLDPA 531

Query: 415 LAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           L  A  A+ ++ + +P +  G V +AY  A+ + F   + +  +    S+FM
Sbjct: 532 LVLATGAT-SLKSVIPGQYLGGVQTAYNSAIISCFYVAVAMAAMSIFGSVFM 582



>gi|256389875|ref|YP_003111439.1| EmrB/QacA subfamily drug resistance transporter [Catenulispora
           acidiphila DSM 44928]
 gi|502434778|ref|WP_012784893.1| multidrug MFS transporter [Catenulispora acidiphila]
 gi|256356101|gb|ACU69598.1| drug resistance transporter, EmrB/QacA subfamily [Catenulispora
           acidiphila DSM 44928]
          Length = 525

 Score =  263 bits (672), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 175/487 (35%), Positives = 254/487 (52%), Gaps = 26/487 (5%)

Query: 1   QTIVATALPAIASDF---KALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVI 57
            TIV+TA+  I  D      L ++ WV TAY+L  TA  P YGK SD+FGRK  ++ A++
Sbjct: 24  NTIVSTAIRTIIGDIGGQNGLARMPWVTTAYVLASTAATPIYGKLSDLFGRKPLYMTAIV 83

Query: 58  TFEIGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXX 117
            F  GS L GL+ N+  +I FRA+ G+G GGIL L   I+ D+V  ++RGKYQ       
Sbjct: 84  LFLTGSALSGLSQNLNELIAFRALQGLGAGGILGLTFAIVGDVVPPRERGKYQGLFGGVF 143

Query: 118 XXXXXXXPLLGGAFTDHVT------WRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQK 171
                  PLLGG FT+H +      WRW FY+NLP+G I + V   +L +P+      ++
Sbjct: 144 MLAMVAGPLLGGIFTEHNSIIGITGWRWVFYVNLPIGIIALFVISAVLHLPK------RR 197

Query: 172 LK-RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLA 230
           +K  IDYIG  +VV   + LLL    GG +Y W SP               F L E +  
Sbjct: 198 VKATIDYIGATLVVAGVVCLLLAAQMGGQQYAWGSPVIIGLAIVGVVVLVGFVLWEIRTP 257

Query: 231 IEPVAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLIL 290
            EP+ P  LF+           F  GM     + Y+P YFQVV GDS T +GL ++P+++
Sbjct: 258 -EPILPMRLFRGDVFRVSSIMGFLIGMVMMGAMMYIPFYFQVVNGDSPTKAGLRMLPMMV 316

Query: 291 GVVIASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXX 350
           G++  S+SSG+ +SRT +  YR   + G A+  IG GL+T  DEN+       +M     
Sbjct: 317 GLLTTSISSGRLISRTGR--YRFFPIAGIAVTTIGLGLMTTMDENTTFFTGALFMFIVGL 374

Query: 351 XXXXXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA 410
                MQ  +L  Q  VE KD+   T    FFR +G  FG A++G I +N LT++++  A
Sbjct: 375 GLGATMQVLILAVQNAVEMKDMGVATTSSTFFRSLGQTFGAAVMGAILTNQLTSHLKTNA 434

Query: 411 IPP-------ELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLAS 463
            P        E   A+  S   +++LP  ++  +I ++  AL T F     + ++ + AS
Sbjct: 435 GPSPAMAPVREHGMAILQSEGAMSKLPQPVQHVLIHSFTQALSTVFLFGAALSLIAWFAS 494

Query: 464 LFMGNHK 470
            F+  HK
Sbjct: 495 WFLKEHK 501



>gi|402220859|gb|EJU00929.1| hypothetical protein DACRYDRAFT_89378 [Dacryopinax sp. DJM-731 SS1]
          Length = 587

 Score =  263 bits (672), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 176/471 (37%), Positives = 247/471 (52%), Gaps = 9/471 (1%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATA+P I  +FK L  + W  +A+ LT+ +FQ T+GK    F  K  FL A+  FE+
Sbjct: 106 TIVATAIPRITDEFKNLADVGWYGSAFFLTLGSFQSTWGKAYKYFPLKPAFLLAIGIFEL 165

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSL+C  APN T +II RAIAG+G  G  S V  I++     + R  Y            
Sbjct: 166 GSLICAAAPNSTALIIGRAIAGMGASGAFSGVYTIVAFSARPEHRPSYISIIGATYGLAS 225

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAI-TVIVAIFLLRIPRPK---GSLLQKLKRIDY 177
              PLLGG FT+ +TWRW F+INLP+G +   I+A+F       K    +  +KL ++D 
Sbjct: 226 VIGPLLGGVFTEKLTWRWCFWINLPIGGVAAAIIAVFFSTPAAAKPVSATGKEKLLQMDP 285

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
           +GT +++G+ I+ LL L WGG   PWSS                F  +E  +    + PP
Sbjct: 286 LGTGMIMGALISYLLALQWGGVTQPWSSSTIIGLLVGFVLMISAFIGIEWHMGERAILPP 345

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
           HLFK+  V       FF    FF ++Y++P+YFQ V G SA+ SG+  IPLILGV + + 
Sbjct: 346 HLFKQRTVALSAGYIFFLTGGFFIILYFLPIYFQSVDGVSASDSGVRNIPLILGVALFTF 405

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
            +G  V+    FA   L + GA L  IGSGLI L D  +     I Y           +Q
Sbjct: 406 LAGNIVTLWGHFA--PLLVIGAVLATIGSGLIYLLDIGTPSPQWISYQVVAGVGIGLGLQ 463

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA--IPPEL 415
             +   Q +V+ KDVA VTA+ +FF+ IG  F ++    IF+N L   + + A  I P L
Sbjct: 464 IPISASQAMVDVKDVAPVTAMALFFQTIGGAFFISAAQAIFANRLLAVLPSSAPSIDPAL 523

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
             A  AS   +   P E+   ++ AY+G L+ AF   IP+  L  L S+F+
Sbjct: 524 VLATGASELRI-VFPQEVLPGILRAYMGGLQAAFAFAIPLLGLAALLSIFV 573



>gi|344999423|ref|YP_004802277.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces sp.
           SirexAA-E]
 gi|503811729|ref|WP_014045723.1| DSBA oxidoreductase [Streptomyces sp. SirexAA-E]
 gi|344315049|gb|AEN09737.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces sp.
           SirexAA-E]
          Length = 680

 Score =  263 bits (672), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 181/477 (37%), Positives = 262/477 (54%), Gaps = 17/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 39  QTIVSTALPTIVSDLGGLDHLSWVVTAYLLAATAATPLWGKLGDQYGRKRLFQTAIVIFL 98

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A +M  +IIFRA+ G+GGGG++ L M I+ DIV  ++RGKYQ          
Sbjct: 99  IGSALCGMAQSMPQLIIFRALQGLGGGGLMVLSMAIVGDIVPPRERGKYQGLFGAVFGVT 158

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FT H++WRW FYINLPLG + ++V   +L IP      +++ K  IDY+G
Sbjct: 159 SVLGPLLGGFFTQHLSWRWVFYINLPLGVVALLVIAAVLHIP------VRRTKHTIDYLG 212

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
           T ++      L+L  + GG  +PW S                F   E + A+EPV P  L
Sbjct: 213 TFLIAAVATCLVLVASLGGTTWPWGSLQIIGLAVLAVVLLAAFVRTERR-AVEPVLPLKL 271

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F+          +F  G A F  + Y+P + QVV G + T SG+ ++P++ G++I S +S
Sbjct: 272 FRIRTFTLVAVISFVIGFAMFGAMTYLPTFLQVVHGITPTLSGVHMLPMVFGLLITSTAS 331

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLI-TLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           GQ VSRT +  ++   +TG  L AIG  L+  L   +S     +C+           MQ 
Sbjct: 332 GQIVSRTGR--WKVFPVTGTGLTAIGLLLLHQLTPSSSTLTMSLCFF-VFGAGLGLVMQV 388

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIE----NIAIPPE 414
            +L  Q  V Y+D+   T+   FFR IGA FGVAI GTIF+N LT  +E      ++P  
Sbjct: 389 LILVAQNAVGYEDLGVATSGATFFRSIGASFGVAIFGTIFTNRLTGKLEAALSGRSLPGG 448

Query: 415 L-AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           + AG++ A    + +LP ++R  V+ AY  ++   F   +P+ ++ F  + F+   +
Sbjct: 449 VDAGSLAADPRALGRLPADLRPAVLDAYSTSITDVFLYAVPVVLVAFAFAWFLKEDR 505



>gi|512663157|ref|WP_016468769.1| drug:H+ antiporter-2 (14 Spanner) (DHA2) family drug resistance MFS
           transporter [Streptomyces sp. HPH0547]
 gi|512153217|gb|EPD95689.1| drug:H+ antiporter-2 (14 Spanner) (DHA2) family drug resistance MFS
           transporter [Streptomyces sp. HPH0547]
          Length = 666

 Score =  263 bits (672), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 164/475 (34%), Positives = 250/475 (52%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP I SD   ++ ++WV TAYLL +TA  P +GK  D +GRK  F  A++ F 
Sbjct: 35  QTIVATALPTIVSDLGGMEHLSWVVTAYLLAVTAVTPLWGKLGDQYGRKRLFQTAIVIFL 94

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCG+A +M  +I FRA+ G+GGGG+++L M I+ D+V  ++RG+YQ          
Sbjct: 95  AGSALCGIAQSMGQLIAFRAVQGLGGGGLITLSMAIVGDLVPPRERGRYQGLFGAVFGTT 154

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H+ WRW FYINLP+GA+ ++V    L +P     + +    IDY+GT
Sbjct: 155 SVLGPLLGGFFTEHLDWRWVFYINLPIGAVALVVIALALHLP-----VSRHPHTIDYLGT 209

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++      ++L  + GG  +PW+S                F +VE + A EPV PP +F
Sbjct: 210 VLIAAVATCVVLGTSLGGTSWPWNSGQTYGLAVLAAVLLACFVVVERR-AAEPVLPPSIF 268

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
              +       +F  G A F  + Y+P + QVV G + T SG+ ++P++LGV+++S  SG
Sbjct: 269 AVRNFTLSAAISFVVGFAMFGCMTYLPTFLQVVHGITPTMSGVHMLPMVLGVLVSSTVSG 328

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q ++ T    ++   + G A+  +G  L+      S       Y           +Q  +
Sbjct: 329 QLITHTGH--WKVFPVLGTAVTTVGLVLLHRMTPGSSEWEMGTYFAVFGLGLGMVLQVLV 386

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSN----VLTNNIENIAIPPELA 416
           L  Q  V Y D+   T+ + FFR +GA  GVA+ G IF++     L + +  + +P  L 
Sbjct: 387 LVAQNAVRYADLGVATSGVTFFRSVGASVGVAVFGAIFASRLGGKLADALRGMRLPRGLT 446

Query: 417 -GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
             A+K     + +LP   R  V+ AY  A+   F    P+  L FL + F+   K
Sbjct: 447 PEALKHDPHSIGRLPPPARRGVLDAYSTAITDVFLYASPLAALAFLLTWFLREQK 501



>gi|290955973|ref|YP_003487155.1| transporter [Streptomyces scabiei 87.22]
 gi|502764331|ref|WP_012999315.1| MFS transporter [Streptomyces scabiei]
 gi|260645499|emb|CBG68587.1| putative integral membrane transport protein [Streptomyces scabiei
           87.22]
          Length = 535

 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 160/474 (33%), Positives = 249/474 (52%), Gaps = 12/474 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I  +   ++ +AWV TAY+L  T   P YG+  D+ GRK  FL A+  F 
Sbjct: 39  QTIVSTALPTIVGELHGVNHMAWVTTAYILAATIAMPVYGRLGDLMGRKTLFLGAIAVFI 98

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS   G+A NMT +II RA+ G+GGGG++     II+D+V  + R KY           
Sbjct: 99  VGSATAGMAQNMTVLIIGRAVQGLGGGGLMITSQAIIADLVPPRQRAKYMAPMGAVFGLA 158

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTD + WRW+F+INLPLGA+ + VA F LR+PR    +      IDY+G 
Sbjct: 159 SVVGPLLGGWFTDGIGWRWAFWINLPLGALALTVAAFALRLPRRSTRV-----AIDYVGI 213

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++  +    +L  +WGG +Y W+ P               F   ++++A EP+ P  LF
Sbjct: 214 ALMAAAVTCTVLVADWGGTDYAWTDPLVLGLAVGAVVAWALFLFSQSRVA-EPIIPLRLF 272

Query: 241 -KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
             R+  +         G+  F+ V Y+P Y Q+V G +AT SGL LIP+++G++  ++ S
Sbjct: 273 SNRIFSIATLLGMVVIGVGMFAAVGYMPTYLQMVYGKTATESGLLLIPMVVGIMATALPS 332

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           GQ +SRT +  Y+   + G A++ +   L++  D ++       Y+          +Q  
Sbjct: 333 GQLISRTGR--YKIYPILGTAVVGVTVLLMSTLDTSTSIVVVCGYLFLLGAGVGLIVQNL 390

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN--IAIPPELAG 417
           +L  Q      DV + T+   FFR IGA  G A VG +F++ LT+ + +       ++ G
Sbjct: 391 VLAVQNAFPPSDVGTATSANNFFREIGATLGTAAVGAVFTHRLTDQLADRLSTADAKVVG 450

Query: 418 AVKA-SATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           +  + + T+V+ LP +++  VI AY  AL   F    P+  L  + +  +   K
Sbjct: 451 STDSLTPTLVHALPDKVQNAVILAYQQALTPVFRYMAPLFALGLVLAFLLPEKK 504



