BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10388_c0_seq1-m.150 5prime_partial 1-915(+) 305 (+)
         (304 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|380088740|emb|CCC13317.1| unnamed protein product [Sordaria m...   427   e-117   Sordaria macrospora k-hell
gi|85100119|ref|XP_960907.1| spermidine synthase [Neurospora cra...   427   e-117   Neurospora crassa OR74A
gi|336262713|ref|XP_003346139.1| hypothetical protein SMAC_06606...   425   e-117   Sordaria macrospora k-hell
gi|451845557|gb|EMD58869.1| hypothetical protein COCSADRAFT_1028...   421   e-115   Bipolaris sorokiniana ND90Pr
gi|242774578|ref|XP_002478468.1| spermidine synthase [Talaromyce...   421   e-115   Talaromyces stipitatus ATCC 10500
gi|255937259|ref|XP_002559656.1| Pc13g12400 [Penicillium chrysog...   419   e-115   Penicillium rubens Wisconsin 54-1255
gi|119495240|ref|XP_001264409.1| spermidine synthase [Neosartory...   419   e-115   Aspergillus fischeri NRRL 181
gi|212532035|ref|XP_002146174.1| spermidine synthase [Talaromyce...   419   e-115   Talaromyces marneffei ATCC 18224
gi|425767689|gb|EKV06255.1| Spermidine synthase (Putrescine amin...   419   e-115   Penicillium digitatum PHI26
gi|340520373|gb|EGR50609.1| spermidine synthase [Trichoderma ree...   418   e-115   Trichoderma reesei QM6a
gi|396485345|ref|XP_003842148.1| similar to spermidine synthase ...   417   e-114   Leptosphaeria maculans JN3
gi|389628860|ref|XP_003712083.1| spermidine synthase [Magnaporth...   417   e-114   Magnaporthe oryzae 70-15
gi|482813767|gb|EOA90458.1| hypothetical protein SETTUDRAFT_1673...   417   e-114   Setosphaeria turcica Et28A
gi|212532039|ref|XP_002146176.1| spermidine synthase [Talaromyce...   417   e-114   Talaromyces marneffei ATCC 18224
gi|70995928|ref|XP_752719.1| spermidine synthase [Aspergillus fu...   417   e-114   Aspergillus fumigatus Af293
gi|330907629|ref|XP_003295873.1| hypothetical protein PTT_03586 ...   417   e-114   Pyrenophora teres f. teres 0-1
gi|189207669|ref|XP_001940168.1| spermidine synthase [Pyrenophor...   417   e-114   Pyrenophora tritici-repentis Pt-1C-BFP
gi|134077286|emb|CAK45626.1| unnamed protein product [Aspergillu...   417   e-114   Aspergillus niger
gi|477530115|gb|ENH81857.1| spermidine synthase [Colletotrichum ...   416   e-114   Colletotrichum orbiculare MAFF 240422
gi|115492019|ref|XP_001210637.1| spermidine synthase [Aspergillu...   416   e-114   Aspergillus terreus NIH2624
gi|238489149|ref|XP_002375812.1| spermidine synthase [Aspergillu...   416   e-114   Aspergillus flavus NRRL3357
gi|440485934|gb|ELQ65850.1| spermidine synthase [Magnaporthe ory...   415   e-114   Magnaporthe oryzae P131
gi|121701283|ref|XP_001268906.1| spermidine synthase [Aspergillu...   415   e-113   Aspergillus clavatus NRRL 1
gi|317030551|ref|XP_001392771.2| spermidine synthase [Aspergillu...   414   e-113   Aspergillus niger CBS 513.88
gi|358371985|dbj|GAA88591.1| spermidine synthase [Aspergillus ka...   414   e-113   Aspergillus kawachii IFO 4308
gi|378733877|gb|EHY60336.1| spermidine synthase [Exophiala derma...   414   e-113   Exophiala dermatitidis NIH/UT8656
gi|310793583|gb|EFQ29044.1| spermidine synthase [Glomerella gram...   414   e-113   Colletotrichum graminicola M1.001
gi|471572648|gb|EMR71033.1| putative spermidine synthase protein...   414   e-113   Eutypa lata UCREL1
gi|67516811|ref|XP_658291.1| SPEE_NEUCR Spermidine synthase (Put...   414   e-113   Aspergillus nidulans FGSC A4
gi|358391288|gb|EHK40692.1| hypothetical protein TRIATDRAFT_3014...   414   e-113   Trichoderma atroviride IMI 206040
gi|226293104|gb|EEH48524.1| spermidine synthase [Paracoccidioide...   414   e-113   
gi|317137159|ref|XP_001727531.2| spermidine synthase [Aspergillu...   413   e-113   Aspergillus oryzae RIB40
gi|367038823|ref|XP_003649792.1| hypothetical protein THITE_2108...   413   e-113   Thielavia terrestris NRRL 8126
gi|511005162|gb|EPB86509.1| spermidine synthase [Mucor circinell...   413   e-113   Mucor circinelloides f. circinelloides 1006PhL
gi|169615146|ref|XP_001800989.1| hypothetical protein SNOG_10727...   413   e-113   Parastagonospora nodorum SN15
gi|347828643|emb|CCD44340.1| similar to spermidine synthase [Bot...   413   e-113   Botrytis cinerea T4
gi|302912624|ref|XP_003050741.1| predicted protein [Nectria haem...   412   e-113   Nectria haematococca mpVI 77-13-4
gi|225683737|gb|EEH22021.1| spermidine synthase [Paracoccidioide...   411   e-112   Paracoccidioides brasiliensis Pb03
gi|472244244|gb|EMR88869.1| putative spermidine synthase protein...   410   e-112   Botrytis cinerea BcDW1
gi|327352193|gb|EGE81050.1| spermidine synthase [Ajellomyces der...   410   e-112   
gi|156044358|ref|XP_001588735.1| hypothetical protein SS1G_10282...   410   e-112   Sclerotinia sclerotiorum 1980 UF-70
gi|320588782|gb|EFX01250.1| spermidine synthase [Grosmannia clav...   409   e-112   Grosmannia clavigera kw1407
gi|367025809|ref|XP_003662189.1| hypothetical protein MYCTH_2302...   409   e-112   Myceliophthora thermophila ATCC 42464
gi|407920351|gb|EKG13563.1| Spermine synthase [Macrophomina phas...   408   e-112   Macrophomina phaseolina MS6
gi|512189737|gb|EPE05503.1| spermidine synthase [Ophiostoma pice...   408   e-111   Ophiostoma piceae UAMH 11346
gi|345561897|gb|EGX44969.1| hypothetical protein AOL_s00173g70 [...   408   e-111   Arthrobotrys oligospora ATCC 24927
gi|399169775|emb|CCE29495.1| SPE-3 spermidine synthase [Clavicep...   407   e-111   Claviceps purpurea 20.1
gi|485923721|gb|EOD48787.1| putative spermidine synthase protein...   406   e-111   Neofusicoccum parvum UCRNP2
gi|384501417|gb|EIE91908.1| spermidine synthase [Rhizopus delema...   406   e-111   Rhizopus delemar RA 99-880
gi|322701141|gb|EFY92892.1| spermidine synthase [Metarhizium acr...   406   e-111   Metarhizium acridum CQMa 102
gi|322706886|gb|EFY98465.1| spermidine synthase [Metarhizium ani...   406   e-111   
gi|361131873|gb|EHL03508.1| putative Spermidine synthase [Glarea...   406   e-111   Glarea lozoyensis 74030
gi|154277382|ref|XP_001539532.1| spermidine synthase [Ajellomyce...   405   e-111   Histoplasma capsulatum NAm1
gi|154304795|ref|XP_001552801.1| hypothetical protein BC1G_08983...   405   e-110   Botrytis cinerea B05.10
gi|358378881|gb|EHK16562.1| hypothetical protein TRIVIDRAFT_1874...   404   e-110   Trichoderma virens Gv29-8
gi|340914898|gb|EGS18239.1| spermidine synthase-like protein [Ch...   404   e-110   Chaetomium thermophilum var. thermophilum DSM 1495
gi|400597126|gb|EJP64861.1| spermidine synthase [Beauveria bassi...   404   e-110   Beauveria bassiana ARSEF 2860
gi|171693823|ref|XP_001911836.1| hypothetical protein [Podospora...   402   e-110   Podospora anserina S mat+
gi|315053415|ref|XP_003176081.1| spermidine synthase [Arthroderm...   402   e-110   Microsporum gypseum CBS 118893
gi|402082530|gb|EJT77548.1| spermidine synthase [Gaeumannomyces ...   402   e-110   Gaeumannomyces graminis var. tritici R3-111a-1
gi|406863819|gb|EKD16866.1| spermidine synthase [Marssonina brun...   401   e-109   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|258572568|ref|XP_002545046.1| spermidine synthase [Uncinocarp...   400   e-109   Uncinocarpus reesii 1704
gi|477515368|gb|ENH67724.1| Spermidine synthase [Fusarium oxyspo...   400   e-109   Fusarium oxysporum f. sp. cubense race 1
gi|452987579|gb|EME87334.1| hypothetical protein MYCFIDRAFT_7118...   399   e-109   Cercospora fijiensis CIRAD86
gi|440639461|gb|ELR09380.1| spermidine synthase [Geomyces destru...   399   e-109   Pseudogymnoascus destructans 20631-21
gi|452848267|gb|EME50199.1| hypothetical protein DOTSEDRAFT_6891...   399   e-109   Dothistroma septosporum NZE10
gi|398411809|ref|XP_003857240.1| hypothetical protein MYCGRDRAFT...   399   e-109   Zymoseptoria tritici IPO323
gi|405955424|gb|EKC22547.1| Spermidine synthase [Crassostrea gigas]   399   e-109   Crassostrea gigas
gi|342887616|gb|EGU87098.1| hypothetical protein FOXB_02492 [Fus...   398   e-109   Fusarium oxysporum Fo5176
gi|296814308|ref|XP_002847491.1| spermidine synthase [Arthroderm...   397   e-108   Arthroderma otae CBS 113480
gi|380483699|emb|CCF40459.1| spermidine synthase [Colletotrichum...   397   e-108   Colletotrichum higginsianum
gi|392864754|gb|EAS27342.2| spermidine synthase [Coccidioides im...   397   e-108   
gi|449303042|gb|EMC99050.1| hypothetical protein BAUCODRAFT_6564...   397   e-108   Baudoinia panamericana UAMH 10762
gi|494827049|gb|EON64065.1| spermidine synthase [Coniosporium ap...   396   e-108   Coniosporium apollinis CBS 100218
gi|406601419|emb|CCH46942.1| Spermidine synthase [Wickerhamomyce...   396   e-108   Wickerhamomyces ciferrii
gi|429852193|gb|ELA27340.1| spermidine synthase [Colletotrichum ...   396   e-108   Colletotrichum gloeosporioides Nara gc5
gi|303318439|ref|XP_003069219.1| spermidine synthase, putative [...   396   e-108   Coccidioides posadasii C735 delta SOWgp
gi|255716758|ref|XP_002554660.1| KLTH0F10560p [Lachancea thermot...   396   e-108   Lachancea thermotolerans CBS 6340
gi|365982711|ref|XP_003668189.1| hypothetical protein NDAI_0A079...   395   e-108   Naumovozyma dairenensis CBS 421
gi|116197943|ref|XP_001224783.1| spermidine synthase [Chaetomium...   395   e-108   Chaetomium globosum CBS 148.51
gi|119175541|ref|XP_001239979.1| hypothetical protein CIMG_09600...   395   e-107   
gi|320039089|gb|EFW21024.1| spermidine synthase [Coccidioides po...   394   e-107   Coccidioides posadasii str. Silveira
gi|388854692|emb|CCF51585.1| probable chimeric spermidine syntha...   394   e-107   Ustilago hordei
gi|366996717|ref|XP_003678121.1| hypothetical protein NCAS_0I010...   394   e-107   Naumovozyma castellii CBS 4309
gi|301620173|ref|XP_002939455.1| PREDICTED: spermidine synthase ...   394   e-107   Xenopus tropicalis [western clawed frog]
gi|156843587|ref|XP_001644860.1| hypothetical protein Kpol_1065p...   394   e-107   Vanderwaltozyma polyspora DSM 70294
gi|19112807|ref|NP_596015.1| spermidine synthase (predicted) [Sc...   393   e-107   Schizosaccharomyces pombe 972h-
gi|475665574|gb|EMT63366.1| Spermidine synthase [Fusarium oxyspo...   393   e-107   Fusarium oxysporum f. sp. cubense race 4
gi|500251712|gb|EON95606.1| putative spermidine synthase protein...   393   e-107   Phaeoacremonium minimum UCRPA7
gi|213409616|ref|XP_002175578.1| spermidine synthase [Schizosacc...   391   e-106   Schizosaccharomyces japonicus yFS275
gi|261190484|ref|XP_002621651.1| spermidine synthase [Ajellomyce...   391   e-106   Blastomyces gilchristii SLH14081
gi|444322638|ref|XP_004181960.1| hypothetical protein TBLA_0H015...   390   e-106   Tetrapisispora blattae CBS 6284
gi|46137467|ref|XP_390425.1| SPEE_NEUCR Spermidine synthase (Put...   390   e-106   
gi|366998257|ref|XP_003683865.1| hypothetical protein TPHA_0A035...   390   e-106   Tetrapisispora phaffii CBS 4417
gi|71023471|ref|XP_761965.1| hypothetical protein UM05818.1 [Ust...   390   e-106   
gi|512853315|ref|XP_004916086.1| PREDICTED: spermidine synthase ...   390   e-106   
gi|326476682|gb|EGE00692.1| spermidine synthase [Trichophyton to...   390   e-106   Trichophyton tonsurans CBS 112818
gi|50286095|ref|XP_445476.1| hypothetical protein [Candida glabr...   389   e-106   Candida glabrata CBS 138
gi|343427335|emb|CBQ70862.1| probable chimeric spermidine syntha...   388   e-105   Sporisorium reilianum SRZ2
gi|346326304|gb|EGX95900.1| spermidine synthase [Cordyceps milit...   388   e-105   Cordyceps militaris CM01
gi|443894911|dbj|GAC72257.1| lysine-ketoglutarate reductase [Pse...   387   e-105   Moesziomyces antarcticus T-34
gi|296421657|ref|XP_002840381.1| hypothetical protein [Tuber mel...   385   e-105   Tuber melanosporum Mel28
gi|147902014|ref|NP_001084875.1| spermidine synthase [Xenopus la...   385   e-105   Xenopus laevis [clawed frog]
gi|453089685|gb|EMF17725.1| spermine synthase [Mycosphaerella po...   384   e-104   Sphaerulina musiva SO2202
gi|410078940|ref|XP_003957051.1| hypothetical protein KAFR_0D026...   384   e-104   Kazachstania africana CBS 2517
gi|328766899|gb|EGF76951.1| hypothetical protein BATDEDRAFT_2092...   382   e-104   Batrachochytrium dendrobatidis JAM81
gi|501754003|emb|CCG82478.1| Spermidine synthase [Taphrina defor...   381   e-103   Taphrina deformans PYCC 5710
gi|498998391|ref|XP_004554226.1| PREDICTED: spermidine synthase-...   380   e-103   Maylandia zebra
gi|367012209|ref|XP_003680605.1| hypothetical protein TDEL_0C050...   380   e-103   Torulaspora delbrueckii
gi|513032938|gb|AGO12910.1| AaceriADL340Wp [Saccharomycetaceae s...   380   e-103   Saccharomycetaceae sp. 'Ashbya aceri'
gi|50303991|ref|XP_451945.1| hypothetical protein [Kluyveromyces...   380   e-103   Kluyveromyces lactis NRRL Y-1140
gi|348514634|ref|XP_003444845.1| PREDICTED: spermidine synthase-...   379   e-103   Oreochromis niloticus
gi|328851888|gb|EGG01038.1| hypothetical protein MELLADRAFT_7307...   379   e-103   Melampsora larici-populina 98AG31
gi|401838282|gb|EJT41985.1| SPE3-like protein [Saccharomyces kud...   379   e-103   Saccharomyces kudriavzevii IFO 1802
gi|6325326|ref|NP_015394.1| spermidine synthase [Saccharomyces c...   379   e-103   Saccharomyces cerevisiae S288c
gi|151942852|gb|EDN61198.1| putrescine aminopropyltransferase [S...   379   e-103   Saccharomyces cerevisiae YJM789
gi|401623242|gb|EJS41348.1| spe3p [Saccharomyces arboricola H-6]      378   e-102   Saccharomyces arboricola H-6
gi|149239971|ref|XP_001525861.1| spermidine synthase [Lodderomyc...   377   e-102   Lodderomyces elongisporus NRRL YB-4239
gi|242117904|ref|NP_957328.2| spermidine synthase [Danio rerio]       376   e-102   Danio rerio [leopard danio]
gi|348570938|ref|XP_003471253.1| PREDICTED: spermidine synthase-...   376   e-102   
gi|448088855|ref|XP_004196651.1| Piso0_003876 [Millerozyma farin...   375   e-102   Millerozyma farinosa CBS 7064
gi|47228825|emb|CAG07557.1| unnamed protein product [Tetraodon n...   375   e-102   Tetraodon nigroviridis
gi|403214093|emb|CCK68594.1| hypothetical protein KNAG_0B01460 [...   375   e-102   Kazachstania naganishii CBS 8797
gi|331226164|ref|XP_003325752.1| spermidine synthase [Puccinia g...   374   e-101   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|320583104|gb|EFW97320.1| spermidine synthase [Ogataea parapol...   374   e-101   
gi|390364436|ref|XP_796573.2| PREDICTED: spermidine synthase-lik...   373   e-101   Strongylocentrotus purpuratus [purple urchin]
gi|513004331|ref|XP_004863645.1| PREDICTED: spermidine synthase ...   373   e-101   Heterocephalus glaber [naked mole rat]
gi|164660446|ref|XP_001731346.1| hypothetical protein MGL_1529 [...   373   e-101   Malassezia globosa CBS 7966
gi|302307177|ref|NP_983755.2| ADL340Wp [Ashbya gossypii ATCC 108...   373   e-101   Eremothecium gossypii ATCC 10895
gi|32766339|gb|AAH55159.1| Zgc:63600 [Danio rerio]                    373   e-101   Danio rerio [leopard danio]
gi|410899599|ref|XP_003963284.1| PREDICTED: spermidine synthase-...   372   e-101   Takifugu rubripes [tiger puffer]
gi|511834034|ref|XP_004741655.1| PREDICTED: spermidine synthase ...   372   e-101   
gi|388582960|gb|EIM23263.1| saccharopine dehydrogenase [Wallemia...   372   e-101   Wallemia mellicola CBS 633.66
gi|254580735|ref|XP_002496353.1| ZYRO0C16412p [Zygosaccharomyces...   372   e-101   Zygosaccharomyces rouxii CBS 732
gi|465795090|emb|CCU99732.1| unnamed protein product [Malassezia...   371   e-100   Malassezia sympodialis ATCC 42132
gi|432864720|ref|XP_004070426.1| PREDICTED: spermidine synthase-...   370   e-100   Oryzias latipes [Japanese rice fish]
gi|466022084|ref|XP_004272432.1| PREDICTED: spermidine synthase ...   370   e-100   Orcinus orca [Orca]
gi|50554613|ref|XP_504715.1| YALI0E33143p [Yarrowia lipolytica] ...   370   e-100   Yarrowia lipolytica CLIB122
gi|471407260|ref|XP_004385219.1| PREDICTED: spermidine synthase ...   369   e-100   Trichechus manatus latirostris
gi|76637216|ref|XP_582280.2| PREDICTED: spermidine synthase isof...   369   e-100   
gi|472383640|ref|XP_004411196.1| PREDICTED: spermidine synthase ...   369   e-100   Odobenus rosmarus divergens
gi|327287238|ref|XP_003228336.1| PREDICTED: spermidine synthase-...   369   e-100   
gi|507547752|ref|XP_004657706.1| PREDICTED: spermidine synthase ...   369   e-100   Jaculus jaculus
gi|410966018|ref|XP_003989535.1| PREDICTED: spermidine synthase ...   368   1e-99   Felis catus [cat]
gi|395840954|ref|XP_003793315.1| PREDICTED: spermidine synthase ...   368   1e-99   Otolemur garnettii
gi|459368498|gb|EMG47201.1| Spermidine synthase, putative [Candi...   368   1e-99   Candida maltosa Xu316
gi|6678131|ref|NP_033298.1| spermidine synthase [Mus musculus] >...   368   1e-99   Mus musculus [mouse]
gi|478503680|ref|XP_004426144.1| PREDICTED: spermidine synthase,...   367   2e-99   
gi|260951089|ref|XP_002619841.1| hypothetical protein CLUG_01000...   367   2e-99   Clavispora lusitaniae ATCC 42720
gi|68482416|ref|XP_714840.1| hypothetical protein CaO19.2250 [Ca...   367   2e-99   Candida albicans SC5314
gi|505760032|gb|EOR04106.1| Saccharopine dehydrogenase [NADP(+),...   367   2e-99   Wallemia ichthyophaga EXF-994
gi|16758208|ref|NP_445916.1| spermidine synthase [Rattus norvegi...   367   2e-99   Rattus norvegicus [brown rat]
gi|507682414|ref|XP_004639791.1| PREDICTED: mannan-binding lecti...   367   3e-99   
gi|504173205|ref|XP_004596174.1| PREDICTED: spermidine synthase ...   367   3e-99   
gi|58269260|ref|XP_571786.1| spermidine synthase [Cryptococcus n...   366   4e-99   Cryptococcus neoformans var. neoformans JEC21
gi|402852915|ref|XP_003891152.1| PREDICTED: spermidine synthase ...   366   5e-99   
gi|344283521|ref|XP_003413520.1| PREDICTED: spermidine synthase-...   366   5e-99   Loxodonta africana [African bush elephant]
gi|321261389|ref|XP_003195414.1| spermidine synthase [Cryptococc...   366   5e-99   Cryptococcus gattii WM276
gi|26390475|dbj|BAC25903.1| unnamed protein product [Mus musculus]    365   8e-99   Mus musculus [mouse]
gi|63253298|ref|NP_003123.2| spermidine synthase [Homo sapiens] ...   365   1e-98   Homo sapiens [man]
gi|122921244|pdb|2O05|A Chain A, Human Spermidine Synthase >gi|1...   365   1e-98   Homo sapiens [man]
gi|255725052|ref|XP_002547455.1| spermidine synthase [Candida tr...   365   1e-98   Candida tropicalis MYA-3404
gi|291222293|ref|XP_002731154.1| PREDICTED: spermidine synthase-...   365   1e-98   
gi|347447556|pdb|3RW9|A Chain A, Crystal Structure Of Human Sper...   365   1e-98   Homo sapiens [man]
gi|114553926|ref|XP_514381.2| PREDICTED: spermidine synthase iso...   364   1e-98   Pan troglodytes
gi|531202|gb|AAA36633.1| spermidine synthase [Homo sapiens]           364   1e-98   Homo sapiens [man]
gi|149695532|ref|XP_001490409.1| PREDICTED: spermidine synthase-...   364   2e-98   Equus caballus [domestic horse]
gi|383873318|ref|NP_001244736.1| spermidine synthase [Macaca mul...   364   2e-98   Macaca mulatta [rhesus macaque]
gi|254569166|ref|XP_002491693.1| hypothetical protein [Komagatae...   364   2e-98   Komagataella phaffii GS115
gi|44888568|gb|AAS48112.1| chimeric spermidine synthase/saccharo...   363   2e-98   Cryptococcus neoformans var. grubii
gi|431906335|gb|ELK10532.1| Mannan-binding lectin serine proteas...   363   3e-98   Pteropus alecto
gi|350585594|ref|XP_003481998.1| PREDICTED: spermidine synthase ...   363   4e-98   Sus scrofa [pigs]
gi|472581620|gb|EMS19348.1| saccharopine dehydrogenase (NADP+, L...   363   4e-98   Rhodotorula toruloides NP11
gi|344302668|gb|EGW32942.1| hypothetical protein SPAPADRAFT_6028...   362   5e-98   Spathaspora passalidarum NRRL Y-27907
gi|354548134|emb|CCE44870.1| hypothetical protein CPAR2_406730 [...   362   6e-98   Candida parapsilosis
gi|241951762|ref|XP_002418603.1| spermidine synthase, putative [...   362   6e-98   Candida dubliniensis CD36
gi|119592082|gb|EAW71676.1| spermidine synthase, isoform CRA_b [...   362   7e-98   Homo sapiens [man]
gi|15077763|gb|AAK83327.1| chimeric spermidine synthase/saccharo...   361   2e-97   Cryptococcus neoformans
gi|74138635|dbj|BAE27138.1| unnamed protein product [Mus musculus]    360   2e-97   Mus musculus [mouse]
gi|395329578|gb|EJF61964.1| saccharopine dehydrogenase [Dichomit...   360   3e-97   Dichomitus squalens LYAD-421 SS1
gi|426381292|ref|XP_004057284.1| PREDICTED: spermidine synthase-...   359   6e-97   Gorilla gorilla gorilla [lowland gorilla]
gi|196007934|ref|XP_002113833.1| hypothetical protein TRIADDRAFT...   359   7e-97   Trichoplax adhaerens
gi|409075374|gb|EKM75755.1| hypothetical protein AGABI1DRAFT_641...   358   1e-96   Agaricus bisporus var. burnettii JB137-S8
gi|156387866|ref|XP_001634423.1| predicted protein [Nematostella...   357   2e-96   Nematostella vectensis
gi|448523556|ref|XP_003868892.1| Spe3 protein [Candida orthopsil...   357   2e-96   Candida orthopsilosis Co 90-125
gi|409041357|gb|EKM50842.1| hypothetical protein PHACADRAFT_2627...   357   2e-96   Phanerochaete carnosa HHB-10118-sp
gi|409041361|gb|EKM50846.1| hypothetical protein PHACADRAFT_1875...   357   2e-96   Phanerochaete carnosa HHB-10118-sp
gi|426327781|ref|XP_004024689.1| PREDICTED: spermidine synthase ...   357   3e-96   Gorilla gorilla gorilla [lowland gorilla]
gi|392575275|gb|EIW68409.1| hypothetical protein TREMEDRAFT_7427...   356   5e-96   Tremella mesenterica DSM 1558
gi|302684945|ref|XP_003032153.1| hypothetical protein SCHCODRAFT...   356   5e-96   Schizophyllum commune H4-8
gi|501310359|dbj|GAC99128.1| spermidine synthase [Pseudozyma hub...   355   8e-96   Pseudozyma hubeiensis SY62
gi|50420767|ref|XP_458921.1| DEHA2D10472p [Debaryomyces hansenii...   355   8e-96   Debaryomyces hansenii CBS767
gi|326427880|gb|EGD73450.1| spermidine synthase [Salpingoeca sp....   353   4e-95   Salpingoeca rosetta
gi|426198024|gb|EKV47950.1| hypothetical protein AGABI2DRAFT_184...   353   4e-95   Agaricus bisporus var. bisporus H97
gi|392588756|gb|EIW78088.1| saccharopine dehydrogenase [Coniopho...   352   8e-95   Coniophora puteana RWD-64-598 SS2
gi|392559013|gb|EIW52198.1| saccharopine dehydrogenase [Trametes...   352   1e-94   Trametes versicolor FP-101664 SS1
gi|406699216|gb|EKD02426.1| spermidine synthase [Trichosporon as...   352   1e-94   Trichosporon asahii var. asahii CBS 8904
gi|344234284|gb|EGV66154.1| spermine synthase [Candida tenuis AT...   352   1e-94   Candida tenuis ATCC 10573
gi|353227289|emb|CCA77802.1| probable chimeric spermidine syntha...   351   1e-94   Serendipita indica DSM 11827
gi|401888169|gb|EJT52134.1| chimeric spermidine synthase/sacchar...   351   2e-94   Trichosporon asahii var. asahii CBS 2479
gi|126138914|ref|XP_001385980.1| hypothetical protein PICST_8435...   350   2e-94   Scheffersomyces stipitis CBS 6054
gi|392339226|ref|XP_003753758.1| PREDICTED: LOW QUALITY PROTEIN:...   350   3e-94   
gi|390597080|gb|EIN06480.1| saccharopine dehydrogenase [Punctula...   349   5e-94   Punctularia strigosozonata HHB-11173 SS5
gi|198427208|ref|XP_002128514.1| PREDICTED: spermidine synthase ...   348   1e-93   Ciona intestinalis [sea vase]
gi|403418525|emb|CCM05225.1| predicted protein [Fibroporia radic...   347   2e-93   Fibroporia radiculosa
gi|336369311|gb|EGN97653.1| hypothetical protein SERLA73DRAFT_92...   347   2e-93   Serpula lacrymans var. lacrymans S7.3
gi|507112387|emb|CDF36070.1| putrescine aminopropyltransferase (...   347   2e-93   Chondrus crispus [Irish moss]
gi|393233308|gb|EJD40881.1| saccharopine dehydrogenase [Auricula...   347   2e-93   Auricularia subglabra TFB-10046 SS5
gi|328351802|emb|CCA38201.1| spermidine synthase [Komagataella p...   346   4e-93   Komagataella phaffii CBS 7435
gi|358058660|dbj|GAA95623.1| hypothetical protein E5Q_02279 [Mix...   346   5e-93   Mixia osmundae IAM 14324
gi|470302017|ref|XP_004347506.1| spermidine synthase [Capsaspora...   345   7e-93   
gi|328863223|gb|EGG12323.1| hypothetical protein MELLADRAFT_2819...   345   8e-93   Melampsora larici-populina 98AG31
gi|449545146|gb|EMD36118.1| hypothetical protein CERSUDRAFT_8522...   345   9e-93   Gelatoporia subvermispora B
gi|444728183|gb|ELW68647.1| Serine/threonine-protein kinase mTOR...   345   1e-92   Tupaia chinensis
gi|443683877|gb|ELT87970.1| hypothetical protein CAPTEDRAFT_1569...   345   1e-92   Capitella teleta
gi|512853322|ref|XP_004916087.1| PREDICTED: spermidine synthase ...   344   2e-92   
gi|170089005|ref|XP_001875725.1| saccharopine dehydrogenase [Lac...   344   2e-92   Laccaria bicolor S238N-H82
gi|363751094|ref|XP_003645764.1| hypothetical protein Ecym_3464 ...   343   3e-92   Eremothecium cymbalariae DBVPG#7215
gi|190348490|gb|EDK40949.2| hypothetical protein PGUG_05047 [Mey...   343   3e-92   Meyerozyma guilliermondii ATCC 6260
gi|321468222|gb|EFX79208.1| hypothetical protein DAPPUDRAFT_3049...   343   4e-92   Daphnia pulex
gi|146414243|ref|XP_001483092.1| hypothetical protein PGUG_05047...   343   4e-92   Meyerozyma guilliermondii ATCC 6260
gi|389746615|gb|EIM87794.1| saccharopine dehydrogenase [Stereum ...   342   6e-92   Stereum hirsutum FP-91666 SS1
gi|302683522|ref|XP_003031442.1| hypothetical protein SCHCODRAFT...   339   5e-91   Schizophyllum commune H4-8
gi|219130033|ref|XP_002185179.1| spermine/spermidine synthase [P...   338   1e-90   Phaeodactylum tricornutum CCAP 1055/1
gi|302422022|ref|XP_003008841.1| spermidine synthase [Verticilli...   338   1e-90   Verticillium alfalfae VaMs.102
gi|330842026|ref|XP_003292987.1| spermidine synthase [Dictyostel...   336   4e-90   Dictyostelium purpureum
gi|393213931|gb|EJC99425.1| spermidine synthase [Fomitiporia med...   332   8e-89   Fomitiporia mediterranea MF3/22
gi|4903273|gb|AAD32851.1|AF069757_1 spermidine synthase [Dictyos...   332   1e-88   Dictyostelium discoideum
gi|66827309|ref|XP_647009.1| hypothetical protein DDB_G0268630 [...   330   2e-88   Dictyostelium discoideum AX4
gi|169862955|ref|XP_001838101.1| spermidine synthase [Coprinopsi...   330   3e-88   Coprinopsis cinerea okayama7#130
gi|470649174|ref|XP_004328115.1| PREDICTED: spermidine synthase ...   329   4e-88   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|440901449|gb|ELR52390.1| Spermidine synthase, partial [Bos gr...   329   5e-88   Bos mutus
gi|167519370|ref|XP_001744025.1| hypothetical protein [Monosiga ...   328   8e-88   Monosiga brevicollis MX1
gi|340376656|ref|XP_003386848.1| PREDICTED: spermidine synthase-...   328   9e-88   Amphimedon queenslandica
gi|470241718|ref|XP_004352434.1| spermidine synthase [Dictyostel...   327   2e-87   Dictyostelium fasciculatum
gi|385302583|gb|EIF46709.1| spermidine synthase [Dekkera bruxell...   327   3e-87   Brettanomyces bruxellensis AWRI1499
gi|397614365|gb|EJK62755.1| hypothetical protein THAOC_16622 [Th...   327   3e-87   Thalassiosira oceanica
gi|512899761|ref|XP_004924726.1| PREDICTED: spermidine synthase-...   326   5e-87   Bombyx mori [silk moth]
gi|380021423|ref|XP_003694565.1| PREDICTED: spermidine synthase-...   325   1e-86   Apis florea [dwarf honeybee]
gi|340384244|ref|XP_003390624.1| PREDICTED: spermidine synthase-...   323   2e-86   
gi|426240325|ref|XP_004014060.1| PREDICTED: spermidine synthase ...   323   2e-86   
gi|512929859|ref|XP_004906528.1| PREDICTED: spermidine synthase ...   323   4e-86   
gi|341893542|gb|EGT49477.1| hypothetical protein CAEBREN_25958 [...   323   4e-86   Caenorhabditis brenneri
gi|471906724|emb|CCO28739.1| spermidine synthase [Rhizoctonia so...   323   5e-86   Rhizoctonia solani AG-1 IB
gi|281204635|gb|EFA78830.1| spermidine synthase [Polysphondylium...   322   5e-86   Polysphondylium pallidum PN500
gi|25154106|ref|NP_496723.2| Protein SPDS-1, isoform a [Caenorha...   322   8e-86   Caenorhabditis elegans [roundworm]
gi|466001508|gb|EMP41527.1| Serine/threonine-protein kinase mTOR...   322   8e-86   Chelonia mydas [green seaturtle]
gi|110762382|ref|XP_001120306.1| PREDICTED: spermidine synthase ...   322   9e-86   Apis mellifera [European honey bee]
gi|300121366|emb|CBK21746.2| unnamed protein product [Blastocyst...   321   2e-85   Blastocystis hominis
gi|1167999|gb|AAB35050.1| spermidine synthase, putrescine aminop...   320   2e-85   Rattus sp. [rats]
gi|224012471|ref|XP_002294888.1| spermine synthase [Thalassiosir...   320   2e-85   Thalassiosira pseudonana CCMP1335
gi|327309372|ref|XP_003239377.1| spermidine synthase [Trichophyt...   320   3e-85   Trichophyton rubrum CBS 118892
gi|212532037|ref|XP_002146175.1| spermidine synthase [Talaromyce...   319   7e-85   Talaromyces marneffei ATCC 18224
gi|354502302|ref|XP_003513226.1| PREDICTED: spermidine synthase-...   318   1e-84   
gi|511930198|ref|XP_004784149.1| PREDICTED: spermidine synthase ...   318   1e-84   
gi|50552163|ref|XP_503556.1| YALI0E04763p [Yarrowia lipolytica] ...   318   1e-84   Yarrowia lipolytica CLIB122
gi|308475269|ref|XP_003099853.1| hypothetical protein CRE_24540 ...   317   4e-84   Caenorhabditis remanei
gi|348689589|gb|EGZ29403.1| hypothetical protein PHYSODRAFT_4775...   315   7e-84   Phytophthora sojae
gi|351713712|gb|EHB16631.1| Spermidine synthase, partial [Hetero...   315   9e-84   Heterocephalus glaber [naked mole rat]
gi|507936898|ref|XP_004679375.1| PREDICTED: spermidine synthase ...   315   1e-83   
gi|359319114|ref|XP_850896.3| PREDICTED: spermidine synthase-lik...   314   2e-83   
gi|452819323|gb|EME26385.1| spermidine synthase [Galdieria sulph...   314   2e-83   Galdieria sulphuraria
gi|432098122|gb|ELK28009.1| Mannan-binding lectin serine proteas...   314   2e-83   Myotis davidii
gi|357605077|gb|EHJ64458.1| putative spermidine synthase [Danaus...   313   3e-83   Danaus plexippus [American monarch]
gi|301774743|ref|XP_002922806.1| PREDICTED: spermidine synthase-...   313   4e-83   
gi|383857837|ref|XP_003704410.1| PREDICTED: spermidine synthase-...   313   5e-83   Megachile rotundata
gi|332250401|ref|XP_003274340.1| PREDICTED: spermidine synthase ...   311   1e-82   
gi|470437129|ref|XP_004338958.1| spermidine synthase [Acanthamoe...   311   2e-82   Acanthamoeba castellanii str. Neff
gi|406606972|emb|CCH41694.1| Spermidine synthase 2 [Wickerhamomy...   309   6e-82   Wickerhamomyces ciferrii
gi|498957942|ref|XP_004524234.1| PREDICTED: spermidine synthase-...   309   6e-82   Ceratitis capitata
gi|428169630|gb|EKX38562.1| hypothetical protein GUITHDRAFT_1651...   309   7e-82   Guillardia theta CCMP2712
gi|402592651|gb|EJW86578.1| spermidine synthase, partial [Wucher...   309   8e-82   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|281349255|gb|EFB24839.1| hypothetical protein PANDA_011804 [A...   308   8e-82   Ailuropoda melanoleuca
gi|254573952|ref|XP_002494085.1| Spermine synthase, required for...   308   9e-82   Komagataella phaffii GS115
gi|170591012|ref|XP_001900265.1| Spermidine synthase [Brugia mal...   307   2e-81   Brugia malayi [agent of lymphatic filariasis]
gi|301105194|ref|XP_002901681.1| spermidine synthase, putative [...   307   3e-81   Phytophthora infestans T30-4
gi|156538693|ref|XP_001607780.1| PREDICTED: spermidine synthase-...   305   9e-81   Nasonia vitripennis
gi|320583760|gb|EFW97973.1| Spermine synthase [Ogataea parapolym...   304   2e-80   
gi|212645616|ref|NP_001129829.1| Protein SPDS-1, isoform b [Caen...   303   3e-80   Caenorhabditis elegans [roundworm]
gi|340723867|ref|XP_003400308.1| PREDICTED: spermidine synthase-...   303   3e-80   
gi|325184913|emb|CCA19405.1| unnamed protein product [Albugo lai...   303   4e-80   
gi|350422672|ref|XP_003493245.1| PREDICTED: spermidine synthase-...   302   7e-80   
gi|482571130|gb|EOA35318.1| hypothetical protein CARUB_v10020501...   302   9e-80   
gi|254584492|ref|XP_002497814.1| ZYRO0F14124p [Zygosaccharomyces...   301   1e-79   
gi|268533566|ref|XP_002631911.1| Hypothetical protein CBG07888 [...   301   1e-79   
gi|410082355|ref|XP_003958756.1| hypothetical protein KAFR_0H021...   301   1e-79   
gi|116785514|gb|ABK23753.1| unknown [Picea sitchensis] >gi|11679...   300   3e-79   
gi|356567616|ref|XP_003552013.1| PREDICTED: spermidine synthase ...   300   3e-79   
gi|91084649|ref|XP_966904.1| PREDICTED: similar to Spermidine Sy...   300   3e-79   
gi|488594788|ref|XP_004485367.1| PREDICTED: LOW QUALITY PROTEIN:...   300   4e-79   
gi|307189718|gb|EFN74011.1| Spermidine synthase [Camponotus flor...   300   4e-79   
gi|58377281|ref|XP_309520.2| AGAP011126-PA [Anopheles gambiae st...   299   5e-79   
gi|312162112|gb|ADQ37303.1| putative spermidine synthase [Pinus ...   299   6e-79   
gi|502154787|ref|XP_004509836.1| PREDICTED: spermidine synthase ...   299   6e-79   
gi|336088579|dbj|BAC20170.2| spermidine synthase [Malus domestica]    298   8e-79   
gi|393909832|gb|EFO27473.2| spermidine synthase [Loa loa]             298   9e-79   
gi|312376799|gb|EFR23786.1| hypothetical protein AND_12250 [Anop...   298   9e-79   
gi|242023526|ref|XP_002432183.1| Spermidine synthase, putative [...   298   1e-78   
gi|6094329|sp|Q96557.1|SPD2_DATST RecName: Full=Spermidine synth...   298   1e-78   
gi|301790795|gb|ADK89558.1| spermidine synthase [Marsilea vestit...   298   2e-78   
gi|312067118|ref|XP_003136592.1| spermidine synthase [Loa loa]        297   2e-78   
gi|156838615|ref|XP_001643010.1| hypothetical protein Kpol_397p1...   297   2e-78   
gi|356526815|ref|XP_003532012.1| PREDICTED: spermidine synthase ...   297   3e-78   
gi|50307673|ref|XP_453816.1| hypothetical protein [Kluyveromyces...   296   4e-78   
gi|242246955|ref|NP_001156229.1| spermidine synthase-like [Acyrt...   296   4e-78   
gi|157125087|ref|XP_001660614.1| spermidine synthase [Aedes aegy...   296   5e-78   
gi|328698378|ref|XP_001944178.2| PREDICTED: spermidine synthase-...   296   5e-78   
gi|297841771|ref|XP_002888767.1| hypothetical protein ARALYDRAFT...   296   5e-78   
gi|23495354|dbj|BAC20171.1| spermidine synthase [Malus domestica]     296   6e-78   
gi|350536257|ref|NP_001234493.1| spermidine synthase [Solanum ly...   296   7e-78   
gi|154623414|emb|CAO02391.1| spermidine synthase [Cochlearia off...   295   7e-78   
gi|405952118|gb|EKC19964.1| Spermidine synthase [Crassostrea gigas]   295   7e-78   
gi|295665965|ref|XP_002793533.1| spermidine synthase [Paracoccid...   295   7e-78   
gi|151941307|gb|EDN59685.1| spermine synthase [Saccharomyces cer...   295   8e-78   
gi|224111294|ref|XP_002315806.1| predicted protein [Populus tric...   295   8e-78   
gi|6094328|sp|O48658.1|SPD1_HYONI RecName: Full=Spermidine synth...   295   1e-77   
gi|384249416|gb|EIE22898.1| spermidine synthase [Coccomyxa subel...   295   1e-77   
gi|15223115|ref|NP_177188.1| Spermidine synthase 2 [Arabidopsis ...   295   1e-77   
gi|259148132|emb|CAY81381.1| Spe4p [Saccharomyces cerevisiae EC1...   295   1e-77   
gi|502093007|ref|XP_004489856.1| PREDICTED: spermidine synthase ...   295   1e-77   
gi|6323175|ref|NP_013247.1| spermine synthase [Saccharomyces cer...   295   1e-77   
gi|357485917|ref|XP_003613246.1| Spermidine synthase [Medicago t...   295   1e-77   
gi|145336078|ref|NP_173794.2| spermidine synthase 1 [Arabidopsis...   294   2e-77   
gi|126153731|emb|CAM35497.1| spermidine synthase [Lotus japonicus]    294   2e-77   
gi|12229958|sp|Q9ZTR1.1|SPD1_PEA RecName: Full=Spermidine syntha...   294   3e-77   
gi|470123254|ref|XP_004297643.1| PREDICTED: spermidine synthase ...   294   3e-77   
gi|12230014|sp|Q9ZUB3.1|SPD1_ARATH RecName: Full=Spermidine synt...   294   3e-77   
gi|482573800|gb|EOA37987.1| hypothetical protein CARUB_v10009456...   294   3e-77   
gi|297845432|ref|XP_002890597.1| hypothetical protein ARALYDRAFT...   293   3e-77   
gi|485621969|gb|EOD18412.1| spermidine synthase [Emiliania huxle...   293   3e-77   
gi|255587587|ref|XP_002534321.1| spermidine synthase 1, putative...   293   3e-77   
gi|401840422|gb|EJT43251.1| SPE4-like protein [Saccharomyces kud...   293   4e-77   
gi|224099715|ref|XP_002311589.1| predicted protein [Populus tric...   293   4e-77   
gi|369726491|gb|AEX20346.1| spermidine synthase [Medicago sativa]     293   4e-77   
gi|256273016|gb|EEU07978.1| Spe4p [Saccharomyces cerevisiae JAY291]   293   4e-77   
gi|99083515|gb|ABF66657.1| spermidine synthase [Ammopiptanthus m...   293   6e-77   
gi|12229957|sp|Q9ZTR0.1|SPD2_PEA RecName: Full=Spermidine syntha...   292   7e-77   
gi|359806591|ref|NP_001241525.1| uncharacterized protein LOC1007...   292   7e-77   
gi|225424695|ref|XP_002263762.1| PREDICTED: spermidine synthase ...   292   9e-77   
gi|323308143|gb|EGA61396.1| Spe4p [Saccharomyces cerevisiae Fost...   292   9e-77   
gi|357433153|gb|AET79382.1| spermidine synthase [Populus tomentosa]   292   9e-77   
gi|392297662|gb|EIW08761.1| Spe4p [Saccharomyces cerevisiae CEN....   291   1e-76   
gi|296086541|emb|CBI32130.3| unnamed protein product [Vitis vini...   291   1e-76   
gi|402218205|gb|EJT98283.1| hypothetical protein DACRYDRAFT_2473...   291   1e-76   
gi|2821961|dbj|BAA24536.1| spermidine synthase [Arabidopsis thal...   291   1e-76   
gi|15150055|emb|CAC51027.1| spermidine synthase [Solanum tuberosum]   291   1e-76   
gi|462419439|gb|EMJ23702.1| hypothetical protein PRUPE_ppa008283...   291   2e-76   
gi|27808434|dbj|BAC55523.1| spermidine synthase [Petunia x hybrida]   291   2e-76   
gi|365759425|gb|EHN01212.1| Spe4p [Saccharomyces cerevisiae x Sa...   291   2e-76   
gi|358248320|ref|NP_001239861.1| uncharacterized protein LOC1007...   291   2e-76   
gi|349579866|dbj|GAA25027.1| K7_Spe4p [Saccharomyces cerevisiae ...   291   2e-76   
gi|6094336|sp|O48660.1|SPDE_NICSY RecName: Full=Spermidine synth...   290   2e-76   
gi|508708488|gb|EOY00385.1| Spermidine synthase 1 [Theobroma cacao]   290   3e-76   
gi|195038906|ref|XP_001990832.1| GH18040 [Drosophila grimshawi] ...   290   3e-76   
gi|449434907|ref|XP_004135237.1| PREDICTED: spermidine synthase-...   290   4e-76   
gi|401624651|gb|EJS42704.1| spe4p [Saccharomyces arboricola H-6]      290   4e-76   
gi|384503184|gb|AFH96952.1| spermidine synthase [Eleutherococcus...   290   4e-76   
gi|49425361|gb|AAT66041.1| spermidine synthase [Cucumis sativus]      290   5e-76   
gi|303284801|ref|XP_003061691.1| predicted protein [Micromonas p...   290   5e-76   
gi|298706538|emb|CBJ29508.1| spermidine/spermine synthase [Ectoc...   290   5e-76   
gi|251831262|gb|ACT21542.1| spermidine synthase [Panax ginseng]       289   5e-76   
gi|478255959|gb|ENN76160.1| hypothetical protein YQE_07331, part...   288   9e-76   
gi|440475286|gb|ELQ43976.1| spermidine synthase, partial [Magnap...   288   1e-75   
gi|226492509|ref|NP_001149286.1| LOC100282908 [Zea mays] >gi|195...   288   1e-75   
gi|170032648|ref|XP_001844192.1| spermidine synthase [Culex quin...   288   1e-75   
gi|195107677|ref|XP_001998435.1| GI23961 [Drosophila mojavensis]...   288   2e-75   
gi|55670890|pdb|1XJ5|A Chain A, X-Ray Structure Of Spermidine Sy...   287   3e-75   
gi|444314143|ref|XP_004177729.1| hypothetical protein TBLA_0A041...   287   3e-75   
gi|223946537|gb|ACN27352.1| unknown [Zea mays] >gi|414588850|tpg...   287   3e-75   
gi|473890074|gb|EMS48579.1| Spermidine synthase 1 [Triticum urartu]   287   3e-75   
gi|218199468|gb|EEC81895.1| hypothetical protein OsI_25717 [Oryz...   286   3e-75   
gi|6094327|sp|Q96556.1|SPD1_DATST RecName: Full=Spermidine synth...   286   4e-75   
gi|332028526|gb|EGI68564.1| Spermidine synthase [Acromyrmex echi...   286   4e-75   
gi|408419366|ref|YP_006760780.1| spermidine synthase SpeE2 [Desu...   286   4e-75   
gi|6094330|sp|O48659.1|SPD2_HYONI RecName: Full=Spermidine synth...   286   6e-75   
gi|115471679|ref|NP_001059438.1| Os07g0408700 [Oryza sativa Japo...   285   9e-75   
gi|297374553|emb|CBL93259.1| spermidine synthase-saccharopine de...   285   1e-74   
gi|6094335|sp|O82147.1|SPDE_COFAR RecName: Full=Spermidine synth...   285   1e-74   
gi|195446427|ref|XP_002070775.1| GK10845 [Drosophila willistoni]...   285   1e-74   
gi|226529177|ref|NP_001140791.1| uncharacterized protein LOC1002...   284   2e-74   
gi|283467363|emb|CBI83265.1| spermidine synthase-saccharopine de...   284   2e-74   
gi|449018515|dbj|BAM81917.1| putrescine aminopropyltransferase [...   284   2e-74   
gi|367016002|ref|XP_003682500.1| hypothetical protein TDEL_0F047...   284   3e-74   
gi|28317069|gb|AAO39553.1| RE01362p, partial [Drosophila melanog...   283   3e-74   
gi|357119034|ref|XP_003561251.1| PREDICTED: spermidine synthase ...   283   5e-74   
gi|494026533|ref|WP_006968727.1| spermidine synthase SpeE [Desul...   282   7e-74   
gi|323451384|gb|EGB07261.1| hypothetical protein AURANDRAFT_5911...   282   9e-74   
gi|366991803|ref|XP_003675667.1| hypothetical protein NCAS_0C031...   282   1e-73   
gi|366997845|ref|XP_003683659.1| hypothetical protein TPHA_0A014...   281   1e-73   
gi|194746211|ref|XP_001955574.1| GF16181 [Drosophila ananassae] ...   281   1e-73   
gi|283467365|emb|CBI83266.1| spermidine synthase-saccharopine de...   281   2e-73   
gi|460383087|ref|XP_004237263.1| PREDICTED: spermidine synthase ...   280   3e-73   
gi|24645443|ref|NP_731384.1| spermidine synthase, isoform A [Dro...   280   3e-73   
gi|56791818|gb|AAW30410.1| spermidine synthase X [Silene latifolia]   280   4e-73   
gi|195499508|ref|XP_002096978.1| GE25970 [Drosophila yakuba] >gi...   280   4e-73   
gi|354545898|emb|CCE42627.1| hypothetical protein CPAR2_202700 [...   280   4e-73   
gi|194902914|ref|XP_001980786.1| GG16982 [Drosophila erecta] >gi...   280   5e-73   
gi|270313549|gb|ACZ73829.1| spermidine synthase [Olea europaea]       279   5e-73   
gi|195330342|ref|XP_002031863.1| GM23823 [Drosophila sechellia] ...   279   6e-73   
gi|410730165|ref|XP_003671260.2| hypothetical protein NDAI_0G024...   279   7e-73   
gi|23495356|dbj|BAC20172.1| spermidine synthase [Malus domestica]     278   9e-73   
gi|190346932|gb|EDK39120.2| hypothetical protein PGUG_03218 [Mey...   278   9e-73   
gi|307196559|gb|EFN78089.1| Spermidine synthase [Harpegnathos sa...   277   3e-72   
gi|56791820|gb|AAW30411.1| spermidine synthase Y [Silene latifolia]   276   5e-72   
gi|302803356|ref|XP_002983431.1| hypothetical protein SELMODRAFT...   276   6e-72   
gi|146419048|ref|XP_001485489.1| hypothetical protein PGUG_03218...   276   7e-72   
gi|159031807|dbj|BAF91875.1| spermidine synthase [Nicotiana bent...   276   7e-72   
gi|56791816|gb|AAW30409.1| spermidine synthase [Silene vulgaris]      275   8e-72   
gi|302784574|ref|XP_002974059.1| hypothetical protein SELMODRAFT...   275   9e-72   
gi|168009020|ref|XP_001757204.1| predicted protein [Physcomitrel...   275   9e-72   
gi|179399176|gb|ACB86615.1| putative spermidine synthase [Silene...   275   1e-71   
gi|168000521|ref|XP_001752964.1| predicted protein [Physcomitrel...   274   2e-71   
gi|357141122|ref|XP_003572094.1| PREDICTED: spermine synthase-li...   273   4e-71   
gi|50294273|ref|XP_449548.1| hypothetical protein [Candida glabr...   273   4e-71   
gi|145352221|ref|XP_001420452.1| Spermidine synthase [Ostreococc...   273   6e-71   
gi|255728769|ref|XP_002549310.1| spermine synthase [Candida trop...   273   6e-71   
gi|255718505|ref|XP_002555533.1| KLTH0G11484p [Lachancea thermot...   272   7e-71   
gi|307105033|gb|EFN53284.1| hypothetical protein CHLNCDRAFT_2610...   272   7e-71   
gi|308198203|ref|XP_001387146.2| predicted protein [Scheffersomy...   272   7e-71   
gi|226509226|ref|NP_001149310.1| spermidine synthase 1 [Zea mays...   272   7e-71   
gi|302665792|ref|XP_003024503.1| hypothetical protein TRV_01334 ...   272   8e-71   
gi|342871552|gb|EGU74126.1| hypothetical protein FOXB_15363 [Fus...   272   8e-71   
gi|413925962|gb|AFW65894.1| spermidine synthase 1 isoform 1 [Zea...   271   1e-70   
gi|407729324|gb|AFU24492.1| SPDS, partial [Drosophila pachea] >g...   271   1e-70   
gi|291001921|ref|XP_002683527.1| predicted protein [Naegleria gr...   271   1e-70   
gi|391325353|ref|XP_003737203.1| PREDICTED: spermidine synthase-...   271   1e-70   
gi|198453209|ref|XP_001359112.2| GA20990 [Drosophila pseudoobscu...   271   1e-70   
gi|422293723|gb|EKU21023.1| spermidine synthase, partial [Nannoc...   271   1e-70   
gi|241950307|ref|XP_002417876.1| spermidine aminopropyltransfera...   271   2e-70   
gi|302500029|ref|XP_003012009.1| hypothetical protein ARB_01765 ...   271   2e-70   
gi|242064674|ref|XP_002453626.1| hypothetical protein SORBIDRAFT...   270   4e-70   
gi|179399111|gb|ACB86613.1| putative spermidine synthase [Silene...   270   4e-70   
gi|179399142|gb|ACB86614.1| putative spermidine synthase [Silene...   270   4e-70   
gi|448526004|ref|XP_003869259.1| hypothetical protein CORT_0D027...   270   4e-70   
gi|242063812|ref|XP_002453195.1| hypothetical protein SORBIDRAFT...   270   5e-70   
gi|407729330|gb|AFU24495.1| SPDS, partial [Drosophila pachea] >g...   270   5e-70   
gi|179399250|gb|ACB86617.1| putative spermidine synthase [Silene...   269   7e-70   
gi|5381172|dbj|BAA82263.1| putrescine N-methyltransferase [Hyosc...   269   8e-70   
gi|357463867|ref|XP_003602215.1| Spermidine synthase [Medicago t...   269   8e-70   
gi|224367740|ref|YP_002601903.1| protein SpeE1 [Desulfobacterium...   269   8e-70   
gi|195624244|gb|ACG33952.1| spermidine synthase 1 [Zea mays]          268   1e-69   
gi|68467241|ref|XP_722282.1| hypothetical protein CaO19.12425 [C...   268   1e-69   
gi|195400309|ref|XP_002058760.1| GJ11148 [Drosophila virilis] >g...   268   1e-69   
gi|397503020|ref|XP_003822134.1| PREDICTED: spermidine synthase ...   268   2e-69   
gi|344256788|gb|EGW12892.1| Spermidine synthase [Cricetulus gris...   268   2e-69   
gi|502124232|ref|XP_004498439.1| PREDICTED: spermine synthase-li...   267   2e-69   
gi|414884326|tpg|DAA60340.1| TPA: hypothetical protein ZEAMMB73_...   267   3e-69   
gi|179399058|gb|ACB86612.1| putative spermidine synthase [Silene...   267   3e-69   
gi|344233776|gb|EGV65646.1| spermine synthase [Candida tenuis AT...   266   5e-69   
gi|412988039|emb|CCO19435.1| spermidine synthase [Bathycoccus pr...   266   5e-69   
gi|5381170|dbj|BAA82262.1| putrescine N-methyltransferase 2 [Atr...   266   5e-69   
gi|126153733|emb|CAM35498.1| spermine synthase [Lotus japonicus]      266   5e-69   
gi|449465192|ref|XP_004150312.1| PREDICTED: spermine synthase-li...   266   5e-69   
gi|294657714|ref|XP_460017.2| DEHA2E16456p [Debaryomyces hanseni...   266   7e-69   
gi|189308765|gb|ACD87085.1| spermidine synthase 3 [Oryza sativa ...   266   7e-69   
gi|50251663|dbj|BAD29687.1| putative aminopropyl transferase [Or...   266   7e-69   
gi|218190429|gb|EEC72856.1| hypothetical protein OsI_06609 [Oryz...   266   7e-69   
gi|459366925|gb|EMG46095.1| Spermine synthase [Candida maltosa X...   266   8e-69   
gi|457871188|ref|XP_004222514.1| spermidine synthase [Plasmodium...   265   1e-68   
gi|33340515|gb|AAQ14853.1|AF321139_1 spermidine synthase [Nicoti...   264   2e-68   
gi|474201758|gb|EMS58513.1| Spermine synthase [Triticum urartu]       264   2e-68   
gi|326532138|dbj|BAK01445.1| predicted protein [Hordeum vulgare ...   264   2e-68   
gi|86438862|emb|CAJ46252.1| putrescine N-methyltransferase [Caly...   264   2e-68   
gi|193792545|gb|ACF21006.1| putrescine N-methyltransferase 2 [An...   264   2e-68   
gi|255086215|ref|XP_002509074.1| predicted protein [Micromonas s...   263   3e-68   
gi|513220215|ref|XP_001234728.3| PREDICTED: spermidine synthase,...   262   7e-68   
gi|482549400|gb|EOA13594.1| hypothetical protein CARUB_v10026659...   262   8e-68   
gi|222423110|dbj|BAH19534.1| AT5G53120 [Arabidopsis thaliana]         261   1e-67   
gi|18423473|ref|NP_568785.1| Spermine synthase [Arabidopsis thal...   261   1e-67   
gi|159489717|ref|XP_001702843.1| spermidine synthase [Chlamydomo...   261   1e-67   
gi|475600781|gb|EMT24635.1| Spermidine synthase [Aegilops tauschii]   261   1e-67   
gi|260942997|ref|XP_002615797.1| hypothetical protein CLUG_04679...   261   2e-67   
gi|297792679|ref|XP_002864224.1| hypothetical protein ARALYDRAFT...   261   2e-67   
gi|156098781|ref|XP_001615406.1| spermidine synthase [Plasmodium...   261   2e-67   
gi|224120662|ref|XP_002318386.1| predicted protein [Populus tric...   261   2e-67   
gi|356526817|ref|XP_003532013.1| PREDICTED: spermidine synthase ...   260   2e-67   
gi|9757993|dbj|BAB08415.1| spermidine synthase [Arabidopsis thal...   260   3e-67   
gi|15983394|gb|AAL11565.1|AF424571_1 AT5g53120/MFH8_5 [Arabidops...   260   4e-67   
gi|166863333|gb|ABZ01524.1| spermidine synthase X [Silene latifo...   260   4e-67   
gi|166863339|gb|ABZ01527.1| spermidine synthase X [Silene latifo...   260   4e-67   
gi|403289994|ref|XP_003945183.1| PREDICTED: LOW QUALITY PROTEIN:...   260   4e-67   
gi|350534638|ref|NP_001234407.1| SPM1 protein [Solanum lycopersi...   259   4e-67   
gi|356516027|ref|XP_003526698.1| PREDICTED: spermine synthase-li...   259   4e-67   
gi|166863381|gb|ABZ01548.1| spermidine synthase X [Silene latifo...   259   5e-67   
gi|166863341|gb|ABZ01528.1| spermidine synthase X [Silene latifo...   259   5e-67   
gi|508776234|gb|EOY23490.1| Spermidine synthase 3 isoform 3 [The...   259   5e-67   
gi|21592832|gb|AAM64782.1| spermidine synthase [Arabidopsis thal...   259   6e-67   
gi|449268442|gb|EMC79306.1| Spermidine synthase, partial [Columb...   259   7e-67   
gi|83770559|dbj|BAE60692.1| unnamed protein product [Aspergillus...   259   8e-67   
gi|508776232|gb|EOY23488.1| Spermidine synthase 3 isoform 1 [The...   259   8e-67   
gi|449486588|ref|XP_002189859.2| PREDICTED: spermidine synthase,...   259   9e-67   
gi|363808324|ref|NP_001242248.1| uncharacterized protein LOC1008...   258   2e-66   
gi|6851056|emb|CAB71155.1| spermidine synthase [Plasmodium falci...   257   2e-66   
gi|448082574|ref|XP_004195172.1| Piso0_005719 [Millerozyma farin...   257   2e-66   
gi|448087174|ref|XP_004196265.1| Piso0_005719 [Millerozyma farin...   257   3e-66   
gi|124804337|ref|XP_001347972.1| spermidine synthase [Plasmodium...   257   3e-66   
gi|283467367|emb|CBI83267.1| spermidine synthase-saccharopine de...   257   3e-66   
gi|483511003|gb|EOB00036.1| Spermidine synthase, partial [Anas p...   257   3e-66   
gi|149243469|pdb|2PWP|A Chain A, Crystal Structure Of Spermidine...   256   4e-66   
gi|460398430|ref|XP_004244762.1| PREDICTED: putrescine N-methylt...   256   4e-66   