>gi|425777471|gb|EKV15644.1| hypothetical protein PDIP_40020 [Penicillium digitatum Pd1]
 gi|425780308|gb|EKV18318.1| hypothetical protein PDIG_09980 [Penicillium digitatum PHI26]
          Length = 546

 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 165/467 (35%), Positives = 242/467 (51%), Gaps = 6/467 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TIVATA+P I ++F +L  + W  +AY+LT  A    +GK    +  K TF+ A+  FE
Sbjct: 67  NTIVATAIPKITAEFDSLPDMGWYGSAYMLTTCAVTLIFGKLYTYYSLKWTFMTALTLFE 126

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+ P  T +II RA+AGVG GG+ S  M++IS +V L+ R  Y           
Sbjct: 127 LGSLVCGVTPTSTGLIIGRALAGVGAGGLFSGSMLVISTLVPLRKRPIYTGIIGGIFGIS 186

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLL--QKLKRIDYI 178
               PLLGGA TDH TWRW FYINLP GA+T I+  F  +   P+  +   +KL+ +D I
Sbjct: 187 SVAGPLLGGALTDHATWRWCFYINLPFGAVTAIMIAFFFQDKPPQKHITSREKLQSLDLI 246

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           GT + + + + LLL L WGG +YPWS+                +  V+         PP 
Sbjct: 247 GTAIFLPTVVCLLLALQWGGQKYPWSNARIIVLFVLFGVGLCIWLYVQHARQELATVPPR 306

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           + K  +V G    N   G AFF  VYY+PL+FQ +KG  AT SG+  +PLILGV I ++ 
Sbjct: 307 IIKNRNVWGALAYNTCLGGAFFVSVYYLPLWFQAIKGADATRSGVMNLPLILGVTIFAMV 366

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           S  A+  T    Y    +  + + +IG+GL+T  + NSG A  I Y           MQ 
Sbjct: 367 S--AILVTVSGYYNPFMLAASVIFSIGNGLLTTLEPNSGSAKWIGYQAMTGIGAGMGMQL 424

Query: 359 TLLCGQGIVEYKDVASVTALLMFFR-LIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
             +  Q  V+  D+   T L++F + L GA+F ++I   +F N L  N+  +    + A 
Sbjct: 425 PTIVVQAAVQEADIPVATTLVVFSQSLSGAIF-ISIAQNVFQNRLVANVRKLVPNIDPAV 483

Query: 418 AVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASL 464
            V+  AT + +   +    V+ AY  A+  +F   + +  L    +L
Sbjct: 484 IVRVGATKLRETFPDNLHMVLQAYNNAVTQSFYIAVAMSALSIFGAL 530



>gi|493090109|ref|WP_006129964.1| multidrug-efflux transporter [Streptomyces gancidicus]
 gi|455652171|gb|EMF30832.1| multidrug-efflux transporter [Streptomyces gancidicus BKS 13-15]
          Length = 680

 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 169/474 (35%), Positives = 249/474 (52%), Gaps = 19/474 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 40  QTIVSTALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKRLFQTAIVIFL 99

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS LCG A +M  +I FRA+ G+GGGG++ L M I+ D+V  ++RG+YQ          
Sbjct: 100 VGSALCGAAQDMPQLIGFRALQGLGGGGLIVLSMAIVGDLVPPRERGRYQGLFGAVFGAT 159

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT H++WRW FY+N+P+G + + V   +L IPR     +     IDY+GT
Sbjct: 160 SVLGPLLGGLFTQHLSWRWVFYVNVPVGIVALAVIATVLHIPRRSTKHV-----IDYLGT 214

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++      L+L  + GG  +PW+S                F  VE + A EPV P  LF
Sbjct: 215 LLIASVATCLVLVASLGGTTWPWASWQIVGLAVLGAVLIVAFVAVERR-AAEPVLPLKLF 273

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV G S T SG+ ++P++ G++++S  SG
Sbjct: 274 RVRTFTLSAVISFIVGFAMFGALTYLPTFLQVVHGISPTLSGVHMLPMVAGMLLSSTGSG 333

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G A+ A+G  L+   D  S  A    +           MQ  +
Sbjct: 334 QIVSRTGR--WKVFPVAGTAVTAVGLLLLHQLDTQSSTAVMSAFFFVFGLGLGLVMQVLV 391

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI--------AIP 412
           L  Q  V Y+D+   T+   FFR IGA FGVA+ G IF+  L + +            +P
Sbjct: 392 LIVQNAVPYEDLGVATSGATFFRSIGASFGVAVFGAIFAGRLGDQLSAAFRGVDLPPGVP 451

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           PE   A++A    +  LP  +R   + AY  A+   F   +P+ +L F  + F+
Sbjct: 452 PE---ALEADPRGIGALPPPLRPAALDAYSTAITDVFLYAVPVALLGFALAWFL 502



>gi|453081964|gb|EMF10012.1| major facilitator superfamily transporter [Mycosphaerella populorum
           SO2202]
          Length = 607

 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 164/475 (34%), Positives = 246/475 (51%), Gaps = 16/475 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI++TA+P I   FKA+D + W  ++YLLT  AFQ  +GK    F  K  ++ A+I FE
Sbjct: 123 NTIISTAIPKITDQFKAIDDVGWYGSSYLLTTCAFQLFFGKLYTFFSIKWVYMVALIIFE 182

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS +CG AP+  ++I+ RA+AGVG  GI S  ++I+++ V L  R  Y           
Sbjct: 183 IGSAVCGAAPDSMSLIVGRAVAGVGSAGIFSGAILIVANTVPLSKRPMYTGLIGAMYGLA 242

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK------GSLLQKLKR 174
               PL+GGAFTDHV+WRW FYINLP+GA+T+I  IF    P  +      G    KL++
Sbjct: 243 SVAGPLMGGAFTDHVSWRWCFYINLPIGAVTLIF-IFFFYHPTTRAKSLAAGGWKAKLEQ 301

Query: 175 IDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPV 234
            D  GTI+ +   + LLL L WGG++Y WS                 +G ++        
Sbjct: 302 FDMYGTIIFLPMIVCLLLALQWGGSKYSWSDGRIIGLFVVFGVLALVWGGIQYWKQDNAT 361

Query: 235 APPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVI 294
            PP L  +  V          G +FF  VYY+P++FQ +KG SAT SG+  IP+ILG+VI
Sbjct: 362 VPPRLITQRTVASAAWFGATLGASFFIFVYYLPIWFQAIKGVSATQSGIRNIPMILGLVI 421

Query: 295 ASVSSGQAVSRTDKFAYRTLSMTGAA-LIAIGSGLITLWDENSGRAPQICYMXXXXXXXX 353
            SV +G  ++      Y T  + G++ L+AIG+G+++    +SG    I Y         
Sbjct: 422 VSVIAGAIITV---LGYYTPFVIGSSVLMAIGAGMLSTLTPSSGSPEWIGYQVLFGAGVG 478

Query: 354 XXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPP 413
             MQ TL+  Q ++   D+   TA +MF + +G    +++   +F N L  N+  +   P
Sbjct: 479 MGMQQTLIAVQAVLPAPDIPIGTATVMFSQTLGGALFISVAQNVFQNKLLTNLRTLV--P 536

Query: 414 ELAGAV---KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
            L  A+     +  + + +P E +  V  AY GA+ + F   +    L  L S+F
Sbjct: 537 GLDPAIVQNTGATELASIIPAEFQDGVKLAYNGAIMSCFYVAVACAGLSILGSMF 591



>gi|256371823|ref|YP_003109647.1| EmrB/QacA subfamily drug resistance transporter [Acidimicrobium
           ferrooxidans DSM 10331]
 gi|506278685|ref|WP_015798460.1| DSBA oxidoreductase [Acidimicrobium ferrooxidans]
 gi|256008407|gb|ACU53974.1| drug resistance transporter, EmrB/QacA subfamily [Acidimicrobium
           ferrooxidans DSM 10331]
          Length = 672

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 172/487 (35%), Positives = 258/487 (52%), Gaps = 16/487 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP IA+D      ++WV TAYL+  TA  P +GK  D++GRK  F  A++ F 
Sbjct: 37  QTIVATALPTIANDLHGFSHLSWVVTAYLIASTASTPLWGKLGDLYGRKRFFQLAILIFL 96

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L GL+ NM  +I+FR + G+GGGG++     II D+VS +DRGKYQ          
Sbjct: 97  VGSALSGLSQNMLELILFRGLQGLGGGGLIVGAQAIIGDVVSPRDRGKYQGLFGAIFGVA 156

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F D ++WRW FYINLP+G    I+AI ++    P+ S   +  R+DY+GT
Sbjct: 157 SVVGPLLGGFFVDSLSWRWVFYINLPIG----IIAIAVISSALPQLSTRVQ-HRVDYLGT 211

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           ++V  +    +L    GG  YPW S                F LVE + A EP+    LF
Sbjct: 212 LLVALAATGYILVTTLGGLTYPWGSWQIITLTIASTVALVAFVLVEQR-ASEPILRMGLF 270

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +           F  G A F  + ++P + Q+V+G S T SG++L+PL+ G+++ S+ +G
Sbjct: 271 RNRTFSMTSAIGFVVGFAMFGAITFLPTFLQIVRGASPTVSGIQLLPLMAGLLVMSIGAG 330

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
             +SR  +  Y+   + G AL+ +G  L++    ++        M          MQ  +
Sbjct: 331 LLISRFGR--YKVFPIVGTALMTVGLWLLSRLSVHTSYGVIAFDMIVLGVGIGGVMQVLV 388

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA----IPPELA 416
           +  Q  V Y+D+   T+   FFR IGA FGVAI G+IF+N L + +  +A    +P  LA
Sbjct: 389 IAVQNAVGYEDLGVATSGATFFRSIGASFGVAIFGSIFTNALDSKLAAVATRYHLPANLA 448

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRTT 476
              + S   +  +P +I   ++ A+  +L   F    PIG+L F+ +LF+    P LR  
Sbjct: 449 VQAEESPKALTAIPAQILPQLLHAFASSLDRVFLVAAPIGLLAFVLTLFL----PELRLR 504

Query: 477 DTVVAFE 483
            +V A +
Sbjct: 505 RSVAAAD 511



>gi|330914599|ref|XP_003296706.1| hypothetical protein PTT_06872 [Pyrenophora teres f. teres 0-1]
 gi|311331047|gb|EFQ95213.1| hypothetical protein PTT_06872 [Pyrenophora teres f. teres 0-1]
          Length = 586

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 169/474 (35%), Positives = 247/474 (52%), Gaps = 13/474 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I  DFKAL+ + W  ++YLLT  A Q  YGK    F  K  +L A+  FE
Sbjct: 103 NTIIATAIPRITDDFKALNDVGWYGSSYLLTTCATQLFYGKLYTFFSIKWVYLIALFIFE 162

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+APN   +II RAI+GVG  GI S  ++IIS  V L+ R  Y           
Sbjct: 163 LGSLICGVAPNSIALIIGRAISGVGAAGIFSGAILIISVTVPLRQRPTYMGLIGGMYGIA 222

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP----KGSLLQKLKRID 176
               PL+GGAFTDH++WRW FYINLP GA+T    I  L + R     + +  Q+L++ D
Sbjct: 223 SVAGPLMGGAFTDHLSWRWCFYINLPFGAVTAAFIIPFLNVKRRGAKVQATWKQQLQKFD 282

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
             GT   + + I LLL L WGG++Y W S                F  ++     +   P
Sbjct: 283 LPGTACFLPAIICLLLALQWGGSKYAWGSARIVVLLVLFVLLVCAFLAIQWWKQEDATVP 342

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P +F   +V G        G AFF +VYY+P++FQ VKG SAT SG+  +P ILG+VI S
Sbjct: 343 PRVFLNRNVWGSAWFGAMLGAAFFLIVYYLPIWFQAVKGASATKSGIMNLPAILGLVIIS 402

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + +G AV+      Y    +  + L+AIG+GL++    +SG    I Y           M
Sbjct: 403 MLAGGAVTTLGY--YTPFMLISSVLMAIGAGLLSTLKVDSGSPMWIGYQFIFGAGVGFGM 460

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELA 416
           Q TL+  Q ++   D+   TA++MF + +G    +++   +F+N L  N+ ++   PEL 
Sbjct: 461 QQTLVAVQTVLPVDDIPIGTAIMMFCQTLGGALFISVGQNVFTNQLIKNLSSVV--PELN 518

Query: 417 GAVKAS--ATVVNQL--PIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
             +  S  AT +  +  P  + G V++AY   L   F   +  G +    + F+
Sbjct: 519 AQLVLSVGATELKHVIDPKFLPG-VLTAYNTTLTQTFYVSVACGAMSIAGAAFV 571



>gi|242796877|ref|XP_002482895.1| MFS multidrug transporter, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218719483|gb|EED18903.1| MFS multidrug transporter, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 607

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 167/489 (34%), Positives = 250/489 (51%), Gaps = 23/489 (4%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV+TA+P I ++FK+   I W  TAYLLT  AFQ  +GK    F  KATFL ++I FE+G
Sbjct: 57  IVSTAIPQITNEFKSAGDIGWYGTAYLLTNCAFQLLFGKVYTFFNVKATFLTSIILFEVG 116

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S LCG APN    I+ RAIAG+G GGILS V+++I   + L  R KYQ            
Sbjct: 117 SALCGAAPNSVAFILGRAIAGLGAGGILSGVIVVIVYAIPLHKRPKYQGFFGAVFAVASV 176

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIP-RPKGS--LLQKLKRIDYIG 179
             PL+GGAFT  VTWRW FYINLPLG + ++   FLL++P RP  +  L +KL +++ +G
Sbjct: 177 AGPLIGGAFTTDVTWRWCFYINLPLGGVVMVFIFFLLQVPDRPTANIPLKEKLHQLNVLG 236

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
            I +V   + L L L WGG    WS                 F L++     +   PP +
Sbjct: 237 MIALVPGVVCLCLALQWGGTTCAWSEGRIVALLVVAFALLIAFALIQVWKPEQATLPPRV 296

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F +  +   F  +   G     LVYY+P+YFQ + G SA  SG+ L+P+++ +V+AS+ +
Sbjct: 297 FLQRSIASGFWVSLCLGAHMNLLVYYLPIYFQAIDGASAVNSGIRLLPMVIPIVVASILT 356

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           GQ VS      Y    + G  L A+G+GL+T  + N+     I Y            QT 
Sbjct: 357 GQFVSYIGY--YTPFMIFGVCLTAVGAGLLTTLEINTTTGKWIGYQIIYGFGLGCSNQTP 414

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIEN------IAIPP 413
            +  Q ++  +D  ++ A LMF       FG  + G IF++V  N +EN      + IP 
Sbjct: 415 NMAAQTVLP-RDQVAIGASLMF-------FGQTLFGAIFTSVGQNVLENQLIKRFLDIPG 466

Query: 414 ELAGAVKASAT--VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNH-- 469
             A  ++++    ++  +P +     +  Y  ++R  F   + +  L  + ++FM     
Sbjct: 467 ITAKLIQSTGATDILKFIPADRHTEALVKYNDSIRVCFQVGLIVACLSIIGAVFMEWRTV 526

Query: 470 KPSLRTTDT 478
           K  L+  D+
Sbjct: 527 KKDLKKPDS 535



>gi|357413676|ref|YP_004925412.1| EmrB/QacA subfamily drug resistance transporter [Streptomyces
           flavogriseus ATCC 33331]
 gi|503922512|ref|WP_014156506.1| DSBA oxidoreductase [Streptomyces flavogriseus]
 gi|320011045|gb|ADW05895.1| drug resistance transporter, EmrB/QacA subfamily [Streptomyces
           flavogriseus ATCC 33331]
          Length = 681

 Score =  262 bits (670), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 179/475 (37%), Positives = 259/475 (54%), Gaps = 15/475 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I S+   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 39  QTIVSTALPTIVSELGGLDHLSWVVTAYLLAATAATPLWGKLGDQYGRKKLFQTAIVIFL 98

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS LCG+A NM  +I FRA+ G+GGGG++ L M I+ DIV+ ++RGKYQ          
Sbjct: 99  VGSALCGMAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDIVTPRERGKYQGLFGAVFGMT 158

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FYINLP+G + ++V    L IP     + +   RIDY+GT
Sbjct: 159 SVLGPLLGGFFTEHLSWRWVFYINLPIGVVALLVIATALHIP-----VRRTKHRIDYLGT 213

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  + W S                F   E + A EPV P  LF
Sbjct: 214 FLIASVATCLVLVASLGGTTWDWGSVQIIALAVLAVVLLVAFVAAERR-AAEPVLPLRLF 272

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
            R         +F  G A F  + Y+P + QVV G S T SG+ ++P++LG+++ S  SG
Sbjct: 273 HRRTFSLVAVISFVIGFAMFGAMTYLPTFLQVVHGISPTLSGVHMLPMVLGLLLTSTGSG 332

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLI-TLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           Q VSRT +  ++   + G AL  IG  L+ TL + +S     +C+           MQ  
Sbjct: 333 QIVSRTGR--WKVFPIAGTALTTIGLLLLHTLSETSSTWTMSLCFF-VFGAGLGLVMQVL 389

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL 415
           +L  Q  V Y+D+   T+   FFR IGA FGVA+ GT+F+N LT  +E+      +P  +
Sbjct: 390 VLIVQNSVGYEDLGVATSGATFFRSIGASFGVAVFGTVFTNRLTGKLEDALSGRPLPSGV 449

Query: 416 -AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNH 469
            AGA+ A    + +LP ++R  V+SAY  ++   F    P+ ++ F  + F+   
Sbjct: 450 DAGALAADPRAIGRLPADLRPSVLSAYSTSITDVFLYAAPVVLVAFALAWFLKEE 504



>gi|493077420|ref|WP_006124154.1| DSBA oxidoreductase [Streptomyces filamentosus]
 gi|291347255|gb|EFE74159.1| integral membrane transport protein [Streptomyces roseosporus NRRL
           15998]
          Length = 691

 Score =  262 bits (670), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 181/477 (37%), Positives = 262/477 (54%), Gaps = 17/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I S+   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 17  QTIVSTALPTIVSELGGLDHLSWVVTAYLLAATAATPLWGKLGDQYGRKKLFQTAIVIFL 76

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+V+ ++RGKYQ          
Sbjct: 77  IGSALCGVAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDLVTPRERGKYQGLFGAVFGVT 136

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLG--AITVIVAIFLLRIPRPKGSLLQKLKRIDYI 178
               PLLGG FT+H++WRW FYINLP+G  A+ VI A+  + + R K +       IDY+
Sbjct: 137 SVLGPLLGGFFTEHLSWRWVFYINLPIGVVALGVIAAVLHIPVHREKHT-------IDYL 189

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           GT ++     +L+L  + GG  + W+SP               F  VE + A+EPV P  
Sbjct: 190 GTFLIAAVATSLVLIASLGGTTWAWASPQIIVLAVLAVVLLVAFIAVERR-AVEPVLPLK 248

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           LF+          +F  G A F  + Y+P + QVV   + T SG+ ++P++ G++I S +
Sbjct: 249 LFRIRTFSLVAVISFVIGFAMFGAMTYLPTFLQVVHDITPTMSGVHMLPMVFGLLITSTA 308

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ VSRT +  ++   + G AL   G  L+   DENS       Y           MQ 
Sbjct: 309 SGQIVSRTGR--WKVFPLAGTALTTAGLLLLHNLDENSSTWLMSAYFFVFGAGLGLVMQV 366

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPE 414
            +L  Q  V Y+D+   T+   FFR IG+ FGVAI GTIF+N LT  + +      +PP 
Sbjct: 367 LVLVAQNSVSYQDLGVATSGATFFRSIGSAFGVAIFGTIFANRLTGQLTDALAGQPLPPG 426

Query: 415 L-AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           + AG++ A    + QLP ++R  V+SAY  ++   F    P+ +L F+ + F+   +
Sbjct: 427 IDAGSLSADPRAIGQLPADLRPGVLSAYSTSITDVFLYAAPVVLLAFVLAWFLREDR 483



>gi|495095321|ref|WP_007820144.1| MFS transporter [Streptomyces sp. Tu6071]
 gi|332743227|gb|EGJ73668.1| putative drug transporter [Streptomyces sp. Tu6071]
          Length = 823

 Score =  262 bits (670), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 167/471 (35%), Positives = 242/471 (51%), Gaps = 15/471 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LD+++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 69  QMIVATALPKIVGELHGLDRMSWAITAYLLTSTVGLPIYGKLGDLFGRKGVFQFAILVFV 128

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G + +M  +I FRAI G+G GG++  V  II DIV  ++RGKY           
Sbjct: 129 VGSALAGWSRSMDQLIAFRAIQGIGAGGLMIGVQAIIGDIVPPRERGKYMGLIGAAFGLA 188

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDHV+WRW FY N+P G +T++V   +L++PRP+     +  ++D +G 
Sbjct: 189 SVAGPLLGGFFTDHVSWRWCFYFNVPFGLLTLVVVTLVLKLPRPR-----RKAKLDVLGA 243

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++  ++  L+L  +WGG EY W S                F L E   A EP+ P  LF
Sbjct: 244 TLLAIASACLVLLTSWGGTEYAWGSRMIIGLGAGAVVSAALFLLAEHH-AAEPLIPLRLF 302

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P Y Q+V G SAT SGL ++P++ GVVIAS+ +G
Sbjct: 303 RERAFNVTGLVGAVVGIALFGAASYLPTYLQMVDGASATESGLLMLPMMGGVVIASIVAG 362

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q ++RT    YR   + G  L  +G  L++  +  + R     +M          M   +
Sbjct: 363 QLITRTGH--YRVYPILGGVLSTLGMWLLSRLEIGTSRFTYSVWMAVLGAGIGLIMPVLV 420

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV- 419
           L  Q  V   D+ + T+   +FR IG   G AI GT+F++ L + + +    P  AG   
Sbjct: 421 LAVQNAVRPGDLGTATSANNYFRQIGGSVGAAIFGTLFASRLADALADRL--PAGAGDTL 478

Query: 420 ----KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
                 +  +V+ LP  +R   I AY  A+   F   +P+  L  L + F+
Sbjct: 479 PDPESVTPQLVHHLPAPLRDGFIQAYADAMPRIFLYLVPVLALGLLIACFL 529



>gi|497956530|ref|WP_010270686.1| MFS transporter [Streptomyces sp. SA3_actG]
          Length = 823

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 167/471 (35%), Positives = 242/471 (51%), Gaps = 15/471 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LD+++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 69  QMIVATALPKIVGELHGLDRMSWAITAYLLTSTVGLPIYGKLGDLFGRKGVFQFAILVFV 128

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G + +M  +I FRAI G+G GG++  V  II DIV  ++RGKY           
Sbjct: 129 VGSALAGWSRSMDQLIAFRAIQGIGAGGLMIGVQAIIGDIVPPRERGKYMGLIGAAFGLA 188

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDHV+WRW FY N+P G +T++V   +L++PRP+     +  ++D +G 
Sbjct: 189 SVAGPLLGGFFTDHVSWRWCFYFNVPFGLLTLVVVTLVLKLPRPR-----RKAKLDVLGA 243

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++  ++  L+L  +WGG EY W S                F L E   A EP+ P  LF
Sbjct: 244 TLLAIASACLVLLTSWGGTEYAWGSRMIIGLGAGAVVSAALFLLAE-HYAAEPLIPLRLF 302

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P Y Q+V G SAT SGL ++P++ GVVIAS+ +G
Sbjct: 303 RERAFNVTGLVGAVVGIALFGAASYLPTYLQMVDGASATESGLLMLPMMGGVVIASIVAG 362

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q ++RT    YR   + G  L  +G  L++  +  + R     +M          M   +
Sbjct: 363 QLITRTGH--YRVYPILGGVLSTLGMWLLSRLEIGTSRFTYSVWMAVLGAGIGLIMPVLV 420

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV- 419
           L  Q  V   D+ + T+   +FR IG   G AI GT+F++ L + + +    P  AG   
Sbjct: 421 LAVQNAVRPGDLGTATSANNYFRQIGGSVGAAIFGTLFASRLADALADRL--PAGAGDTL 478

Query: 420 ----KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
                 +  +V+ LP  +R   I AY  A+   F   +P+  L  L + F+
Sbjct: 479 PDPESVTPQLVHHLPAPLRDGFIQAYADAMPRIFLYLVPVLALGLLIACFL 529



>gi|496360570|ref|WP_009069746.1| efflux protein, partial [Streptomyces sp. SPB78]
 gi|302431723|gb|EFL03539.1| efflux protein [Streptomyces sp. SPB78]
          Length = 674

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 167/471 (35%), Positives = 242/471 (51%), Gaps = 15/471 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LD+++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 106 QMIVATALPKIVGELHGLDRMSWAITAYLLTSTVGLPIYGKLGDLFGRKGVFQFAILVFV 165

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G + +M  +I FRAI G+G GG++  V  II DIV  ++RGKY           
Sbjct: 166 VGSALAGWSRSMDQLIAFRAIQGIGAGGLMIGVQAIIGDIVPPRERGKYMGLIGAAFGLA 225

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDHV+WRW FY N+P G +T++V   +L++PRP+     +  ++D +G 
Sbjct: 226 SVAGPLLGGFFTDHVSWRWCFYFNVPFGLLTLVVVTLVLKLPRPR-----RKAKLDLLGA 280

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++  ++  L+L  +WGG EY W S                F L E   A EP+ P  LF
Sbjct: 281 TLLAIASACLVLLTSWGGTEYAWGSRMIIGLGAGAVVSAALFLLAE-HYAAEPLIPLRLF 339

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P Y Q+V G SAT SGL ++P++ GVVIAS+ +G
Sbjct: 340 RERAFNVTGLVGAVVGIALFGAASYLPTYLQMVDGASATESGLLMLPMMGGVVIASIVAG 399

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q ++RT    YR   + G  L  +G  L++  +  + R     +M          M   +
Sbjct: 400 QLITRTGH--YRVYPILGGVLSTLGMWLLSRLEIGTSRFTYSVWMAVLGAGIGLIMPVLV 457

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAV- 419
           L  Q  V   D+ + T+   +FR IG   G AI GT+F++ L + + +    P  AG   
Sbjct: 458 LAVQNAVRPGDLGTATSANNYFRQIGGSVGAAIFGTLFASRLADALADRL--PAGAGDTL 515

Query: 420 ----KASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
                 +  +V+ LP  +R   I AY  A+   F   +P+  L  L + F+
Sbjct: 516 PDPESVTPQLVHHLPAPLRDGFIQAYADAMPRIFLYLVPVLALGLLIACFL 566



>gi|497756394|ref|WP_010070578.1| DSBA oxidoreductase [Streptomyces filamentosus]
          Length = 715