>gi|380088740|emb|CCC13317.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 291

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/287 (68%), Positives = 239/287 (83%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP IQDGWFRE   +WPGQAM L++E+VL HEKSLYQDVLIFKST +G VLVLD V+QC
Sbjct: 5   THPTIQDGWFREISNMWPGQAMTLKVEKVLHHEKSLYQDVLIFKSTDHGNVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDVVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSK++LP M+ GF++PKV VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ  YF+
Sbjct: 125 LSKQFLPHMSAGFEHPKVKVHVGDGFKFLEDFKNTFDVIITDSSDPEGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +ALR GG+I+TQ E QWLHL LIT+++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLHDALREGGVITTQAENQWLHLPLITKLKKDCKEVFPVAEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D   N+K PLR WS+EEEEKLCRYYNS+IH+A+FILP F K AL+
Sbjct: 245 SKDPNANVKVPLRSWSQEEEEKLCRYYNSEIHKASFILPTFAKKALE 291



>gi|85100119|ref|XP_960907.1| spermidine synthase [Neurospora crassa OR74A]
 gi|8134725|sp|Q9Y8H7.1|SPEE_NEUCR RecName: Full=Spermidine synthase; Short=SPDSY; AltName:
           Full=Putrescine aminopropyltransferase
 gi|5231273|dbj|BAA81738.1| spermidine synthase [Neurospora crassa]
 gi|28922438|gb|EAA31671.1| spermidine synthase [Neurospora crassa OR74A]
 gi|28950283|emb|CAD71251.1| spermidine synthase (spe-3) [Neurospora crassa]
 gi|336472398|gb|EGO60558.1| spermidine synthase [Neurospora tetrasperma FGSC 2508]
 gi|350294380|gb|EGZ75465.1| spermidine synthase [Neurospora tetrasperma FGSC 2509]
          Length = 291

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/287 (68%), Positives = 239/287 (83%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP IQDGWFRE   +WPGQAM L++E+VL HEKSLYQDVLIFKST +G VLVLD V+QC
Sbjct: 5   AHPTIQDGWFREISNMWPGQAMTLKVEKVLHHEKSLYQDVLIFKSTDHGNVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSK++LP M+ GF++PKV VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ  YF+
Sbjct: 125 LSKQFLPHMSAGFEHPKVKVHVGDGFKFLEDFKNTFDVIITDSSDPEGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +ALR GG+I+TQ E QWLHL LIT+++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLHDALREGGVITTQAENQWLHLPLITKLKKDCKEVFPVAEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D   N+K PLR WS+EEEEKLCRYYNS+IH+A+FILP F K AL+
Sbjct: 245 SKDPNANVKVPLRSWSQEEEEKLCRYYNSEIHKASFILPTFAKKALE 291



>gi|336262713|ref|XP_003346139.1| hypothetical protein SMAC_06606 [Sordaria macrospora k-hell]
          Length = 292

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/288 (68%), Positives = 240/288 (83%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP IQDGWFRE   +WPGQAM L++E+VL HEKSLYQDVLIFKST +G VLVLD V+QC
Sbjct: 5   THPTIQDGWFREISNMWPGQAMTLKVEKVLHHEKSLYQDVLIFKSTDHGNVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDVVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSK++LP M+ GF++PKV VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ  YF+
Sbjct: 125 LSKQFLPHMSAGFEHPKVKVHVGDGFKFLEDFKNTFDVIITDSSDPEGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+ +ALR GG+I+TQG E QWLHL LIT+++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLHDALREGGVITTQGSENQWLHLPLITKLKKDCKEVFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           CS D   N+K PLR WS+EEEEKLCRYYNS+IH+A+FILP F K AL+
Sbjct: 245 CSKDPNANVKVPLRSWSQEEEEKLCRYYNSEIHKASFILPTFAKKALE 292



>gi|451845557|gb|EMD58869.1| hypothetical protein COCSADRAFT_102852 [Bipolaris sorokiniana
           ND90Pr]
 gi|451998111|gb|EMD90576.1| hypothetical protein COCHEDRAFT_1104326 [Bipolaris maydis C5]
 gi|477592143|gb|ENI09214.1| hypothetical protein COCC4DRAFT_36789 [Bipolaris maydis ATCC 48331]
          Length = 292

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/287 (67%), Positives = 232/287 (80%), Gaps = 1/287 (0%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+DGWFRE   +WPGQAM L+++EVL HEKS YQDVLIF+ST YG VLVLD V+QCT
Sbjct: 6   HPTIKDGWFREISGMWPGQAMTLQVKEVLHHEKSQYQDVLIFESTDYGTVLVLDNVIQCT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NPE VLVI      VLREV KH+ VKE VLCDIDE+VIRL
Sbjct: 66  ERDEFSYQEMITHLAMNSHPNPEKVLVIGGGDGGVLREVVKHDCVKEAVLCDIDEAVIRL 125

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK+YLP M++GF++PK T  +GDGF+FL DK   FD+IITD+SDP GPAE+LFQ  YFEL
Sbjct: 126 SKQYLPGMSVGFEHPKTTTIVGDGFKFLEDKKGEFDVIITDSSDPEGPAEALFQKAYFEL 185

Query: 196 MKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           +  ALR GG+I+TQG E QWLH+ LI  ++  C+E++P VEYAYTTIPTYPSGQIGF++C
Sbjct: 186 LNGALREGGVITTQGSENQWLHMPLIVNLKKACKEVFPNVEYAYTTIPTYPSGQIGFMVC 245

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D  +NLKKPLR WS EEEE LCRYY+ +IHEAAF+LP F + AL+
Sbjct: 246 SKDANLNLKKPLRSWSAEEEESLCRYYSKEIHEAAFVLPTFARKALR 292



>gi|242774578|ref|XP_002478468.1| spermidine synthase [Talaromyces stipitatus ATCC 10500]
 gi|218722087|gb|EED21505.1| spermidine synthase [Talaromyces stipitatus ATCC 10500]
          Length = 291

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 231/287 (80%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L+++EVL HEKS YQDVL+F+ST +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEASDMWPGQAMTLKVKEVLHHEKSQYQDVLVFESTDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHESV+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VHIGDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPNVKVHIGDGFKFLADYKNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  ALR GG+I+TQ E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLNGALREGGVITTQAENQWLHLQLITDLKKSCKEVFPVAEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             D   N+K+PLR WS EEEEKLCRYYN+ IH A+F+LP F + AL+
Sbjct: 245 CKDATRNVKEPLRTWSREEEEKLCRYYNADIHRASFVLPNFARKALE 291



>gi|255937259|ref|XP_002559656.1| Pc13g12400 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211584276|emb|CAP92309.1| Pc13g12400 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 293