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 179/475 (37%), Positives = 261/475 (54%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I S+   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 41  QTIVSTALPTIVSELGGLDHLSWVVTAYLLAATAATPLWGKLGDQYGRKKLFQTAIVIFL 100

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+V+ ++RGKYQ          
Sbjct: 101 IGSALCGVAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDLVTPRERGKYQGLFGAVFGVT 160

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FYINLP+G + + V   +L IP     + ++   IDY+GT
Sbjct: 161 SVLGPLLGGFFTEHLSWRWVFYINLPIGVVALGVIAAVLHIP-----VHREKHTIDYLGT 215

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++     +L+L  + GG  + W+SP               F  VE + A+EPV P  LF
Sbjct: 216 FLIAAVATSLVLIASLGGTTWAWASPQIIVLAVLAVVLLVAFIAVERR-AVEPVLPLKLF 274

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV   + T SG+ ++P++ G++I S +SG
Sbjct: 275 RIRTFSLVAVISFVIGFAMFGAMTYLPTFLQVVHDITPTMSGVHMLPMVFGLLITSTASG 334

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G AL   G  L+   DENS       Y           MQ  +
Sbjct: 335 QIVSRTGR--WKVFPLAGTALTTAGLLLLHNLDENSSTWLMSAYFFVFGAGLGLVMQVLV 392

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPEL- 415
           L  Q  V Y+D+   T+   FFR IG+ FGVAI GTIF+N LT  + +      +PP + 
Sbjct: 393 LVAQNSVSYQDLGVATSGATFFRSIGSAFGVAIFGTIFANRLTGQLTDALAGQPLPPGID 452

Query: 416 AGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           AG++ A    + QLP ++R  V+SAY  ++   F    P+ +L F+ + F+   +
Sbjct: 453 AGSLSADPRAIGQLPADLRPGVLSAYSTSITDVFLYAAPVVLLAFVLAWFLREDR 507



>gi|471321419|ref|YP_007520449.1| transmembrane efflux protein [Streptomyces davawensis JCM 4913]
 gi|505469926|ref|WP_015656716.1| transmembrane efflux protein [Streptomyces davawensis]
 gi|408528148|emb|CCK26322.1| transmembrane efflux protein [Streptomyces davawensis JCM 4913]
          Length = 795

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 158/453 (34%), Positives = 235/453 (51%), Gaps = 13/453 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LD+++W  TAYLLT T   P YGK  D+ GRK  F FA++ F 
Sbjct: 52  QMIVATALPRIVGELHGLDRMSWAITAYLLTSTIGLPVYGKLGDLLGRKGVFQFAIVVFV 111

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A  M  +I +RA+ GVG GG++  V  II+DIV  + RG+Y           
Sbjct: 112 VGSALAGRAETMDQLIAYRAVQGVGAGGLMIGVQAIIADIVPPRQRGRYMGLIGAAFGLA 171

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY N+P G +T+ V   +L++P+P         R+D +G+
Sbjct: 172 SVAGPLLGGYFTDHLSWRWCFYFNVPFGIVTLAVVAAVLKLPKPTAR-----PRLDILGS 226

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG E+ W S                F LV  + A EP+ P  LF
Sbjct: 227 LLLAAASTCLVLLTSWGGTEHAWGSRIILGLGAGAAAATVLF-LVAERFAPEPLIPLRLF 285

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P + Q+V G SAT SGL ++P++ G+V ASV +G
Sbjct: 286 RDSVFTITSLVGLVIGVALFGAASYLPTFLQMVDGASATESGLLMLPMMGGIVGASVVAG 345

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +S T +  Y+   + G AL  +G  L++  D ++ R     +M          M   +
Sbjct: 346 QLISHTGR--YKIYPVLGGALSVLGMWLLSRLDIDTPRLHYSLWMAVLGAGIGMVMPVLI 403

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           L  Q  V   D+ + T+   +FR IG   G AI GT+F++ LT+ + +  +P    G + 
Sbjct: 404 LAVQNSVRPADLGTATSANNYFRQIGGSVGAAIFGTLFADRLTDALAD-RLPASAGGGLP 462

Query: 421 ASATV----VNQLPIEIRGPVISAYVGALRTAF 449
              ++    V+ LP  +R   I AY  A+   F
Sbjct: 463 DPESITPQAVHALPPGLRDAYIQAYADAMPRIF 495



>gi|497404122|ref|WP_009718320.1| DSBA oxidoreductase [Streptomyces himastatinicus]
 gi|302463427|gb|EFL26520.1| drug transporter [Streptomyces himastatinicus ATCC 53653]
          Length = 683

 Score =  262 bits (669), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 174/483 (36%), Positives = 254/483 (52%), Gaps = 15/483 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 46  QTIVSTALPTIVSDLGGLDHLSWVVTAYLLASTAATPLWGKLGDQYGRKKLFQAAIVIFL 105

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS LCGLA +M  +I FR + G+GGGG++ L M I+ DIV  ++RG+YQ          
Sbjct: 106 AGSALCGLAQDMGQLIAFRGLQGLGGGGLIVLSMAIVGDIVPPRERGRYQGLFGAVFSCT 165

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F D ++WRW FYIN+P+G + ++V   +L +P     + +    IDY+GT
Sbjct: 166 SVLGPLLGGLFVDQLSWRWVFYINIPVGVVALLVIASVLHLP-----VGRTRHTIDYLGT 220

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++ G    L+L  + GG  + W S                F  VE + A EPV P  LF
Sbjct: 221 GLIAGVAATLVLMASLGGVSFGWGSWQILGLAALGAVLLIAFVQVERR-AAEPVLPLKLF 279

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +      C    F  G A F  + Y+P + QVV+G S T SG+ ++P++LG+++ S  SG
Sbjct: 280 RSRTFTLCAVIGFVVGFAMFGSMIYLPTFLQVVQGVSPTLSGVHMLPMVLGMLLCSTVSG 339

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           + VSRT +  Y+   + G A+  IG  L+    E SG      Y           +Q  +
Sbjct: 340 ELVSRTGR--YKVFPILGTAVTGIGLLLLHQLRETSGVVETSAYFFVFGCGLGLVIQVLV 397

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIPPELA 416
           L  Q  V Y+D+   T+   FFR IGA FGV++ G+IF+  LT  I +      +PP + 
Sbjct: 398 LIVQNSVSYQDLGVATSGATFFRSIGASFGVSVFGSIFAGNLTPKIADALAGRPLPPGVT 457

Query: 417 -GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRT 475
            G + A    + +LP   R  V+ AY  ++   F   +P+ +L F+ + F+   +  LR 
Sbjct: 458 PGGLAADPRALGRLPPGDRAGVVHAYALSITDVFLYAVPVVLLAFVLAWFL--REEPLRA 515

Query: 476 TDT 478
           + T
Sbjct: 516 SVT 518



>gi|159039618|ref|YP_001538871.1| EmrB/QacA family drug resistance transporter [Salinispora arenicola
           CNS-205]
 gi|501135493|ref|WP_012184119.1| transporter [Salinispora arenicola]
 gi|157918453|gb|ABV99880.1| drug resistance transporter, EmrB/QacA subfamily [Salinispora
           arenicola CNS-205]
          Length = 523

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 151/409 (36%), Positives = 227/409 (55%), Gaps = 17/409 (4%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           IV+TALP I  +F  LD   WV TAY+L  T   P +GK  D+FGRK+ FL +V+ F +G
Sbjct: 33  IVSTALPRIVGEFGGLDHFTWVVTAYVLGTTVSTPIWGKLGDLFGRKSIFLTSVVIFLVG 92

Query: 63  SLLCGLA---------PNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXX 113
           S LCG+A           M  +I FRA+ G+G GG+L  V+ II D+V  ++RG+YQ   
Sbjct: 93  SALCGMAGSNLLGGPDDGMAELIAFRAVQGLGAGGLLVGVLAIIGDLVPPRERGRYQGMI 152

Query: 114 XXXXXXXXXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLK 173
                      PL+GG  TDH++WRW+FY+NLPLG + +++ +  LR+PR +        
Sbjct: 153 AGIMAIALVAGPLVGGFITDHLSWRWAFYVNLPLGGVALVLLVATLRLPRYRTE-----H 207

Query: 174 RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP 233
           RID++G  ++     A++L   WGGNEY W SP               F +VE + A+EP
Sbjct: 208 RIDWLGAALLAVGITAMVLITTWGGNEYAWRSPQIVGLVGLAVAALAVFAVVELR-AVEP 266

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
           + P  LF   +        F  G A F  + ++PLY Q V+G SAT SGL L+PL+ G++
Sbjct: 267 ILPLKLFANRNFALISAIGFLLGFAMFGAMSFLPLYQQTVQGASATESGLLLLPLMFGML 326

Query: 294 IASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXX 353
           + S++ G+ ++RT +  YR   + G  +++ G  L+T  D  +GR     Y+        
Sbjct: 327 VVSLAVGRTITRTGR--YRVFPIVGGVVMSAGMALLTYLDAQTGRTESSLYLFVLGVGMG 384

Query: 354 XXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVL 402
             MQTT+L  Q  V+ +D+ + +    FFR IG  FG+++ G +F++ L
Sbjct: 385 FLMQTTMLIAQNSVDQRDLGAASGAATFFRSIGGSFGISLFGAVFASRL 433



>gi|396457914|ref|XP_003833570.1| similar to MFS toxin efflux pump (AflT) [Leptosphaeria maculans
           JN3]
 gi|312210118|emb|CBX90205.1| similar to MFS toxin efflux pump (AflT) [Leptosphaeria maculans
           JN3]
          Length = 560

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 167/473 (35%), Positives = 248/473 (52%), Gaps = 16/473 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATA+P I  +FKAL+ + W  ++YLLT  A Q  YGKF   +  K  +L A+  FE
Sbjct: 77  NTIIATAIPRITDEFKALNDVGWYGSSYLLTTCATQLIYGKFYSFYSIKWVYLTALSIFE 136

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+APN T +II RAIAGVG  G+ S  ++I+S  V L+ R  Y           
Sbjct: 137 LGSLICGVAPNSTALIIGRAIAGVGAAGVFSGAILIVSVTVPLRQRPTYMGLIGGMYGIA 196

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPR----PKGSLLQKLKRID 176
               PL+GGAFTDH+TWRW FYINLP GA+T    +   +I R     + +L +++K+ D
Sbjct: 197 SVAGPLMGGAFTDHLTWRWCFYINLPFGAVTAGFILLFFQISRREKKSEATLKEQIKKFD 256

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
             GT + + + I LLL L WGG+ Y W+S                F  ++     +   P
Sbjct: 257 LEGTSLFLPAIICLLLALQWGGSTYAWNSGRVVALLVLAGLLIIGFIAIQWWKQEDATVP 316

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
           P +F   +V G        G  FF +VY++P++FQ +KG SAT SG+  +P ILG+VI S
Sbjct: 317 PRIFLNRNVWGSAWFGAMLGAGFFVMVYFLPIWFQAIKGVSATKSGIMNLPAILGLVIVS 376

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + +G  V+      Y    +  + L++IG+GL++  + +SG    I Y           M
Sbjct: 377 MGAGALVTVIGY--YTPFMLLSSVLMSIGAGLLSTLEVDSGSPKWIGYQALFGAGVGFGM 434

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPEL- 415
           Q TL+  Q  +  KD+    A  MFF+ +G    +++   +F+N L  N+   A+ P+L 
Sbjct: 435 QQTLIAVQTALPAKDIPIAVACQMFFQTLGGALFISVAQNVFTNQLIKNLA--AVVPDLD 492

Query: 416 AGAVKASATVVNQLPIEIR--GPVISAYVGALRTAF-----TADIPIGILCFL 461
           A  V+ +     +  IE R    V++AY   L   F     TA + IG   F+
Sbjct: 493 ASIVRMTGATELKTVIEQRFLPGVLTAYNLTLTQVFYVSVATATVSIGGAAFV 545



>gi|497734638|ref|WP_010048822.1| transporter [Streptomyces chartreusis]
          Length = 529

 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 153/456 (33%), Positives = 235/456 (51%), Gaps = 23/456 (5%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           I+ TA+P I  +   L+ ++WV TAY L   A  P +GK  D++GRK TFL +++ F IG
Sbjct: 42  IIGTAMPTIVGELGGLEHLSWVVTAYTLATAASTPLWGKLGDMYGRKGTFLSSIVIFLIG 101

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A NM  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 102 SALSGMAQNMGELIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMMAGVMALAMI 161

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TD+  WRW+FYINLPLG + ++    +L +P+ +        RIDY+G  +
Sbjct: 162 GGPLVGGTITDNWGWRWAFYINLPLGVVALVAVSAVLHLPKKRSE-----ARIDYLGAAL 216

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     A++L   WGG EY WSS                F   +TK A EPV P H+F+ 
Sbjct: 217 LTVGITAIVLVTTWGGTEYAWSSARIMELIGIGVAALVGFAFWQTK-AAEPVVPLHIFRS 275

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F    ++PLY Q V+G SAT SGL L+P++  +++ S+ +G+ 
Sbjct: 276 RNFTLMSVIGFITGFVMFGATLFLPLYQQSVQGASATNSGLLLLPMLGAMLVTSMVAGRV 335

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T +  Y+   + G+ L+ +G  L++  D  + R     +M          MQ T+L 
Sbjct: 336 TTNTGR--YKVFPILGSVLMTVGLYLLSTMDTGTSRVTSGVFMAVVGFGMGCLMQITMLV 393

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR +G+ FGVAI+G +F+N + +      +  E AGA+ + 
Sbjct: 394 AQNSVEMKDMGVASSSTTLFRTLGSSFGVAIMGALFNNRVQD------VMSERAGALGSK 447

Query: 423 AT---------VVNQLPIEIRGPVISAYVGALRTAF 449
            T          + +LP+  R     A      +AF
Sbjct: 448 VTEQSAQLDAKSLEKLPVLAREAYQHAVSAGTHSAF 483



>gi|477533763|gb|ENH85334.1| MFS gliotoxin efflux transporter [Colletotrichum orbiculare MAFF
           240422]
          Length = 565

 Score =  261 bits (668), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 167/469 (35%), Positives = 243/469 (51%), Gaps = 12/469 (2%)

Query: 2   TIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEI 61
           TIVATA+P I  +FK LD++AW   A+ + + AFQ T+GK    F  K +FL ++  FE+
Sbjct: 84  TIVATAIPKITDEFKGLDQVAWYGAAFFMCVAAFQSTWGKAYKYFPLKTSFLLSIFIFEV 143

Query: 62  GSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXX 121
           GSL+CG+APN   +I+ RAIAGVG  GI S    II        R  +            
Sbjct: 144 GSLICGVAPNSVALIVGRAIAGVGAAGIGSGAYTIIGFSAPPDKRPTFTGIIGASYGIAS 203

Query: 122 XXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP----KGSLLQKLKRIDY 177
              PL+GGAFTDHV+WRW FYINLP+G ++  + +F    P      K SL +K  ++D 
Sbjct: 204 VIGPLIGGAFTDHVSWRWCFYINLPIGGVSAAIILFFFHTPPQAVPVKASLREKFLQMDL 263

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
           +GT +++G+TIA LL L WGG+ +PW+S                F ++E       +  P
Sbjct: 264 LGTALIMGATIAFLLALQWGGHTHPWNSSVVVGLLVGFGLILVAFIVLEWYQGERSMIAP 323

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            LF    V       FF   A+F LVYY+P+YFQ V   S T SG+  +PLI+ V IA++
Sbjct: 324 RLFSDRTVYISSLYAFFFAGAYFVLVYYLPIYFQSVDNASPTQSGVRNLPLIIAVTIATI 383

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
           +SG  +S T    Y  + +  AA+  IG+GL+   D  +     I Y            Q
Sbjct: 384 ASGITISMTG--IYTPILVASAAIATIGAGLLYTLDIGTSSDKWIGYQVLAGLAWGAGFQ 441

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
             ++  QG V   D+AS TA+L+FF+ +G  F VA   + F  ++T     +A  P++  
Sbjct: 442 VPIIAVQGTVGESDLASATAVLLFFQTVGGAFFVAAAQSGF--LITMLKSAVAAVPDIDA 499

Query: 418 --AVKASATVVNQ-LPIEIRGPVISAYVGALRTAFTADIP-IGILCFLA 462
              V   AT + +    ++   VI AY+  L+  F   +  +G+  FLA
Sbjct: 500 NLVVLTGATQIREAFAPDVVPAVIRAYMDGLKVTFALTVAGVGVSFFLA 548



>gi|375141930|ref|YP_005002579.1| EmrB/QacA subfamily drug resistance transporter [Mycobacterium
           rhodesiae NBB3]
 gi|503979113|ref|WP_014213107.1| MFS transporter [Mycobacterium rhodesiae]
 gi|359822551|gb|AEV75364.1| drug resistance transporter, EmrB/QacA subfamily [Mycobacterium
           rhodesiae NBB3]
          Length = 684

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 170/489 (34%), Positives = 256/489 (52%), Gaps = 22/489 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       +WV T+YLL  T      GK  D+FGRKA F  +V+ F 
Sbjct: 43  QTIVATALPTVVADLGGAGHQSWVVTSYLLASTIVTAVVGKLGDLFGRKAVFQASVLFFL 102

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS+LCGLA +MT ++  RA+ G+GGG ++   M +I +++ L++RG+YQ          
Sbjct: 103 AGSILCGLAGSMTMLVASRALQGIGGGAMMVTAMAVIGEVIPLRERGRYQGALGAVFGVT 162

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR-IDYIG 179
               PLLGG FTDH+TWRW+F+IN+P     +++ +  + IP    SL +  K  IDY G
Sbjct: 163 TVIGPLLGGFFTDHLTWRWAFWINVP--IGIIVIVVGTMAIP----SLAKAAKPVIDYAG 216

Query: 180 TIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHL 239
            + +  +   L L  +WGG+ Y WSSP               F  VE++   EP+ P  L
Sbjct: 217 MLFIGLAASGLTLATSWGGSTYAWSSPMIIGLFAASLVALAIFVRVESRTP-EPILPIRL 275

Query: 240 FKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSS 299
           F       C    F  G A    + ++P + Q V G SAT SG+  +P++ G++I S+ S
Sbjct: 276 FASPVFTVCCILGFIVGFAMLGALTFLPTFMQFVNGVSATESGMRTLPMVAGMLITSIGS 335

Query: 300 GQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTT 359
           GQ V RT +  Y+   + G A +A+G  L++     +    Q   +          MQ  
Sbjct: 336 GQIVGRTGR--YKVFPVAGTAAMALGFLLLSQMGAATPLWQQSMNLFVLGAGIGLCMQVL 393

Query: 360 LLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGA- 418
           +L  Q    + D+   T+ + FFR IG+ FG AI G++F+N LT+      IP  LA + 
Sbjct: 394 ILVVQNTSSFSDLGVATSGVTFFRTIGSSFGAAIFGSLFANFLTSR-----IPGALAASG 448

Query: 419 --VKA--SATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLR 474
             V+A  S   ++ L  E+  P++ AY  +L T F   +P+ I+ F+ SLF+   +  LR
Sbjct: 449 APVRAADSPQALHALSPEMAAPIVDAYADSLGTVFLCGVPVAIVGFVVSLFLKEVR--LR 506

Query: 475 TTDTVVAFE 483
             +TV A +
Sbjct: 507 EIETVSASD 515



>gi|238499375|ref|XP_002380922.1| efflux pump antibiotic resistance protein, putative [Aspergillus
           flavus NRRL3357]
 gi|317150205|ref|XP_001823867.2| MFS toxin efflux pump [Aspergillus oryzae RIB40]
 gi|220692675|gb|EED49021.1| efflux pump antibiotic resistance protein, putative [Aspergillus
           flavus NRRL3357]
          Length = 582

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 158/468 (33%), Positives = 245/468 (52%), Gaps = 6/468 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI++TA+P I   FK+L+ + W  +AYLLT  A   T+GK    +  K  +L A+  FE
Sbjct: 100 NTIISTAIPKITDQFKSLEDVGWYGSAYLLTTCALCLTFGKLYTFYSTKWVYLTALFVFE 159

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+CG+APN  T+I+ RAIAG+G  G+ S  +III+  V L  R  +           
Sbjct: 160 LGSLICGIAPNSLTLIVGRAIAGLGAAGLFSGALIIIAQTVPLNRRPIFAAMMGSMYGIA 219

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRP---KGSLLQKLKRIDY 177
               PL+GGAFTD ++WRW FYINLP G +T    IF  R P+          ++ ++D+
Sbjct: 220 SVAGPLMGGAFTDRLSWRWCFYINLPFGGVTAFFIIFFFRAPKSVKDNSGFKNQMGQLDF 279

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
            GT + + S I +LL L WGG  Y W++                F  ++     +   PP
Sbjct: 280 PGTALFMPSIICVLLALQWGGTMYAWNNARIIALFVVFGVLLIAFCGIQWWQQDKATVPP 339

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            L K  +V G    +F  G AFF  +YY+P++FQ +KG +AT SG+  +PL+L +++AS+
Sbjct: 340 RLVKNRNVWGAAAYSFCVGGAFFIYIYYLPIWFQAIKGVTATRSGIMNLPLLLPMIVASI 399

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
           ++G  V+      Y    +    L++IG GL++    +SG A  I Y           +Q
Sbjct: 400 AAGACVTMVGY--YTPFMIATPILMSIGGGLLSTLKVDSGDAAWIGYQVLFGVGVGLGLQ 457

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
             ++  Q  +   DV + TA++MF + +G    V++   +F N L  NI   A   ++A 
Sbjct: 458 QPMIVVQAALPIADVPTATAIVMFTQTLGGALFVSVAQNVFQNQLRKNILARAPEVDIAK 517

Query: 418 AVKASATVVNQ-LPIEIRGPVISAYVGALRTAFTADIPIGILCFLASL 464
            V A AT++ Q +  +I   V+ +Y  A+   F A + IG + F A+L
Sbjct: 518 VVGAGATMLRQAVSKDILPTVLESYNDAITQTFYAAVAIGAIGFFAAL 565



>gi|501303484|dbj|GAC92907.1| hypothetical protein PHSY_000466 [Pseudozyma hubeiensis SY62]
          Length = 697

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 169/467 (36%), Positives = 259/467 (55%), Gaps = 7/467 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q+I++TAL  I + F A ++ +W++T+YLLT TA  P YG+FSDIFGRK   + A+  F 
Sbjct: 158 QSIISTALGTITASFHAGNESSWLSTSYLLTSTAASPLYGRFSDIFGRKTCMIVALTGFL 217

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LC  A ++T +I+FRAIAG  GGGI+SLVM+I+ D+VSL++RG YQ          
Sbjct: 218 IGSALCAAAQSITQLIVFRAIAGCFGGGIVSLVMVIVGDVVSLRERGTYQGVLGVVVAVS 277

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PL+GGA    V WRW F + +P+  + +++ + LL + R +GS+  KL +IDY+GT
Sbjct: 278 NAGGPLIGGALAS-VGWRWCFILAVPIVIVALVMVVILLPLKRVEGSVKSKLAKIDYLGT 336

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            +V+  ++ LLL LNWGG +Y W+SP               F +VE ++A  P+ P  LF
Sbjct: 337 ALVLSGSVLLLLGLNWGGQQYSWTSPHVLVTMILGVVIFIAFAIVEARVAALPLVPMRLF 396

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K   V          G  F+ L+++VP + QVVKG S   +G+ LIPL+      S  +G
Sbjct: 397 KVGTVCSVLVQTVCSGGIFYLLLFFVPQFTQVVKGYSGVKAGVTLIPLMALQATTSTVAG 456

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
              SRT K  Y+ L + G  + +IG GL++L +E S     I ++          +QTTL
Sbjct: 457 VLTSRTGK--YKVLIVVGFGIFSIGVGLLSLLNERSSIGEVIGFLLLAGFGAGGTLQTTL 514

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           +  Q  V  +D+A VT+   F RL G   G+AI   I +N + + ++   +P ++   V 
Sbjct: 515 VAAQNAVGREDMAVVTSTRNFMRLFGGTLGLAISYAILNNTVRSQVKT--LPSDVIAQVV 572

Query: 421 ASATVVN--QLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
            +  ++   +        ++ AYV A R  F   + + +L F+ +L 
Sbjct: 573 RNPKMITSGEFDAATSELLLRAYVQAFRNVFRFGLGMVLLAFVVTLL 619



>gi|490049552|ref|WP_003951908.1| MFS transporter [Streptomyces albus]
 gi|291358136|gb|EFE85038.1| efflux protein [Streptomyces albus J1074]
          Length = 811

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 163/450 (36%), Positives = 237/450 (52%), Gaps = 15/450 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 54  QMIVATALPKIVGELHGLDKMSWAITAYLLTSTVSLPVYGKLGDLFGRKGVFQFAIVVFI 113

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS L G + +M  +I FRA+ G+G GG++  V  II+DIV  ++R +Y           
Sbjct: 114 IGSGLAGWSRSMDELIAFRALQGLGAGGLMIGVQAIIADIVPPRERARYMGLIGAAFGLA 173

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY N+P G +T+ V   +L++P+P         R+D  G 
Sbjct: 174 SVAGPLLGGFFTDHMSWRWCFYFNVPFGLVTLAVVAVVLKLPKPA-----TRGRLDVPGI 228

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F LV  + A EP+ P  LF
Sbjct: 229 LLLATASTCLVLLTSWGGTEYAWGSGTILALAAGAVLSTVLF-LVAERYAAEPLIPLRLF 287

Query: 241 KR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    ++ G        G+A F    Y+P + Q+V G SAT SGL ++P++ GVV AS+ 
Sbjct: 288 RESIFNLTGLI--GAVVGIALFGAASYLPTFLQMVDGASATESGLLMLPMMGGVVGASIL 345

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ +S+T +  YR   + G  L A+G  L++L +  + R     +M          M  
Sbjct: 346 SGQLISKTGR--YRPYPIAGGVLAALGMWLLSLLETGTSRLHYSIWMAVLGAGIGLIMPV 403

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGA 418
            +L  Q  V   D+ + T+   +FR IG   G A+ GT+F+  LT+ + +       AG+
Sbjct: 404 LVLAVQNSVRPADLGTATSANNYFRQIGGSVGAAVFGTLFAQRLTDALADRLPAGAPAGS 463

Query: 419 VKASA---TVVNQLPIEIRGPVISAYVGAL 445
           V A A     V+ +   +R P I AY  A+
Sbjct: 464 VDAEAITPQAVHAMAPALRDPYIQAYADAM 493



>gi|493087690|ref|WP_006128722.1| MFS transporter [Streptomyces filamentosus]
 gi|291351837|gb|EFE78741.1| efflux protein [Streptomyces roseosporus NRRL 15998]
          Length = 811

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 169/475 (35%), Positives = 251/475 (52%), Gaps = 16/475 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   L+K++W  TAYLL  T   P YGK  D+FGRK  F FA++ F 
Sbjct: 69  QMIVATALPKIVGELHGLEKMSWAVTAYLLASTIVLPLYGKLGDLFGRKGVFQFAIVVFI 128