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 189/287 (65%), Positives = 230/287 (80%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP IQDGWF EK  +WPGQAM L++ +++ HEKS YQDVL+F+S+ YG VLVLD V+QC
Sbjct: 5   THPTIQDGWFSEKSGMWPGQAMSLKVNQIIHHEKSKYQDVLVFESSDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NPE VLVI      VLREV KH SVKE  LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPEKVLVIGGGDGGVLREVVKHASVKEATLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP MAIGF +P    H+GDGFEFL+++ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMAIGFQHPNAHTHVGDGFEFLKNRQNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+K+ALR GG+I+TQG E QWLHLD+I  ++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLKSALREGGVITTQGSENQWLHLDMIADLKKACKEVFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           CS D   N+++PLR W+ EEE+KLCRYYN  IH A+F+LP F +  L
Sbjct: 245 CSKDATRNVREPLRTWTAEEEQKLCRYYNQDIHRASFVLPNFARQKL 291



>gi|119495240|ref|XP_001264409.1| spermidine synthase [Neosartorya fischeri NRRL 181]
 gi|119412571|gb|EAW22512.1| spermidine synthase [Neosartorya fischeri NRRL 181]
          Length = 292

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 188/286 (65%), Positives = 233/286 (81%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E+  +WPGQAM L++ ++L HEKS YQDVL+F+ST YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEQSDMWPGQAMNLKVNQILHHEKSKYQDVLVFESTDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHESV+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VHIGDGF+FL+++ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPNVKVHIGDGFQFLKERKNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+++ALR GG+I+TQ E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLRDALRDGGVITTQAENQWLHLSLITDLKKACKEVFPVAEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
             D   N+++P+R WS EEEE+LCRYYN  IH A+F+LP F + AL
Sbjct: 245 CKDANRNVREPVRTWSREEEERLCRYYNQDIHRASFVLPNFARKAL 290



>gi|212532035|ref|XP_002146174.1| spermidine synthase [Talaromyces marneffei ATCC 18224]
 gi|210071538|gb|EEA25627.1| spermidine synthase [Talaromyces marneffei ATCC 18224]
          Length = 333

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 191/287 (66%), Positives = 231/287 (80%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L+++EVL HEKS YQDVL+F+ST YG VLVLD V+QC
Sbjct: 47  THPTIKDGWFSETSDMWPGQAMTLKVKEVLHHEKSQYQDVLVFESTDYGTVLVLDNVIQC 106

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E +LCDIDE+VIR
Sbjct: 107 TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEAILCDIDEAVIR 166

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VH+GDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 167 VSKKYLPGMSIGFQHPNVKVHVGDGFKFLADYKNEFDVIITDSSDPEGPAESLFQKPYFE 226

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  ALR GG+I+TQ E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 227 LLNGALREGGVITTQAENQWLHLSLITDLKKSCKEVFPVAEYAYTTIPTYPSGQIGFMVC 286

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             D   N+K+P+R WS EEEEKLCRYYN+ IH A+F+LP F + AL+
Sbjct: 287 CKDATRNVKEPVRSWSREEEEKLCRYYNADIHRASFVLPNFARKALE 333



>gi|425767689|gb|EKV06255.1| Spermidine synthase (Putrescine aminopropyltransferase)
           [Penicillium digitatum PHI26]
 gi|425780384|gb|EKV18391.1| Putrescine aminopropyltransferase [Penicillium digitatum Pd1]
          Length = 293

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 188/287 (65%), Positives = 231/287 (80%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP IQDGWF EK  +WPGQAM L++ +++ HEKS YQDVL+F+S+ YG VLVLD V+QC
Sbjct: 5   THPTIQDGWFSEKSGMWPGQAMSLKVNQIIHHEKSKYQDVLVFESSDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NPE VLVI      VLREV KH SVKE  LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPEKVLVIGGGDGGVLREVVKHASVKEATLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP MAIGF +P    H+GDGFEFL+++ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMAIGFQHPNAHTHVGDGFEFLKNRQNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+ +ALR GG+I+TQG E QWLHLD+I++++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLNSALREGGVITTQGSENQWLHLDMISELKKSCKEVFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           CS D   N+++PLR W+ EEE+KLCRYYN  IH A+F+LP F +  L
Sbjct: 245 CSKDATRNVREPLRTWTAEEEQKLCRYYNQDIHRASFVLPNFARQKL 291



>gi|340520373|gb|EGR50609.1| spermidine synthase [Trichoderma reesei QM6a]
          Length = 293

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/293 (66%), Positives = 239/293 (81%), Gaps = 1/293 (0%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           MSG   HP IQDGWFRE   +WPGQAM L++E+VL HEKSLYQDVLIFKST YG VLVLD
Sbjct: 1   MSGEIVHPTIQDGWFREISDMWPGQAMTLKVEKVLHHEKSLYQDVLIFKSTDYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            VVQ TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+SV+E +LCDID
Sbjct: 61  NVVQATERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDSVEEAILCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIRLSK+YLP MA+GF++PK  VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ
Sbjct: 121 EAVIRLSKQYLPHMAVGFEHPKSKVHVGDGFKFLDDYKNTFDVIITDSSDPEGPAESLFQ 180

Query: 190 VKYFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
             YF+L+ +ALR GG+I+TQG E  WLHL LI +++  C++++PV EYAYTTIPTYPSGQ
Sbjct: 181 KPYFQLLHDALREGGVITTQGSESPWLHLPLIARLKKDCKDVFPVAEYAYTTIPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           IGF++C  D   N+++PLR W++EEEE+ CRYYN++IH+A+FILP F K AL+
Sbjct: 241 IGFMVCCKDANRNVREPLRSWTKEEEEEKCRYYNAEIHKASFILPTFAKKALE 293



>gi|396485345|ref|XP_003842148.1| similar to spermidine synthase [Leptosphaeria maculans JN3]
 gi|312218724|emb|CBX98669.1| similar to spermidine synthase [Leptosphaeria maculans JN3]
          Length = 292

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/290 (65%), Positives = 235/290 (81%), Gaps = 1/290 (0%)

Query: 13  TTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVV 72
           +  HP I+DGWFRE   +WPGQAM L+++EVL HEKSLYQD+LIF+ST YG+VLVLD V+
Sbjct: 3   SIEHPTIKDGWFREISNMWPGQAMTLQVKEVLHHEKSLYQDILIFESTDYGMVLVLDNVI 62

Query: 73  QCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESV 132
           QCTERDEFSYQEMITH+ MN H NPE VLVI      VLRE+ KH+ VKE VLCDIDE+V
Sbjct: 63  QCTERDEFSYQEMITHLGMNAHPNPERVLVIGGGDGGVLREIVKHDCVKEAVLCDIDEAV 122

Query: 133 IRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKY 192
           IRLSK+YLP M++GF++PKV   +GDGF+FL DK   FD+IITD+SDP GPAE+LF+ +Y
Sbjct: 123 IRLSKQYLPGMSVGFNHPKVQTIVGDGFKFLEDKKGQFDVIITDSSDPEGPAEALFKKEY 182

Query: 193 FELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGF 251
           FEL+  ALR GG+I+TQG E QWLH+ LI  ++  C+E++P VEY YTTIPTYPSGQIGF
Sbjct: 183 FELLNGALREGGVITTQGSENQWLHMPLIVNLKKACKEVFPTVEYGYTTIPTYPSGQIGF 242

Query: 252 ILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           ++CS D   +LKKPLR WS EEEE+LCRYY+ +IHEAAF+LP F + AL+
Sbjct: 243 MVCSKDANRDLKKPLRSWSREEEEQLCRYYSKEIHEAAFVLPTFARKALQ 292



>gi|389628860|ref|XP_003712083.1| spermidine synthase [Magnaporthe oryzae 70-15]
 gi|351644415|gb|EHA52276.1| spermidine synthase [Magnaporthe oryzae 70-15]
          Length = 293

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/292 (65%), Positives = 238/292 (81%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           MSG  +H  I+DGWFRE   +WPGQAM L++E+VL HE+S YQDVLIF+ST YG VLVLD
Sbjct: 1   MSGEITHETIKDGWFREISDMWPGQAMTLKVEKVLHHERSKYQDVLIFQSTDYGKVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            V+QCTERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDID
Sbjct: 61  NVIQCTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIRLSK+YLP M+ GF++PKV VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ
Sbjct: 121 EAVIRLSKEYLPNMSAGFNHPKVKVHVGDGFKFLADYQNTFDVIITDSSDPEGPAESLFQ 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF+L+ NAL  GG+I+TQ E QWLHL LIT+++  C+E++PV EYAYTTIPTYPSGQI
Sbjct: 181 KPYFQLLFNALTEGGVITTQAENQWLHLPLITKLRKDCKEIFPVAEYAYTTIPTYPSGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           GF++CS D K NLK+PLR W++EEE + CRYY+S IH+A+F+LP F + AL+
Sbjct: 241 GFMVCSKDPKANLKEPLRSWTQEEELEKCRYYSSDIHKASFVLPNFARKALQ 292



>gi|482813767|gb|EOA90458.1| hypothetical protein SETTUDRAFT_167302 [Setosphaeria turcica Et28A]
          Length = 291

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/286 (66%), Positives = 231/286 (80%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+DGWFRE   +WPGQAM L+++EVL HEKS YQDVLIF+ST YG VLVLD V+QCT
Sbjct: 6   HPTIKDGWFREISGMWPGQAMTLQVKEVLHHEKSKYQDVLIFESTDYGTVLVLDNVIQCT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NPE VLVI      VLREV KH+ VKE VLCDIDE+VIRL
Sbjct: 66  ERDEFSYQEMITHLAMNSHPNPEKVLVIGGGDGGVLREVVKHDCVKEAVLCDIDEAVIRL 125

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK+YLP M++GF++PK T  +GDGF+FL DK   FD+IITD+SDP GPAE+LFQ +YF+L
Sbjct: 126 SKQYLPGMSVGFEHPKTTTIVGDGFKFLEDKKGEFDVIITDSSDPEGPAEALFQKEYFQL 185

Query: 196 MKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCS 255
           +  ALR GG+I+TQ E QWLH+ LI  ++  C+E++P VEYAYTTIPTYPSGQIGF++CS
Sbjct: 186 LNGALREGGVITTQAENQWLHMPLIVNLKKACKEVFPTVEYAYTTIPTYPSGQIGFMVCS 245

Query: 256 IDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
            D   +LKKPLR WS EEEE LCRYY+ +IHEA+F+LP F + AL+
Sbjct: 246 KDATRDLKKPLRSWSTEEEESLCRYYSKEIHEASFVLPIFARKALR 291



>gi|212532039|ref|XP_002146176.1| spermidine synthase [Talaromyces marneffei ATCC 18224]
 gi|210071540|gb|EEA25629.1| spermidine synthase [Talaromyces marneffei ATCC 18224]
          Length = 334

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/288 (66%), Positives = 232/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L+++EVL HEKS YQDVL+F+ST YG VLVLD V+QC
Sbjct: 47  THPTIKDGWFSETSDMWPGQAMTLKVKEVLHHEKSQYQDVLVFESTDYGTVLVLDNVIQC 106

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E +LCDIDE+VIR
Sbjct: 107 TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEAILCDIDEAVIR 166

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VH+GDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 167 VSKKYLPGMSIGFQHPNVKVHVGDGFKFLADYKNEFDVIITDSSDPEGPAESLFQKPYFE 226

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  ALR GG+I+TQG E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 227 LLNGALREGGVITTQGSENQWLHLSLITDLKKSCKEVFPVAEYAYTTIPTYPSGQIGFMV 286

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C  D   N+K+P+R WS EEEEKLCRYYN+ IH A+F+LP F + AL+
Sbjct: 287 CCKDATRNVKEPVRSWSREEEEKLCRYYNADIHRASFVLPNFARKALE 334



>gi|70995928|ref|XP_752719.1| spermidine synthase [Aspergillus fumigatus Af293]
 gi|42820759|emb|CAF32072.1| spermidine synthase, putative [Aspergillus fumigatus]
 gi|66850354|gb|EAL90681.1| spermidine synthase [Aspergillus fumigatus Af293]
 gi|159131474|gb|EDP56587.1| spermidine synthase [Aspergillus fumigatus A1163]
          Length = 293

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 189/287 (65%), Positives = 234/287 (81%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E+  +WPGQAM L++ ++L HEKS YQDVL+F+ST YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEQSDMWPGQAMNLKVNQILHHEKSKYQDVLVFESTDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHESV+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VHIGDGF+FL+++ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPNVKVHIGDGFQFLKERKNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+++ALR GG+I+TQG E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLRDALRDGGVITTQGSENQWLHLSLITDLKKACKEVFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           C  D   N+++P+R WS EEEE+LCRYYN  IH A+F+LP F + AL
Sbjct: 245 CCKDATRNVREPVRTWSREEEERLCRYYNQDIHRASFVLPNFARKAL 291



>gi|330907629|ref|XP_003295873.1| hypothetical protein PTT_03586 [Pyrenophora teres f. teres 0-1]
 gi|311332413|gb|EFQ96023.1| hypothetical protein PTT_03586 [Pyrenophora teres f. teres 0-1]
          Length = 292

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/287 (66%), Positives = 234/287 (81%), Gaps = 1/287 (0%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+DGWFRE   +WPGQAM L+++EVL HEKS YQDVLIF+ST+YG VLVLD V+QCT
Sbjct: 6   HPTIKDGWFREISGMWPGQAMTLQVKEVLHHEKSKYQDVLIFESTNYGTVLVLDNVIQCT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NPE VLVI      VLREV KH+ VKE VLCDIDE+VIRL
Sbjct: 66  ERDEFSYQEMITHLAMNAHPNPEKVLVIGGGDGGVLREVVKHDCVKEAVLCDIDEAVIRL 125

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK+YLP M++GF++PK T  +GDGF+FL DK   FD+IITD+SDP GPAE+LFQ  YFEL
Sbjct: 126 SKQYLPGMSVGFEHPKTTTIVGDGFKFLEDKKGEFDVIITDSSDPEGPAEALFQKSYFEL 185

Query: 196 MKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           +  ALR GG+I+TQG E QWLH+ LI +++  C+E++P VEY YTTIPTYPSGQIGF++C
Sbjct: 186 LNGALREGGVITTQGSENQWLHMPLIVELKKACKEVFPNVEYGYTTIPTYPSGQIGFMVC 245

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D  ++LKKPLR WS EEEE+LCRYY+ +IH+AAF+LP F + AL+
Sbjct: 246 SKDANLDLKKPLRTWSTEEEEQLCRYYSKEIHQAAFVLPTFARKALQ 292



>gi|189207669|ref|XP_001940168.1| spermidine synthase [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187976261|gb|EDU42887.1| spermidine synthase [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 292

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 193/287 (67%), Positives = 233/287 (81%), Gaps = 1/287 (0%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+DGWFRE   +WPGQAM L+++EVL HEKS YQDVLIF+ST+YG VLVLD V+QCT
Sbjct: 6   HPTIKDGWFREISGMWPGQAMTLQVKEVLHHEKSKYQDVLIFESTNYGTVLVLDNVIQCT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NPE VLVI      VLREV KH+ VKE VLCDIDE+VIRL
Sbjct: 66  ERDEFSYQEMITHLAMNAHPNPEKVLVIGGGDGGVLREVVKHDCVKEAVLCDIDEAVIRL 125

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK+YLP M++GF++PK T  +GDGF+FL DK   FD+IITD+SDP GPAE+LFQ  YFEL
Sbjct: 126 SKQYLPGMSVGFEHPKTTTIVGDGFKFLEDKKGEFDVIITDSSDPEGPAEALFQKSYFEL 185

Query: 196 MKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           +  ALR GG+I+TQG E QWLH+ LI +++  C+E++P VEY YTTIPTYPSGQIGF++C
Sbjct: 186 LNGALREGGVITTQGSENQWLHMPLIVELKKACKEVFPNVEYGYTTIPTYPSGQIGFMVC 245

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D   +LKKPLR WS EEEE+LCRYY+ +IHEAAF+LP F + AL+
Sbjct: 246 SKDANRDLKKPLRTWSTEEEEQLCRYYSKEIHEAAFVLPTFARKALQ 292



>gi|134077286|emb|CAK45626.1| unnamed protein product [Aspergillus niger]
 gi|350629834|gb|EHA18207.1| hypothetical protein ASPNIDRAFT_207954 [Aspergillus niger ATCC
           1015]
          Length = 292

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 186/286 (65%), Positives = 232/286 (81%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E+  +WPGQAM L++ ++L HEKS YQDVL+F+S+ YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEQSDMWPGQAMNLKVNQILHHEKSKYQDVLVFESSDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E  LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEATLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VH+GDGF+FL+++ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPNVKVHVGDGFQFLKERQNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+++ALR GG+I+TQ E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLRDALREGGVITTQAENQWLHLSLITDLKKACKEVFPVAEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
             D   N+K+P+R W+ EEEEKLCRYYN  IH A+F+LP F + AL
Sbjct: 245 CKDATRNVKEPVRSWTREEEEKLCRYYNQDIHRASFVLPNFARKAL 290



>gi|477530115|gb|ENH81857.1| spermidine synthase [Colletotrichum orbiculare MAFF 240422]
          Length = 292

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 190/288 (65%), Positives = 240/288 (83%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP IQDGWFRE   +WPGQAM L++++V+ HEKS YQDVLIF+ST +G+VLVLD V+QC
Sbjct: 5   THPTIQDGWFREISDMWPGQAMTLKVKKVIHHEKSKYQDVLIFESTDHGMVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH++V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDTVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSK++LP MA+GFD+PK   H+GDGF+FL +  N+FD+IITD+SDP GPAESLFQ  YF+
Sbjct: 125 LSKQFLPGMAVGFDHPKSKTHVGDGFKFLEEYKNTFDVIITDSSDPEGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+ +ALR GG+I+TQG E QWLH+ LIT+++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLHDALREGGVITTQGSENQWLHMPLITKLKKDCKEIFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C  D   N+K+P+RKWSEEEEEKLCRYY++ IH+A+FILP F K AL+
Sbjct: 245 CCKDATRNVKEPVRKWSEEEEEKLCRYYSADIHKASFILPTFAKKALQ 292



>gi|115492019|ref|XP_001210637.1| spermidine synthase [Aspergillus terreus NIH2624]
 gi|114197497|gb|EAU39197.1| spermidine synthase [Aspergillus terreus NIH2624]
          Length = 291

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 233/287 (81%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E+  +WPGQAM L++ ++L HEKS YQDVL+F+S+ YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEQSDMWPGQAMNLKVNQILHHEKSKYQDVLVFESSDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H +P+ VLVI      VLREV KHE V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPDPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M++GF +PKV VH+GDGFEFL+++ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSVGFQHPKVKVHVGDGFEFLKNRQNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+++ALR GG+I+TQ E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLRDALRDGGVITTQAENQWLHLSLITDLKKACKEVFPVAEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             D   N+++P+R WS EEEE+LCRYYN  IH A+F+LP F + AL 
Sbjct: 245 CKDASRNVREPVRSWSREEEERLCRYYNQDIHRASFVLPNFARKALN 291



>gi|238489149|ref|XP_002375812.1| spermidine synthase [Aspergillus flavus NRRL3357]
 gi|220698200|gb|EED54540.1| spermidine synthase [Aspergillus flavus NRRL3357]
 gi|391869729|gb|EIT78924.1| spermidine synthase [Aspergillus oryzae 3.042]
          Length = 340

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 187/297 (62%), Positives = 232/297 (78%)

Query: 5   FSRLLMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGI 64
           FS  +     +HP IQDGWF EK  +WPGQAM L++ ++L HEKS YQDVL+F+S+ YG 
Sbjct: 44  FSHSITMSEKTHPTIQDGWFSEKSNMWPGQAMSLKVNQILHHEKSKYQDVLVFESSDYGT 103

Query: 65  VLVLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIV 124
           VLVLD V+QCTERDEFSYQEMITH+ MN H NPE VLVI      VLREV KH++VK+ +
Sbjct: 104 VLVLDNVIQCTERDEFSYQEMITHLAMNSHPNPEKVLVIGGGDGGVLREVVKHDTVKKAI 163

Query: 125 LCDIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPA 184
           LCDIDE+VIR+SKKYLP M+IGF +P V   +GDGFEFL+   N FD+IITD+SDP GPA
Sbjct: 164 LCDIDEAVIRVSKKYLPGMSIGFQHPNVEEFVGDGFEFLKTHKNEFDVIITDSSDPEGPA 223

Query: 185 ESLFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTY 244
           ESLFQ  YFEL+++ALR GG+I+TQ E QWLHL LIT ++  C+E++PV EYAYTTIPTY
Sbjct: 224 ESLFQKPYFELLRDALRDGGVITTQAENQWLHLSLITDLKKACKEVFPVAEYAYTTIPTY 283

Query: 245 PSGQIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           PSGQIGF++C  D   N+++P+R W+ EEEE+LCRYYN  IH A+F+LP F + AL 
Sbjct: 284 PSGQIGFMVCCKDANRNVREPVRSWTREEEERLCRYYNQDIHRASFVLPNFARKALN 340



>gi|440485934|gb|ELQ65850.1| spermidine synthase [Magnaporthe oryzae P131]
          Length = 294

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 193/293 (65%), Positives = 239/293 (81%), Gaps = 1/293 (0%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           MSG  +H  I+DGWFRE   +WPGQAM L++E+VL HE+S YQDVLIF+ST YG VLVLD
Sbjct: 1   MSGEITHETIKDGWFREISDMWPGQAMTLKVEKVLHHERSKYQDVLIFQSTDYGKVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            V+QCTERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDID
Sbjct: 61  NVIQCTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIRLSK+YLP M+ GF++PKV VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ
Sbjct: 121 EAVIRLSKEYLPNMSAGFNHPKVKVHVGDGFKFLADYQNTFDVIITDSSDPEGPAESLFQ 180

Query: 190 VKYFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
             YF+L+ NAL  GG+I+TQG E QWLHL LIT+++  C+E++PV EYAYTTIPTYPSGQ
Sbjct: 181 KPYFQLLFNALTEGGVITTQGSENQWLHLPLITKLRKDCKEIFPVAEYAYTTIPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           IGF++CS D K NLK+PLR W++EEE + CRYY+S IH+A+F+LP F + AL+
Sbjct: 241 IGFMVCSKDPKANLKEPLRSWTQEEELEKCRYYSSDIHKASFVLPNFARKALQ 293



>gi|121701283|ref|XP_001268906.1| spermidine synthase [Aspergillus clavatus NRRL 1]
 gi|119397049|gb|EAW07480.1| spermidine synthase [Aspergillus clavatus NRRL 1]
          Length = 293

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 234/287 (81%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E+  +WPGQAM L++ ++L HEKS YQDVL+F+ST YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEQSGMWPGQAMNLKVNQILHHEKSKYQDVLVFESTDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VH+GDGF+FL+++ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPNVKVHVGDGFQFLKERRNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+++ALR GG+I+TQG E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLRDALREGGVITTQGSENQWLHLPLITDLKKSCKEVFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           C  D   N+++P+R WS EEEE+LCRYYN  IH A+F+LP F + AL
Sbjct: 245 CCKDATRNVREPVRSWSREEEERLCRYYNQDIHRASFVLPNFARKAL 291



>gi|317030551|ref|XP_001392771.2| spermidine synthase [Aspergillus niger CBS 513.88]
          Length = 293

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 233/287 (81%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E+  +WPGQAM L++ ++L HEKS YQDVL+F+S+ YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEQSDMWPGQAMNLKVNQILHHEKSKYQDVLVFESSDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E  LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEATLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VH+GDGF+FL+++ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPNVKVHVGDGFQFLKERQNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+++ALR GG+I+TQG E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLRDALREGGVITTQGSENQWLHLSLITDLKKACKEVFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           C  D   N+K+P+R W+ EEEEKLCRYYN  IH A+F+LP F + AL
Sbjct: 245 CCKDATRNVKEPVRSWTREEEEKLCRYYNQDIHRASFVLPNFARKAL 291



>gi|358371985|dbj|GAA88591.1| spermidine synthase [Aspergillus kawachii IFO 4308]
          Length = 293

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 187/287 (65%), Positives = 233/287 (81%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E+  +WPGQAM L++ ++L HEKS YQDVL+F+S+ YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEQSDMWPGQAMNLKVNQILHHEKSKYQDVLVFESSDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E  LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEATLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VH+GDGF+FL+++ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPNVKVHVGDGFQFLKERQNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+++ALR GG+I+TQG E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLRDALREGGVITTQGSENQWLHLSLITDLKKSCKEVFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           C  D   N+K+P+R W+ EEEEKLCRYYN  IH A+F+LP F + AL
Sbjct: 245 CCKDATRNVKEPVRSWTREEEEKLCRYYNQDIHRASFVLPNFARKAL 291



>gi|378733877|gb|EHY60336.1| spermidine synthase [Exophiala dermatitidis NIH/UT8656]
          Length = 291

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/287 (66%), Positives = 235/287 (81%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L++ +VL HEKS YQDVL+F+S+ +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISDMWPGQAMILKVNQVLHHEKSKYQDVLVFESSDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP++VLVI      VLREV KHESV++ +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKSVLVIGGGDGGVLREVVKHESVEKAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VHIGDGF+FL D+ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPAVDVHIGDGFKFLADRKNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  AL+ GG+I+TQ E QWLHL LIT+++  C+E++PVVEYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLYGALKDGGVITTQAENQWLHLPLITKLKKDCKEVFPVVEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             D   ++K PLR WS EEE+KLCRYYN +IH+A+FILP F + ALK
Sbjct: 245 CKDPNRDVKVPLRSWSPEEEDKLCRYYNKEIHQASFILPTFARKALK 291



>gi|310793583|gb|EFQ29044.1| spermidine synthase [Glomerella graminicola M1.001]
          Length = 291

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/286 (66%), Positives = 234/286 (81%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP IQDGWFRE   +WPGQAM L++++V+ HEKS YQDVLIF+ST YG+VLVLD V+Q T
Sbjct: 6   HPTIQDGWFREISDMWPGQAMTLKVKKVVHHEKSQYQDVLIFESTDYGMVLVLDNVIQAT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE V+E +LCDIDE+VIRL
Sbjct: 66  ERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEAVIRL 125

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK+YLP MA+GF++PK   H+GDGF+FL +  N+FD+IITD+SDP GPAESLF+  YF+L
Sbjct: 126 SKQYLPNMAVGFEHPKAKTHVGDGFKFLEEYKNTFDVIITDSSDPEGPAESLFEKPYFQL 185

Query: 196 MKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCS 255
           + +ALR GG+ISTQ E QWLH+ LI +++  C+E++PV EY YTTIPTYPSGQIGF++C 
Sbjct: 186 LHDALREGGVISTQAENQWLHMPLICKLKKDCKEIFPVAEYGYTTIPTYPSGQIGFMVCC 245

Query: 256 IDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
            D   N+K+PLRKWS EEE+KLCRYYNS+IH+AAFILP F K AL+
Sbjct: 246 KDPSRNVKEPLRKWSPEEEDKLCRYYNSEIHKAAFILPNFAKKALQ 291



>gi|471572648|gb|EMR71033.1| putative spermidine synthase protein [Eutypa lata UCREL1]
          Length = 292

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/288 (67%), Positives = 233/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP IQDGWFRE   +WPGQAM L +++VL HEKS YQDVLIF+ST +G VLVLD V+QC
Sbjct: 5   THPTIQDGWFREISEMWPGQAMTLRVKKVLHHEKSQYQDVLIFESTDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H  P+ VLVI      VLREV KHE V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPEPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSK+YLP MA GF +PK  VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ  YF+
Sbjct: 125 LSKQYLPGMAEGFKHPKSKVHVGDGFKFLNDYKNAFDVIITDSSDPEGPAESLFQKSYFQ 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+ +ALRPGG+I+TQG E QWLHL LIT+++  C E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLHDALRPGGVITTQGSENQWLHLSLITKLKKDCGEVFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C+ D   ++KKPLR W+ EEE KLCRYYN++IH+A+FILP F   ALK
Sbjct: 245 CTKDADRDVKKPLRSWTPEEEAKLCRYYNAEIHKASFILPTFAAQALK 292



>gi|67516811|ref|XP_658291.1| SPEE_NEUCR Spermidine synthase (Putrescine aminopropyltransferase)
           (SPDSY) [Aspergillus nidulans FGSC A4]
 gi|16024930|gb|AAL11443.1| spermidine synthase [Emericella nidulans]
 gi|40746307|gb|EAA65463.1| SPEE_NEUCR Spermidine synthase (Putrescine aminopropyltransferase)
           (SPDSY) [Aspergillus nidulans FGSC A4]
 gi|259489040|tpe|CBF88983.1| TPA: SPEE_NEUCR Spermidine synthase (Putrescine
           aminopropyltransferase) (SPDSY)Spermidine synthase ;
           [Source:UniProtKB/TrEMBL;Acc:Q96UK1] [Aspergillus
           nidulans FGSC A4]
          Length = 292

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 186/286 (65%), Positives = 229/286 (80%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E+  +WPGQAM L + ++L HEKS YQDVL+F+S+ YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEQSEMWPGQAMNLRVNQILHHEKSKYQDVLVFESSDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V VH+GDGFEFL+ + N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPNVKVHVGDGFEFLKQRQNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+++ALR GG+I+TQ E QWLHL LI  ++  C E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLRDALRDGGVITTQAENQWLHLPLIADLKKACNEVFPVAEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
             D   N+K+P+R WS EEEE+LCRYYN  IH A+F+LP F + AL
Sbjct: 245 CKDANRNVKEPVRTWSREEEERLCRYYNQDIHRASFVLPNFARKAL 290



>gi|358391288|gb|EHK40692.1| hypothetical protein TRIATDRAFT_301493 [Trichoderma atroviride IMI
           206040]
          Length = 292

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 234/292 (80%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           MS    HP IQDGWFRE   +WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVLD
Sbjct: 1   MSNEIVHPTIQDGWFREISNMWPGQAMTLKVEKVLHHEKSQYQDVLIFKSTDYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            V+Q TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDID
Sbjct: 61  NVIQATERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIRLSK++LP M++GFD+PK   H+GDGF+FL D  N+FD+IITD+SDP GPAESLF+
Sbjct: 121 EAVIRLSKQFLPHMSVGFDHPKSKTHVGDGFKFLDDYKNTFDVIITDSSDPEGPAESLFK 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF+L+ +ALR GG+I+TQ E QWLHL LITQ++  C+E++PV EYAYTTIPTYPSGQI
Sbjct: 181 KPYFQLLHDALREGGVITTQAENQWLHLPLITQLKKDCKEIFPVAEYAYTTIPTYPSGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           GF++C  D   N++ PLR W+ EEEE+ CRYYN++IH+A+FILP F K AL+
Sbjct: 241 GFMVCCKDANRNVRVPLRSWTPEEEEQKCRYYNAEIHKASFILPTFAKKALE 292



>gi|226293104|gb|EEH48524.1| spermidine synthase [Paracoccidioides brasiliensis Pb18]
          Length = 292

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/288 (63%), Positives = 235/288 (81%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L++ ++L HEKS YQDVL+F+S+ +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEISDMWPGQAMTLKVNQILHHEKSKYQDVLVFESSDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M++GF +P VTVH+GDGF+FL D+ N FD+IITD+SDP GPAE+LFQ  YFE
Sbjct: 125 VSKKYLPGMSVGFQHPNVTVHVGDGFKFLADRKNEFDVIITDSSDPEGPAEALFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ NALR GG+++TQ E QWLHL LIT+++   RE++PVVEYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLFNALREGGVVTTQAENQWLHLSLITELKRNIREIFPVVEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
             D   ++++P+R W+ EEEEKLCRYYN +IH A+F+LP F + AL++
Sbjct: 245 CKDSSRDVREPVRTWTREEEEKLCRYYNKEIHRASFVLPNFARKALEQ 292



>gi|317137159|ref|XP_001727531.2| spermidine synthase [Aspergillus oryzae RIB40]
          Length = 291

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 229/287 (79%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP IQDGWF EK  +WPGQAM L++ ++L HEKS YQDVL+F+S+ YG VLVLD V+QC
Sbjct: 5   THPTIQDGWFSEKSNMWPGQAMSLKVNQILHHEKSKYQDVLVFESSDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NPE VLVI      VLREV KH++VK+ +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPEKVLVIGGGDGGVLREVVKHDTVKKAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M+IGF +P V   +GDGFEFL+   N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 VSKKYLPGMSIGFQHPNVEEFVGDGFEFLKTHKNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+++ALR GG+I+TQ E QWLHL LIT ++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLRDALRDGGVITTQAENQWLHLSLITDLKKACKEVFPVAEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             D   N+++P+R W+ EEEE+LCRYYN  IH A+F+LP F + AL 
Sbjct: 245 CKDANRNVREPVRSWTREEEERLCRYYNQDIHRASFVLPNFARKALN 291



>gi|367038823|ref|XP_003649792.1| hypothetical protein THITE_2108747 [Thielavia terrestris NRRL 8126]
 gi|346997053|gb|AEO63456.1| hypothetical protein THITE_2108747 [Thielavia terrestris NRRL 8126]
          Length = 292

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/291 (65%), Positives = 238/291 (81%), Gaps = 1/291 (0%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           G  +HP I+DGWFRE   +WPGQAM L++++VL HEKS YQDVLIF+ST++G VLVLD V
Sbjct: 2   GDITHPTIKDGWFREISDMWPGQAMTLQVKKVLHHEKSKYQDVLIFESTNHGNVLVLDNV 61

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +QCTERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE V+E VLCDIDE+
Sbjct: 62  IQCTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVLKHECVEEAVLCDIDEA 121

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVK 191
           VIRLSK++LP MA+GF+NPK  VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ  
Sbjct: 122 VIRLSKQFLPHMAVGFNNPKAKVHVGDGFKFLNDYKNTFDVIITDSSDPEGPAESLFQKP 181

Query: 192 YFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIG 250
           YF+L+ +ALR GG+I+TQG E QWLHL LI++++  C E++PV EYAYTTIPTYPSGQIG
Sbjct: 182 YFQLLHDALRDGGVITTQGSENQWLHLPLISKLKKDCSEIFPVAEYAYTTIPTYPSGQIG 241

Query: 251 FILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           F++C  D   N++ PLR W++EEE KLCRYYNS+IH+A+F+LP F + AL+
Sbjct: 242 FMVCCKDPNRNVRVPLRSWTKEEERKLCRYYNSEIHKASFVLPTFAQEALQ 292



>gi|511005162|gb|EPB86509.1| spermidine synthase [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 293