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS L G +  M  +I FRA+ G+GGGG++  V  II+DIV  ++RG+Y           
Sbjct: 129 IGSALAGWSRTMDELIAFRALQGIGGGGLMIGVQAIIADIVPARERGRYMGLIGAVFGLA 188

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH +WRW FYIN+P G +T+ V   +L++PRP         R+D +G 
Sbjct: 189 SVAGPLLGGFFTDHASWRWCFYINVPFGLVTLAVIAVVLKLPRPA-----VRPRLDVLGA 243

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++  ++  L+L  +WGG EY W S                F  VE + A EP+ P  LF
Sbjct: 244 ALLAAASTCLVLVTSWGGTEYAWGSRTILGLAAGAVVTTALFVAVEHR-AAEPIIPLRLF 302

Query: 241 KR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    +V G        G+A F    Y+P Y Q+V G SAT SGL ++P++LG+V  S++
Sbjct: 303 RDSVFNVTGL--VGAVVGIALFGAASYLPTYLQMVDGVSATESGLLMLPMMLGIVGGSIA 360

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ ++RT +  YR   + G+A+  +G GL++L + ++       Y           M  
Sbjct: 361 SGQLITRTGR--YRIYPIVGSAVSVVGMGLLSLLEADTSPVAYSFYQAVLGLGIGLVMSV 418

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIP--PELA 416
            +L  Q  V   D+ + T+   +FR IG   G AI GT+F+  L++ +  + +P   EL 
Sbjct: 419 LVLAVQNSVRPSDLGTATSANNYFRQIGGSVGAAIFGTLFAGRLSDAL-GVRLPTGAELP 477

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKP 471
                +  +V+ +   +R   I AYV A+   F   +P+ +L  + + F+   KP
Sbjct: 478 DPESITPQIVHAMEPALRDAYIQAYVDAMPRIFLYLVPVLVLGLILAFFL-KEKP 531



>gi|497758504|ref|WP_010072688.1| MFS transporter [Streptomyces filamentosus]
          Length = 817

 Score =  261 bits (667), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 169/475 (35%), Positives = 251/475 (52%), Gaps = 16/475 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   L+K++W  TAYLL  T   P YGK  D+FGRK  F FA++ F 
Sbjct: 75  QMIVATALPKIVGELHGLEKMSWAVTAYLLASTIVLPLYGKLGDLFGRKGVFQFAIVVFI 134

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS L G +  M  +I FRA+ G+GGGG++  V  II+DIV  ++RG+Y           
Sbjct: 135 IGSALAGWSRTMDELIAFRALQGIGGGGLMIGVQAIIADIVPARERGRYMGLIGAVFGLA 194

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH +WRW FYIN+P G +T+ V   +L++PRP         R+D +G 
Sbjct: 195 SVAGPLLGGFFTDHASWRWCFYINVPFGLVTLAVIAVVLKLPRPA-----VRPRLDVLGA 249

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++  ++  L+L  +WGG EY W S                F  VE + A EP+ P  LF
Sbjct: 250 ALLAAASTCLVLVTSWGGTEYAWGSRTILGLAAGAVVTTALFVAVEHR-AAEPIIPLRLF 308

Query: 241 KR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    +V G        G+A F    Y+P Y Q+V G SAT SGL ++P++LG+V  S++
Sbjct: 309 RDSVFNVTGL--VGAVVGIALFGAASYLPTYLQMVDGVSATESGLLMLPMMLGIVGGSIA 366

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ ++RT +  YR   + G+A+  +G GL++L + ++       Y           M  
Sbjct: 367 SGQLITRTGR--YRIYPIVGSAVSVVGMGLLSLLEADTSPVAYSFYQAVLGLGIGLVMSV 424

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIP--PELA 416
            +L  Q  V   D+ + T+   +FR IG   G AI GT+F+  L++ +  + +P   EL 
Sbjct: 425 LVLAVQNSVRPSDLGTATSANNYFRQIGGSVGAAIFGTLFAGRLSDAL-GVRLPTGAELP 483

Query: 417 GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKP 471
                +  +V+ +   +R   I AYV A+   F   +P+ +L  + + F+   KP
Sbjct: 484 DPESITPQIVHAMEPALRDAYIQAYVDAMPRIFLYLVPVLVLGLILAFFL-KEKP 537



>gi|490090067|ref|WP_003992021.1| transporter [Streptomyces viridochromogenes]
 gi|302470820|gb|EFL33913.1| transmembrane efflux protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 531

 Score =  261 bits (667), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 152/456 (33%), Positives = 234/456 (51%), Gaps = 23/456 (5%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           I+ TA+P I  +   L+ ++WV TAY L   A  P +GK  D++GRK TF+ +++ F IG
Sbjct: 42  IIGTAMPTIVGELGGLEHLSWVVTAYTLATAASTPLWGKLGDMYGRKGTFMTSIVIFLIG 101

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A NM  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 102 SALSGMAQNMGELIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMMAGVMALAMI 161

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TD+  WRW+FYINLPLG + +     +L +P+ +        RIDY+G  +
Sbjct: 162 GGPLVGGTITDNWGWRWAFYINLPLGVVALAAISVVLHLPKKRSE-----ARIDYLGAAL 216

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +     A++L   WGG EY WSS                F   +T+ A EPV P H+F+ 
Sbjct: 217 LTVGITAIVLVTTWGGTEYAWSSARIMELIGIGVAALVGFVFWQTR-AAEPVVPLHIFRS 275

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G   F    ++PLY Q V+G SAT SGL L+P++  +++ S+ +G+ 
Sbjct: 276 RNFTLMSVIGFVTGFVMFGATLFLPLYQQSVQGASATNSGLLLLPMLGAMLVTSMVAGRV 335

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + T K  Y+   + G+ L+ +G  L++  D  + R     +M          MQ T+L 
Sbjct: 336 TTNTGK--YKVFPVLGSVLMIVGLYLLSTMDTGTSRFTSGVFMAVVGFGMGCLMQITMLV 393

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKAS 422
            Q  VE KD+   ++    FR +G+ FGVAI+G +F+N + +      +  E AGA+ + 
Sbjct: 394 AQNSVEMKDMGVASSSTTLFRTLGSSFGVAIMGALFNNRVQD------VMTERAGALGSK 447

Query: 423 AT---------VVNQLPIEIRGPVISAYVGALRTAF 449
            T          + +LP+  R     A      +AF
Sbjct: 448 VTEQSAQLDAKSLEKLPVLAREAYQHAVSAGTHSAF 483



>gi|477530866|gb|ENH82591.1| MFS aflatoxin efflux [Colletotrichum orbiculare MAFF 240422]
          Length = 626

 Score =  261 bits (666), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 163/455 (35%), Positives = 237/455 (52%), Gaps = 15/455 (3%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           I+ATA+P I  DF+++  I W  +AYLLT  AFQ  +GK    F  K+ F+ +V+ FEIG
Sbjct: 82  IIATAVPQITDDFRSVTDIGWYGSAYLLTTCAFQLLFGKLYAFFDIKSVFMVSVVLFEIG 141

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S +CG APN    I+ RAIAGVGG GI+S V++I+   V L  R KYQ            
Sbjct: 142 SAICGAAPNSIAFIVGRAIAGVGGAGIISGVIVIMVHSVPLHRRPKYQGAFGAVFGIASV 201

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKG----SLLQKLKRIDYI 178
             PLLGGAFT  VTWRW FYINLPLG + ++V  F+LR P        +L +KL ++D++
Sbjct: 202 VGPLLGGAFTTKVTWRWCFYINLPLGGVALLVIGFVLRAPAQDDIGSMTLREKLAQLDFL 261

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           GT + + + + LLL L WGG EY W                  F  ++  L      PP 
Sbjct: 262 GTSLFIPAVVCLLLALQWGGVEYAWKDGRIIALLVLAGVLVAAFISIQFLLPKTATVPPR 321

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           + ++  +       F  G       Y++P++FQ ++G SA  SG+  +PL+L + + +  
Sbjct: 322 IMRQRTIAFASFAAFCVGAQMMVFTYFLPIWFQAIQGVSAVDSGIRTLPLVLSMTLFAGV 381

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           +G  V+R     Y  + + G A++A+G+GL+T    ++G A    Y            Q 
Sbjct: 382 TGALVTRIGY--YTPVMLFGTAVMAVGAGLLTTLAVDTGAARWAGYQVVYGVGMGMTFQA 439

Query: 359 TLLCGQGIVEYKDVASVTALLMFF--RLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELA 416
             L  Q ++  +DV  V A +MFF   L GAVF +++   + +N L   +  I   P L 
Sbjct: 440 PNLAAQTVLRTRDV-PVGASIMFFAQTLGGAVF-ISVGQNVLNNELVGRLRRI---PGLQ 494

Query: 417 G--AVKASATVVNQLPIEIRGPVISAYVGALRTAF 449
           G     A AT + QLP ++R P + AY  ALR  F
Sbjct: 495 GLDLKGAGATTITQLPEDVRAPALEAYNAALRIVF 529



>gi|490099722|ref|WP_004001610.1| putative Multidrug-efflux transporter [Streptomyces
           viridochromogenes]
 gi|443338673|gb|ELS52943.1| putative Multidrug-efflux transporter [Streptomyces
           viridochromogenes Tue57]
          Length = 688

 Score =  261 bits (666), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 173/477 (36%), Positives = 256/477 (53%), Gaps = 17/477 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   L+ ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 50  QTIVSTALPTIVSDLGGLEHLSWVVTAYLLASTAATPLWGKLGDQYGRKRLFQIAIVIFL 109

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS LCG+A +M  +I FRA+ G+GGGG++ L M I+ DIVS ++RG+YQ          
Sbjct: 110 VGSALCGMAQDMGQLIAFRAVQGLGGGGVMVLSMAIVGDIVSPRERGRYQGLFGAVFGAT 169

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKR--IDYI 178
               PLLGG FT+H++WRW FYINLP+G + + V   +LRIPR       K  R  IDY+
Sbjct: 170 SVLGPLLGGVFTEHLSWRWVFYINLPVGVVALAVIAAVLRIPR-------KATRHVIDYL 222

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           GT ++      L+L  + GG  + W S                F  VE + A EPV P  
Sbjct: 223 GTFLIASVATCLVLVASLGGTTWSWGSAQILGLAVLGAVLAVAFVAVERR-AAEPVLPLK 281

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           LF+          +F  G A F  + Y+P + QVV+G S T SG+ ++P++ G++++S  
Sbjct: 282 LFRVRTFALSAVISFVVGFAMFGAMTYLPTFLQVVQGVSPTMSGVHMLPMVAGMLLSSTG 341

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ VSRT +  ++   + G  +  +G  L+   D +S       +           MQ 
Sbjct: 342 SGQIVSRTGR--WKVFPIAGTGVTTLGLLLLHQLDVDSSTWEMSVFFFVFGLGLGLVMQV 399

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI----ENIAIPPE 414
            +L  Q  V Y+D+   T+   FFR IGA FGVAI GTIF+N L + +        +PP 
Sbjct: 400 LVLIVQNAVSYEDLGVATSGATFFRSIGASFGVAIFGTIFANRLDDKLVEAFRGARLPPG 459

Query: 415 LA-GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
           ++   ++A    + +LP+++R   + AY  ++   F    P+ +L F+ + F+   K
Sbjct: 460 VSLEGLEADPRGIAELPVDLRPGALQAYASSITDVFLYAAPVALLGFVLAWFLREDK 516



>gi|353241917|emb|CCA73698.1| probable DHA14-like major facilitator; ABC transporter
           [Piriformospora indica DSM 11827]
          Length = 581

 Score =  261 bits (666), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 172/487 (35%), Positives = 243/487 (49%), Gaps = 22/487 (4%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP +AS F ALD++ WV TAY LT       +G+   I   K  +L  ++ FE
Sbjct: 92  QTIVATALPKLASQFNALDQLTWVVTAYFLTQAGLMLFFGQVLTIAKAKWVYLSCIVLFE 151

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGSL+CG+AP M  +I  RA  GVG  GI   ++ ++S I  L++R              
Sbjct: 152 IGSLICGVAPQMNVLIFGRAFQGVGASGIYISIITVLSQITKLENR----PILFGTFGAV 207

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPR-------PKGSLLQKLK 173
               PLLGGA TDH TWRW FYINLP G I+++ A+                 ++LQ+  
Sbjct: 208 FAIGPLLGGALTDHATWRWCFYINLPFGGISIVAALLFQPSNPPPPNPLYDSKTMLQRWL 267

Query: 174 RIDYIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP 233
            +D++G  + V + + LLLPL WGG   PW+                 F   E       
Sbjct: 268 ALDWVGAFLSVATVVCLLLPLQWGGVTRPWNDKAVIALFVVFAALFGAFIAWEHHKGARA 327

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
           + P   F+    VG     F   + F +  YY+P ++Q  KG +A+ SG+++IP +L +V
Sbjct: 328 MMPLSFFRNRTQVGGALAIFAMMIPFLAGTYYLPFFYQ-AKGRTASQSGIDIIPFMLTMV 386

Query: 294 IASVSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXX 353
            AS +SG  V+ T  + Y  + + G  + A+G+GL+   DE  G A  I Y         
Sbjct: 387 FASFTSGGIVNATGHYYY--ILVFGPLISAVGAGLLFTIDEFMGSARLIGYQIIFGMGLG 444