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 235/291 (80%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           M+   +HP I DGWF EK T+WPGQAM L++EE+L  EKS YQDVL+F+S +YG VLVLD
Sbjct: 1   MAAPLTHPCIVDGWFMEKSTMWPGQAMSLKVEEILHVEKSKYQDVLVFQSANYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            V+Q TERDEFSYQEMITH+ MN H  P+ VLVI      VLREV KHE V+E  L DID
Sbjct: 61  NVIQATERDEFSYQEMITHLAMNSHPCPKKVLVIGGGDGGVLREVVKHECVEEATLVDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+V R+SKKYLP MAIGF++PKV VHIGDGFEFL+DK N +D+IITD+SDP GPAESLF 
Sbjct: 121 EAVPRVSKKYLPNMAIGFEHPKVKVHIGDGFEFLKDKANQYDVIITDSSDPDGPAESLFG 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             +F+L+KNAL   G+ STQGEC WLHL LI +V+ +C++LYP VEYAYT+IPTYPSGQI
Sbjct: 181 PDFFQLLKNALTEKGVFSTQGECMWLHLPLIRKVKDFCKDLYPQVEYAYTSIPTYPSGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           G I+CS D  VNL++PLRK++ E+E+KLCRYYNS++H+AAF+LPQF K AL
Sbjct: 241 GHIMCSKDPNVNLREPLRKFTPEQEDKLCRYYNSEVHKAAFVLPQFAKKAL 291



>gi|169615146|ref|XP_001800989.1| hypothetical protein SNOG_10727 [Phaeosphaeria nodorum SN15]
 gi|160702895|gb|EAT82121.2| hypothetical protein SNOG_10727 [Phaeosphaeria nodorum SN15]
          Length = 292

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/287 (66%), Positives = 231/287 (80%), Gaps = 1/287 (0%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+DGWFRE   +WPGQAM L+++EV+ HEKS YQDVLIF+ST YG+VLVLD V+QCT
Sbjct: 6   HPTIKDGWFREISNMWPGQAMTLKVKEVIHHEKSKYQDVLIFESTDYGMVLVLDNVIQCT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NPE VLVI      VLREV KH+ VKE VLCDIDE+VIRL
Sbjct: 66  ERDEFSYQEMITHLAMNAHPNPEKVLVIGGGDGGVLREVVKHDCVKEAVLCDIDEAVIRL 125

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK+YLP M++GF++PK    +GDGF+FL DK   FD+IITD+SDP GPAE+LFQ  YFEL
Sbjct: 126 SKQYLPGMSVGFEHPKTQTIVGDGFKFLEDKKGEFDVIITDSSDPEGPAEALFQKAYFEL 185

Query: 196 MKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           +  ALR GG+ISTQG E QWLH+ LI  ++  C+E++P VEY YTTIPTYPSGQIGF++C
Sbjct: 186 LNGALREGGVISTQGSENQWLHMPLIANLKKACKEVFPNVEYGYTTIPTYPSGQIGFMVC 245

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D   +LKKPLR W+ EEEE+LCRYY+ +IHEAAF+LP F + AL+
Sbjct: 246 SKDADRDLKKPLRTWAPEEEEQLCRYYSKEIHEAAFVLPTFARKALR 292



>gi|347828643|emb|CCD44340.1| similar to spermidine synthase [Botryotinia fuckeliana T4]
          Length = 292

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 232/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L+++ VL HEKS YQDVLIF+ST YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISEMWPGQAMTLKVKNVLHHEKSKYQDVLIFESTDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP MAI + +PKV  HIGDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 LSKKYLPGMAISYQHPKVKTHIGDGFKFLDDYKNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  AL+ GG+I+TQG E QWLHL LIT+++  C+E++P VEYAYTTIPTYPSGQIGF++
Sbjct: 185 LLFGALKEGGVITTQGSENQWLHLPLITKLKKDCKEVFPNVEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C  D   +L KPLRKWS EEEEKLCRYYN+ IHEA+F+LP F + ALK
Sbjct: 245 CCKDANRDLSKPLRKWSPEEEEKLCRYYNAAIHEASFVLPTFARAALK 292



>gi|302912624|ref|XP_003050741.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256731679|gb|EEU45028.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 294

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/294 (64%), Positives = 239/294 (81%), Gaps = 1/294 (0%)

Query: 9   LMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           + S   +H  I+DGWFRE   +WPGQAM L +E+VL HEKS YQDVLIFKST +G VLVL
Sbjct: 1   MSSEEITHETIKDGWFREISEMWPGQAMTLRVEKVLVHEKSKYQDVLIFKSTDFGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D VVQCTERDEFSYQEMITH+ MN H NP+ VLVI      VLRE+ KH+ V+E +LCDI
Sbjct: 61  DNVVQCTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREIVKHDCVEEAILCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+V+RLSK+YLP M++GFD+PKV VHIGDGF+FL D  N FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVVRLSKQYLPNMSVGFDHPKVKVHIGDGFKFLDDYKNEFDVIITDSSDPDGPAEALF 180

Query: 189 QVKYFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSG 247
           Q  YF+L+ +AL+ GG+ISTQG E QWLHL LITQ++  CR ++PV EYAYTTIPTYPSG
Sbjct: 181 QKNYFKLLHDALKEGGVISTQGSENQWLHLPLITQLKKDCRSIFPVAEYAYTTIPTYPSG 240

Query: 248 QIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           QIGF++CS D   ++K PLR+W++EEE++ CRYY+S+IH+A+F+LP+F + AL+
Sbjct: 241 QIGFMVCSKDPNADVKTPLRQWTKEEEDEKCRYYSSEIHKASFVLPKFAEKALE 294



>gi|225683737|gb|EEH22021.1| spermidine synthase [Paracoccidioides brasiliensis Pb03]
          Length = 293

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/289 (64%), Positives = 236/289 (81%), Gaps = 1/289 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L++ ++L HEKS YQDVL+F+S+ +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEISDMWPGQAMTLKVNQILHHEKSKYQDVLVFESSDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M++GF +P VTVH+GDGF+FL D+ N FD+IITD+SDP GPAE+LFQ  YFE
Sbjct: 125 VSKKYLPGMSVGFQHPNVTVHVGDGFKFLADRKNEFDVIITDSSDPEGPAEALFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+ NALR GG+++TQG E QWLHL LIT+++   RE++PVVEYAYTTIPTYPSGQIGF++
Sbjct: 185 LLFNALREGGVVTTQGSENQWLHLSLITELKRNIREIFPVVEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           C  D   ++++P+R W+ EEEEKLCRYYN +IH A+F+LP F + AL++
Sbjct: 245 CCKDSSRDVREPVRTWTREEEEKLCRYYNKEIHRASFVLPNFARKALEQ 293



>gi|472244244|gb|EMR88869.1| putative spermidine synthase protein [Botryotinia fuckeliana BcDW1]
          Length = 642

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/286 (67%), Positives = 229/286 (80%), Gaps = 1/286 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I DGWFRE   +WPGQAM L+++ VL HEKS YQDVLIF+ST YG VLVLD V+QCTERD
Sbjct: 37  ITDGWFREISEMWPGQAMTLKVKNVLHHEKSKYQDVLIFESTDYGTVLVLDNVIQCTERD 96

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE+VIRLSKK
Sbjct: 97  EFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEAVIRLSKK 156

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP MAI + +PKV  HIGDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFEL+  
Sbjct: 157 YLPGMAISYQHPKVKTHIGDGFKFLDDYKNEFDVIITDSSDPEGPAESLFQKPYFELLFG 216

Query: 199 ALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
           AL+ GG+I+TQG E QWLHL LIT+++  C+E++P VEYAYTTIPTYPSGQIGF++C  D
Sbjct: 217 ALKEGGVITTQGSENQWLHLPLITKLKKDCKEVFPNVEYAYTTIPTYPSGQIGFMVCCKD 276

Query: 258 DKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
              +L KPLRKWS EEEEKLCRYYN+ IHEA+F+LP F + ALK +
Sbjct: 277 ANRDLSKPLRKWSPEEEEKLCRYYNAAIHEASFVLPTFARAALKTA 322



>gi|327352193|gb|EGE81050.1| spermidine synthase [Ajellomyces dermatitidis ATCC 18188]
          Length = 386

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 231/286 (80%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQA+ L++ ++L HEKS YQDVL+F+S+ +G VLVLD V+QC
Sbjct: 99  THPTIKDGWFSEVSDMWPGQALTLKVNQILHHEKSKYQDVLVFESSDHGTVLVLDNVIQC 158

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHESV+E VLCDIDE+VIR
Sbjct: 159 TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAVLCDIDEAVIR 218

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M++GF +P VTVH+ DGF+FL D+ N FD+IITD+SDP GPAE+LFQ  YFE
Sbjct: 219 VSKKYLPGMSVGFQHPNVTVHVADGFKFLADRKNEFDVIITDSSDPEGPAEALFQKPYFE 278

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ NALR GG+++TQ E QWLHL LIT ++   RE++PVVEYAYTTIPTYPSGQIGF++C
Sbjct: 279 LLFNALREGGVVTTQAENQWLHLSLITDLKRSIREIFPVVEYAYTTIPTYPSGQIGFMVC 338

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
             D   ++++P+R W+ EEEEKLCRYYN +IH A+F+LP F + AL
Sbjct: 339 CKDKDRDVREPVRSWTREEEEKLCRYYNKEIHRASFVLPNFARKAL 384



>gi|156044358|ref|XP_001588735.1| hypothetical protein SS1G_10282 [Sclerotinia sclerotiorum 1980]
 gi|154694671|gb|EDN94409.1| hypothetical protein SS1G_10282 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 292

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/288 (67%), Positives = 232/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L+++ VL HEKS +QDVLIF+ST YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISEMWPGQAMTLKVKNVLHHEKSKFQDVLIFESTDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP MAI + +PKV  HIGDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 LSKKYLPGMAISYQHPKVKTHIGDGFKFLDDYKNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  AL+ GG+I+TQG E QWLHL LIT+++  C+E++P VEYAYTTIPTYPSGQIGF++
Sbjct: 185 LLFGALKEGGVITTQGSENQWLHLPLITKLKKDCKEVFPNVEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C  D   +L KP+RKWS EEEEKLCRYYN+ IHEA+F+LP F + ALK
Sbjct: 245 CCKDADRDLSKPVRKWSPEEEEKLCRYYNAAIHEASFVLPTFARAALK 292



>gi|320588782|gb|EFX01250.1| spermidine synthase [Grosmannia clavigera kw1407]
          Length = 293

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/293 (64%), Positives = 234/293 (79%), Gaps = 1/293 (0%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           MS   +H  IQDGWFRE   +WPGQAM L +++VL HEKS YQDVL+F+ST YG VLVLD
Sbjct: 1   MSNEITHATIQDGWFREISEMWPGQAMTLRVKKVLHHEKSKYQDVLVFESTDYGKVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            V+QCTERDEFSYQEMITH+ M+ H +P+ VLVI      VLREV KHE ++E  LCDID
Sbjct: 61  NVIQCTERDEFSYQEMITHLAMHSHPDPKRVLVIGGGDGGVLREVVKHECLEEATLCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIR+SK+YLP M++GFD+PKV VH+GDGF+FL D  N FD+IITD+SDP GPAESLFQ
Sbjct: 121 EAVIRVSKQYLPGMSVGFDHPKVKVHVGDGFKFLDDYKNHFDVIITDSSDPEGPAESLFQ 180

Query: 190 VKYFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
             YF+L+ +ALR GG+I+TQG E QWLHL LI +++  C+E++PV EYAYT+IPTYPSGQ
Sbjct: 181 KPYFQLLHSALREGGVITTQGSENQWLHLPLIAKLKKDCKEVFPVAEYAYTSIPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           IGF++CS D   NLK PLR W+ EEE KLCRYYN++IH+A+F+LP F   AL+
Sbjct: 241 IGFMVCSKDPNANLKMPLRSWTAEEEAKLCRYYNAEIHKASFVLPTFAAKALQ 293



>gi|367025809|ref|XP_003662189.1| hypothetical protein MYCTH_2302498 [Myceliophthora thermophila ATCC
           42464]
 gi|347009457|gb|AEO56944.1| hypothetical protein MYCTH_2302498 [Myceliophthora thermophila ATCC
           42464]
          Length = 292

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/291 (65%), Positives = 236/291 (81%), Gaps = 1/291 (0%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           G  +H  I+DGWFRE   +WPGQAM L +++VL HEKS YQDVLIF+ST +G VLVLD V
Sbjct: 2   GDITHATIKDGWFREISDMWPGQAMTLRVKKVLHHEKSKYQDVLIFESTDHGNVLVLDNV 61

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +QCTERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE V+E +LCDIDE+
Sbjct: 62  IQCTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEA 121

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVK 191
           VIRLSK+YLP MA+GF++PKV VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ  
Sbjct: 122 VIRLSKQYLPHMAVGFNHPKVKVHVGDGFKFLDDYKNTFDVIITDSSDPEGPAESLFQKP 181

Query: 192 YFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIG 250
           YF+L+ +ALR GG+I+TQG E QWLHL LIT+++  C E++PV EYAYTTIPTYPSGQIG
Sbjct: 182 YFQLLHDALREGGVITTQGSENQWLHLPLITKLKKDCSEIFPVAEYAYTTIPTYPSGQIG 241

Query: 251 FILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           F++C  D   N++ P+R WS+EEE KLCRYYN++IH+A+FILP F + AL+
Sbjct: 242 FMVCCKDPNRNVRVPVRTWSKEEERKLCRYYNAEIHKASFILPTFAQQALE 292



>gi|407920351|gb|EKG13563.1| Spermine synthase [Macrophomina phaseolina MS6]
          Length = 292

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/288 (64%), Positives = 230/288 (79%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L++ +VL HEKS YQDVLIF+S+ YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISDMWPGQAMTLKVNQVLHHEKSKYQDVLIFESSDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP M++GF +P V   +GDGF+FL D+ N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 LSKKYLPGMSVGFQHPAVQTIVGDGFKFLADRQNEFDVIITDSSDPEGPAESLFQKSYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  ALR GG+I+TQ E QWLH+ LI ++   C+E++P VEYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLNGALREGGVITTQAENQWLHMPLIAKLMKDCKEVFPTVEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
             D   ++KKP+R WS EEEEKLC+YY+ +IHEA+F+LP F + AL++
Sbjct: 245 CKDGNRDVKKPVRSWSTEEEEKLCKYYSKEIHEASFVLPNFARKALRQ 292



>gi|512189737|gb|EPE05503.1| spermidine synthase [Ophiostoma piceae UAMH 11346]
          Length = 294

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 236/294 (80%), Gaps = 1/294 (0%)

Query: 9   LMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           + S   +H  I+DGWFRE   +WPGQAM L +++VL HEKS YQDVLIF+ST YG VLVL
Sbjct: 1   MSSEEITHATIKDGWFREISEMWPGQAMTLRVKKVLHHEKSKYQDVLIFESTDYGTVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+QCTERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E  LCDI
Sbjct: 61  DNVIQCTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEATLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP MA GF++PKV VH+GDGF+FL D  N+FD+IITD+SDP GPAESLF
Sbjct: 121 DEAVIRLSKQYLPGMAAGFEHPKVKVHVGDGFKFLEDYQNTFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSG 247
           +  YFEL+ +ALR GG+I+TQG E QWLHL LI Q++  C+E++ V EYAYTTIPTYPSG
Sbjct: 181 KKSYFELLHSALREGGVITTQGSENQWLHLPLIAQLKKDCQEVFAVAEYAYTTIPTYPSG 240

Query: 248 QIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           QIGF++CS D K N+K+PLR+W+ EEE++ C+YY++ IH+A+F+LP F K AL+
Sbjct: 241 QIGFMVCSKDPKANVKEPLRQWTAEEEDQKCKYYSADIHKASFVLPNFAKKALQ 294



>gi|345561897|gb|EGX44969.1| hypothetical protein AOL_s00173g70 [Arthrobotrys oligospora ATCC
           24927]
          Length = 293

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/291 (64%), Positives = 232/291 (79%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           MS   +HP I DGWFRE   +W GQAM L++E++L HEKSLYQDVL+FKST YG VLVLD
Sbjct: 1   MSEELTHPTIVDGWFREINEMWRGQAMTLKVEKILHHEKSLYQDVLVFKSTDYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            V+QCTERDEFSYQEMITH+ MN H  P+ VLVI      VLREV KHE V+E +LCDID
Sbjct: 61  NVIQCTERDEFSYQEMITHLAMNSHPEPKKVLVIGGGDGGVLREVIKHECVEEAILCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIR+SK+YLP M+  + +PKV  HIGDGF+FL D  N+FD+IITD+SDP GPAESLFQ
Sbjct: 121 EAVIRVSKQYLPDMSASYKHPKVKTHIGDGFKFLADYKNTFDVIITDSSDPDGPAESLFQ 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
           + YFEL++ ALR GG+I+TQ E QWLH+DLI +++  C + +PV EYAYTTIPTYPSGQI
Sbjct: 181 LPYFELLEGALREGGVITTQAENQWLHIDLIQRLKKDCGKTFPVAEYAYTTIPTYPSGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           GF++C  D   ++ KPLR+WSEEEE+KLCRYYN++IHEA+FILP F +  L
Sbjct: 241 GFMVCCKDANRDVTKPLRRWSEEEEDKLCRYYNAKIHEASFILPTFARKKL 291



>gi|399169775|emb|CCE29495.1| SPE-3 spermidine synthase [Claviceps purpurea 20.1]
          Length = 292

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/288 (65%), Positives = 233/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISEMWPGQAMTLKVEKVLHHEKSQYQDVLIFKSTDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ M+ H NP+ VLVI      VLRE+ KH+ V+E +LCDIDE+V+R
Sbjct: 65  TERDEFSYQEMITHLAMHSHPNPKKVLVIGGGDGGVLREIVKHDCVEEAILCDIDEAVVR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSK+YLP MA GF +PK  VHIGDGF+FL D  N FD+IITD+SDP GPAESLF+  YF+
Sbjct: 125 LSKQYLPNMAEGFSHPKSKVHIGDGFKFLNDYKNCFDVIITDSSDPEGPAESLFKKPYFQ 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+ +ALR GG+I+TQG E QWLHL LITQ++  C+E++PV EYAYTTIPTYPSGQIGF++
Sbjct: 185 LLHDALRDGGVITTQGSENQWLHLPLITQLKKDCKEIFPVAEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C  D   N++ PLR+W+ EEEE  CRYYN++IH+A+FILP F K AL+
Sbjct: 245 CCKDATRNVRVPLRQWTPEEEEAKCRYYNAEIHKASFILPNFAKKALQ 292



>gi|485923721|gb|EOD48787.1| putative spermidine synthase protein [Neofusicoccum parvum UCRNP2]
          Length = 293

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/288 (65%), Positives = 230/288 (79%), Gaps = 1/288 (0%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+DGWFRE   +WPGQAM L++ +VL HEKS YQDVLIF+S+ YG VLVLD V+QCT
Sbjct: 6   HPTIKDGWFREISDMWPGQAMTLKVNQVLHHEKSKYQDVLIFESSDYGTVLVLDNVIQCT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE V+E +LCDIDE+VIRL
Sbjct: 66  ERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEAVIRL 125

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SKKYLP M++GF +P V   +GDGF+FL D+ N FD+IITD+SDP GPAESLFQ  YFEL
Sbjct: 126 SKKYLPGMSVGFQHPAVQTIVGDGFKFLADRQNEFDVIITDSSDPEGPAESLFQKSYFEL 185

Query: 196 MKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           +  ALR GG+I+TQG E QWLH+ LI ++   C+E++P VEYAYTTIPTYPSGQIGF++C
Sbjct: 186 LNGALREGGVITTQGSENQWLHMPLIAKLMKDCKEVFPTVEYAYTTIPTYPSGQIGFMVC 245

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
             D   +LKKP+R WS EEEEKLC+YY+ +IHEA+F+LP F + AL++
Sbjct: 246 CKDAGRDLKKPVRSWSVEEEEKLCKYYSKEIHEASFVLPNFARKALRQ 293



>gi|384501417|gb|EIE91908.1| spermidine synthase [Rhizopus delemar RA 99-880]
          Length = 292

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 235/292 (80%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           M+   SHP I DGWF EK T+WPGQAM +++EE+L  EKS YQDVL+F+S++YG VLVLD
Sbjct: 1   MAAPLSHPCIVDGWFMEKSTMWPGQAMSIKVEEILHVEKSKYQDVLVFQSSNYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            V+Q TERDEFSYQEMITH+ MN H  P+ VLVI      VLREV KHESV+E +L DID
Sbjct: 61  NVIQATERDEFSYQEMITHLAMNSHPCPKKVLVIGGGDGGVLREVVKHESVEEAILVDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+V R+SKKYLP MAIGF++PKV VHIGDGFEFL+DK+N +D+IITD+SDP GPAESLF 
Sbjct: 121 EAVPRVSKKYLPNMAIGFEHPKVKVHIGDGFEFLKDKINQYDVIITDSSDPDGPAESLFG 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
            ++F+L+KNAL   G+ STQGEC WLHL LI +V+ +C++LYP VEYAYT IPTYP GQI
Sbjct: 181 AEFFQLLKNALTENGVFSTQGECMWLHLPLIKKVKDFCKDLYPRVEYAYTCIPTYPCGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           G ILCS D    LK+PLRK++ E+EEKL RYY++ +H+AAF+LPQF K AL+
Sbjct: 241 GHILCSKDPNAVLKEPLRKFTPEQEEKLMRYYSADMHKAAFVLPQFAKKALE 292



>gi|322701141|gb|EFY92892.1| spermidine synthase [Metarhizium acridum CQMa 102]
          Length = 292

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/287 (66%), Positives = 231/287 (80%), Gaps = 1/287 (0%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+DGWFRE   +WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVLD V+Q T
Sbjct: 6   HPTIKDGWFREISDMWPGQAMTLKVEKVLHHEKSQYQDVLIFKSTDYGTVLVLDNVIQAT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E  LCDIDE+VIRL
Sbjct: 66  ERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEATLCDIDEAVIRL 125

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK+YLPKMA GF +PK  VH+GDGF+FL D  N FD+IITD+SDP GPAESLF+  YF+L
Sbjct: 126 SKQYLPKMAEGFKHPKSKVHVGDGFKFLDDYKNCFDVIITDSSDPEGPAESLFKKPYFQL 185

Query: 196 MKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           + +ALR GG+I+TQG E QWLHL LITQ++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 186 LHDALRDGGVITTQGSENQWLHLPLITQLKKDCKEIFPVAEYAYTTIPTYPSGQIGFMVC 245

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             D   N++ PLR+W+ EEEE  CRYYN++IH+A+F+LP F K AL+
Sbjct: 246 CKDANRNVRVPLRQWTPEEEEAKCRYYNAEIHKASFVLPTFAKKALE 292



>gi|322706886|gb|EFY98465.1| spermidine synthase [Metarhizium anisopliae ARSEF 23]
          Length = 335

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/287 (66%), Positives = 231/287 (80%), Gaps = 1/287 (0%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+DGWFRE   +WPGQAM L++++VL HEKS YQDVLIFKST YG VLVLD V+Q T
Sbjct: 49  HPTIKDGWFREISDMWPGQAMTLKVDKVLHHEKSQYQDVLIFKSTDYGTVLVLDNVIQAT 108

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E  LCDIDE+VIRL
Sbjct: 109 ERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEATLCDIDEAVIRL 168

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK+YLPKMA GF +PK  VH+GDGF+FL D  N FD+IITD+SDP GPAESLF+  YF+L
Sbjct: 169 SKQYLPKMAEGFKHPKSKVHVGDGFKFLDDYKNCFDVIITDSSDPEGPAESLFKKPYFQL 228

Query: 196 MKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           + +ALR GG+I+TQG E QWLHL LITQ++  C+E++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 229 LHDALRDGGVITTQGSENQWLHLPLITQLKKDCKEIFPVAEYAYTTIPTYPSGQIGFMVC 288

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             D   N++ PLR+W+ EEEE  CRYYN++IH+A+FILP F K AL+
Sbjct: 289 CKDANRNVRVPLRQWTPEEEEAKCRYYNAEIHKASFILPTFAKKALE 335



>gi|361131873|gb|EHL03508.1| putative Spermidine synthase [Glarea lozoyensis 74030]
 gi|512200528|gb|EPE29360.1| S-adenosyl-L-methionine-dependent methyltransferase [Glarea
           lozoyensis ATCC 20868]
          Length = 292

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 188/288 (65%), Positives = 233/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L+++ ++ HEKS YQDVLIF+ST YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISEMWPGQAMTLKVKNIIHHEKSKYQDVLIFESTDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEF+YQEMITH+ MN H +P+ VLVI      VLREV KH+ V+E +LCDIDE+VIR
Sbjct: 65  TERDEFAYQEMITHLAMNSHPDPKKVLVIGGGDGGVLREVIKHDCVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP MA+GF +PKV VH+GDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 LSKKYLPGMAVGFQHPKVKVHVGDGFKFLDDYKNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  AL+ GG+I+TQG E QWLHL LIT+++  C+E++P VEYAYTTIPTYPSGQIGF++
Sbjct: 185 LLFGALKEGGVITTQGSENQWLHLPLITKLKKDCKEVFPTVEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C  D   ++ KPLR W+ EEEEK+ RYYN+ IH+A+FILP F +NAL+
Sbjct: 245 CCKDANRDVTKPLRSWTAEEEEKVNRYYNADIHKASFILPTFARNALR 292



>gi|154277382|ref|XP_001539532.1| spermidine synthase [Ajellomyces capsulatus NAm1]
 gi|150413117|gb|EDN08500.1| spermidine synthase [Ajellomyces capsulatus NAm1]
 gi|225561157|gb|EEH09438.1| spermidine synthase [Ajellomyces capsulatus G186AR]
 gi|240280284|gb|EER43788.1| spermidine synthase [Ajellomyces capsulatus H143]
 gi|325096647|gb|EGC49957.1| spermidine synthase [Ajellomyces capsulatus H88]
          Length = 292

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 181/286 (63%), Positives = 229/286 (80%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L++ ++L HEKS YQDVL+F+S+ +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEISDMWPGQAMTLKVNQILHHEKSKYQDVLVFESSDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE+V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHETVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M++GF +P V VH+ DGF+FL D+ N FD+IITD+SDP GPAE+LFQ  YFE
Sbjct: 125 VSKKYLPGMSVGFQHPNVKVHVADGFKFLADRKNEFDVIITDSSDPEGPAEALFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ NALR GG+++TQ E QWLHL LIT ++   RE++PVVEYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLFNALREGGVVTTQAENQWLHLSLITDLKRNIREIFPVVEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
             D   ++++P+R W+  EEEKLCRYYN +IH A+F+LP F + AL
Sbjct: 245 CKDASRDVREPVRSWTRAEEEKLCRYYNKEIHRASFVLPNFARKAL 290



>gi|154304795|ref|XP_001552801.1| hypothetical protein BC1G_08983 [Botryotinia fuckeliana B05.10]
          Length = 310

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/284 (67%), Positives = 228/284 (80%), Gaps = 1/284 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I +GWFRE   +WPGQAM L+++ VL HEKS YQDVLIF+ST YG VLVLD V+QCTERD
Sbjct: 27  ISNGWFREISEMWPGQAMTLKVKNVLHHEKSKYQDVLIFESTDYGTVLVLDNVIQCTERD 86

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE+VIRLSKK
Sbjct: 87  EFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEAVIRLSKK 146

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP MAI + +PKV  HIGDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFEL+  
Sbjct: 147 YLPGMAISYQHPKVKTHIGDGFKFLDDYKNEFDVIITDSSDPEGPAESLFQKPYFELLFG 206

Query: 199 ALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
           AL+ GG+I+TQG E QWLHL LIT+++  C+E++P VEYAYTTIPTYPSGQIGF++C  D
Sbjct: 207 ALKEGGVITTQGSENQWLHLPLITKLKKDCKEVFPNVEYAYTTIPTYPSGQIGFMVCCKD 266

Query: 258 DKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
              +L KPLRKWS EEEEKLCRYYN+ IHEA+F+LP F + ALK
Sbjct: 267 ANRDLSKPLRKWSPEEEEKLCRYYNAAIHEASFVLPTFARAALK 310



>gi|358378881|gb|EHK16562.1| hypothetical protein TRIVIDRAFT_187417 [Trichoderma virens Gv29-8]
          Length = 292

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/292 (64%), Positives = 232/292 (79%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           MS    HP IQDGW+RE   +WPGQAM L++E+VL HEKSLYQDVLIFKST YG VLVLD
Sbjct: 1   MSDEIVHPTIQDGWYREISDMWPGQAMTLKVEKVLHHEKSLYQDVLIFKSTDYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            VVQ TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE V+E +LCDID
Sbjct: 61  NVVQATERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAILCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIRLSK+YLP MA+GF++PK   H+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ
Sbjct: 121 EAVIRLSKQYLPGMAVGFEHPKSKTHVGDGFKFLDDYKNTFDVIITDSSDPEGPAESLFQ 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF+L+ +ALR GG+I+TQ E  WLHL LI +++  C E++PV EYAYTTIPTYPSGQI
Sbjct: 181 KPYFQLLHDALREGGVITTQAESPWLHLPLIARLKKDCGEVFPVAEYAYTTIPTYPSGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           GF++C  D   N+K P+R +++EEE++  RYYNS+IH+A+F+LP F K AL+
Sbjct: 241 GFMVCCKDANRNVKVPVRSFTKEEEDEKLRYYNSEIHKASFVLPNFAKKALE 292



>gi|340914898|gb|EGS18239.1| spermidine synthase-like protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 296

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/292 (64%), Positives = 235/292 (80%), Gaps = 1/292 (0%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           G  +HP I+DGWFRE   +W GQAM L +++VL HEKS YQDVLIF+ST +G VLVLD V
Sbjct: 5   GEITHPTIKDGWFREISDMWAGQAMTLRVKKVLHHEKSKYQDVLIFESTDHGRVLVLDNV 64

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +QCTERDEFSYQEMITH+ MN H  P+ VLVI      VLREV KHE V+E +LCDIDE+
Sbjct: 65  IQCTERDEFSYQEMITHLAMNSHPEPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEA 124

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVK 191
           VIRLSK+YLP MA+GF++PKV VH+GDGF+FL +  N+FD+IITD+SDP GPAESLFQ  
Sbjct: 125 VIRLSKQYLPNMAVGFNHPKVKVHVGDGFKFLAEYKNTFDVIITDSSDPEGPAESLFQKP 184

Query: 192 YFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIG 250
           YF+L+  ALR GG+I+TQG E QWLHL LIT+++  C E++PV EYAYTTIPTYPSGQIG
Sbjct: 185 YFQLLYEALRDGGVITTQGSENQWLHLPLITKLKKDCSEIFPVAEYAYTTIPTYPSGQIG 244

Query: 251 FILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           F++C  D   ++K PLR WS+EEE +LC+YYNS+IH+AAF+LP F + AL++
Sbjct: 245 FMVCCKDPNRDVKVPLRTWSKEEERRLCKYYNSEIHKAAFVLPTFAQMALEQ 296



>gi|400597126|gb|EJP64861.1| spermidine synthase [Beauveria bassiana ARSEF 2860]
          Length = 292

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/288 (64%), Positives = 233/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L++E+VL HEKS YQDVL+FKST YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISNMWPGQAMTLKVEKVLHHEKSKYQDVLVFKSTDYGHVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+ +N H NP+ VLVI      VLREV KH+ V+E +LCDIDE+V R
Sbjct: 65  TERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEAVPR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK++LP+MA G  + K TVHIGDGF+FL D  N+FD+IITD+SDP GPAESLFQ  YF+
Sbjct: 125 VSKQFLPEMATGLTHAKSTVHIGDGFKFLNDYKNTFDVIITDSSDPEGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+ +ALR GG+ISTQG E QWLHL LITQ++  C+E++PVVEYAYTTIPTYPSGQIGF++
Sbjct: 185 LLHDALRDGGVISTQGSENQWLHLSLITQLKKDCKEIFPVVEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           CS D   ++K P+R W+  EEE+ CRYYN++IH+A+F+LP F K AL+
Sbjct: 245 CSKDASRDVKVPVRTWTPAEEEEKCRYYNAEIHKASFVLPNFAKKALQ 292



>gi|171693823|ref|XP_001911836.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946860|emb|CAP73664.1| unnamed protein product [Podospora anserina S mat+]
          Length = 292

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/291 (64%), Positives = 234/291 (80%), Gaps = 1/291 (0%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           G  +H  I+DGWFRE   +WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVLD V
Sbjct: 2   GDITHSTIKDGWFREISNMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTDYGNVLVLDNV 61

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +Q TERDEF+YQEMIT++ M  H  P+ VLVI      VLREV KH+ V+E +LCDIDE+
Sbjct: 62  IQATERDEFAYQEMITNLAMMSHPEPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEA 121

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVK 191
           VIRLSK+YLP M+ GF++PKV VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ  
Sbjct: 122 VIRLSKQYLPHMSAGFNHPKVKVHVGDGFKFLDDYKNTFDVIITDSSDPEGPAESLFQKP 181

Query: 192 YFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIG 250
           YF+L+ +ALR GG+I+TQG E QWLHL LIT+++  C+E++PV EYAYTTIPTYPSGQIG
Sbjct: 182 YFKLLHDALREGGVITTQGSENQWLHLPLITKLKQDCKEIFPVAEYAYTTIPTYPSGQIG 241

Query: 251 FILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           F++C+ D   N+K PLR W++EEEEK CRYYNS+IH+A+F+LP F   AL+
Sbjct: 242 FMVCTKDANRNVKVPLRSWTKEEEEKHCRYYNSEIHKASFVLPTFAAKALQ 292



>gi|315053415|ref|XP_003176081.1| spermidine synthase [Arthroderma gypseum CBS 118893]
 gi|311337927|gb|EFQ97129.1| spermidine synthase [Arthroderma gypseum CBS 118893]
          Length = 292

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/288 (62%), Positives = 231/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L + ++L HEKS YQDVL+F+S+ +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEVSDMWPGQAMNLRVNQILHHEKSKYQDVLVFESSDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLRE+ KH++V+E VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREIVKHDTVEEAVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M++GF +P   VH+GDGF+FL ++ N FD+IITD+SDP GPAE LFQ  YFE
Sbjct: 125 VSKKYLPGMSVGFQHPNAKVHVGDGFKFLEEQKNQFDVIITDSSDPEGPAEVLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  ALR GG+ISTQG E QWLHL +IT+++   RE++PVVEYAYTTIPTYPSGQIGF++
Sbjct: 185 LLHGALREGGVISTQGSENQWLHLSMITELKKLMREVFPVVEYAYTTIPTYPSGQIGFLV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
              D + N+++PLRKW+ EEE+KLCRYYN ++H A+F+LP F + AL+
Sbjct: 245 ACKDAERNVREPLRKWTREEEDKLCRYYNQEVHRASFVLPNFARKALE 292



>gi|402082530|gb|EJT77548.1| spermidine synthase [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 292

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 186/291 (63%), Positives = 230/291 (79%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           MS    H  I+DGWFRE   +WPGQAM L++++VL HEKS YQDVLIFKST YG VLVLD
Sbjct: 1   MSDEIVHETIKDGWFREISDMWPGQAMTLKVDKVLHHEKSQYQDVLIFKSTDYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
            V+Q TERDEF+YQEMITH+ +N H NP+ VLVI      VLREV KH+ V+E +LCDID
Sbjct: 61  NVIQATERDEFAYQEMITHLALNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIRLSK+YLP MA G  +PK TVH+GDGF+FL +  N+FD+IITD+SDP GPAESLFQ
Sbjct: 121 EAVIRLSKQYLPGMAAGLTHPKATVHVGDGFKFLDEYKNAFDVIITDSSDPDGPAESLFQ 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF+L+ +ALR GG+I+TQ E QWLHL LIT+++  C+E++PV EYAYTTIPTYPSGQI
Sbjct: 181 KSYFQLLHDALREGGVITTQAENQWLHLPLITRLKKDCKEVFPVAEYAYTTIPTYPSGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           GF++CS D K ++K PLR W+ E+E   CRYYN+ IH+A+FILP F + AL
Sbjct: 241 GFMVCSKDPKADVKVPLRSWTREDEVAKCRYYNADIHKASFILPTFAQQAL 291



>gi|406863819|gb|EKD16866.1| spermidine synthase [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 292

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/288 (65%), Positives = 232/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L+++ V+ HEKS YQDVLIF+ST +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISDMWPGQAMTLKVKNVIHHEKSKYQDVLIFESTDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVIKHDCVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP MAI + +PKV VH+GDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 LSKKYLPGMAISYQHPKVKVHVGDGFKFLDDYKNEFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  AL+ GG+I+TQG E QWLHL +IT+++  C+E++P VEYAYTTIPTYPSGQIGF++
Sbjct: 185 LLFGALKEGGVITTQGSENQWLHLPMITKLKKDCKEVFPNVEYAYTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C  D   +LK P+R WS EEEEKLCRYY++ IH+A+F+LP F + AL+
Sbjct: 245 CCKDADRDLKTPVRTWSAEEEEKLCRYYSADIHKASFVLPNFARIALR 292



>gi|258572568|ref|XP_002545046.1| spermidine synthase [Uncinocarpus reesii 1704]
 gi|237905316|gb|EEP79717.1| spermidine synthase [Uncinocarpus reesii 1704]
          Length = 292

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/288 (63%), Positives = 228/288 (79%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L + ++L HEKS YQDVL+F+S+ +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEISEMWPGQAMTLRVNQILHHEKSKYQDVLVFESSDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHESV+E VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M++GF +P V VHIGDGF+FL ++ N FD+IITD+SDP GPAE LFQ  YFE
Sbjct: 125 VSKKYLPGMSLGFQHPNVKVHIGDGFKFLEERKNEFDVIITDSSDPEGPAEVLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  +LR GG+ISTQG E QWLH+ LIT ++   +E++PVVEYAYTTIPTYPSGQIGF++
Sbjct: 185 LLHGSLREGGVISTQGSENQWLHIKLITDLKKLMKEVFPVVEYAYTTIPTYPSGQIGFLV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
              D   N+++P+R W+ EEE+KLCRYYN  IH A+F+LP F + AL+
Sbjct: 245 ACKDASRNIREPVRSWTREEEDKLCRYYNQDIHRASFVLPSFARKALE 292



>gi|477515368|gb|ENH67724.1| Spermidine synthase [Fusarium oxysporum f. sp. cubense race 1]
          Length = 294

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 182/294 (61%), Positives = 233/294 (79%), Gaps = 1/294 (0%)

Query: 9   LMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           + S   +HP I+DGWFRE   +WPG AM L +E+VL HEKS YQDVLIFKST +G VLVL
Sbjct: 1   MSSEEITHPTIKDGWFREISDMWPGHAMTLRVEKVLVHEKSKYQDVLIFKSTDFGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+QCTERDEFSYQEMI H+ +N H NP+ VLVI      VLRE+ KH+ V+E  LCDI
Sbjct: 61  DNVIQCTERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREIVKHDCVEEATLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+V+RLSK++LP MA GFD+PK   HIGDGF+FL D  N FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVVRLSKEHLPSMACGFDHPKSKTHIGDGFKFLNDYKNEFDVIITDSSDPDGPAEALF 180

Query: 189 QVKYFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSG 247
           Q  YF+L+++ALR GG+I+TQG E  WLHL LIT+++  C+ ++PV EYAYTTIPTYPSG
Sbjct: 181 QKSYFQLLRDALREGGVITTQGSESPWLHLPLITRLKKDCQAIFPVAEYAYTTIPTYPSG 240

Query: 248 QIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           QIGF++CS D K ++K PLR W++EEE+  CRYY+++IH+A+F+LP+F + AL+
Sbjct: 241 QIGFMVCSKDPKADVKTPLRSWTKEEEDAKCRYYSAEIHKASFVLPKFAQKALE 294



>gi|452987579|gb|EME87334.1| hypothetical protein MYCFIDRAFT_71189 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 292

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/288 (63%), Positives = 234/288 (81%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L + +V+ HEKS YQDVLIF+S+ YG+VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISDMWPGQAMTLRVNQVVHHEKSKYQDVLIFESSDYGMVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDE+SYQEMITH+ M  H NP+ VLVI      VLREV KHESV+E VLCDIDE+VIR
Sbjct: 65  TERDEYSYQEMITHLGMFSHPNPKKVLVIGGGDGGVLREVVKHESVEEAVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP M++GF +PKV VH+GDGF+FL D  +SFD+IITD+SDP GPAE+LFQ  YFE
Sbjct: 125 LSKKYLPGMSVGFQHPKVKVHVGDGFKFLADYKDSFDVIITDSSDPEGPAEALFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+ +ALR GG+I+TQG E  WLH+ +I  ++  C++++PV EY +TTIPTYPSGQIGF++
Sbjct: 185 LLHDALREGGVITTQGSENPWLHMSMIVDLKKSCKQVFPVAEYGWTTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C+ D K ++KKPLR  SE EE+KL +YY+S++HEAAFILP+F + AL+
Sbjct: 245 CTKDGKRDVKKPLRSVSEAEEDKLFKYYSSKVHEAAFILPKFAEKALR 292



>gi|440639461|gb|ELR09380.1| spermidine synthase [Geomyces destructans 20631-21]
          Length = 291

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/287 (64%), Positives = 228/287 (79%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L+++ VL HEKS YQDVLIF+ST YG VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISDMWPGQAMTLKVKNVLHHEKSKYQDVLIFESTDYGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEF+YQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E VLCDIDE+VIR
Sbjct: 65  TERDEFAYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVIKHDCVEEAVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP MAI + +PKV VH+GDGF+FL D  N FD+IITD+SDP GPAE LFQ  YF+
Sbjct: 125 LSKKYLPGMAISYQHPKVKVHVGDGFKFLDDYKNEFDVIITDSSDPEGPAEMLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  AL+ GG+ISTQ E QWLHL LIT+++  C+E++P VEYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLFGALKEGGVISTQAENQWLHLPLITKLKKDCKEVFPTVEYAYTTIPTYPSGQIGFMIC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D   ++K PLR ++ E+E+   RYYN+ IH+A+FILP F + AL+
Sbjct: 245 SKDATRDMKTPLRSFTAEQEDSQLRYYNADIHKASFILPTFARKALQ 291



>gi|452848267|gb|EME50199.1| hypothetical protein DOTSEDRAFT_68912 [Dothistroma septosporum
           NZE10]
          Length = 291

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 182/287 (63%), Positives = 231/287 (80%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L++ +V+ HEKS YQDVLIF+S+ YG+VLVLD V+QC
Sbjct: 5   THPTIKDGWFREISDMWPGQAMTLKVNQVVHHEKSKYQDVLIFESSDYGMVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ M  H NP+ VLVI      VLREV KHESV+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLGMFSHPNPKKVLVIGGGDGGVLREVVKHESVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP M++GF++P V VH+GDGF+FL D  ++FD+IITD+SDP GPAE+LFQ  YFE
Sbjct: 125 LSKKYLPGMSVGFNHPNVKVHVGDGFKFLEDYKDTFDVIITDSSDPEGPAEALFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  ALR GGII+TQ E  WLHL++I  ++   + ++PV EY +TTIPTYPSGQIGF++C
Sbjct: 185 LLHGALREGGIITTQAENPWLHLNMIENLKKSIKTIFPVAEYGWTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D   N+KKPLR  SE EE+KL +YY+S++HEAAF+LP+F + AL+
Sbjct: 245 SKDANSNVKKPLRTVSEAEEDKLFKYYSSKVHEAAFVLPKFAEKALR 291



>gi|398411809|ref|XP_003857240.1| hypothetical protein MYCGRDRAFT_107360 [Zymoseptoria tritici
           IPO323]
 gi|339477125|gb|EGP92216.1| hypothetical protein MYCGRDRAFT_107360 [Zymoseptoria tritici
           IPO323]
          Length = 291

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 182/287 (63%), Positives = 231/287 (80%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE+  +WPGQAM L++ +V+ HEKS YQDVLIF+S+ +G+VLVLD V+QC
Sbjct: 5   THPTIKDGWFREQSDMWPGQAMTLKVNQVVHHEKSQYQDVLIFESSDHGMVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEF+YQEMITH+ M  H NP+ VLVI      VLREV KHESV+E  LCDIDE+VIR
Sbjct: 65  TERDEFAYQEMITHLAMFAHPNPKKVLVIGGGDGGVLREVVKHESVEEATLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP M++GF +P V VH+GDGF+FL D  ++FD+IITD+SDP GPAESLFQ  YFE
Sbjct: 125 LSKKYLPGMSVGFQHPNVKVHVGDGFKFLEDYKDTFDVIITDSSDPEGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  ALR GGIISTQ E  WLHL++IT+++   + ++PV EY +TTIPTYPSGQIGF++C
Sbjct: 185 LLHGALREGGIISTQAENPWLHLNMITELKKSVKTVFPVAEYGWTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D   N+KKP R  S+EEE+KL +YY+S+IHEAAF+LP+F +  L+
Sbjct: 245 SKDGSRNVKKPQRTLSDEEEDKLFKYYSSKIHEAAFVLPKFVEQKLR 291



>gi|405955424|gb|EKC22547.1| Spermidine synthase [Crassostrea gigas]
          Length = 299

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 181/287 (63%), Positives = 227/287 (79%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I+DGWF E   LWPGQAM L++E+VL  E+S YQDVL+FKS  YG VLVLDGV+QCTERD
Sbjct: 4   IKDGWFSEISELWPGQAMSLQVEDVLFQERSKYQDVLVFKSKTYGNVLVLDGVIQCTERD 63

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEM+ H+P+NCH NP  VL+I      VLREV KH  V+ + +C+IDE VI +SKK
Sbjct: 64  EFSYQEMLAHLPLNCHPNPRKVLIIGGGDGGVLREVVKHPEVQSVEMCEIDEKVIEVSKK 123

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLPKMAIGF++ K+++HIGDGFE+++     FD+IITD+SDP+GPA SLF+  Y+ELMKN
Sbjct: 124 YLPKMAIGFESSKLSLHIGDGFEYMKKHQGEFDVIITDSSDPIGPASSLFEKSYYELMKN 183

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           ALRPGGI+  QGEC WLH+DLI  +Q +CR LYPVV+YAYTTIPTYPSGQIGFILC ++ 
Sbjct: 184 ALRPGGIVCCQGECLWLHIDLIKGMQDFCRGLYPVVDYAYTTIPTYPSGQIGFILCGLNS 243

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N K+P+RK++ EEE KL  +YYN+ +H +AF+LPQF +  LK  S
Sbjct: 244 DANFKEPVRKFTLEEEIKLKLQYYNADVHRSAFVLPQFARKVLKGES 290



>gi|342887616|gb|EGU87098.1| hypothetical protein FOXB_02492 [Fusarium oxysporum Fo5176]
          Length = 294

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 182/294 (61%), Positives = 232/294 (78%), Gaps = 1/294 (0%)

Query: 9   LMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           + S   +HP I+DGWFRE   +WPG AM L +E+VL HEKS YQDVLIFKST +G VLVL
Sbjct: 1   MSSEEITHPTIKDGWFREISDMWPGHAMTLRVEKVLVHEKSKYQDVLIFKSTDFGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+QCTERDEFSYQEMI H+ +N H NP+ VLVI      VLRE+ KH+ V+E  LCDI
Sbjct: 61  DNVIQCTERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREIVKHDCVEEATLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+V+RLSK++LP MA GFD+PK   HIGDGF+FL D  N FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVVRLSKEHLPSMACGFDHPKSKTHIGDGFKFLNDYKNEFDVIITDSSDPDGPAEALF 180

Query: 189 QVKYFELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSG 247
           Q  YF+L+ +ALR GG+I+TQG E  WLHL LIT+++  C+ ++PV EYAYTTIPTYPSG
Sbjct: 181 QKSYFQLLHDALREGGVITTQGSESPWLHLPLITRLKKDCQAIFPVAEYAYTTIPTYPSG 240

Query: 248 QIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           QIGF++CS D K ++K PLR W++EEE+  CRYY+++IH+A+F+LP+F + AL+
Sbjct: 241 QIGFMVCSKDPKADVKTPLRSWTKEEEDAKCRYYSAEIHKASFVLPKFAQKALE 294



>gi|296814308|ref|XP_002847491.1| spermidine synthase [Arthroderma otae CBS 113480]
 gi|238840516|gb|EEQ30178.1| spermidine synthase [Arthroderma otae CBS 113480]
          Length = 292

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/288 (62%), Positives = 229/288 (79%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L + ++L HEKS YQDVL+F+S+ +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEISDMWPGQAMNLRVNQILHHEKSKYQDVLVFESSDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLRE+ KH++V+E VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREIVKHDTVEEAVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M++GF +P   VH+ DGF+FL ++ N FD+IITD+SDP GPAE LFQ  YFE
Sbjct: 125 VSKKYLPGMSVGFQHPNAKVHVRDGFKFLEEQKNQFDVIITDSSDPEGPAEVLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  ALR GG+ISTQG E QWLHL +IT+++   RE++PVVEYAYTTIPTYPSGQIGF++
Sbjct: 185 LLHGALREGGVISTQGSENQWLHLSMITELKKLMREVFPVVEYAYTTIPTYPSGQIGFLV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
              D + N+++P+R W+ EEE+KLCRYYN +IH A+FILP F + AL+
Sbjct: 245 ACKDSERNVREPVRTWTREEEDKLCRYYNQEIHRASFILPNFARKALE 292



>gi|380483699|emb|CCF40459.1| spermidine synthase [Colletotrichum higginsianum]
          Length = 272

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/272 (66%), Positives = 227/272 (83%)

Query: 30  LWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHI 89
           +WPGQAM L++++V+ HEKS YQDVLIF+ST YG+VLVLD V+Q TERDEFSYQEMITH+
Sbjct: 1   MWPGQAMTLKVKKVVHHEKSQYQDVLIFESTDYGMVLVLDNVIQATERDEFSYQEMITHL 60

Query: 90  PMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDN 149
            MN H NP+ VLVI      VLREV KHE V+E +LCDIDE+VIRLSK++LP MA+GFD+
Sbjct: 61  AMNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEAVIRLSKQFLPNMAVGFDH 120

Query: 150 PKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQ 209
           PK   H+GDGF+FL +  N+FD+IITD+SDP GPAESLFQ  YF+L+ +ALR GG+I+TQ
Sbjct: 121 PKSKTHVGDGFKFLEEYKNTFDVIITDSSDPEGPAESLFQKPYFQLLHDALREGGVITTQ 180

Query: 210 GECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRKW 269
            E QWLH+ LI++++  C+E++PV EYAYTTIPTYPSGQIGF++C+ D   N+K+PLRKW
Sbjct: 181 AENQWLHMPLISKLKKDCKEIFPVAEYAYTTIPTYPSGQIGFMVCTKDANRNVKEPLRKW 240

Query: 270 SEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S EEEEKLC+YYNS+IH+A+FILP F K AL+
Sbjct: 241 SAEEEEKLCKYYNSEIHKASFILPNFAKKALE 272



>gi|392864754|gb|EAS27342.2| spermidine synthase [Coccidioides immitis RS]
          Length = 347

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/287 (62%), Positives = 225/287 (78%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L + ++L HEKS YQD+LIF+ST +G  LVLD V+QC
Sbjct: 61  THPTIKDGWFSEISDMWPGQAMTLRVNQILHHEKSKYQDILIFESTDHGTCLVLDNVIQC 120

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLRE+ KHESV+E +LCDIDE+VIR
Sbjct: 121 TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREIVKHESVEEAILCDIDEAVIR 180

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
            SKKYLP M+IGF +P V VHIGDGF+FL ++ N FD+IITD+SDP GPAE LFQ  YFE
Sbjct: 181 ASKKYLPGMSIGFQHPNVKVHIGDGFKFLEERKNEFDVIITDSSDPEGPAEVLFQKPYFE 240

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  +LR GG+ISTQ E QWLH+ LIT ++   +E++PVVEYAYT+IPTYPSGQIGF++ 
Sbjct: 241 LLYGSLREGGVISTQAENQWLHIKLITDLKKLMKEVFPVVEYAYTSIPTYPSGQIGFLVA 300

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             D   N+++P+R W+ EEE+KLCRYYN  IH A+F+LP F + AL+
Sbjct: 301 CKDPNRNIREPVRSWTREEEDKLCRYYNQDIHRASFVLPGFARKALE 347



>gi|449303042|gb|EMC99050.1| hypothetical protein BAUCODRAFT_65644 [Baudoinia compniacensis UAMH
           10762]
          Length = 292

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 183/288 (63%), Positives = 231/288 (80%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP IQDGWFRE   +WPGQAM L++ +++ HEKS YQDVLIF+S+ YG+VLVLD V+QC
Sbjct: 5   THPTIQDGWFREISDMWPGQAMTLKVNQIIHHEKSQYQDVLIFESSDYGMVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+ M  H NP+ VLVI      VLREV KHE V+E VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHLGMFAHPNPKRVLVIGGGDGGVLREVVKHECVEEAVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP M++GF +P V VH+GDGF+FL DK ++FD+IITD+SDP GPAESLFQ  YF+
Sbjct: 125 LSKKYLPGMSVGFQHPNVKVHVGDGFKFLEDKKDTFDVIITDSSDPEGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  ALR GG+I+TQG E  WLH+ LIT+++  C+E++PV EYA+TTIPTYPSGQIGF++
Sbjct: 185 LLHGALREGGVITTQGSENPWLHMKLITELKKSCKEVFPVAEYAWTTIPTYPSGQIGFMI 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           C  D   N+KKPLR  S EEE++  +YY+ Q+HEAAF+LP+F + AL+
Sbjct: 245 CCKDASRNVKKPLRSLSPEEEDQQFKYYSKQVHEAAFVLPKFAEKALR 292



>gi|494827049|gb|EON64065.1| spermidine synthase [Coniosporium apollinis CBS 100218]
          Length = 272

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/272 (66%), Positives = 222/272 (81%)

Query: 30  LWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHI 89
           +WPGQAM L++ +V+ HEKS YQDVLIF+S+ YG+VLVLD V+QCTERDEFSYQEMITH+
Sbjct: 1   MWPGQAMTLKVNQVIHHEKSKYQDVLIFESSDYGMVLVLDNVIQCTERDEFSYQEMITHL 60

Query: 90  PMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDN 149
            MN H NPENVLVI      VLREV KH  VK+ +LCDIDE+VIRLSKKYLP M++GF +
Sbjct: 61  AMNAHPNPENVLVIGGGDGGVLREVVKHSCVKKAILCDIDEAVIRLSKKYLPGMSVGFQH 120

Query: 150 PKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQ 209
           P V   +GDGF+FL D+ N FD+IITD+SDP GPAESLFQ  YFEL+  AL+ GG+I+TQ
Sbjct: 121 PAVETVVGDGFKFLADRKNEFDVIITDSSDPEGPAESLFQKPYFELLNGALKDGGVITTQ 180

Query: 210 GECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRKW 269
            E QWLH+ LI Q++  C+E++PVVEYAYTTIPTYPSGQIGF++C  D   N+KKPLR W
Sbjct: 181 AENQWLHMPLIAQLKKSCKEVFPVVEYAYTTIPTYPSGQIGFMVCCKDGSRNVKKPLRSW 240

Query: 270 SEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S+EEEEKLC+YY+ +IHEA+F+LP F + AL+
Sbjct: 241 SQEEEEKLCKYYSKEIHEASFVLPNFARKALR 272



>gi|406601419|emb|CCH46942.1| Spermidine synthase [Wickerhamomyces ciferrii]
          Length = 293

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/293 (63%), Positives = 229/293 (78%), Gaps = 1/293 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I+DGWFRE   T+WPGQAM L +E++L  EKSLYQDVL+FKST YG VLVL
Sbjct: 1   MSAELTHPTIKDGWFREISDTMWPGQAMSLRVEKILHVEKSLYQDVLVFKSTDYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEFSYQEMITH+ +N H NP+ VLVI      VLREV KHESV+E VLCDI
Sbjct: 61  DNVIQATERDEFSYQEMITHLALNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAVLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIR+SK+YLP+M+  + +PKV  HIGDGF+FL D  N+FD+IITD+SDP GPAESLF
Sbjct: 121 DEAVIRVSKEYLPEMSASYKHPKVKTHIGDGFKFLNDYKNTFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF+L+  AL   G+I+TQ E  WLHL +IT ++  C+E++PV EYAYTTIPTYPSGQ
Sbjct: 181 QKPYFQLLNEALTEKGVITTQAENIWLHLKIITDLKKACKEVFPVAEYAYTTIPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           IGF++CS D   N+K+PLR  S+E+E+KL RYYN +IH A+F+LP +   ALK
Sbjct: 241 IGFMVCSKDANANVKQPLRSVSKEDEDKLYRYYNKEIHSASFVLPTWAAKALK 293



>gi|429852193|gb|ELA27340.1| spermidine synthase [Colletotrichum gloeosporioides Nara gc5]
          Length = 273

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 181/273 (66%), Positives = 229/273 (83%), Gaps = 1/273 (0%)

Query: 30  LWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHI 89
           +WPGQAM L++++V+ HEKS YQDVLIF+ST +G+VLVLD V+QCTERDEFSYQEMITH+
Sbjct: 1   MWPGQAMTLKVKKVIHHEKSKYQDVLIFESTDHGMVLVLDNVIQCTERDEFSYQEMITHL 60

Query: 90  PMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDN 149
            MN H NP+ VLVI      VLREV KH++V+E +LCDIDE+VIRLSK++LP MA+GFD+
Sbjct: 61  AMNSHPNPKKVLVIGGGDGGVLREVVKHDTVEEAILCDIDEAVIRLSKQFLPGMAVGFDH 120

Query: 150 PKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQ 209
           PK   H+GDGF+FL +  N+FD+IITD+SDP GPAESLFQ  YF+L+ +ALR GG+I+TQ
Sbjct: 121 PKSKTHVGDGFKFLEEYKNTFDVIITDSSDPEGPAESLFQKPYFQLLHDALREGGVITTQ 180

Query: 210 G-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRK 268
           G E QWLHL LIT+++  C+E++PV EYAYTTIPTYPSGQIGF++C+ D   N+K+P+RK
Sbjct: 181 GSENQWLHLSLITKLKKDCKEIFPVAEYAYTTIPTYPSGQIGFMVCTKDANRNVKEPIRK 240

Query: 269 WSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           WS EEEEKLC+YYN+ IH+AAFILP F K AL+
Sbjct: 241 WSPEEEEKLCKYYNADIHKAAFILPNFAKKALE 273



>gi|303318439|ref|XP_003069219.1| spermidine synthase, putative [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240108905|gb|EER27074.1| spermidine synthase, putative [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 347

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/286 (62%), Positives = 224/286 (78%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+DGWF E   +WPGQAM L + ++L HEKS YQD+LIF+ST +G  LVLD V+QCT
Sbjct: 62  HPTIKDGWFSEISDMWPGQAMTLRVNQILHHEKSKYQDILIFESTDHGTCLVLDNVIQCT 121

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+ MN H NP+ VLVI      VLRE+ KHESV+E +LCDIDE+VIR 
Sbjct: 122 ERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREIVKHESVEEAILCDIDEAVIRA 181

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SKKYLP M+IGF +P V VHIGDGF+FL ++ N FD+IITD+SDP GPAE LFQ  YFEL
Sbjct: 182 SKKYLPGMSIGFQHPNVKVHIGDGFKFLEERKNEFDVIITDSSDPEGPAEVLFQKPYFEL 241

Query: 196 MKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCS 255
           +  +LR GG+ISTQ E QWLH+ LIT ++   +E++PVVEYAYT+IPTYPSGQIGF++  
Sbjct: 242 LYGSLREGGVISTQAENQWLHIKLITDLKKLMKEVFPVVEYAYTSIPTYPSGQIGFLVAC 301

Query: 256 IDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
            D   N+++P+R W+ EEE+KLCRYYN  IH A+F+LP F + AL+
Sbjct: 302 KDPTRNIREPVRSWTREEEDKLCRYYNQDIHRASFVLPGFARKALE 347



>gi|255716758|ref|XP_002554660.1| KLTH0F10560p [Lachancea thermotolerans]
 gi|238936043|emb|CAR24223.1| KLTH0F10560p [Lachancea thermotolerans CBS 6340]
          Length = 294

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/293 (63%), Positives = 229/293 (78%), Gaps = 1/293 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I+DGWFRE   T+WPGQAM L +E+VL HEKS YQDVLIFKST YG VLVL
Sbjct: 1   MSQEITHPTIKDGWFREISDTMWPGQAMTLRVEKVLHHEKSKYQDVLIFKSTDYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEFSYQEMI H+ +N H NP+ VLVI      VLRE+ KHESV+E  LCDI
Sbjct: 61  DNAIQVTERDEFSYQEMIAHLGLNSHPNPKKVLVIGGGDGGVLREIVKHESVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP+MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRLSKQYLPEMAASYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YFEL+ +AL   G+I+TQGE  WLHL +I +++  C E++P VEYAYTTIPTYPSGQ
Sbjct: 181 QKPYFELLSSALTEKGVITTQGESIWLHLPIIKELKKACSEVFPTVEYAYTTIPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           IGF++CS D  V++KKPLR+ S+EEE KL +YYN +IHEAAF+LP +    L+
Sbjct: 241 IGFMVCSKDGSVDVKKPLRQKSDEEEAKLYKYYNKKIHEAAFVLPTWAAKELE 293



>gi|365982711|ref|XP_003668189.1| hypothetical protein NDAI_0A07920 [Naumovozyma dairenensis CBS 421]
 gi|343766955|emb|CCD22946.1| hypothetical protein NDAI_0A07920 [Naumovozyma dairenensis CBS 421]
          Length = 294

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/294 (63%), Positives = 228/294 (77%), Gaps = 1/294 (0%)

Query: 9   LMSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLV 67
           + S   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST YG VLV
Sbjct: 1   MASQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLV 60

Query: 68  LDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCD 127
           LD V+Q TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHESV+E VLCD
Sbjct: 61  LDNVIQATERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAVLCD 120

Query: 128 IDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESL 187
           IDE+VIRLSK+YLP+MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+L
Sbjct: 121 IDEAVIRLSKEYLPEMAKSYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETL 180

Query: 188 FQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSG 247
           FQ  YFEL+  AL   G+I+TQ E  W+HL +I  ++  C E++PV EYAYTTIPTYPSG
Sbjct: 181 FQKSYFELLNGALTEKGVITTQAENMWIHLPVIKDLKKACSEVFPVAEYAYTTIPTYPSG 240

Query: 248 QIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
            IGF++CS D   N+KKPLR+ S+E+EEKL RYYN +IHEA+F+LP +    L+
Sbjct: 241 SIGFMVCSKDKDCNVKKPLREISDEDEEKLYRYYNKRIHEASFVLPTWVTKELR 294



>gi|116197943|ref|XP_001224783.1| spermidine synthase [Chaetomium globosum CBS 148.51]
 gi|88178406|gb|EAQ85874.1| spermidine synthase [Chaetomium globosum CBS 148.51]
          Length = 283

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/282 (65%), Positives = 229/282 (81%), Gaps = 1/282 (0%)

Query: 21  DGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEF 80
           +GWFRE   +WPGQAM L +++VL HEKS +QDVLIF+ST++G VLVLD V+QCTERDEF
Sbjct: 2   NGWFREISEMWPGQAMTLRVKKVLHHEKSKFQDVLIFESTNHGNVLVLDNVIQCTERDEF 61

Query: 81  SYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYL 140
           SYQEMITH+ MN H NP+ VLVI      VLREV KHE V+E  LCDIDE+VIRLSKKYL
Sbjct: 62  SYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHECVEEATLCDIDEAVIRLSKKYL 121

Query: 141 PKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNAL 200
           P M+ GF++ KV VHIGDGF+FL D  N+FD+IITD+SDP GPAESLFQ  YF+L+ +AL
Sbjct: 122 PHMSAGFNHSKVKVHIGDGFKFLDDYKNTFDVIITDSSDPEGPAESLFQKPYFKLLHDAL 181

Query: 201 RPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDK 259
           R GG+I+TQG E QWLHL LIT+++  C E++PV EYAYTTIPTYPSGQIGF++C  D  
Sbjct: 182 REGGVITTQGSENQWLHLPLITKLKKDCGEIFPVAEYAYTTIPTYPSGQIGFMVCCKDAN 241

Query: 260 VNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
            N+++P+R WS+EEE KLCRYYN+ IH+A+F+LP F + AL+
Sbjct: 242 RNVREPVRSWSKEEERKLCRYYNADIHKASFVLPTFAQEALE 283



>gi|119175541|ref|XP_001239979.1| hypothetical protein CIMG_09600 [Coccidioides immitis RS]
          Length = 292

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/288 (62%), Positives = 226/288 (78%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L + ++L HEKS YQD+LIF+ST +G  LVLD V+QC
Sbjct: 5   THPTIKDGWFSEISDMWPGQAMTLRVNQILHHEKSKYQDILIFESTDHGTCLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLRE+ KHESV+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREIVKHESVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
            SKKYLP M+IGF +P V VHIGDGF+FL ++ N FD+IITD+SDP GPAE LFQ  YFE
Sbjct: 125 ASKKYLPGMSIGFQHPNVKVHIGDGFKFLEERKNEFDVIITDSSDPEGPAEVLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  +LR GG+ISTQG E QWLH+ LIT ++   +E++PVVEYAYT+IPTYPSGQIGF++
Sbjct: 185 LLYGSLREGGVISTQGSENQWLHIKLITDLKKLMKEVFPVVEYAYTSIPTYPSGQIGFLV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
              D   N+++P+R W+ EEE+KLCRYYN  IH A+F+LP F + AL+
Sbjct: 245 ACKDPNRNIREPVRSWTREEEDKLCRYYNQDIHRASFVLPGFARKALE 292



>gi|320039089|gb|EFW21024.1| spermidine synthase [Coccidioides posadasii str. Silveira]
          Length = 292

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/288 (62%), Positives = 226/288 (78%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L + ++L HEKS YQD+LIF+ST +G  LVLD V+QC
Sbjct: 5   THPTIKDGWFSEISDMWPGQAMTLRVNQILHHEKSKYQDILIFESTDHGTCLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLRE+ KHESV+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREIVKHESVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
            SKKYLP M+IGF +P V VHIGDGF+FL ++ N FD+IITD+SDP GPAE LFQ  YFE
Sbjct: 125 ASKKYLPGMSIGFQHPNVKVHIGDGFKFLEERKNEFDVIITDSSDPEGPAEVLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+  +LR GG+ISTQG E QWLH+ LIT ++   +E++PVVEYAYT+IPTYPSGQIGF++
Sbjct: 185 LLYGSLREGGVISTQGSENQWLHIKLITDLKKLMKEVFPVVEYAYTSIPTYPSGQIGFLV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
              D   N+++P+R W+ EEE+KLCRYYN  IH A+F+LP F + AL+
Sbjct: 245 ACKDPTRNIREPVRSWTREEEDKLCRYYNQDIHRASFVLPGFARKALE 292



>gi|388854692|emb|CCF51585.1| probable chimeric spermidine synthase/saccharopine reductase
           [Ustilago hordei]
          Length = 769

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 231/295 (78%), Gaps = 8/295 (2%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           G  +HP I+DGWF E  + WPGQAM L+++ +L HE+SLYQDVL+F+ST +G VLVLDGV
Sbjct: 2   GVITHPNIRDGWFHETNSQWPGQAMSLQVQRILHHERSLYQDVLVFESTTFGNVLVLDGV 61

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +QCTERDEFSYQEMI H+P+  H NPE VLVI      VLREV KH+SVKE VLCDIDE+
Sbjct: 62  IQCTERDEFSYQEMIAHLPIASHPNPERVLVIGGGDGGVLREVVKHDSVKEAVLCDIDEA 121

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVN--SFDIIITDASDPVGPAESLFQ 189
           V R+SK+YLPKMA G  +PK TV IGDGF+FL+D  N  SFD+IITD+SDPVGPAE+LFQ
Sbjct: 122 VPRVSKQYLPKMAEGLTHPKSTVIIGDGFKFLQDPKNKASFDVIITDSSDPVGPAEALFQ 181

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF L+K AL+PGG ISTQ EC W+HL+LI +++   +EL+PV +YA+TTIPTYPSGQI
Sbjct: 182 QPYFALLKEALKPGGHISTQAECIWIHLNLIGELRRSTKELFPVADYAFTTIPTYPSGQI 241

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           GF++CS+D   N+++PLR+ S       CRYYNSQ+H+AAF +P+F +  ++  +
Sbjct: 242 GFVICSLDANRNVREPLREVSN------CRYYNSQVHKAAFTVPEFARKVIEDGA 290



>gi|366996717|ref|XP_003678121.1| hypothetical protein NCAS_0I01080 [Naumovozyma castellii CBS 4309]
 gi|342303992|emb|CCC71776.1| hypothetical protein NCAS_0I01080 [Naumovozyma castellii CBS 4309]
          Length = 293