Query: 354 XXMQTTLLCGQGIVEY----KDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI 409
              Q  L+  Q   EY    + +A  ++LL F +LIG V G+AI GTIF+N L   +   
Sbjct: 445 IAGQLPLMAVQA--EYALLPELIAQASSLLSFLQLIGGVVGIAIAGTIFNNKLNTELSVY 502

Query: 410 A--IPPELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMG 467
           A  +PP+    VK S TV+ +L   I+G VI AYV AL   F   IP  +L  +   F+ 
Sbjct: 503 APNLPPDTLEHVKQSVTVIFELEDTIKGGVIHAYVKALTWIFILCIPACVLASICGAFVR 562

Query: 468 NHKPSLR 474
           N     R
Sbjct: 563 NWNFKTR 569



>gi|494476761|ref|WP_007266238.1| transporter [Streptomyces sp. C]
 gi|302445493|gb|EFL17309.1| transmembrane efflux protein [Streptomyces sp. C]
          Length = 531

 Score =  261 bits (666), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 159/465 (34%), Positives = 243/465 (52%), Gaps = 7/465 (1%)

Query: 3   IVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFEIG 62
           I+ TA+P I  +   L+ ++WV TAY L   A  P +GK  D++GRK +FL ++I F +G
Sbjct: 41  IIGTAMPTIVGELGGLEHLSWVVTAYTLATAASTPIWGKIGDMYGRKGSFLTSIIIFLVG 100

Query: 63  SLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXXXX 122
           S L G+A +M  +I FRA+ G+G GG++  VM II D++  ++RGKYQ            
Sbjct: 101 SALSGMAQDMGQLIGFRAVQGLGAGGLMVGVMAIIGDLIPPRERGKYQGMMAGVMALAMI 160

Query: 123 XXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGTIV 182
             PL+GG  TDH+ WRWSFYINLPLGA+ + +   +L +P+ K     +  +IDYIG  +
Sbjct: 161 GGPLVGGTITDHMGWRWSFYINLPLGAVALAMVSAVLHLPKKKSQ--GERPKIDYIGAAL 218

Query: 183 VVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLFKR 242
           +  +  + +L   WGG EY W S                F   ETK A EPV P H+F+ 
Sbjct: 219 LTLAITSTVLVTTWGGTEYAWGSAEIIGLIAVGVLSVAAFLYAETK-AAEPVMPLHIFRS 277

Query: 243 LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSGQA 302
            +        F  G A F  V Y+PL+ Q V+G SAT SGL L+P++L ++  S+ +G+ 
Sbjct: 278 RNFTLMSVIGFLVGFAMFGGVLYLPLFQQSVQGASATNSGLLLLPMLLSMMAVSLVAGRI 337

Query: 303 VSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTLLC 362
            + + K  Y+   + G AL+ +G  L+   D  + R     YM          MQ T+L 
Sbjct: 338 TTSSGK--YKVFPIAGGALMVVGLFLLATMDTGTTRLVSGLYMAVLGAGLGFLMQITMLV 395

Query: 363 GQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVKA- 421
            Q  V+ KD+   ++    FR +G  FGVA++G++F++ +T+ +     P     A  A 
Sbjct: 396 AQNSVDMKDMGVASSSATLFRTLGGSFGVALMGSLFTSQVTDTMSERLGPQAAQAAGSAQ 455

Query: 422 -SATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLF 465
             A  + +LP  +R     A      +AF     + +L F+ + F
Sbjct: 456 LDAASLAKLPEAVRDAYQHAVAAGTHSAFLLGAAVAVLGFVLAWF 500



>gi|405123274|gb|AFR98039.1| tetracycline efflux protein [Cryptococcus neoformans var. grubii
           H99]
          Length = 637

 Score =  260 bits (665), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 156/409 (38%), Positives = 226/409 (55%), Gaps = 22/409 (5%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV TALP +                      A QP YG+ SDIFGRK T L  +  F 
Sbjct: 195 QTIVTTALPTLGQ--------------------ATQPVYGRLSDIFGRKFTLLGCLFIFL 234

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL C LA  M  +IIFRAI G+GGGGIL+L MIIISD+VSL++RGKYQ          
Sbjct: 235 MGSLACALAQTMIQLIIFRAIQGLGGGGILTLAMIIISDVVSLKERGKYQGITGCVVALA 294

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               P++GGAFT++ +WRW FYINLPL +I++I+ +FLL + R +GS++ K+K++D+ G+
Sbjct: 295 NSCGPIVGGAFTENASWRWCFYINLPLTSISMIIIVFLLPLRRVRGSIIAKIKKLDFYGS 354

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           I+ +      L+ L+W G++YPW S                F  VE K+   P+ P H+F
Sbjct: 355 ILTLAWAAPFLIALSWAGSQYPWDSAAVLVPLLVGLALLGLFIFVEAKMVSLPLVPMHIF 414

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           K + V  CF T F  G++F++ +YY+P YFQ+V+G SA  SG+  +PL+L   + S ++G
Sbjct: 415 KNVSVSACFFTTFMNGLSFYATLYYLPQYFQIVRGASAIRSGVLTLPLMLVQTVTSFTTG 474

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
              S+T  + +  +   G  +  IG GL++     +  A    Y            QT L
Sbjct: 475 IIQSKTGDYWWNLV--VGYTIWTIGLGLLSSITPTTSIAKLSGYQIIVGIGAGQTFQTGL 532

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI 409
           +  Q  VE KD+A+ T L  F R +G    +A   +I +N +  NI  +
Sbjct: 533 VAIQASVERKDMATATGLRNFLRQMGGTIALAACNSIVNNCVRRNISGV 581



>gi|478687039|ref|YP_007743849.1| Efflux protein [Streptomyces albus J1074]
 gi|505319701|ref|WP_015506803.1| Efflux protein [Streptomyces albus]
 gi|477542893|gb|AGI86846.1| Efflux protein [Streptomyces albus J1074]
          Length = 852

 Score =  260 bits (665), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 163/450 (36%), Positives = 237/450 (52%), Gaps = 15/450 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LDK++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 95  QMIVATALPKIVGELHGLDKMSWAITAYLLTSTVSLPVYGKLGDLFGRKGVFQFAIVVFI 154

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS L G + +M  +I FRA+ G+G GG++  V  II+DIV  ++R +Y           
Sbjct: 155 IGSGLAGWSRSMDELIAFRALQGLGAGGLMIGVQAIIADIVPPRERARYMGLIGAAFGLA 214

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FY N+P G +T+ V   +L++P+P         R+D  G 
Sbjct: 215 SVAGPLLGGFFTDHMSWRWCFYFNVPFGLVTLAVVAVVLKLPKPA-----TRGRLDVPGI 269

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F LV  + A EP+ P  LF
Sbjct: 270 LLLATASTCLVLLTSWGGTEYAWGSGTILALAAGAVLSTVLF-LVAERYAAEPLIPLRLF 328

Query: 241 KR--LHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +    ++ G        G+A F    Y+P + Q+V G SAT SGL ++P++ GVV AS+ 
Sbjct: 329 RESIFNLTGLI--GAVVGIALFGAASYLPTFLQMVDGASATESGLLMLPMMGGVVGASIL 386

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SGQ +S+T +  YR   + G  L A+G  L++L +  + R     +M          M  
Sbjct: 387 SGQLISKTGR--YRPYPIAGGVLAALGMWLLSLLETGTSRLHYSIWMAVLGAGIGLIMPV 444

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGA 418
            +L  Q  V   D+ + T+   +FR IG   G A+ GT+F+  LT+ + +       AG+
Sbjct: 445 LVLAVQNSVRPADLGTATSANNYFRQIGGSVGAAVFGTLFAQRLTDALADRLPAGAPAGS 504

Query: 419 VKASA---TVVNQLPIEIRGPVISAYVGAL 445
           V A A     V+ +   +R P I AY  A+
Sbjct: 505 VDAEAITPQAVHAMAPALRDPYIQAYADAM 534



>gi|326470039|gb|EGD94048.1| major facilitator superfamily transporter [Trichophyton tonsurans
           CBS 112818]
          Length = 553

 Score =  260 bits (665), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 160/473 (33%), Positives = 246/473 (52%), Gaps = 14/473 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           +TI+ATA+P IA+ F AL  I W A+AYL+T  A Q T+GK    +  K   L A++ FE
Sbjct: 69  RTIIATAVPEIANQFHALTDINWYASAYLITSCATQLTWGKVYTFYSTKFVLLSAIVIFE 128

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS LCG APN TT I+ RAIAG G  GI S   ++I+ +V L+ R  Y           
Sbjct: 129 VGSALCGAAPNSTTFIVGRAIAGTGSAGIFSGTTVVIAQVVPLRKRPVYVGMMGSIFGVA 188

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLL--RIPRPKGSLLQKLKRIDYI 178
               PL+GGAFTD VTWRW FYINLP+G +T+ V +FLL  R  +   S   ++ R+D I
Sbjct: 189 SIIGPLMGGAFTDRVTWRWCFYINLPIGGVTMAVLLFLLNVRSKKESASWQAQVNRLDPI 248

Query: 179 GTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPH 238
           G+++ + S    LL L  GG  YPW++                F  V+     +   PP 
Sbjct: 249 GSVLFLPSATCFLLALQLGGTSYPWNNGRIIALFVVSGVLMIAFVAVQIWRQEDATVPPR 308

Query: 239 LFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVS 298
           +F +  +      + F G    S++Y +P++FQ VKG +A  SG++ IP++L +V+ S+ 
Sbjct: 309 IFCQRSIASGTAFSAFVGGGLISMLYALPIWFQAVKGTTAVQSGIDTIPMVLSLVVGSIL 368

Query: 299 SGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQT 358
           SG  ++ T    Y         L++IG+GL T +  ++  +  I Y           MQ 
Sbjct: 369 SGSIITATGH--YVPWMYVSTVLMSIGAGLTTTFKADTNHSAWIGYQVLFGFGIGTGMQQ 426

Query: 359 TLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIA---IPPEL 415
             L  Q ++  KD+++  +L+ F + +G    VAI  ++FSN L +N+  +    +   L
Sbjct: 427 ASLAAQTVLNMKDLSTGVSLMFFAQSLGGALFVAISQSLFSNALASNLAKVPGLDVQAVL 486

Query: 416 AGAVKASATVV--NQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           A   K  + VV  ++LP+     V+  Y  +LR +F   + +  L  L ++ M
Sbjct: 487 ASGAKDLSKVVPLDKLPL-----VLPLYNDSLRRSFIVSLAVSCLMILPTIGM 534



>gi|322705044|gb|EFY96633.1| efflux pump antibiotic resistance protein, putative [Metarhizium
           anisopliae ARSEF 23]
          Length = 657

 Score =  260 bits (665), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 158/453 (34%), Positives = 237/453 (52%), Gaps = 6/453 (1%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            +I+ATA+P I  +F +L  I W  +AY+LT ++FQ  +GKF   +  K  FL  +  FE
Sbjct: 175 NSIIATAIPRITDEFHSLPDIGWYGSAYMLTGSSFQLLFGKFYTFWSIKWIFLGTIGVFE 234

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GSL+C +APN  T+II RA+AG+G  GI +  + I++  V L+ R  Y           
Sbjct: 235 LGSLVCAVAPNSMTLIIGRAVAGMGSAGIFAGALTILAYTVPLEKRPIYSGLIGSMWGIS 294

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKG---SLLQKLKRIDY 177
               PLLGG FTD ++WRW FYINLP+G +TV V  F    P+ K    +  Q++ ++D 
Sbjct: 295 SVAGPLLGGVFTDRLSWRWCFYINLPVGLVTVAVITFFFPDPKRKKVPMTWRQRIWKMDP 354

Query: 178 IGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPP 237
           IGTI  + + + LLL L+WGG+EYPW S                F  V+ ++      PP
Sbjct: 355 IGTIAFLPAVVCLLLALHWGGSEYPWDSARITSLLMLAAVLILLFLYVQWRMQDNATVPP 414

Query: 238 HLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASV 297
            +FK+  V       FF G  F   +Y++P++FQ VKG S   SG+  IP++L VVI +V
Sbjct: 415 RIFKKRTVWASSLFEFFIGACFLLAMYFLPIWFQAVKGASPVKSGVMNIPMLLSVVIFTV 474

Query: 298 SSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQ 357
           +SG  VS      Y    + GA L+ IG GL++    +S  A  I +           MQ
Sbjct: 475 TSGAIVSSWGY--YTPFIIGGAVLMPIGYGLMSTLTVDSSAAAWIGFQVIAGAGVGVGMQ 532

Query: 358 TTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAG 417
             L+  Q +++  DV + TA+++F + +G    V+   T+F+N L N +   A   +   
Sbjct: 533 QPLIAVQVVLDMADVPTGTAIIIFMQSLGGALFVSAGQTVFTNRLENFLHEFAPQVDPKA 592

Query: 418 AVKASAT-VVNQLPIEIRGPVISAYVGALRTAF 449
            + A AT +    P E  G ++ A+  AL   F
Sbjct: 593 VLAAGATGIRTAFPEEFLGAIVKAFNSALTNCF 625



>gi|494630035|ref|WP_007387979.1| MFS transporter [Streptomyces coelicoflavus]
 gi|371552478|gb|EHN79724.1| efflux protein [Streptomyces coelicoflavus ZG0656]
          Length = 822

 Score =  260 bits (665), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 160/437 (36%), Positives = 233/437 (53%), Gaps = 11/437 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q IVATALP I  +   LD+++W  TAYLLT T   P YGK  D+FGRK  F FA++ F 
Sbjct: 69  QMIVATALPKIVGELHGLDRMSWAITAYLLTSTVGLPIYGKLGDLFGRKGVFQFAILVFV 128