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/293 (63%), Positives = 228/293 (77%), Gaps = 1/293 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVL
Sbjct: 1   MAQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE V+E VLCDI
Sbjct: 61  DNVIQATERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAVLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP+MA  +D+PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAESLF
Sbjct: 121 DEAVIRLSKEYLPEMAKSYDHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q +YFEL+  AL   G+I+TQ E  W+HL +I  ++  C E++PV EYAYTTIPTYPSG 
Sbjct: 181 QKEYFELLNGALTEKGVITTQAENMWIHLPVIKDLKKACSEVFPVAEYAYTTIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           IGF++CS D   N+KKPLR+ S+ +EE+L RYYN +IHEA+F+LP +    L+
Sbjct: 241 IGFMVCSKDKTCNVKKPLREISDADEERLYRYYNKRIHEASFVLPTWVTKELR 293



>gi|301620173|ref|XP_002939455.1| PREDICTED: spermidine synthase isoform X1 [Xenopus (Silurana)
           tropicalis]
          Length = 300

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 233/295 (78%), Gaps = 1/295 (0%)

Query: 7   RLLMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVL 66
           R    G      +QDGWFRE  +LWPGQAM LE+EEVL H++S +Q++L+F+S  YG VL
Sbjct: 3   RAFCRGANMEKPVQDGWFRETCSLWPGQAMSLEVEEVLYHKQSSFQEILVFRSKTYGNVL 62

Query: 67  VLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLC 126
           VLDG++QCTERDEFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C
Sbjct: 63  VLDGLIQCTERDEFSYQEMIANLPLYSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQC 122

Query: 127 DIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAES 186
           +IDE VI +SKKYLP MAIG+ +PK+T+H+GDGF+F++   ++FD+IITD+SDPVGPAES
Sbjct: 123 EIDEEVINVSKKYLPGMAIGYSSPKLTLHVGDGFQFMKQNQDAFDVIITDSSDPVGPAES 182

Query: 187 LFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPS 246
           LF+  Y++LMK ALR GGI+  QGECQWLHLDLI ++  +C+ L+PVVEYAY TIPTYPS
Sbjct: 183 LFKESYYQLMKTALREGGILCCQGECQWLHLDLIKEMHQFCKTLFPVVEYAYCTIPTYPS 242

Query: 247 GQIGFILCSIDDKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
           GQIGF+LCS D   N K+P+++ S+E+ +K+  RYYNS+IH+AAF+LP+FT+ AL
Sbjct: 243 GQIGFMLCSKDPSTNFKEPVQQLSQEQVDKMNLRYYNSRIHQAAFVLPEFTRKAL 297



>gi|156843587|ref|XP_001644860.1| hypothetical protein Kpol_1065p17 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115512|gb|EDO17002.1| hypothetical protein Kpol_1065p17 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 293

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/292 (64%), Positives = 225/292 (77%), Gaps = 1/292 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVL
Sbjct: 1   MSQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHESV+E  LCDI
Sbjct: 61  DNVIQATERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAESLF
Sbjct: 121 DEAVIRLSKEYLPDMAKAYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YFEL+ +AL   G+I+TQ E  W+HL +I  ++  C E++PV EYAYTTIPTYPSGQ
Sbjct: 181 QKAYFELLSSALTEKGVITTQAESMWIHLPIIKDLKKACGEVFPVAEYAYTTIPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           IGF++CS D   N+KKP+R+ SEE+E +L RYYN +IHE +F+LP +    L
Sbjct: 241 IGFMVCSKDKSANVKKPIREISEEKERELYRYYNKRIHETSFVLPTWVDKEL 292



>gi|19112807|ref|NP_596015.1| spermidine synthase (predicted) [Schizosaccharomyces pombe 972h-]
 gi|1174417|sp|Q09741.1|SPEE_SCHPO RecName: Full=Spermidine synthase; Short=SPDSY; AltName:
           Full=Putrescine aminopropyltransferase
 gi|984695|emb|CAA90820.1| spermidine synthase (predicted) [Schizosaccharomyces pombe]
          Length = 298

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 176/290 (60%), Positives = 229/290 (78%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I+DGWFRE   +WPGQAM L++++VL   KS YQDVL+F+S  YG VLVLDG +Q 
Sbjct: 7   SHPLIKDGWFREINNMWPGQAMTLKVKKVLYAGKSKYQDVLVFESETYGHVLVLDGAIQA 66

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+ +N H NP+ VLVI      VLREV KHE V+E +LCDIDE VI+
Sbjct: 67  TERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEDVIK 126

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP+M+ GF++PKV VHIGDGF+FL+D  N+FD+IITD+SDP GPAE+LFQ  YF+
Sbjct: 127 VSKQYLPEMSAGFNHPKVKVHIGDGFKFLQDYQNTFDVIITDSSDPDGPAEALFQKPYFQ 186

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +ALR GG+I+TQ EC W+HL +I+ V +  + ++P V YAYTTIPTYPSG IGF++ 
Sbjct: 187 LLSDALRGGGVITTQAECMWIHLGVISNVLTAVKTVFPNVRYAYTTIPTYPSGSIGFVVA 246

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           S D  ++L KPLRKWS EEE KLC+YYNS+IH A+F+LP F ++ + +++
Sbjct: 247 SKDASIDLSKPLRKWSPEEENKLCKYYNSEIHAASFVLPTFARDVVDKAT 296



>gi|475665574|gb|EMT63366.1| Spermidine synthase [Fusarium oxysporum f. sp. cubense race 4]
          Length = 295

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/295 (61%), Positives = 231/295 (78%), Gaps = 2/295 (0%)

Query: 9   LMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           + S   +HP I+DGWFRE   +WPG AM L +E+VL HEKS YQDVLIFKST +G VLVL
Sbjct: 1   MSSEEITHPTIKDGWFREISDMWPGHAMTLRVEKVLVHEKSKYQDVLIFKSTDFGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+QCTERDEFSYQEMI H+ +N H NP+ VLVI      VLRE+ KH+ V+E  LCDI
Sbjct: 61  DNVIQCTERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREIVKHDCVEEATLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+V+RLSK++LP MA GFD+PK   HIGDGF+FL D  N FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVVRLSKEHLPSMACGFDHPKSKTHIGDGFKFLNDYKNEFDVIITDSSDPDGPAEALF 180

Query: 189 QVKYFE-LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPS 246
           Q  YF+ L+  ALR GG+I+TQG E  WLHL LIT+++  C+ ++PV EYAYTTIPTYPS
Sbjct: 181 QKSYFQLLLHGALREGGVITTQGSESPWLHLPLITRLKKDCQAIFPVAEYAYTTIPTYPS 240

Query: 247 GQIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           GQIGF++CS D K ++K PLR W++EEE+  CRYY+++IH+A+F+LP+F + AL+
Sbjct: 241 GQIGFMVCSKDPKADVKTPLRSWTKEEEDAKCRYYSAEIHKASFVLPKFAQKALE 295



>gi|500251712|gb|EON95606.1| putative spermidine synthase protein [Togninia minima UCRPA7]
          Length = 273

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/273 (68%), Positives = 224/273 (82%), Gaps = 1/273 (0%)

Query: 30  LWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHI 89
           +WPGQAM L++++VL HEKS YQDVLIF+ST YG VLVLD V+QCTERDEFSYQEMITH+
Sbjct: 1   MWPGQAMTLKVKKVLHHEKSKYQDVLIFESTDYGTVLVLDNVIQCTERDEFSYQEMITHL 60

Query: 90  PMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDN 149
            MN H +P+ VLVI      VLREV KHE V+E  LCDIDE+VIRLSK+YLP MA GF +
Sbjct: 61  AMNSHPDPKKVLVIGGGDGGVLREVVKHECVEEATLCDIDEAVIRLSKQYLPGMAEGFKH 120

Query: 150 PKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQ 209
           PKV VH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ  YF+L+ +ALR GG+I+TQ
Sbjct: 121 PKVKVHVGDGFKFLDDYKNTFDVIITDSSDPEGPAESLFQKPYFKLLHDALREGGVITTQ 180

Query: 210 G-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRK 268
           G E QWLHL LIT+++  C+E++PV EYAYTTIPTYPSGQIGF++C+ D   NLK P+R 
Sbjct: 181 GSENQWLHLPLITKLKKDCKEIFPVAEYAYTTIPTYPSGQIGFMVCTKDANRNLKVPVRS 240

Query: 269 WSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           W+ EEEEKLCRYYNS+IH+A+FILP F   ALK
Sbjct: 241 WTPEEEEKLCRYYNSEIHKASFILPTFAAKALK 273



>gi|213409616|ref|XP_002175578.1| spermidine synthase [Schizosaccharomyces japonicus yFS275]
 gi|212003625|gb|EEB09285.1| spermidine synthase [Schizosaccharomyces japonicus yFS275]
          Length = 300

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 173/289 (59%), Positives = 223/289 (77%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE   +WPGQAM L++++VL  ++S +QDVLIF+S  YG VLVLDGV+Q 
Sbjct: 9   THPSIKDGWFREINKMWPGQAMTLKVKKVLHAKRSKFQDVLIFESETYGRVLVLDGVIQA 68

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+ +N H+NP+ VLVI      VLREV KHESV+E+VLCDID  VI 
Sbjct: 69  TERDEFSYQEMIAHLALNSHANPKKVLVIGGGDGGVLREVVKHESVEEVVLCDIDADVID 128

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
            SKK++P MA+G+++PKV  H+GDGF+FL+D  N+FD+IITD+SDP GPAE+LF+  YF+
Sbjct: 129 YSKKFIPSMAVGYEHPKVKTHVGDGFQFLKDYTNTFDVIITDSSDPDGPAEALFEAPYFQ 188

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  ALR  G+I+TQ EC WLHL +I  V    R+ +P V YAYTTIPTYPSG IGF++ 
Sbjct: 189 LLHGALRENGVITTQAECMWLHLSVIENVLKAARKAFPNVRYAYTTIPTYPSGSIGFVVA 248

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           S +  ++L KPLR W+ EEE KLCRYYN +IHEAAFILP F +  + ++
Sbjct: 249 SKNTAIDLSKPLRTWTAEEEAKLCRYYNKEIHEAAFILPNFARAVVNKA 297



>gi|261190484|ref|XP_002621651.1| spermidine synthase [Ajellomyces dermatitidis SLH14081]
 gi|239591074|gb|EEQ73655.1| spermidine synthase [Ajellomyces dermatitidis SLH14081]
 gi|239614764|gb|EEQ91751.1| spermidine synthase [Ajellomyces dermatitidis ER-3]
          Length = 273

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 176/271 (64%), Positives = 221/271 (81%)

Query: 30  LWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHI 89
           +WPGQA+ L++ ++L HEKS YQDVL+F+S+ +G VLVLD V+QCTERDEFSYQEMITH+
Sbjct: 1   MWPGQALTLKVNQILHHEKSKYQDVLVFESSDHGTVLVLDNVIQCTERDEFSYQEMITHL 60

Query: 90  PMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDN 149
            MN H NP+ VLVI      VLREV KHESV+E VLCDIDE+VIR+SKKYLP M++GF +
Sbjct: 61  AMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAVLCDIDEAVIRVSKKYLPGMSVGFQH 120

Query: 150 PKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQ 209
           P VTVH+ DGF+FL D+ N FD+IITD+SDP GPAE+LFQ  YFEL+ NALR GG+++TQ
Sbjct: 121 PNVTVHVADGFKFLADRKNEFDVIITDSSDPEGPAEALFQKPYFELLFNALREGGVVTTQ 180

Query: 210 GECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRKW 269
            E QWLHL LIT ++   RE++PVVEYAYTTIPTYPSGQIGF++C  D   ++++P+R W
Sbjct: 181 AENQWLHLSLITDLKRSIREIFPVVEYAYTTIPTYPSGQIGFMVCCKDKDRDVREPVRSW 240

Query: 270 SEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           + EEEEKLCRYYN +IH A+F+LP F + AL
Sbjct: 241 TREEEEKLCRYYNKEIHRASFVLPNFARKAL 271



>gi|444322638|ref|XP_004181960.1| hypothetical protein TBLA_0H01540 [Tetrapisispora blattae CBS 6284]
 gi|387515006|emb|CCH62441.1| hypothetical protein TBLA_0H01540 [Tetrapisispora blattae CBS 6284]
          Length = 295

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/292 (63%), Positives = 224/292 (76%), Gaps = 1/292 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVL
Sbjct: 1   MANQITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTDYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEFSYQEMITH+ +N H NP+ VLVI      VLREV KHESV+E  +C+I
Sbjct: 61  DNVIQATERDEFSYQEMITHLGLNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAWICEI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP+MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRLSKEYLPEMAASYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YFEL++ AL   G+I+TQ E  WLHL +I  ++  C E++PV EYAYTTIPTYPSGQ
Sbjct: 181 QKAYFELLRGALTEKGVITTQAESMWLHLPIIKDLKKACSEVFPVAEYAYTTIPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           IGF++CS D   N+KKPLR+  E  EEKL RYYN +IHE +F+LP +    L
Sbjct: 241 IGFMVCSKDKNANVKKPLRELPEATEEKLYRYYNKKIHETSFVLPTWVDKEL 292



>gi|46137467|ref|XP_390425.1| SPEE_NEUCR Spermidine synthase (Putrescine aminopropyltransferase)
           (SPDSY) [Fusarium graminearum PH-1]
 gi|408396997|gb|EKJ76148.1| hypothetical protein FPSE_03623 [Fusarium pseudograminearum CS3096]
          Length = 294

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/288 (62%), Positives = 226/288 (78%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I DGWFRE   +WPG AM L +E+VL HEKS YQDVLIFKST +G VLVLD V+QC
Sbjct: 7   THPTIVDGWFREISDMWPGHAMTLRVEKVLVHEKSKYQDVLIFKSTDFGNVLVLDNVIQC 66

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+ +N H NP+ VLVI      VLRE+ KH+ V+E  LCDIDE+VIR
Sbjct: 67  TERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREIVKHDCVEEATLCDIDEAVIR 126

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSK++LP MA GFD+PK   H+GDGF+FL D  N FD+IITD+SDP GPAE+LFQ  YF+
Sbjct: 127 LSKEHLPSMACGFDHPKSKTHVGDGFKFLNDYKNEFDVIITDSSDPDGPAEALFQKSYFQ 186

Query: 195 LMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           L+ +ALR GG+I+TQG E  WLHL LI +++  C  ++PV EYAYTTIPTYPSGQIGF++
Sbjct: 187 LLHDALREGGVITTQGSESPWLHLPLIARLKKDCGAIFPVAEYAYTTIPTYPSGQIGFMV 246

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           CS D K ++K P+R W++EEE++  RYY+S+IH+A+F+LP+F   AL+
Sbjct: 247 CSKDPKADVKNPIRSWTKEEEDEKLRYYSSEIHKASFVLPKFAAKALE 294



>gi|366998257|ref|XP_003683865.1| hypothetical protein TPHA_0A03550 [Tetrapisispora phaffii CBS 4417]
 gi|357522160|emb|CCE61431.1| hypothetical protein TPHA_0A03550 [Tetrapisispora phaffii CBS 4417]
          Length = 294

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/294 (63%), Positives = 226/294 (76%), Gaps = 1/294 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVL
Sbjct: 1   MSQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHESV+E  LCDI
Sbjct: 61  DNVIQVTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP+M+  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRLSKEYLPEMSSVYSHPKVRTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YFEL+ +AL   G+ISTQ E  WLHL +I  ++  C E++PV EYAYTTIPTYPSGQ
Sbjct: 181 QKSYFELLNSALTEKGVISTQAESMWLHLPIIKDLKKACGEVFPVAEYAYTTIPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           IGF++CS D   N+KKPLR+ S E+E +L RYYN +IHE +F+LP +    L +
Sbjct: 241 IGFMICSKDKNANVKKPLREISNEKELELYRYYNKRIHETSFVLPTWVGKELNQ 294



>gi|71023471|ref|XP_761965.1| hypothetical protein UM05818.1 [Ustilago maydis 521]
 gi|46101530|gb|EAK86763.1| hypothetical protein UM05818.1 [Ustilago maydis 521]
 gi|224174752|emb|CAX51128.1| spermidine synthase-saccharopine dehydrogenase [Ustilago maydis]
          Length = 769

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 229/295 (77%), Gaps = 8/295 (2%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           G  +HP I+DGWF E  + WPGQAM LE++ +L HEKSL+QDVL+F+ST +G VLVLDGV
Sbjct: 2   GVITHPNIRDGWFHETNSQWPGQAMSLEVQRILHHEKSLFQDVLVFESTTFGNVLVLDGV 61

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +QCTERDEFSYQEMI H+P+  H NPE VLVI      VLREV KH+SVKE VLCDIDE+
Sbjct: 62  IQCTERDEFSYQEMIAHLPIASHPNPERVLVIGGGDGGVLREVVKHDSVKEAVLCDIDEA 121

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVN--SFDIIITDASDPVGPAESLFQ 189
           V R+SK+YLP MA G  +PK TV IGDGF FL+D  N  SFD+IITD+SDPVGPAE+LFQ
Sbjct: 122 VPRVSKQYLPHMAEGLTHPKSTVIIGDGFAFLQDPKNKASFDVIITDSSDPVGPAEALFQ 181

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF L+K AL+PGG ISTQ EC W+HL+LI +++   +EL+PV +YA+TTIPTYPSGQI
Sbjct: 182 QPYFALLKEALKPGGHISTQAECVWIHLNLIGELRRSTKELFPVADYAFTTIPTYPSGQI 241

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           GF++CS+D   N+++PLR+  +      CRYYNSQ+H+AAF +P+F +  ++  +
Sbjct: 242 GFVVCSLDANRNVREPLREVPD------CRYYNSQVHKAAFTVPEFARKVIEDGA 290



>gi|512853315|ref|XP_004916086.1| PREDICTED: spermidine synthase isoform X2 [Xenopus (Silurana)
           tropicalis]
          Length = 317

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 231/292 (79%), Gaps = 1/292 (0%)

Query: 7   RLLMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVL 66
           R    G      +QDGWFRE  +LWPGQAM LE+EEVL H++S +Q++L+F+S  YG VL
Sbjct: 3   RAFCRGANMEKPVQDGWFRETCSLWPGQAMSLEVEEVLYHKQSSFQEILVFRSKTYGNVL 62

Query: 67  VLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLC 126
           VLDG++QCTERDEFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C
Sbjct: 63  VLDGLIQCTERDEFSYQEMIANLPLYSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQC 122

Query: 127 DIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAES 186
           +IDE VI +SKKYLP MAIG+ +PK+T+H+GDGF+F++   ++FD+IITD+SDPVGPAES
Sbjct: 123 EIDEEVINVSKKYLPGMAIGYSSPKLTLHVGDGFQFMKQNQDAFDVIITDSSDPVGPAES 182

Query: 187 LFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPS 246
           LF+  Y++LMK ALR GGI+  QGECQWLHLDLI ++  +C+ L+PVVEYAY TIPTYPS
Sbjct: 183 LFKESYYQLMKTALREGGILCCQGECQWLHLDLIKEMHQFCKTLFPVVEYAYCTIPTYPS 242

Query: 247 GQIGFILCSIDDKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTK 297
           GQIGF+LCS D   N K+P+++ S+E+ +K+  RYYNS+IH+AAF+LP+FT+
Sbjct: 243 GQIGFMLCSKDPSTNFKEPVQQLSQEQVDKMNLRYYNSRIHQAAFVLPEFTR 294



>gi|326476682|gb|EGE00692.1| spermidine synthase [Trichophyton tonsurans CBS 112818]
 gi|326485311|gb|EGE09321.1| spermidine synthase [Trichophyton equinum CBS 127.97]
          Length = 288

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/287 (62%), Positives = 227/287 (79%), Gaps = 3/287 (1%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E   +WPGQAM L + ++L HEKS YQDVL+F+S+ +G VLVLD V+QC
Sbjct: 5   THPTIKDGWFSEVSDMWPGQAMNLRVNQILHHEKSDYQDVLVFESSDHGTVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+ MN H NP+ VLVI      VLRE+ KH++V+E VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREIVKHDTVEEAVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP M++GF +P   V++ DGF+FL ++ N FD+IITD+SDP GPAE LFQ  YFE
Sbjct: 125 VSKKYLPGMSVGFQHPNAKVYVRDGFKFLEEQKNQFDVIITDSSDPEGPAEVLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  ALR GG+I+   E QWLHL +IT+++   RE++PVVEYAYTTIPTYPSGQIGF++ 
Sbjct: 185 LLHGALREGGVIT---ENQWLHLSMITELKKLMREVFPVVEYAYTTIPTYPSGQIGFLVA 241

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             D + N+++PLRKWS EEE+KLCRYYN +IH A+FILP F + AL+
Sbjct: 242 CKDAERNVREPLRKWSREEEDKLCRYYNQEIHRASFILPNFARKALE 288



>gi|50286095|ref|XP_445476.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524781|emb|CAG58387.1| unnamed protein product [Candida glabrata]
          Length = 293

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 183/288 (63%), Positives = 226/288 (78%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST+YG VLVLD V+Q
Sbjct: 5   THPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTNYGNVLVLDNVIQ 64

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHE V+E  LCDIDE+VI
Sbjct: 65  ATERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAWLCDIDEAVI 124

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
           RLSK+YLP MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LFQ  YF
Sbjct: 125 RLSKEYLPDMAGVYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLFQQSYF 184

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           EL+++AL   G+I+TQ E  WLHL +I  ++  C +++PV EYAYTTIPTYPSG IGF++
Sbjct: 185 ELLRSALTDKGVITTQAESMWLHLPIIKDLKKACSQVFPVAEYAYTTIPTYPSGTIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           CS D   N+KKPLR+ +EE+E+KL RYYN +IHE++F+LP +    L+
Sbjct: 245 CSKDASANVKKPLREMTEEQEKKLLRYYNKRIHESSFVLPTWVAKELE 292



>gi|343427335|emb|CBQ70862.1| probable chimeric spermidine synthase/saccharopine reductase
           [Sporisorium reilianum SRZ2]
          Length = 769

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/295 (60%), Positives = 227/295 (76%), Gaps = 8/295 (2%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           G  +HP I+DGWF E  + WPGQAM LE++ +L HEKSL+QDVL+F+ST +G VLVLDGV
Sbjct: 2   GVITHPNIRDGWFHETNSQWPGQAMSLEVQRILHHEKSLFQDVLVFESTTFGNVLVLDGV 61

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +QCTERDEFSYQEMI H+P+  H NPE VLVI      VLREV KH+SVKE VLCDIDE+
Sbjct: 62  IQCTERDEFSYQEMIAHLPIASHPNPERVLVIGGGDGGVLREVVKHDSVKEAVLCDIDEA 121

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVN--SFDIIITDASDPVGPAESLFQ 189
           V R+SK+YLP MA G  +PK TV IGDGF FL D  N  SFD+IITD+SDPVGPAE+LFQ
Sbjct: 122 VPRVSKQYLPNMAQGLTHPKSTVIIGDGFAFLEDPKNKASFDVIITDSSDPVGPAEALFQ 181

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF L+K AL+PGG ISTQ EC W+HL+LI +++   +EL+PV +YA+TTIPTYPSGQI
Sbjct: 182 QPYFALLKQALKPGGHISTQAECVWIHLNLIGELRRSTKELFPVADYAFTTIPTYPSGQI 241

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           GF++CS+D   N+++PLR+  +      CRYYNS +H+AAF +P+F +  ++  +
Sbjct: 242 GFVVCSLDANRNVREPLREVPD------CRYYNSHVHKAAFTVPEFARKVIEDGA 290



>gi|346326304|gb|EGX95900.1| spermidine synthase [Cordyceps militaris CM01]
          Length = 327

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/290 (63%), Positives = 229/290 (78%), Gaps = 8/290 (2%)

Query: 20  QDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDE 79
           +DGWFRE   +WPGQAM L++E+VL HEKS YQDVL+FKST YG VLVLD V+QCTERDE
Sbjct: 38  KDGWFREISHMWPGQAMTLKVEKVLHHEKSKYQDVLVFKSTDYGHVLVLDNVIQCTERDE 97

Query: 80  FSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDE-------SV 132
           FSYQEMITH+ MN H NP+ VLVI      VLREV KH+ V+E +LCDIDE       +V
Sbjct: 98  FSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDELTPSPNQAV 157

Query: 133 IRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKY 192
            R+SK++LP+MA G  + K TVHIGDGF+FL D  N+FD+IITD+SDP GPAESLFQ  Y
Sbjct: 158 PRVSKQFLPEMATGLTHAKSTVHIGDGFKFLDDYKNTFDVIITDSSDPDGPAESLFQKPY 217

Query: 193 FELMKNALRPGGIISTQG-ECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGF 251
           F+L+ +ALR GG+I+TQG E QWLHL LITQ++  C+E++PVVEYAYTTIPTYPSGQIGF
Sbjct: 218 FQLLHDALREGGVITTQGSENQWLHLALITQLKKDCKEIFPVVEYAYTTIPTYPSGQIGF 277

Query: 252 ILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           ++CS D   ++K P+R W+  EEE  CRYYN++IH+A+F+LP F K AL+
Sbjct: 278 MVCSKDASRDVKVPVRSWTPAEEEAKCRYYNAEIHKASFVLPNFAKKALQ 327



>gi|443894911|dbj|GAC72257.1| lysine-ketoglutarate reductase [Pseudozyma antarctica T-34]
          Length = 769

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/295 (59%), Positives = 230/295 (77%), Gaps = 8/295 (2%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           G  +HP I+DGWF E  + WPGQAM L+++ +L HEKSL+QDVL+F+ST +G VLVLDGV
Sbjct: 2   GVITHPNIRDGWFHETNSQWPGQAMSLQVQRILHHEKSLFQDVLVFESTTFGNVLVLDGV 61

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +QCTERDEFSYQEMI H+P+  H NPE VLVI      VLREV KH+SVKE +LCDIDE+
Sbjct: 62  IQCTERDEFSYQEMIAHLPIASHPNPERVLVIGGGDGGVLREVVKHDSVKEAILCDIDEA 121

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVN--SFDIIITDASDPVGPAESLFQ 189
           V R+S++YLPKMA G ++PK  V IGDGF FL+D  N  SFD+IITD+SDPVGPAE LFQ
Sbjct: 122 VPRVSQQYLPKMAEGLNHPKSKVIIGDGFAFLKDPKNKASFDVIITDSSDPVGPAEVLFQ 181

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF L+K AL+PGG ISTQ EC W+HL+LI +++   +EL+PV +YA+TTIPTYPSGQI
Sbjct: 182 QPYFALLKEALKPGGHISTQAECVWIHLNLIGELRRSTKELFPVADYAFTTIPTYPSGQI 241

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           GF++CS+D   N+++PLR+  +      CRYYNS++H+A+FI+P+F +  ++  +
Sbjct: 242 GFVVCSLDANRNVREPLRQVPD------CRYYNSEVHKASFIVPEFARKVIEEGA 290



>gi|296421657|ref|XP_002840381.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636596|emb|CAZ84572.1| unnamed protein product [Tuber melanosporum]
          Length = 280

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 219/286 (76%), Gaps = 11/286 (3%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP IQDGWFRE   +WPGQAM L +++VL HEKS YQDVLIF+ST YG VLVLD V+QCT
Sbjct: 6   HPTIQDGWFREVSEMWPGQAMTLRVKKVLHHEKSKYQDVLIFESTDYGNVLVLDNVIQCT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEF+YQEMITH+ MN H NP+ VLVI      VLREV KHE            +VIRL
Sbjct: 66  ERDEFAYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHEC-----------AVIRL 114

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK+YLP M+ GFD+PK  VH+GDGF+FL D  N FD+IITD+SDP GPAESLFQ  YFEL
Sbjct: 115 SKQYLPHMSKGFDHPKSKVHVGDGFKFLEDYKNEFDVIITDSSDPEGPAESLFQKPYFEL 174

Query: 196 MKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCS 255
           +  AL+ GG+I+TQ E QWLHL LIT ++  CRE++PVVEYAYTTIPTYPSGQIGF++CS
Sbjct: 175 LFGALKEGGVITTQAENQWLHLQLITDLKKSCREVFPVVEYAYTTIPTYPSGQIGFMVCS 234

Query: 256 IDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
            D   ++ KPLR  S+EEE+K+ RYYN +IHEA+F+LP F   ALK
Sbjct: 235 KDANRDVSKPLRTVSDEEEQKMYRYYNKRIHEASFVLPTFAAAALK 280



>gi|147902014|ref|NP_001084875.1| spermidine synthase [Xenopus laevis]
 gi|47123853|gb|AAH70692.1| MGC83147 protein [Xenopus laevis]
          Length = 290

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 174/283 (61%), Positives = 228/283 (80%), Gaps = 1/283 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           +QDGWFRE  +LWPGQA+ LE+EEVL H++S +Q++L+ +S  YG VLVLDG++QCTERD
Sbjct: 5   VQDGWFRETCSLWPGQALSLEVEEVLYHQRSPFQEILVLRSKTYGNVLVLDGLIQCTERD 64

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI +SKK
Sbjct: 65  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEEVINVSKK 124

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP MAIG+ +PK+T+H+GDGF+F++   ++FDIIITD+SDPVGPAESLF+  Y++LMK 
Sbjct: 125 YLPGMAIGYSSPKLTLHVGDGFQFMKQNQDAFDIIITDSSDPVGPAESLFKESYYQLMKT 184

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           ALR GGI+  QGECQWLHLDLI ++  +C+ L+PVVEYAY TIPTYPSGQIGF+LCS + 
Sbjct: 185 ALREGGILCCQGECQWLHLDLIKEMNQFCKTLFPVVEYAYCTIPTYPSGQIGFMLCSKNP 244

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
             N K+P+++ S+E+ +K+  RYYNS IH AAF+LP+FT+ AL
Sbjct: 245 STNFKEPVQQLSQEQVDKMNLRYYNSSIHRAAFVLPEFTRKAL 287



>gi|453089685|gb|EMF17725.1| spermine synthase [Mycosphaerella populorum SO2202]
          Length = 292

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 175/287 (60%), Positives = 224/287 (78%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I DGWFRE   +WPGQAM L++ +V+ HEKS YQDVLIF+S+ YG+VLVLD V+QC
Sbjct: 5   THPTIVDGWFREINHMWPGQAMTLKVNQVVHHEKSKYQDVLIFESSDYGMVLVLDNVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+ +  H NP  VLVI      VLREV KH SV+E +LCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHLALFSHPNPRKVLVIGGGDGGVLREVVKHPSVEEAILCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           LSKKYLP MA+GF++PK   H+GDGF+FL D  N FD+IITD+SDP GPAE+LFQ  YF+
Sbjct: 125 LSKKYLPGMAVGFNHPKCKTHVGDGFKFLDDYKNEFDVIITDSSDPDGPAEALFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +ALR GG+ISTQ E  WLHL +I Q++  C+ ++PV EY +TTIPTYPSGQIGF++C
Sbjct: 185 LLHDALREGGVISTQAENPWLHLSIIQQLKKDCKSVFPVAEYGWTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           + D   ++ KPLR   + EE+KL +YY+ ++HEAAF+LP+F + AL+
Sbjct: 245 TKDASRDVTKPLRTLDDAEEDKLFKYYSKKVHEAAFVLPKFAEKALR 291



>gi|410078940|ref|XP_003957051.1| hypothetical protein KAFR_0D02680 [Kazachstania africana CBS 2517]
 gi|372463636|emb|CCF57916.1| hypothetical protein KAFR_0D02680 [Kazachstania africana CBS 2517]
          Length = 294

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/288 (61%), Positives = 226/288 (78%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVL+FKST YG VLVLD  +Q
Sbjct: 7   THPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLVFKSTDYGNVLVLDNAIQ 66

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMITH+ MN H NP+ VLVI      VLREV KHESV+E VLCDIDE+VI
Sbjct: 67  VTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAVLCDIDEAVI 126

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
           RLSKKYLP+++  +D+PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAESLFQ  YF
Sbjct: 127 RLSKKYLPELSKSYDHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAESLFQKPYF 186

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           +L+ +AL   G+I+TQ E  W+HL +I  ++  C +++PV EYA+T+IPTYP+G IGF++
Sbjct: 187 QLLNDALTENGVITTQAESFWVHLPIIKNLKKACSDVFPVAEYAWTSIPTYPTGMIGFMV 246

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           CS D   N+KKPLR+ S+EEE++  RYY+ ++HEAAF+LP +    L+
Sbjct: 247 CSKDKSANVKKPLREISDEEEKEKYRYYSKKVHEAAFVLPTWVAKELQ 294



>gi|328766899|gb|EGF76951.1| hypothetical protein BATDEDRAFT_20923 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 289

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 173/285 (60%), Positives = 223/285 (78%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           HP I+  WF+E   LWPGQAM L+++E+L HEKSLYQDVL+F+STH+G VLVLDGV+Q T
Sbjct: 3   HPNIEGDWFKETTALWPGQAMTLQVKEILHHEKSLYQDVLVFESTHHGNVLVLDGVIQAT 62

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMI H+P+N H NP+ VLVI      VLREV KH+ V+ + L +IDE+VI+ 
Sbjct: 63  ERDEFSYQEMIAHLPLNAHPNPKQVLVIGGGDGGVLREVVKHDCVEHVTLVEIDEAVIKA 122

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK++LP MA GF +PKVTVH+GDGFE+L+   +++D+IITD+SDPVGPAE+LFQ  +++L
Sbjct: 123 SKQFLPAMAAGFQHPKVTVHVGDGFEYLKSHSHAYDVIITDSSDPVGPAEALFQESFYDL 182

Query: 196 MKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCS 255
           M+ +L PGGII TQGECQWLHL LI  V    R++YPVVEYA+ ++PTYP GQIGFILC 
Sbjct: 183 MRQSLLPGGIICTQGECQWLHLPLIKTVLDASRKIYPVVEYAWASVPTYPCGQIGFILCC 242

Query: 256 IDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
            +   +LK P R++ ++ E    +YYNS +H AAF+LPQFT NAL
Sbjct: 243 NEAGRSLKVPARQFPKDFERANLKYYNSDVHSAAFVLPQFTNNAL 287



>gi|501754003|emb|CCG82478.1| Spermidine synthase [Taphrina deformans PYCC 5710]
          Length = 293

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/285 (61%), Positives = 218/285 (76%), Gaps = 1/285 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           +H  ++DGWF E   T+WPGQ   L++EE+L  +KSLYQDVL+F+S+ YG VLVLDG +Q
Sbjct: 4   THALVKDGWFHEISGTMWPGQHFSLKVEEILYAQKSLYQDVLVFRSSTYGNVLVLDGAIQ 63