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS L G A +M  +I FRA+ GVG GG++  V  II+DIV  ++RG++           
Sbjct: 129 VGSALAGRAQSMDQLIAFRAVQGVGAGGLMIGVQAIIADIVPPRERGRFMGLIGAAFGLA 188

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FTDH++WRW FYIN+P G +T+ V   +L++PR     L+   R+D +G 
Sbjct: 189 SVAGPLLGGYFTDHLSWRWCFYINVPFGLVTMAVVAVVLKLPR-----LRVKPRLDVLGA 243

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
           +++  ++  L+L  +WGG EY W S                F +V  + A EP+ P  LF
Sbjct: 244 LLLAAASTCLVLLTSWGGTEYDWGSRTILGLAAGAVGSTLLF-VVAERFAPEPLIPLRLF 302

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +              G+A F    Y+P + Q+V G SAT SGL ++P++ GVV+AS+ SG
Sbjct: 303 RDSVFNVTALVGLVVGVALFGAASYLPTFLQMVDGASATESGLLMLPMMGGVVVASIVSG 362

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q +SRT    YR   + G+AL  +G  L++  D ++ R     +M          M   +
Sbjct: 363 QLISRTGH--YRIHPILGSALSVVGMWLLSRLDIDTPRLHYSIWMAVLGAGIGMVMPVLV 420

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIPPELAGAVK 420
           L  Q  V   D+ + T+   +FR IG   G A+ GT+F+  LT+ + +       AG   
Sbjct: 421 LAVQNSVRPTDLGTATSANNYFRQIGGSVGAAVFGTLFAGRLTDALADRVPADAGAGLPD 480

Query: 421 ASA---TVVNQLPIEIR 434
           A A    +V+ LP  +R
Sbjct: 481 AEAITPQLVHSLPPALR 497



>gi|514326997|gb|EPH40117.1| putative MFS-type transporter [Streptomyces aurantiacus JA 4570]
          Length = 656

 Score =  260 bits (664), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 175/475 (36%), Positives = 259/475 (54%), Gaps = 13/475 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIV+TALP I SD   LD ++WV TAYLL  TA  P +GK  D +GRK  F  A++ F 
Sbjct: 23  QTIVSTALPTIVSDLGGLDHLSWVVTAYLLAATAATPLWGKLGDQYGRKKLFQTAIVIFL 82

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           IGS LCG+A NM  +I FRA+ G+GGGG++ L M I+ D+VS ++RGKYQ          
Sbjct: 83  IGSALCGVAQNMPQLIGFRALQGLGGGGLMVLSMAIVGDLVSPRERGKYQGLFGAVFGAT 142

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG FT+H++WRW FY+NLP+G + ++V    L IP  +         IDY+GT
Sbjct: 143 SVLGPLLGGLFTEHLSWRWVFYVNLPIGVVALVVIAAALHIPASRAR-----HTIDYLGT 197

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            ++      L+L  + GG  + W S                F  VE K A EPV P  LF
Sbjct: 198 FLIASVATCLVLVASLGGTTWAWGSAQIIGLAVLGVVLAVWFVAVERK-AAEPVIPLKLF 256

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +          +F  G A F  + Y+P + QVV+G S T SG+ ++P+++G+++AS +SG
Sbjct: 257 RIRTFTLTAVISFVVGFAMFGAMTYLPTFLQVVQGVSPTMSGVHMLPMVVGLLLASTASG 316

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           Q VSRT +  ++   + G  + A+G  L+   DENS       +           MQ  +
Sbjct: 317 QIVSRTGR--WKVFPIAGTGVTALGLLLLHQLDENSPTGEMSAFFFVFGLGLGLVMQVLV 374

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFS----NVLTNNIENIAIPPELA 416
           L  Q  V Y+D+   T+   FFR IGA FGVAI GT+F+    + LT+ +    +P  ++
Sbjct: 375 LIVQNAVSYEDLGVATSGATFFRSIGASFGVAIFGTVFTGRLGDKLTDALRGQGLPAGVS 434

Query: 417 -GAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHK 470
             ++KA    + +LP ++R  V+SAY  ++   F    P+ ++ F+ + F+   +
Sbjct: 435 VDSLKADPRGIAELPADLRPGVLSAYASSITDVFLYAAPVALVAFVLAWFLREDR 489



>gi|489978283|ref|WP_003881419.1| MFS transporter [Mycobacterium fortuitum]
 gi|403651197|gb|EJZ06353.1| EmrB/QacA family drug resistance transporter [Mycobacterium
           fortuitum subsp. fortuitum DSM 46621]
          Length = 730

 Score =  260 bits (664), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 166/474 (35%), Positives = 242/474 (51%), Gaps = 24/474 (5%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           QTIVATALP + +D       AWV T+YLL  T      GK  D FGRK  F  A++ F 
Sbjct: 42  QTIVATALPTVVADLGGAGHQAWVVTSYLLASTIVTAVVGKLGDTFGRKKIFQVAILLFL 101

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS+LCG A +M  ++  RA+ G+GGG I    + +I +++ L+DRG+YQ          
Sbjct: 102 VGSVLCGAAGSMGMLVASRALQGLGGGAITVTAVAVIGEVIPLRDRGRYQGALGAVFGVT 161

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIF----LLRIPRPKGSLLQKLKRID 176
               PLLGG FTDH++WRW+F+IN+P+  + + +A        R  RP          +D
Sbjct: 162 TVIGPLLGGLFTDHLSWRWAFWINVPVAVVVIAIAAVAIPEFTRTARPV---------LD 212

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAP 236
           Y G ++V      L L  +WGG  Y W+S                F  VE +LA EPV P
Sbjct: 213 YAGIVLVGLGAAGLTLATSWGGTTYAWTSVTIIGLFVGSVVALVAFVFVE-RLAAEPVLP 271

Query: 237 PHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIAS 296
             LF       C   +F  G A    + ++P Y Q V G SAT SGL  +P+++G+++ S
Sbjct: 272 IRLFGNPVFTVCCVLSFVVGFAMLGALTFLPTYMQFVDGVSATASGLRTLPMVVGLLVTS 331

Query: 297 VSSGQAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXM 356
           + SG  V RT K  YR   + G A++AIG  L++  D ++    Q  Y+          M
Sbjct: 332 LGSGVLVGRTGK--YRIYPIAGTAIMAIGFVLLSRMDADTSTLTQSLYLLVLGSGIGLSM 389

Query: 357 QTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENI----AIP 412
           Q  +L  Q  V++ D+   T+ + FFR IG+ FG AI G++F+N L + + +       P
Sbjct: 390 QVLILVVQNTVDFTDLGVATSGVTFFRAIGSSFGAAIFGSLFANFLGDRLPSAMAGSGAP 449

Query: 413 PELAGAVKASATVVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
           PE A     S  V++ LP E+  P+I AY  +L   F    P   + F+ +LF+
Sbjct: 450 PEAA----TSPRVLHGLPHEVAVPIIDAYADSLTRVFLFAAPFAAVGFVLALFL 499



>gi|407927030|gb|EKG19935.1| Major facilitator superfamily [Macrophomina phaseolina MS6]
          Length = 548

 Score =  260 bits (664), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 243/476 (51%), Gaps = 15/476 (3%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
            TI+ATALP I   F+ L+ + W  +AYL T  AFQ  +GK    + RK TFL A++ FE
Sbjct: 62  NTIIATALPRITDHFRKLEDVGWYGSAYLFTTCAFQLPFGKLFSFYSRKWTFLIALLIFE 121

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
           +GS++CG A      I  RAIAG+GG G+LS  +II++  V L+ R  +           
Sbjct: 122 LGSVICGAASTSAMFIAGRAIAGLGGAGVLSGALIIVAFSVPLEKRSNFTALIGGMFGIA 181

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPK----GSLLQKLKRID 176
               PL+GGAF DHV+WRW FYINLP+GA+T  V +  L   R K    G  L++L+ +D
Sbjct: 182 SVSGPLMGGAFADHVSWRWCFYINLPVGAVTSAVLLVWLHDGRTKRGAGGPFLEQLRTLD 241

Query: 177 YIGTIVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEP--- 233
            +G  + +GS I LLL L WGG  Y WS                  G +  ++ +EP   
Sbjct: 242 PLGNALFLGSIICLLLALQWGGTTYEWSDGRVVALFVMFGVLLA--GFIALEVHVEPRRA 299

Query: 234 VAPPHLFKRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVV 293
             PPH+ ++  +          G AFF  VYY+P YFQ +KG SA  SG++++PLIL  V
Sbjct: 300 TVPPHIARQRSIAFGSVFALCIGAAFFLFVYYLPYYFQAIKGASALRSGIDVLPLILMQV 359

Query: 294 IASVSSGQAVSRTDKFAYRT-LSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXX 352
           + +V +G   + T K  Y     +     ++ G+GL+TL   +S       Y        
Sbjct: 360 VGTVVAG---ALTQKLGYYMPFVVLSVVFMSAGAGLLTLLATDSSTGAWAGYQLVFGFGA 416

Query: 353 XXXMQTTLLCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNIENIAIP 412
               Q   L  Q ++   +VA+ TA+ MF +L+G    V++   +F+N L   I    IP
Sbjct: 417 GLGFQQASLAAQAVLPQAEVATGTAIAMFVQLLGGAVFVSVGENVFTNRLVEGIAAAQIP 476

Query: 413 PELAGAVKA-SATVVNQL-PIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFM 466
              A  V A  AT + +L P E  G V++AY+ AL   +   + +  L  L ++ M
Sbjct: 477 GLDAQTVVAMGATELRRLVPSEHVGAVMAAYMDALVRVYRVGLIVACLSGLGAVGM 532



>gi|296269294|ref|YP_003651926.1| EmrB/QacA subfamily drug resistance transporter [Thermobispora
           bispora DSM 43833]
 gi|502896590|ref|WP_013131566.1| multidrug MFS transporter [Thermobispora bispora]
 gi|296092081|gb|ADG88033.1| drug resistance transporter, EmrB/QacA subfamily [Thermobispora
           bispora DSM 43833]
          Length = 535

 Score =  259 bits (663), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 160/480 (33%), Positives = 248/480 (51%), Gaps = 13/480 (2%)

Query: 1   QTIVATALPAIASDFKALDKIAWVATAYLLTMTAFQPTYGKFSDIFGRKATFLFAVITFE 60
           Q+IV TALP I S+   LD+++WV TAYLLT TA  P +GK SD++GR+  F  A+  F 
Sbjct: 57  QSIVGTALPRIVSELGGLDRLSWVVTAYLLTSTAATPVWGKISDLYGRRIIFQAAIAIFL 116

Query: 61  IGSLLCGLAPNMTTMIIFRAIAGVGGGGILSLVMIIISDIVSLQDRGKYQXXXXXXXXXX 120
            GS   GL+ ++  +I  RAI G+GGGG++++   I++D++  ++RG+YQ          
Sbjct: 117 AGSAFAGLSQSIGQLIASRAIQGLGGGGLMAIAFGIVADVIPPRERGRYQGYFGAVWGTA 176

Query: 121 XXXXPLLGGAFTDHVTWRWSFYINLPLGAITVIVAIFLLRIPRPKGSLLQKLKRIDYIGT 180
               PLLGG F D   WRW F INLP+G + + V    LR+P     L ++ +R+DY+G 
Sbjct: 177 SVAGPLLGGFFADGPGWRWIFLINLPIGIVALAVVSAALRLP-----LERRRQRVDYLGA 231

Query: 181 IVVVGSTIALLLPLNWGGNEYPWSSPXXXXXXXXXXXXXXXFGLVETKLAIEPVAPPHLF 240
            V+       LL L+W G E  W++P               F LVE + A EP+ P  LF
Sbjct: 232 TVIAAGVACFLLYLDWAGRELGWTAPGALALLAGAVSLASLFVLVELR-AFEPILPMRLF 290

Query: 241 KRLHVVGCFTTNFFQGMAFFSLVYYVPLYFQVVKGDSATTSGLELIPLILGVVIASVSSG 300
           +           F  G+A F  + ++P+Y QVV+G S T SGL L+P +LG+   SV++G
Sbjct: 291 RNAVFSVGNLFGFLSGLAMFGGLVFLPVYLQVVQGMSPTVSGLALLPAVLGIFSTSVATG 350

Query: 301 QAVSRTDKFAYRTLSMTGAALIAIGSGLITLWDENSGRAPQICYMXXXXXXXXXXMQTTL 360
           + +SRT +  Y+   + G+A++ +   L++    ++       Y           MQT +
Sbjct: 351 RLMSRTGR--YKAFPIAGSAVLIVALWLLSTIGVDTPYWRVAAYAYLFGAGLGCCMQTVV 408

Query: 361 LCGQGIVEYKDVASVTALLMFFRLIGAVFGVAIVGTIFSNVLTNNI--ENIAIPPELAGA 418
              Q  V   D+   T+   FFR++GA  G AI+G + ++ LT+++  E    PP   GA
Sbjct: 409 TAVQNAVRRSDIGVATSSTAFFRMMGAAIGTAIMGVVLTDRLTHHMAAEFGGRPPTGPGA 468

Query: 419 VKASAT---VVNQLPIEIRGPVISAYVGALRTAFTADIPIGILCFLASLFMGNHKPSLRT 475
                     + +L   IR  V++A+  A+   F   IP      + +LF+     + RT
Sbjct: 469 TAIDVNDVEAIRRLAPPIREHVLAAFSHAIDDVFLVSIPFVAAALVVALFLKEIPLAGRT 528