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMIT++ M  H NP+ VLVI      VLREV KHE V+  VLCDID  VI
Sbjct: 64  VTERDEFSYQEMITNLAMMSHPNPKKVLVIGGGDGGVLREVVKHECVESAVLCDIDADVI 123

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
           ++SK+YLP MA G  +PK TVH+GDGF+FL D  N+FD+IITD+SDP GPAESLFQ  YF
Sbjct: 124 KVSKEYLPNMATGLTHPKSTVHVGDGFKFLDDYKNTFDVIITDSSDPEGPAESLFQKPYF 183

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           +L+ +ALR GG I+TQ ECQWLHL +I  +++ C  ++P V YA+TTIPTYPSGQIGF++
Sbjct: 184 QLLHDALREGGCITTQAECQWLHLKVIKDLKATCSAIFPNVRYAFTTIPTYPSGQIGFMV 243

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKN 298
           CS D    L KPLR W+ EEE+K CRYYN ++H AAF+LPQF KN
Sbjct: 244 CSKDKTATLNKPLRSWTPEEEQKYCRYYNKEVHAAAFVLPQFMKN 288



>gi|498998391|ref|XP_004554226.1| PREDICTED: spermidine synthase-like [Maylandia zebra]
          Length = 289

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 231/287 (80%), Gaps = 1/287 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
            I+DGWF E  TLWPGQAM L++EEVL H+KS +QDV++FKS  YG VLVLDGV+QCTER
Sbjct: 3   HIKDGWFTESCTLWPGQAMSLQVEEVLYHKKSKFQDVMVFKSKTYGNVLVLDGVIQCTER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMI ++P+  H  P+ VL+I      VLREV KH  V+  VLC+IDE VI +SK
Sbjct: 63  DEFAYQEMIANLPLCSHPCPKKVLIIGGGDGGVLREVVKHPLVESAVLCEIDEDVINVSK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           K+LP MA GF +PK+T+HIGDGFEF++   ++FDIIITD+SDPVGPAESLF+  Y++LMK
Sbjct: 123 KFLPGMAKGFFSPKLTLHIGDGFEFMKQNQDAFDIIITDSSDPVGPAESLFKESYYQLMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            ALR GGII +QGECQWLHL+LI ++Q++C+ L+PVV+YAY+TIPTYPSGQIGF+LCS +
Sbjct: 183 AALRSGGIICSQGECQWLHLELIKEMQTFCKTLFPVVDYAYSTIPTYPSGQIGFMLCSKN 242

Query: 258 DKVNLKKPLRKWSEEEEEKLC-RYYNSQIHEAAFILPQFTKNALKRS 303
            + N ++P++  S+EE+E +  +YYN +IH+A+F+LP+F +  L+ +
Sbjct: 243 PETNFREPVKALSKEEKESMSLKYYNPEIHKASFVLPEFARKVLREA 289



>gi|367012209|ref|XP_003680605.1| hypothetical protein TDEL_0C05050 [Torulaspora delbrueckii]
 gi|359748264|emb|CCE91394.1| hypothetical protein TDEL_0C05050 [Torulaspora delbrueckii]
          Length = 295

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/287 (60%), Positives = 225/287 (78%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           +HP I DGWFRE   T+WPGQAM L++++VL HEKS YQDVL+FKST YG VLVLD V+Q
Sbjct: 7   THPTIVDGWFREISDTMWPGQAMTLKVDKVLHHEKSKYQDVLVFKSTDYGNVLVLDNVIQ 66

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMI+H+ +N H NP+ VLVI      VLRE+ KHES++E  LCDIDE+VI
Sbjct: 67  ATERDEFSYQEMISHLALNSHPNPKKVLVIGGGDGGVLREIVKHESIEEAWLCDIDEAVI 126

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
            +SKKYLP+M+  + +PKV  +IGDGF+FLRD  N+FD+IITD+SDP GPAESLFQ  YF
Sbjct: 127 NVSKKYLPEMSASYSHPKVKTYIGDGFQFLRDYQNTFDVIITDSSDPEGPAESLFQEDYF 186

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           +L+ +AL   G+I+TQ E  W+HL +I ++++ C  ++PV EYAYTTIPTYP+GQIGF++
Sbjct: 187 KLLNSALTEKGVITTQAESMWIHLPIIKELKNVCNNVFPVAEYAYTTIPTYPTGQIGFMV 246

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           CS D    +KKPLR+ ++EEE KL RYYN +IHEA+F+LP + +  L
Sbjct: 247 CSKDKNAKVKKPLREVTDEEESKLYRYYNKRIHEASFVLPTWVQKEL 293



>gi|513032938|gb|AGO12910.1| AaceriADL340Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 293

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/292 (60%), Positives = 227/292 (77%), Gaps = 1/292 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   SHP I+DGWFRE   T+WPGQAM L +E+VL HEKS YQDVL+FKST++G VLVL
Sbjct: 1   MSDEISHPTIKDGWFREISDTMWPGQAMTLRVEKVLHHEKSKYQDVLVFKSTNHGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D VVQC+ERDEF+YQEMITH+ MN H+NP+ VLVI      VLREV KHESV+E  LCDI
Sbjct: 61  DNVVQCSERDEFAYQEMITHLAMNLHANPKKVLVIGGGDGGVLREVLKHESVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIR+SK+YLP+M+  +++PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRVSKQYLPEMSRSYEHPKVKTHIGDGFQFLRDYPNTFDVIITDSSDPEGPAEALF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           +  YF L+  AL   G+I+TQ E  ++HL++I Q+++ C +L+P V YAY ++PTYPSGQ
Sbjct: 181 EKPYFALLNEALTEKGVITTQAESLFIHLEIIKQLKNTCSQLFPNVGYAYASVPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           IGF++CS +  + L KPLR  SEE+E KL +YYN ++HEA F+LP F    L
Sbjct: 241 IGFMVCSKNADIELNKPLRTISEEQENKLYKYYNKKMHEACFVLPNFAAKEL 292



>gi|50303991|ref|XP_451945.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641077|emb|CAH02338.1| KLLA0B09372p [Kluyveromyces lactis]
          Length = 293

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/287 (61%), Positives = 219/287 (76%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           +HP I DGWFRE   T+WPGQAM L +E++L HEKS YQDVL+FKST YG VLVLD  +Q
Sbjct: 5   THPTIVDGWFREISDTMWPGQAMTLRVEKILHHEKSKYQDVLVFKSTDYGNVLVLDNAIQ 64

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMI H+ +N H NP+ VLVI      VLRE+ KH+SV+E  LCDIDE+VI
Sbjct: 65  VTERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREIVKHDSVQEAWLCDIDEAVI 124

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
           R+SK+YLP+MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPA SLFQ  YF
Sbjct: 125 RVSKEYLPEMAKSYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAASLFQQSYF 184

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           EL+  AL   G+ISTQ E  W+HL +I +++  C+E++P V YAYTTIPTYP+GQIGF++
Sbjct: 185 ELLNGALTEKGVISTQAESMWIHLPIIKELKKACKEVFPTVGYAYTTIPTYPTGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           CS D  V++ KPLR  SEEEEE   RYYN ++HEA+F+LP +    L
Sbjct: 245 CSKDANVDVTKPLRSISEEEEEAKYRYYNKKVHEASFVLPTWVAKEL 291



>gi|348514634|ref|XP_003444845.1| PREDICTED: spermidine synthase-like [Oreochromis niloticus]
          Length = 289

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 230/287 (80%), Gaps = 1/287 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
            I+DGWF E  TLWPGQAM L++EEVL H+KS +QDV++FKS  YG VLVLDGV+QCTER
Sbjct: 3   HIKDGWFTESCTLWPGQAMSLQVEEVLYHKKSKFQDVMVFKSKTYGNVLVLDGVIQCTER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMI ++P+  H  P+ VL+I      VLREV KH  V+  VLC+IDE VI +SK
Sbjct: 63  DEFAYQEMIANLPLCSHPCPKKVLIIGGGDGGVLREVVKHPLVESAVLCEIDEDVINVSK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           K+LP MA GF +PK+T+HIGDGFEF++   ++FDIIITD+SDPVGPAESLF+  Y++LMK
Sbjct: 123 KFLPGMAKGFFSPKLTLHIGDGFEFMKQNQDAFDIIITDSSDPVGPAESLFKESYYQLMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            ALR GGII +QGECQWLHL+LI ++Q++C+ L+PVV+YAY+TIPTYPSGQIGF+LCS +
Sbjct: 183 AALRSGGIICSQGECQWLHLELIKEMQTFCKTLFPVVDYAYSTIPTYPSGQIGFMLCSKN 242

Query: 258 DKVNLKKPLRKWSEEEEEKLC-RYYNSQIHEAAFILPQFTKNALKRS 303
            + N ++P++  S+EE+E +  +YYN +IH+A+F+LP+F +  L  +
Sbjct: 243 PETNFREPVKALSKEEKESMSLKYYNPEIHKASFVLPEFARKVLSEA 289



>gi|328851888|gb|EGG01038.1| hypothetical protein MELLADRAFT_73077 [Melampsora larici-populina
           98AG31]
          Length = 698

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 223/290 (76%), Gaps = 7/290 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP +QDGWF+E+  LWPGQAM L+++++L  EKS +QDVL+F+S  +G VLVLDG +QC
Sbjct: 5   THPSVQDGWFKEESPLWPGQAMSLQVKKILHVEKSKFQDVLVFESVAHGNVLVLDGAIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
            E DEFSYQEMI HIP+N H NPE+VLVI      VLREV KH SVK  VLCDIDE+V R
Sbjct: 65  VENDEFSYQEMIAHIPLNSHPNPEHVLVIGGGDGGVLREVLKHPSVKTAVLCDIDEAVPR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPV-GPAESLFQVKYF 193
           +SK YLP MA GF++P+VT+ IGDGF+FLRD+V  FD+IITD+SDP  GPA++LF + YF
Sbjct: 125 VSKDYLPHMAAGFNDPRVTLFIGDGFQFLRDQVGKFDVIITDSSDPNEGPAQTLFGMPYF 184

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           +L+KNALRP G ISTQGEC WLHL LI  +    ++L+P VEYAYT+IPTYPSG IGF++
Sbjct: 185 QLLKNALRPNGSISTQGECIWLHLPLIHSLIKGSKDLFPQVEYAYTSIPTYPSGTIGFVV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           CS+D   NLKKPLR      + +  RYYN ++HEAAF+LP+F +  +  +
Sbjct: 245 CSLDKDRNLKKPLR------QVRNTRYYNKRVHEAAFVLPEFARATIAAA 288



>gi|401838282|gb|EJT41985.1| SPE3-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 293

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/292 (60%), Positives = 225/292 (77%), Gaps = 1/292 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVL
Sbjct: 1   MAQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEF+YQEMI H+ +N H +P+ VLVI      VLREV KHESV E  LCDI
Sbjct: 61  DNVIQATERDEFAYQEMIAHLALNSHPSPKKVLVIGGGDGGVLREVVKHESVVEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP+MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRLSKEYLPEMAASYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q +YF+L+ +AL   G+I+TQ E  W+HL +I  ++  C E++PV EY++ TIPTYP+G 
Sbjct: 181 QKEYFQLLNSALTERGVITTQAESMWIHLPIIKDLKKACSEVFPVAEYSFVTIPTYPTGT 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           IGF++CS D   N+KKPLR+ S+E+EE+L RYYN +IHEA+FILP +    L
Sbjct: 241 IGFMVCSKDKSCNVKKPLREISDEKEEELYRYYNKRIHEASFILPTWAAKEL 292



>gi|6325326|ref|NP_015394.1| spermidine synthase [Saccharomyces cerevisiae S288c]
 gi|2498945|sp|Q12074.1|SPEE_YEAST RecName: Full=Spermidine synthase; Short=SPDSY; AltName:
           Full=Putrescine aminopropyltransferase
 gi|805049|emb|CAA89186.1| unknown [Saccharomyces cerevisiae]
 gi|1230677|gb|AAB68120.1| Spe3p: putrescine aminopropyltransferase(spermidine synthase)
           [Saccharomyces cerevisiae]
 gi|1314137|emb|CAA94977.1| unknown [Saccharomyces cerevisiae]
 gi|1326074|gb|AAC17191.1| spermidine synthase [Saccharomyces cerevisiae]
 gi|190408005|gb|EDV11270.1| spermidine synthase [Saccharomyces cerevisiae RM11-1a]
 gi|207340351|gb|EDZ68728.1| YPR069Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256268925|gb|EEU04272.1| Spe3p [Saccharomyces cerevisiae JAY291]
 gi|259150222|emb|CAY87025.1| Spe3p [Saccharomyces cerevisiae EC1118]
 gi|285815597|tpg|DAA11489.1| TPA: spermidine synthase [Saccharomyces cerevisiae S288c]
 gi|323302568|gb|EGA56375.1| Spe3p [Saccharomyces cerevisiae FostersB]
 gi|323331321|gb|EGA72739.1| Spe3p [Saccharomyces cerevisiae AWRI796]
 gi|323346300|gb|EGA80590.1| Spe3p [Saccharomyces cerevisiae Lalvin QA23]
 gi|323350212|gb|EGA84359.1| Spe3p [Saccharomyces cerevisiae VL3]
 gi|349581877|dbj|GAA27034.1| K7_Spe3p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|365762545|gb|EHN04079.1| Spe3p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392296079|gb|EIW07182.1| Spe3p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 293

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 225/292 (77%), Gaps = 1/292 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVL
Sbjct: 1   MAQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEF+YQEMI H+ +N H NP+ VLVI      VLREV KH+SV+E  LCDI
Sbjct: 61  DNVIQATERDEFAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHDSVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP+MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRLSKEYLPEMAASYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q +YF+L+ +AL   G+I+TQ E  W+HL +I  ++  C E++PV EY++ TIPTYP+G 
Sbjct: 181 QKEYFQLLNSALTEKGVITTQAESMWIHLPIIKDLKKACSEVFPVAEYSFVTIPTYPTGT 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           IGF++CS D   N+KKPLR+ S+E+E +L RYYN +IHEA+F+LP +    L
Sbjct: 241 IGFMVCSKDKTCNVKKPLREISDEKEAELYRYYNKKIHEASFVLPTWAAKEL 292



>gi|151942852|gb|EDN61198.1| putrescine aminopropyltransferase [Saccharomyces cerevisiae YJM789]
          Length = 293

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/292 (60%), Positives = 225/292 (77%), Gaps = 1/292 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVL
Sbjct: 1   MTQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEF+YQEMI H+ +N H NP+ VLVI      VLREV KH+SV+E  LCDI
Sbjct: 61  DNVIQATERDEFAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHDSVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP+MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRLSKEYLPEMAASYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q +YF+L+ +AL   G+I+TQ E  W+HL +I  ++  C E++PV EY++ TIPTYP+G 
Sbjct: 181 QKEYFQLLNSALTEKGVITTQAESMWIHLPIIKDLKKACSEVFPVAEYSFVTIPTYPTGT 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           IGF++CS D   N+KKPLR+ S+E+E +L RYYN +IHEA+F+LP +    L
Sbjct: 241 IGFMVCSKDKTCNVKKPLREISDEKEAELYRYYNKKIHEASFVLPTWAAKEL 292



>gi|401623242|gb|EJS41348.1| spe3p [Saccharomyces arboricola H-6]
          Length = 293

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/292 (60%), Positives = 224/292 (76%), Gaps = 1/292 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS +QDVLIFKST YG VLVL
Sbjct: 1   MAQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKFQDVLIFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEF+YQEMI H+ +N H NP+ VLVI      VLREV KHESV+E  LCDI
Sbjct: 61  DNVIQATERDEFAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHESVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP+MA  + +PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRLSKEYLPEMAASYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q +YF+L+ +AL   G+I+TQ E  W+HL +I  ++  C E++PV EY++ TIPTYP+G 
Sbjct: 181 QKEYFQLLNSALTEKGVITTQAESMWIHLPIIKDLKKACSEVFPVAEYSFVTIPTYPTGT 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           IGF++CS D   N+KKPLR   +E+EE+L RYYN +IHEA+FILP +    L
Sbjct: 241 IGFMVCSKDKTSNVKKPLRAICDEKEEELYRYYNKRIHEASFILPTWAAKEL 292



>gi|149239971|ref|XP_001525861.1| spermidine synthase [Lodderomyces elongisporus NRRL YB-4239]
 gi|146449984|gb|EDK44240.1| spermidine synthase [Lodderomyces elongisporus NRRL YB-4239]
          Length = 297

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/296 (59%), Positives = 222/296 (75%), Gaps = 2/296 (0%)

Query: 10  MSGTTSHPQIQDGWFREK-PTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   SHP IQDGWF EK  T+WPGQAM LE+++VL  EKS YQDVL+FKS  YG VLVL
Sbjct: 1   MAQELSHPSIQDGWFAEKSATMWPGQAMSLEVDKVLHVEKSKYQDVLVFKSKTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEFSYQEMITH+ MN H NP+  LVI      VLRE+ KH S++E  LCDI
Sbjct: 61  DNCIQVTERDEFSYQEMITHLAMNSHPNPKKALVIGGGDGGVLREILKHSSIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP MA+ + +P+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLF
Sbjct: 121 DETVIEVSKKYLPDMAVSYQDPRTKVHIGDGFKFLEEYKNQFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YFEL+KNAL   G+I+TQ E  W+H+D+I++++  C +++PVVEYAYT IPTYPSG 
Sbjct: 181 QKPYFELLKNALTEKGVITTQAENMWIHMDIISKLKKDCSDIFPVVEYAYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           IGF++CS D   N+KKPLR +W +E   K  +YYN QIHEAAF+LP +    L ++
Sbjct: 241 IGFMVCSKDANANVKKPLRFEWDDEFVAKNLKYYNKQIHEAAFVLPNWADQKLNKN 296



>gi|242117904|ref|NP_957328.2| spermidine synthase [Danio rerio]
          Length = 289

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 226/287 (78%), Gaps = 1/287 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
            I+DGWF E  TLWPGQAM L++EEVL H+KS +QDV++FKS  YG VL+LDGV+QCTER
Sbjct: 3   NIKDGWFTETCTLWPGQAMSLQVEEVLYHKKSKFQDVMVFKSKTYGNVLILDGVIQCTER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEFSYQEMI ++P+ CH  P+ VL+I      VLREV KH  V+ +V C+IDE VI +SK
Sbjct: 63  DEFSYQEMIANLPLCCHPCPKKVLIIGGGDGGVLREVVKHPLVESVVQCEIDEDVINVSK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           KYLP MA GF +PK+T+H+GDGFEF++   ++FDIIITD+SDPVGPAESLF+  Y++LMK
Sbjct: 123 KYLPGMAKGFFSPKLTLHVGDGFEFMKKNQDAFDIIITDSSDPVGPAESLFKESYYQLMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            AL  GGI+  QGECQWLHL+LI +++++C+ L+PVV+YAY TIPTYPSGQIGF+LCS +
Sbjct: 183 TALCEGGILCCQGECQWLHLELIKEMRTFCKTLFPVVDYAYCTIPTYPSGQIGFMLCSKN 242

Query: 258 DKVNLKKPLRKWSEEEEEKLC-RYYNSQIHEAAFILPQFTKNALKRS 303
            K N ++PLR+ + +E E +  +YYN +IH AAFILP+F +  L  +
Sbjct: 243 SKTNFREPLRELTRDEIESMSLKYYNPEIHRAAFILPEFARKVLSEA 289



>gi|348570938|ref|XP_003471253.1| PREDICTED: spermidine synthase-like [Cavia porcellus]
          Length = 367

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 164/283 (57%), Positives = 227/283 (80%), Gaps = 1/283 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ +PK+T+H+GDGFEF++   ++FDIIITD+SDPVGPAESLF+  Y++LMK 
Sbjct: 136 FLPSMAVGYSSPKLTLHVGDGFEFMKQNRDAFDIIITDSSDPVGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI  ++ +CR L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGVLCCQGECQWLHLDLIKSMRQFCRSLFPVVSYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNAL 300
             N ++P+++ ++ + E++  RYYN+++H AAF+LP+F + AL
Sbjct: 256 NTNFREPVQQLTQAQVEQRQLRYYNAEVHRAAFVLPEFARKAL 298



>gi|448088855|ref|XP_004196651.1| Piso0_003876 [Millerozyma farinosa CBS 7064]
 gi|448093022|ref|XP_004197682.1| Piso0_003876 [Millerozyma farinosa CBS 7064]
 gi|359378073|emb|CCE84332.1| Piso0_003876 [Millerozyma farinosa CBS 7064]
 gi|359379104|emb|CCE83301.1| Piso0_003876 [Millerozyma farinosa CBS 7064]
          Length = 296

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/296 (59%), Positives = 222/296 (75%), Gaps = 2/296 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   SHP I+DGWF E   T+WPGQAM L +E+VL  EKS YQDVL+FKST YG VLVL
Sbjct: 1   MSSELSHPTIKDGWFAEISDTMWPGQAMSLRVEKVLHVEKSKYQDVLVFKSTDYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           DG +QCTERDEFSYQEMITH+ +N H NP+  LVI      VLRE+ KH SV+E  LCDI
Sbjct: 61  DGCIQCTERDEFSYQEMITHLALNSHPNPKRALVIGGGDGGVLREILKHSSVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP+M+  + NP+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLF
Sbjct: 121 DETVIEVSKKYLPEMSSAYSNPRTKVHIGDGFKFLAEYKNHFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF+L+K AL   G+I+TQ E  WLH+D+I++++  C+E++PV EYAYT IPTYPSG 
Sbjct: 181 QKPYFQLLKEALTDKGVITTQAENIWLHMDIISKLKKDCKEIFPVAEYAYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           IGF++CS D + N+K P+R +W ++  E+  RYYN  IHEA+F+LP F    L RS
Sbjct: 241 IGFMVCSKDPQANVKSPVRYEWDDKFAEENLRYYNKSIHEASFVLPTFADKVLNRS 296



>gi|47228825|emb|CAG07557.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 289

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 226/287 (78%), Gaps = 1/287 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
            I++GWF EK  LWPGQAM L ++EVL ++KS +QDVL+F S  YG VLVLDGV+QCTER
Sbjct: 3   HIKEGWFMEKSALWPGQAMSLRVKEVLYNKKSKFQDVLLFASETYGNVLVLDGVIQCTER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMI ++P+  H +P+ VL+I      VLREV KH  V+ +V C+IDE VI +SK
Sbjct: 63  DEFAYQEMIANLPLCSHPSPKKVLIIGGGDGGVLREVVKHPLVESVVQCEIDEDVINVSK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           K+LP MA GF +PK+T+H+GDGFEF++   N+FD+IITD+SDPVGPAESLF+  YF+LMK
Sbjct: 123 KFLPGMAKGFFSPKLTLHVGDGFEFMKQNNNAFDVIITDSSDPVGPAESLFKESYFQLMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
           +ALR GGI+ +QGECQWLHL+LI +++ +C+ L+PVVEYAY+TIPTYPSGQIGF+LCS D
Sbjct: 183 SALRDGGILCSQGECQWLHLELIKEMRIFCKTLFPVVEYAYSTIPTYPSGQIGFMLCSKD 242

Query: 258 DKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRS 303
            K N K+P +  S+EE E +  +YYN +IH A+FILP+F K  L  +
Sbjct: 243 PKTNFKEPAKALSKEEIETMDLKYYNPEIHRASFILPEFAKKVLSEA 289



>gi|403214093|emb|CCK68594.1| hypothetical protein KNAG_0B01460 [Kazachstania naganishii CBS
           8797]
          Length = 293

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 224/293 (76%), Gaps = 1/293 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I DGWFRE   T+WPG+AM L++++VL HEKS YQDVLIFKST +G VLVL
Sbjct: 1   MSEQITHPTIVDGWFREISDTMWPGEAMTLKVDKVLHHEKSKYQDVLIFKSTDFGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEFSYQEMI H+ +N H NP+ VLVI      VLRE+ KHE V+E VLCDI
Sbjct: 61  DNAIQVTERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREIVKHECVEEAVLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSKKYLP M+  +D+PKV VHIGDGF+FL++  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRLSKKYLPDMSKSYDHPKVKVHIGDGFQFLKEYQNTFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YFEL+ +AL   G+I+TQ E  W+HL +I  ++  C+ ++PV EYA+T+IPTYP+G 
Sbjct: 181 QKPYFELLNDALTEKGVITTQAESFWIHLPIIKDLKKACKAVFPVAEYAWTSIPTYPTGM 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           IGF++CS D  VN+KKPLR+ S  EEEKL RYY+  IH A+F+LP +    L+
Sbjct: 241 IGFMVCSKDKSVNVKKPLREISSAEEEKLYRYYSKDIHAASFVLPTWVAKELE 293



>gi|331226164|ref|XP_003325752.1| spermidine synthase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|309304742|gb|EFP81333.1| spermidine synthase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 759

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 173/295 (58%), Positives = 225/295 (76%), Gaps = 7/295 (2%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           M+ T +HP I+DGWFRE+  LWPGQAM L++++VL  EKS +QDVL+F+ST +G VLVLD
Sbjct: 1   MATTLTHPAIKDGWFREESNLWPGQAMSLQVKKVLHVEKSKFQDVLVFESTSHGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
           G +QC E DEFSYQEMI H+P+N H NPE+VLVI      VLREV KH SVK   L DID
Sbjct: 61  GAIQCVENDEFSYQEMIAHLPLNSHPNPEHVLVIGGGDGGVLREVLKHPSVKTATLVDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPV-GPAESLF 188
           E+V R+SK +LP MA GF++P+VTVHIGDGF++LRD+V  FD+IITD+SDP  GPA++LF
Sbjct: 121 EAVPRVSKTFLPHMAAGFNDPRVTVHIGDGFQYLRDQVGKFDVIITDSSDPNEGPAQTLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
            + YFEL+KNAL+P G I+TQGEC WLHL LI  +    ++L+P VEYAYT+IPTYPSG 
Sbjct: 181 GMPYFELLKNALKPNGSIATQGECIWLHLPLIHSLIKGAKDLFPQVEYAYTSIPTYPSGT 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           IGF++CS+D    LK+PLR      + +  +YYN  +H AAF+LP+F + A++ +
Sbjct: 241 IGFVVCSLDKDRKLKQPLR------QVRNTKYYNKNVHAAAFVLPEFARQAVEAA 289



>gi|320583104|gb|EFW97320.1| spermidine synthase [Ogataea parapolymorpha DL-1]
          Length = 292

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/288 (60%), Positives = 223/288 (77%), Gaps = 1/288 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           SHP I+DGWF E   T+WPG+AM L++ ++L  ++S YQDVL+F+S++YG VLVLDG +Q
Sbjct: 5   SHPMIKDGWFAEVSDTMWPGEAMSLKVNKILYSQRSKYQDVLVFESSNYGNVLVLDGAIQ 64

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMI H+ +N H NP+ VLVI      VLREV KHE V+E VLCDIDE VI
Sbjct: 65  ATERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAVLCDIDEDVI 124

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
            +SKKYLP+M+  + +PKV VHIGDGF+FL D  N FD+IITD+SDP GPAESLFQ  YF
Sbjct: 125 AVSKKYLPEMSKSYAHPKVRVHIGDGFKFLNDYKNCFDVIITDSSDPEGPAESLFQKPYF 184

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           +L+K AL   G+ISTQ E  WLHL++I +++  C++++PV EYAY TIPTYPSGQIGF++
Sbjct: 185 QLLKEALTEKGVISTQAESIWLHLNIIKELKKTCKDVFPVAEYAYCTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           CS D KV++ KPLR   EE E KL +YY+S IH+AAF+LP F + AL+
Sbjct: 245 CSKDPKVDVTKPLRSVDEETERKLYKYYSSDIHKAAFVLPNFAREALQ 292



>gi|390364436|ref|XP_796573.2| PREDICTED: spermidine synthase-like [Strongylocentrotus purpuratus]
          Length = 299

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 172/280 (61%), Positives = 219/280 (78%), Gaps = 1/280 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           ++ GWF E  TLWPG+A  LE+EEVL HE+S +QDVL+FKS  YG VLVLDGV+QCTERD
Sbjct: 4   LKKGWFSELGTLWPGEAASLEVEEVLFHERSKFQDVLVFKSKTYGNVLVLDGVIQCTERD 63

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMIT +P+N H  P+ VLVI      V+REV KH  V+ +  C+ID  V+ +SKK
Sbjct: 64  EFSYQEMITFLPLNSHPCPKKVLVIGGGDGGVIREVVKHPDVESVTQCEIDGCVVEVSKK 123

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP M+ G+D+PK+T HIGDGF ++++  N+FD+IITD+SDPVGPAE LF+ +YFELM++
Sbjct: 124 YLPNMSKGYDSPKLTQHIGDGFAYMKENKNAFDVIITDSSDPVGPAEMLFEKEYFELMRS 183

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+PGGII TQGE  WLHLDLI  +Q +CR LYPVVEYA+TTIPTYPSGQIGF LCS   
Sbjct: 184 ALKPGGIICTQGESLWLHLDLIKSMQKFCRTLYPVVEYAFTTIPTYPSGQIGFTLCSTSS 243

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTK 297
             + + P+ K S+E+ ++L  +YYNS +H+AAF+LPQF K
Sbjct: 244 DTDFRDPVHKLSDEQIKELGLKYYNSDVHKAAFVLPQFAK 283



>gi|513004331|ref|XP_004863645.1| PREDICTED: spermidine synthase [Heterocephalus glaber]
          Length = 302

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 163/287 (56%), Positives = 228/287 (79%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I +GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IHEGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ +PK+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAVGYSSPKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI  ++ +CR L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDLIKAMRQFCRSLFPVVGYAYCTIPTYPSGQIGFMLCSKNA 255

Query: 259 KVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P+++ ++ + E++  +YYN+++H AAF+LP+F + AL  +S
Sbjct: 256 STNFREPVQQLTQAQVEQRQLKYYNAEVHRAAFVLPEFARKALNDAS 302



>gi|164660446|ref|XP_001731346.1| hypothetical protein MGL_1529 [Malassezia globosa CBS 7966]
 gi|159105246|gb|EDP44132.1| hypothetical protein MGL_1529 [Malassezia globosa CBS 7966]
          Length = 769

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/284 (62%), Positives = 209/284 (73%), Gaps = 8/284 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I DGWF E+   WPGQAM L +  +L HEKS YQDVL+F+S  YG VLVLDG +QC
Sbjct: 9   THPNIHDGWFHEENPQWPGQAMSLRVRRILHHEKSQYQDVLVFESETYGNVLVLDGAIQC 68

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEF+YQEMI H+P+N H NP  VLVI      VLRE+ KHESV+E +LCDIDE+V R
Sbjct: 69  TERDEFAYQEMIAHLPINSHPNPRRVLVIGGGDGGVLREIVKHESVEEAILCDIDEAVPR 128

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVN--SFDIIITDASDPVGPAESLFQVKY 192
           +S KYLPKMA G ++PK TV IGDGF FL D  N  SFD+IITD+SDP GPAE LFQ  Y
Sbjct: 129 VSAKYLPKMAEGLNHPKSTVIIGDGFAFLNDPKNKASFDVIITDSSDPEGPAEVLFQKPY 188

Query: 193 FELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFI 252
           FEL+K ALRPGG ISTQGE  WLHL LI  +    +EL+PV +YAYT IPTYPSGQIGF+
Sbjct: 189 FELLKQALRPGGHISTQGESMWLHLQLIRSLTQATKELFPVADYAYTLIPTYPSGQIGFV 248

Query: 253 LCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFT 296
           +CS+D   N+++PLR          C YYN+ IH A+FILPQF 
Sbjct: 249 VCSLDANRNVREPLRTVPN------CSYYNNDIHRASFILPQFA 286



>gi|302307177|ref|NP_983755.2| ADL340Wp [Ashbya gossypii ATCC 10895]
 gi|299788874|gb|AAS51579.2| ADL340Wp [Ashbya gossypii ATCC 10895]
 gi|374106968|gb|AEY95876.1| FADL340Wp [Ashbya gossypii FDAG1]
          Length = 293

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 172/293 (58%), Positives = 226/293 (77%), Gaps = 1/293 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I+DGWFRE   T+WPGQAM L +E+VL HEKS YQDVL+FKST++G VLVL
Sbjct: 1   MSDEITHPTIKDGWFREISDTMWPGQAMTLRVEKVLHHEKSKYQDVLVFKSTNHGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D VVQC+ERDEF+YQEMITH+ MN H+NP+ VLVI      VLREV KHESV+E  LCDI
Sbjct: 61  DNVVQCSERDEFAYQEMITHLAMNLHANPKKVLVIGGGDGGVLREVLKHESVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIR+SK+YLP+M+  +++PKV  HIGDGF+FLRD  N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRVSKQYLPEMSRSYEHPKVKTHIGDGFQFLRDYPNTFDVIITDSSDPEGPAEALF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           +  YF L+  AL   G+I+TQ E  ++H+++I Q++  C +L+P V YAY ++PTYPSGQ
Sbjct: 181 EQPYFSLLNQALTENGVITTQAESLFIHMEIIKQLKGTCSQLFPNVGYAYASVPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           IGF++CS +  + L KPLR  S+E+E +L +YY+ ++HEA F+LP F    L 
Sbjct: 241 IGFMVCSKNADIELSKPLRTISDEQERELYKYYSKKMHEACFVLPTFAAKELN 293



>gi|32766339|gb|AAH55159.1| Zgc:63600 [Danio rerio]
          Length = 289

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/287 (59%), Positives = 224/287 (78%), Gaps = 1/287 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
            I+DGWF E  TLWPGQAM L++EEVL H+KS +QDV++FKS  YG VL+LDGV+QCTER
Sbjct: 3   NIKDGWFTETCTLWPGQAMSLQVEEVLYHKKSKFQDVMVFKSKTYGNVLILDGVIQCTER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEFSYQEMI ++P+ CH  P+ VL+I      VLREV KH  V+ +V C+IDE  I +SK
Sbjct: 63  DEFSYQEMIANLPLCCHPCPKKVLIIGGGDGGVLREVVKHPLVESVVQCEIDEDAINVSK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           KYLP MA GF +PK+T+H+GDGFEF++   ++FDIIITD+SDPVGPAESL +  Y++LMK
Sbjct: 123 KYLPGMAKGFFSPKLTLHVGDGFEFMKKNQDAFDIIITDSSDPVGPAESLLKESYYQLMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            AL  GGI+  QGECQWLHL+LI +++++C+ L+PVV+YAY TIPTYPSGQIGF+LCS +
Sbjct: 183 TALCEGGILCCQGECQWLHLELIKEMRTFCKTLFPVVDYAYCTIPTYPSGQIGFMLCSKN 242

Query: 258 DKVNLKKPLRKWSEEEEEKLC-RYYNSQIHEAAFILPQFTKNALKRS 303
            K N ++PLR+ + +E E +  +YYN +IH AAFILP+F +  L  +
Sbjct: 243 SKTNFREPLRELTRDEIESMSLKYYNPEIHRAAFILPEFARKVLSEA 289



>gi|410899599|ref|XP_003963284.1| PREDICTED: spermidine synthase-like [Takifugu rubripes]
          Length = 289

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 227/287 (79%), Gaps = 1/287 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
            I+DGWF EK  LWPGQAM L+++EVL ++KS +QDVL+F S  YG VLVLDGV+QCTER
Sbjct: 3   HIKDGWFMEKSALWPGQAMSLQVKEVLYNKKSKFQDVLVFTSETYGNVLVLDGVIQCTER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMI ++P+  H +P+ VL+I      VLREV K+  V+ +VLC+IDE VI +SK
Sbjct: 63  DEFAYQEMIANLPLCSHLSPKRVLIIGGGDGGVLREVVKNPLVESVVLCEIDEDVINVSK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           K+LP MA GF +PK+T+H+GDGFEF++   N+FD+IITD+SDPVGPAESLF+  YF+LMK
Sbjct: 123 KFLPGMAKGFFSPKLTLHVGDGFEFMKQNNNAFDVIITDSSDPVGPAESLFKESYFQLMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
           +AL+ GGI+ +QGECQWLHL+LI +++S+C  L+P VEYAY+TIPTYPSGQIGF+LCS +
Sbjct: 183 SALKDGGILCSQGECQWLHLELIKEMRSFCETLFPAVEYAYSTIPTYPSGQIGFMLCSKN 242

Query: 258 DKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRS 303
            K N K+P++  S+EE   +  +YYN +IH A+FILP+F +  L  +
Sbjct: 243 PKTNFKEPVKALSKEEIGTMDLKYYNPEIHRASFILPEFARKVLNEA 289



>gi|511834034|ref|XP_004741655.1| PREDICTED: spermidine synthase [Mustela putorius furo]
          Length = 401

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/283 (56%), Positives = 227/283 (80%), Gaps = 1/283 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I +GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 115 IHEGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKSYGNVLVLDGVIQCTERD 174

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 175 EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVLKHSSVESVVQCEIDEDVIQVSKK 234

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 235 FLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 294

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI Q++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 295 ALKDNGVLCCQGECQWLHLDLIKQMRQFCKSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 354

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
             + +KP+++ ++++ E++  +YYNS +H+AAF+LP+F + AL
Sbjct: 355 STDFRKPVQQLTQKQVEQMQLKYYNSDVHQAAFVLPEFARKAL 397



>gi|388582960|gb|EIM23263.1| saccharopine dehydrogenase [Wallemia sebi CBS 633.66]
          Length = 745

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/292 (61%), Positives = 218/292 (74%), Gaps = 7/292 (2%)

Query: 13  TTSHPQI-QDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           + +HP +  +GWF E    WPGQA+ L++ ++L  EKS YQDVL+F+S  YG VLVLDG 
Sbjct: 2   SLTHPAVDNNGWFHEISPQWPGQALSLKVNKILHVEKSKYQDVLVFESESYGNVLVLDGA 61

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           VQCTERDEFSYQEMI H+PM  H NPE VLVI      VLREV KH  VKE VLCDIDE+
Sbjct: 62  VQCTERDEFSYQEMIAHLPMASHPNPERVLVIGGGDGGVLREVIKHPQVKEAVLCDIDEA 121

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVK 191
           V R+SK+YLPKMA G ++ KVTV IGDGF+FL+DK N FD+IITD+SDP GPA +LF+  
Sbjct: 122 VPRVSKQYLPKMAEGLEHEKVTVFIGDGFKFLQDKKNYFDVIITDSSDPEGPAAALFEKA 181

Query: 192 YFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGF 251
           +FEL+KNALR GG ISTQGEC WLHL LI  ++   REL+   EYAYTTIPTYPSGQIGF
Sbjct: 182 FFELLKNALRDGGHISTQGECIWLHLPLIKSLRLATRELFATAEYAYTTIPTYPSGQIGF 241

Query: 252 ILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           I+CS D   NL+KPLR+  +      C+YYN++IHE AF LPQF ++AL   
Sbjct: 242 IVCSKDGSRNLRKPLREVPD------CKYYNAKIHECAFQLPQFAESALNEG 287



>gi|254580735|ref|XP_002496353.1| ZYRO0C16412p [Zygosaccharomyces rouxii]
 gi|238939244|emb|CAR27420.1| ZYRO0C16412p [Zygosaccharomyces rouxii]
          Length = 293

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/293 (59%), Positives = 223/293 (76%), Gaps = 1/293 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I DGWFRE   T+WPGQAM L++E+VL HEKS YQDVLIFKST YG VLVL
Sbjct: 1   MSQEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTDYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D V+Q TERDEFSYQEMI H+ +N H  P+ VLVI      VLRE+ KHESV+E  LCDI
Sbjct: 61  DNVIQATERDEFSYQEMIAHLGLNSHPEPKKVLVIGGGDGGVLREIVKHESVEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VIRLSK+YLP+M+  +++PKV  +IGDGFEFL+   N+FD+IITD+SDP GPAE+LF
Sbjct: 121 DEAVIRLSKQYLPEMSASYNHPKVKTYIGDGFEFLKKYQNTFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF+L+ +AL   G+I+TQ E  W+HL +I  ++  C  ++PVVEYAYTTIPTYP+GQ
Sbjct: 181 QEDYFKLLNSALTEKGVITTQAESMWIHLPIIRDLKKACSAVFPVVEYAYTTIPTYPTGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           IGF++C  D   N+K+PLR+ S+E+E +L +YYN +IH AAF LP +    L+
Sbjct: 241 IGFMVCCKDKAANVKQPLRELSDEKEAQLYKYYNKRIHGAAFTLPTWVAKELQ 293



>gi|465795090|emb|CCU99732.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 765

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 214/296 (72%), Gaps = 8/296 (2%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           MS   SHP I DGWF E    WPGQAM L++  +L  E+S +QDVL+F+S  YG VLVLD
Sbjct: 1   MSTVLSHPLIVDGWFHEVSRQWPGQAMSLKVRRILHTEQSQFQDVLVFESETYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
           G +QCTERDEFSYQEMI H+P+N H NP  VLVI      VLRE+ KH+SV+E VLCDID
Sbjct: 61  GAIQCTERDEFSYQEMIAHLPINSHPNPRRVLVIGGGDGGVLREIVKHDSVEEAVLCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVN--SFDIIITDASDPVGPAESL 187
           E+V R+SK YLPKMA G D+PK TV IGDGF FL+D  N  +FD+IITD+SDP GPAE L
Sbjct: 121 EAVPRVSKTYLPKMAEGLDHPKSTVIIGDGFAFLKDPKNKGAFDVIITDSSDPDGPAEVL 180

Query: 188 FQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSG 247
           FQ  YFEL++ ALRPGG ISTQ E  WLHL LI Q+    REL+PV +YAYT IPTYP G
Sbjct: 181 FQKSYFELLREALRPGGHISTQAESVWLHLGLIRQLTQSTRELFPVADYAYTLIPTYPCG 240

Query: 248 QIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           QIGF++CS+D + N+++PLR          CRYYN+ IH AAF+LP+F    + R 
Sbjct: 241 QIGFVVCSLDAQRNVREPLRTVPN------CRYYNNDIHRAAFVLPEFAHRVVARG 290



>gi|432864720|ref|XP_004070426.1| PREDICTED: spermidine synthase-like [Oryzias latipes]
          Length = 289

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/284 (59%), Positives = 228/284 (80%), Gaps = 1/284 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
            I+DGWF E   LWPGQAM L++EEVL ++KS +QDV++FKS  YG VLVLDGV+QCTER
Sbjct: 3   HIKDGWFTESCALWPGQAMSLQVEEVLYNKKSKFQDVMVFKSKTYGNVLVLDGVIQCTER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMI ++P+  H  P+ VLVI      VLREV KH  V+ +VLC+IDE VI +SK
Sbjct: 63  DEFAYQEMIANLPLCSHPCPKKVLVIGGGDGGVLREVVKHPLVESVVLCEIDEDVINVSK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           K+LP MA GF +PK+T+H+GDGFEF++   ++FDIIITD+SDPVGPAESLF+  Y++LMK
Sbjct: 123 KFLPGMAKGFFSPKLTLHVGDGFEFMKQNQDAFDIIITDSSDPVGPAESLFKESYYQLMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            ALR GGI+ +QGECQWLHL+LI +++++C+ L+PVV+YAY TIPTYPSGQIG++LCS +
Sbjct: 183 AALRSGGILCSQGECQWLHLELIKEMRTFCKTLFPVVDYAYGTIPTYPSGQIGYMLCSKN 242

Query: 258 DKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
            + N ++P++  S+EE E +  +YYN++IH+A+F+LP+F +  L
Sbjct: 243 PETNFREPVKALSKEEMETMNLQYYNTEIHKASFVLPEFARKVL 286



>gi|466022084|ref|XP_004272432.1| PREDICTED: spermidine synthase [Orcinus orca]
          Length = 302

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 163/284 (57%), Positives = 227/284 (79%), Gaps = 1/284 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSQYQDILVFRSKSYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLYSHPNPRKVLIIGGGDGGVLREVVKHSSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV+YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVDYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNALK 301
             N ++P+++ ++++ EE   +YYNS +H+AAF+LP+F + AL 
Sbjct: 256 STNFREPVQQLTQKQVEEMQLKYYNSDVHQAAFVLPEFARKALN 299



>gi|50554613|ref|XP_504715.1| YALI0E33143p [Yarrowia lipolytica]
 gi|49650584|emb|CAG80319.1| YALI0E33143p [Yarrowia lipolytica CLIB122]
          Length = 292

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 169/287 (58%), Positives = 219/287 (76%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           +HP I DGWFRE   T+WPGQAM L + ++L  EKS YQDVL+F+ST YG VLVLDG +Q
Sbjct: 5   THPSIVDGWFREISDTMWPGQAMALRVNQILHVEKSKYQDVLVFESTDYGNVLVLDGAIQ 64

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDE++YQEMI H+ +N H NP+ VLVI      VLRE+ KH+ V+E VLCDIDE+V 
Sbjct: 65  ATERDEYAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREIVKHDCVEEAVLCDIDEAVP 124

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
           R+SK+YLP M++GF++PK  VHIGDGF+FL++  N+FD+IITD+SDP GPA SLFQ  YF
Sbjct: 125 RVSKQYLPTMSVGFNHPKTKVHIGDGFKFLQEYQNTFDVIITDSSDPEGPAASLFQKPYF 184

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           EL+  AL   G+I+TQGE  WLH+ +I +++  C++++P  +YAY TIPTYPSGQIGF++
Sbjct: 185 ELLSGALTEKGVITTQGESIWLHMKIIKELRQACKQVFPSADYAYCTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           CS D   NL+KPLR  S EEE KL RYYN  IH A+F+LP + ++ L
Sbjct: 245 CSKDKDANLRKPLRSVSPEEESKLYRYYNKDIHSASFVLPTWARDDL 291



>gi|471407260|ref|XP_004385219.1| PREDICTED: spermidine synthase [Trichechus manatus latirostris]
          Length = 302

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 226/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE   LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCPLWPGQALSLQVEQLLHHQRSQYQDILVFRSKSYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVEAVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++PL++ +E + E++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 256 STNFREPLQQLTETQVEQRQLKYYNSDVHRAAFVLPEFARKALNDMS 302



>gi|76637216|ref|XP_582280.2| PREDICTED: spermidine synthase isoform 1 [Bos taurus]
 gi|297484096|ref|XP_002694090.1| PREDICTED: spermidine synthase [Bos taurus]
 gi|296479186|tpg|DAA21301.1| TPA: spermidine synthase-like [Bos taurus]
          Length = 302

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 226/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKSYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHSSVEAVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPSMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV+YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVDYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++PL+   +++ EE   +YYNS +H AAF+LP+F + AL   S
Sbjct: 256 STNFREPLQPLMQKQVEEMQLKYYNSDVHRAAFVLPEFARKALNDVS 302



>gi|472383640|ref|XP_004411196.1| PREDICTED: spermidine synthase [Odobenus rosmarus divergens]
          Length = 302

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 227/287 (79%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I +GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IHEGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKSYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVLKHSSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI Q++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKDNGVLCCQGECQWLHLDLIKQMRQFCKSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             + +KP++  ++++ E++  +YYNS +H+AAF+LP+F + AL   S
Sbjct: 256 STDFQKPVQPLTQKQVEQMQLKYYNSDVHQAAFVLPEFARKALNDVS 302



>gi|327287238|ref|XP_003228336.1| PREDICTED: spermidine synthase-like [Anolis carolinensis]
          Length = 341

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 164/287 (57%), Positives = 222/287 (77%), Gaps = 1/287 (0%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
           G      +++GWFRE  +LWPGQA+ L++E+VL   +S +Q++L+F+S  YG VLVLDGV
Sbjct: 4   GLEGAAAVKEGWFRETCSLWPGQALSLQVEQVLHQHRSPFQEILVFRSKTYGNVLVLDGV 63

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +QCTERDEFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ ++ C+IDE 
Sbjct: 64  IQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVIQCEIDED 123

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVK 191
           VI  SKK+LP MA+G+ +PK+T+H+GDGFEF++    +FD+IITD+SDP+GPAESLF+  
Sbjct: 124 VIEASKKFLPGMAVGYASPKLTLHVGDGFEFMKQNQEAFDVIITDSSDPMGPAESLFKES 183

Query: 192 YFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGF 251
           Y++LMK ALR  GI+  QGECQWLHLDLI +++ +C+ L+PVVEYAY TIPTYPSGQIGF
Sbjct: 184 YYQLMKTALREDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVEYAYCTIPTYPSGQIGF 243

Query: 252 ILCSIDDKVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTK 297
           +LCS +   N ++P++K S+E+ EE   +YYNS IH AAF+LP+F +
Sbjct: 244 MLCSKNPNTNFREPVQKLSQEQVEEMSLKYYNSNIHRAAFVLPEFAR 290



>gi|507547752|ref|XP_004657706.1| PREDICTED: spermidine synthase [Jaculus jaculus]
          Length = 302

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 163/287 (56%), Positives = 228/287 (79%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVEAVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVGYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P+++ ++ + E++  +YYNS++H AAF+LP+F + AL   S
Sbjct: 256 STNFREPVQQLTQAQVEQMQLKYYNSEVHRAAFVLPEFARKALNDVS 302



>gi|410966018|ref|XP_003989535.1| PREDICTED: spermidine synthase [Felis catus]
          Length = 302

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 228/287 (79%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKSYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VIR+SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVLKHSSVESVVQCEIDEDVIRVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY +IPTYPSGQIGF+LCS + 
Sbjct: 196 ALKDDGVLCCQGECQWLHLDLIKEMRQFCKSLFPVVAYAYCSIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             + +KP+++ + ++ E++  +YYNS +H+AAF+LP+F + AL   S
Sbjct: 256 GTDFRKPVQQLTRKQVEQMQLKYYNSDVHQAAFVLPEFARKALNDVS 302



>gi|395840954|ref|XP_003793315.1| PREDICTED: spermidine synthase [Otolemur garnettii]
          Length = 302

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 163/287 (56%), Positives = 228/287 (79%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H +P  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPSPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P+++ ++++ EK+  +YYNS +H AAF+LP+F + AL   S
Sbjct: 256 NTNFREPVQQLTQKQVEKMQLKYYNSDVHRAAFVLPEFARKALNDVS 302



>gi|459368498|gb|EMG47201.1| Spermidine synthase, putative [Candida maltosa Xu316]
          Length = 297

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 220/295 (74%), Gaps = 2/295 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I+DGWF E   T+WPGQAM L++E+VL   KS YQDVL+FKST YG VLVL
Sbjct: 1   MSQELTHPAIKDGWFAEISETMWPGQAMSLQVEKVLYAGKSKYQDVLVFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEFSYQEMITH+ MN H NP+  LVI      VLRE+ KH+S++E  LCDI
Sbjct: 61  DNCIQVTERDEFSYQEMITHLAMNSHPNPKKALVIGGGDGGVLREILKHDSIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP MA  +D+P+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLF
Sbjct: 121 DEAVIEVSKKYLPNMAKSYDDPRTKVHIGDGFKFLEEYKNQFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF+L+K+AL   G+I+TQ E  W+H+D+I++++  CRE++PV EYAYT IPTYPSG 
Sbjct: 181 QKPYFQLLKDALTEKGVITTQAENMWIHMDIISKLKKDCREIFPVAEYAYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           IGF++CS D   ++ KP+R  WS+E   K  +YYN QIHEA+F+LP +    L +
Sbjct: 241 IGFMVCSKDPNADVSKPIRFDWSDEFVAKNLKYYNKQIHEASFVLPTWADQILNK 295



>gi|6678131|ref|NP_033298.1| spermidine synthase [Mus musculus]
 gi|2498944|sp|Q64674.1|SPEE_MOUSE RecName: Full=Spermidine synthase; Short=SPDSY; AltName:
           Full=Putrescine aminopropyltransferase
 gi|309502|gb|AAC37666.1| spermidine synthase [Mus musculus]
 gi|1061192|emb|CAA91561.1| spermidine synthase [Mus musculus]
 gi|13542723|gb|AAH05566.1| Spermidine synthase [Mus musculus]
 gi|26341728|dbj|BAC34526.1| unnamed protein product [Mus musculus]
 gi|148682879|gb|EDL14826.1| mCG16662 [Mus musculus]
 gi|1097138|prf||2113276A spermidine synthase
          Length = 302

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 162/284 (57%), Positives = 226/284 (79%), Gaps = 1/284 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI +SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+GF + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAVGFSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV+YAY +IPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVDYAYCSIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALK 301
             N ++P+++ ++ + E++  +YYNS +H AAF+LP+FT+ AL 
Sbjct: 256 STNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLPEFTRKALN 299



>gi|478503680|ref|XP_004426144.1| PREDICTED: spermidine synthase, partial [Ceratotherium simum simum]
          Length = 300

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 160/287 (55%), Positives = 230/287 (80%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 14  IREGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 73

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH S++ +V C+IDE VI++SKK
Sbjct: 74  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSLESVVQCEIDEDVIQVSKK 133

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LM+ 
Sbjct: 134 FLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMRT 193

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV+YAY TIPTYPSGQIGF+LCS + 
Sbjct: 194 ALKEDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVDYAYCTIPTYPSGQIGFMLCSKNP 253

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P+++ ++++ E++  +YYNS +H+AAF+LP+F + AL   S
Sbjct: 254 STNFREPVQQLTQKQVEQMQLKYYNSDVHQAAFVLPEFARKALNDVS 300



>gi|260951089|ref|XP_002619841.1| hypothetical protein CLUG_01000 [Clavispora lusitaniae ATCC 42720]
 gi|238847413|gb|EEQ36877.1| hypothetical protein CLUG_01000 [Clavispora lusitaniae ATCC 42720]
          Length = 297

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 168/295 (56%), Positives = 225/295 (76%), Gaps = 2/295 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I+DGWF E   T+WPG AM L+++EVL   KS YQDVL+FKST++G VLVL
Sbjct: 1   MAQELTHPSIKDGWFAEVSDTMWPGSAMSLKVQEVLYAGKSKYQDVLVFKSTNWGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDE+SYQEMITH+ MN H NP+  LVI      VLRE+ KH S++E  LCDI
Sbjct: 61  DNCIQVTERDEYSYQEMITHLAMNSHPNPKKALVIGGGDGGVLREILKHSSIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP MA  +++P+  VHIGDGF+FL D  N+FD+IITD+SDP GPAESLF
Sbjct: 121 DETVIEVSKKYLPNMAKAYNDPRTKVHIGDGFKFLEDYKNTFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YFEL+K AL   G+I+TQ E  WLH+D+I++++  C++++PV EYAYT+IPTYPSG 
Sbjct: 181 QKPYFELLKGALTEKGVITTQAESIWLHMDIISKLKKDCQQIFPVAEYAYTSIPTYPSGT 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           IGF++CS D+  N+KKPLR +W ++  ++  +YYN+Q+HEA+F+LPQ+    L +
Sbjct: 241 IGFMVCSKDESANVKKPLRFEWDDKFVDENLKYYNAQVHEASFVLPQWADKILNK 295



>gi|68482416|ref|XP_714840.1| hypothetical protein CaO19.2250 [Candida albicans SC5314]
 gi|68482537|ref|XP_714778.1| hypothetical protein CaO19.9790 [Candida albicans SC5314]
 gi|46436372|gb|EAK95735.1| hypothetical protein CaO19.9790 [Candida albicans SC5314]
 gi|46436437|gb|EAK95799.1| hypothetical protein CaO19.2250 [Candida albicans SC5314]
 gi|238883593|gb|EEQ47231.1| spermidine synthase [Candida albicans WO-1]
          Length = 297

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 220/295 (74%), Gaps = 2/295 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I+DGWF E   T+WPGQAM L++E+VL  EKS YQDVL+FKST YG VLVL
Sbjct: 1   MAQELTHPAIKDGWFAEISDTMWPGQAMSLKVEKVLHVEKSKYQDVLVFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEFSYQEMITH+ +N H NP+  LVI      VLRE+ KHES++E  LCDI
Sbjct: 61  DNCIQVTERDEFSYQEMITHLALNSHPNPKKALVIGGGDGGVLREILKHESIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP MA  +D+P+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLF
Sbjct: 121 DETVIEVSKKYLPNMAKSYDDPRTRVHIGDGFKFLEEYKNQFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF+L+K+AL   G+I+TQ E  W+H+D+I++++  C E++PV EYAYT IPTYPSG 
Sbjct: 181 QKPYFQLLKDALTEKGVITTQAENMWIHMDIISKLKKDCNEIFPVAEYAYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           IGF++CS D   N+ KP+R  WS+E   K  +YYN +IHEAAF+LP +    L +
Sbjct: 241 IGFMVCSKDPNANVSKPIRFDWSDEFVAKNLKYYNKKIHEAAFVLPTWADQVLNK 295



>gi|505760032|gb|EOR04106.1| Saccharopine dehydrogenase [NADP(+), L-glutamate-forming] [Wallemia
           ichthyophaga EXF-994]
          Length = 746

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 216/295 (73%), Gaps = 7/295 (2%)

Query: 10  MSGTTSHPQI-QDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   SHP I  + WF E    WPGQA+ L++ ++L  EKS +QDVL+F+S  YG VLVL
Sbjct: 1   MSSPLSHPAIDNNNWFHEISPQWPGQALSLKVNKILHVEKSQFQDVLVFESQSYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           DG VQCTERDEFSYQEMITH+PM  H NP+ VLVI      VLREV KH  V+E VLCDI
Sbjct: 61  DGAVQCTERDEFSYQEMITHLPMASHPNPQRVLVIGGGDGGVLREVVKHPQVQEAVLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+V R+SK YLP MA   ++ KVTV IGDGF+FL+DK N FD+IITD+SDP GPA +LF
Sbjct: 121 DEAVPRVSKAYLPHMAQALNHEKVTVFIGDGFKFLQDKKNYFDVIITDSSDPEGPAAALF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           +  +FEL+KNALR GG ISTQGEC WLHL LI  ++   REL+   EYAYTTIPTYPSGQ
Sbjct: 181 EKAFFELLKNALREGGHISTQGECIWLHLPLIKSLRLATRELFATAEYAYTTIPTYPSGQ 240

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           IGFI+CS D   NL+KPLR+  +      C+YYNS+IH+ AF LPQF  +AL  S
Sbjct: 241 IGFIVCSKDGSRNLRKPLREVPD------CKYYNSKIHQCAFQLPQFADSALNDS 289



>gi|16758208|ref|NP_445916.1| spermidine synthase [Rattus norvegicus]
 gi|392346259|ref|XP_003749506.1| PREDICTED: spermidine synthase-like [Rattus norvegicus]
 gi|13384156|gb|AAK21288.1|AF337636_1 spermidine synthase [Rattus norvegicus]
 gi|118763718|gb|AAI28734.1| Spermidine synthase [Rattus norvegicus]
          Length = 302

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 162/284 (57%), Positives = 225/284 (79%), Gaps = 1/284 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI +SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVSYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALK 301
             N ++P+++ ++ + E++  +YYNS +H AAF+LP+FT+ AL 
Sbjct: 256 STNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLPEFTRKALN 299



>gi|507682414|ref|XP_004639791.1| PREDICTED: mannan-binding lectin serine protease 2 [Octodon degus]
          Length = 725

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 161/280 (57%), Positives = 224/280 (80%), Gaps = 1/280 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 11  IREGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 70

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 71  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 130

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ +PK+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 131 FLPGMAIGYSSPKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 190

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI  ++ +CR L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 191 ALKEDGILCCQGECQWLHLDLIKSMRQFCRSLFPVVGYAYCTIPTYPSGQIGFMLCSKNP 250

Query: 259 KVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTK 297
             N ++P++  ++ + E++  +YYN+++H AAF+LP+F +
Sbjct: 251 STNFQEPIQPLTQAQVEQRQLKYYNAEVHRAAFVLPEFAR 290



>gi|504173205|ref|XP_004596174.1| PREDICTED: spermidine synthase [Ochotona princeps]
          Length = 354

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 224/284 (78%), Gaps = 1/284 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 68  IREGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 127

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H  P  VL+I      VLREV KH SV+ +V C+IDE VI +SKK
Sbjct: 128 EFSYQEMIANLPLCSHPRPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIHVSKK 187

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ +PK+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 188 FLPGMAVGYSSPKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 247

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI Q++ +C+ L+PVV YAY TIPTYP GQIGF+LCS + 
Sbjct: 248 ALKEDGVLCCQGECQWLHLDLIKQMRQFCKALFPVVGYAYCTIPTYPGGQIGFMLCSKNP 307

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALK 301
             N  +P+++ ++++ E++  +YYNS +H AAF+LP+F + AL 
Sbjct: 308 STNFAEPVQQLTQKQVEQMQLKYYNSDVHRAAFVLPEFARKALN 351



>gi|58269260|ref|XP_571786.1| spermidine synthase [Cryptococcus neoformans var. neoformans JEC21]
 gi|134114271|ref|XP_774383.1| hypothetical protein CNBG3640 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257018|gb|EAL19736.1| hypothetical protein CNBG3640 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228022|gb|AAW44479.1| spermidine synthase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 748

 Score =  366 bits (940), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 222/292 (76%), Gaps = 6/292 (2%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           M+ + SHP I DGWFRE  T WPGQAM L++++VL  EKSL+QDVL+F+S  YG VLVLD
Sbjct: 1   MAVSQSHPNIVDGWFREINTQWPGQAMTLKVKQVLHQEKSLFQDVLVFESETYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
           GV+Q TERDEFSYQEMITH+PM  H NPENVLVI      V+REV KH+SVK++ LCDID
Sbjct: 61  GVIQATERDEFSYQEMITHLPMASHPNPENVLVIGGGDGGVIREVLKHKSVKKVTLCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIR+SK++LP M+  + +P+V VHIGDGF+FL +  N +D+IITD+SDPVGPAE+LFQ
Sbjct: 121 EAVIRVSKQWLPLMSDCYKDPRVEVHIGDGFKFLPEHKNEYDVIITDSSDPVGPAEALFQ 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF+L+K AL+ GG +STQ EC W+HL LI  ++  C +L+PVV+Y +TTIPTYP+GQI
Sbjct: 181 PPYFQLLKEALKEGGSVSTQAECLWIHLPLIKTLKETCSKLFPVVKYGFTTIPTYPAGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           G ++C+ D   +L  PLR   +       RYYNS++H AAF +P+F +  L+
Sbjct: 241 GIMVCTKDSTRDLTVPLRAVPD------TRYYNSEVHRAAFTIPEFGRAMLE 286



>gi|402852915|ref|XP_003891152.1| PREDICTED: spermidine synthase [Papio anubis]
          Length = 302

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 226/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H+NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHANPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P++  ++++  ++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 256 STNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS 302



>gi|344283521|ref|XP_003413520.1| PREDICTED: spermidine synthase-like [Loxodonta africana]
          Length = 302

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 226/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHQRSQYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVEAVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAI + + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIAYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKKDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P+++ ++ + E++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 256 STNFREPVQELTQPQVEQRQLKYYNSDVHRAAFVLPEFARKALNDMS 302



>gi|321261389|ref|XP_003195414.1| spermidine synthase [Cryptococcus gattii WM276]
 gi|317461887|gb|ADV23627.1| Spermidine synthase, putative [Cryptococcus gattii WM276]
          Length = 750

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 221/292 (75%), Gaps = 6/292 (2%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           M+ + SHP I DGWFRE  T WPGQAM L++++VL  EKSL+QDVL+F+S  YG VLVLD
Sbjct: 1   MAVSQSHPNIVDGWFREINTQWPGQAMTLKVKQVLHKEKSLFQDVLVFESETYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
           GV+Q TERDEFSYQEMITH+PM  H NPENVLVI      V+REV KH+SVK++ LCDID
Sbjct: 61  GVIQATERDEFSYQEMITHLPMASHPNPENVLVIGGGDGGVIREVLKHKSVKKVTLCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIR+SK++LP M+  + +P+V VHIGDGF+FL +  N +D+IITD+SDPVGPAE+LFQ
Sbjct: 121 EAVIRVSKQWLPLMSNCYKDPRVEVHIGDGFKFLPEHKNEYDVIITDSSDPVGPAEALFQ 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF+L+K AL+ GG +STQ EC W+HL LI  ++  C  L+PVV+Y +TTIPTYP+GQI
Sbjct: 181 PPYFQLLKEALKEGGSVSTQAECLWVHLPLIKTLKETCSNLFPVVKYGFTTIPTYPAGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           G ++C+ D   +L  PLR   +       RYYNS++H AAF +P+F +  L+
Sbjct: 241 GIMVCTKDSTRDLTVPLRAVPD------TRYYNSEVHRAAFTIPEFGRAMLE 286



>gi|26390475|dbj|BAC25903.1| unnamed protein product [Mus musculus]
          Length = 302

 Score =  365 bits (937), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 161/284 (56%), Positives = 225/284 (79%), Gaps = 1/284 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI +SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+GF + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAVGFSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLD I +++ +C+ L+PVV+YAY +IPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDHIKEMRHFCKSLFPVVDYAYCSIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALK 301
             N ++P+++ ++ + E++  +YYNS +H AAF+LP+FT+ AL 
Sbjct: 256 STNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLPEFTRKALN 299



>gi|63253298|ref|NP_003123.2| spermidine synthase [Homo sapiens]
 gi|134811|sp|P19623.1|SPEE_HUMAN RecName: Full=Spermidine synthase; Short=SPDSY; AltName:
           Full=Putrescine aminopropyltransferase
 gi|338394|gb|AAA60574.1| spermidine synthase [Homo sapiens]
 gi|12653087|gb|AAH00309.1| Spermidine synthase [Homo sapiens]
 gi|21620021|gb|AAH33106.1| Spermidine synthase [Homo sapiens]
 gi|119592081|gb|EAW71675.1| spermidine synthase, isoform CRA_a [Homo sapiens]
 gi|190689401|gb|ACE86475.1| spermidine synthase protein [synthetic construct]
 gi|190690763|gb|ACE87156.1| spermidine synthase protein [synthetic construct]
          Length = 302

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 225/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P++  ++++  ++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 256 STNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS 302



>gi|122921244|pdb|2O05|A Chain A, Human Spermidine Synthase
 gi|122921245|pdb|2O05|B Chain B, Human Spermidine Synthase
 gi|122921247|pdb|2O06|A Chain A, Human Spermidine Synthase
 gi|122921248|pdb|2O06|B Chain B, Human Spermidine Synthase
 gi|122921250|pdb|2O07|A Chain A, Human Spermidine Synthase
 gi|122921251|pdb|2O07|B Chain B, Human Spermidine Synthase
 gi|122921255|pdb|2O0L|A Chain A, Human Spermidine Synthase
 gi|122921256|pdb|2O0L|B Chain B, Human Spermidine Synthase
          Length = 304

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 225/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 18  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 77

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 78  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 137

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 138 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 197

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 198 ALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 257

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P++  ++++  ++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 258 STNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS 304



>gi|255725052|ref|XP_002547455.1| spermidine synthase [Candida tropicalis MYA-3404]
 gi|240135346|gb|EER34900.1| spermidine synthase [Candida tropicalis MYA-3404]
          Length = 297

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 173/295 (58%), Positives = 220/295 (74%), Gaps = 2/295 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I+DGWF E   T+WPGQAM L++E+VL  EKS YQDVL+FKST YG VLVL
Sbjct: 1   MSQELTHPAIKDGWFAEISDTMWPGQAMSLKVEKVLHVEKSKYQDVLVFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEFSYQEMITH+ +N H NP+  LVI      VLRE+ KHES++E  LCDI
Sbjct: 61  DNCIQVTERDEFSYQEMITHLALNSHPNPKKALVIGGGDGGVLREILKHESIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP+MA  + +P+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLF
Sbjct: 121 DETVIEVSKKYLPEMAKSYADPRTKVHIGDGFKFLEEYKNQFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF+L+K+AL   G+I+TQ E  W+H+D+I++++  CRE++PV EYAYT IPTYPSG 
Sbjct: 181 QKPYFQLLKDALTEKGVITTQAENMWIHMDIISKLKKDCREIFPVAEYAYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           IGF++CS D    + KP+R  WS+E   K  RYYN +IHEAAF+LP +    L +
Sbjct: 241 IGFMVCSKDPNAVVSKPIRFDWSDEFVAKNLRYYNKRIHEAAFVLPTWADQILNK 295



>gi|291222293|ref|XP_002731154.1| PREDICTED: spermidine synthase-like [Saccoglossus kowalevskii]
          Length = 409

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 176/278 (63%), Positives = 218/278 (78%), Gaps = 1/278 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           IQ+GWFRE   LWP Q M LE+EEVL   +S +QDVL+FKS  YG VLVLDGV+QCTERD
Sbjct: 4   IQNGWFREVSPLWPSQCMSLEVEEVLYEGRSDFQDVLVFKSKTYGNVLVLDGVIQCTERD 63

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI+H+P+N H +P+NVL+I      V+REV KH  V+ +  C+ID+ VI +SKK
Sbjct: 64  EFSYQEMISHLPLNSHPHPKNVLIIGGGDGGVVREVVKHPCVETVTQCEIDKKVIEVSKK 123

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP MA+G+++PK+  HIGDGF F+ +    FD+IITD+SDP+GPAESLF+  Y+ELMK 
Sbjct: 124 YLPTMAVGYESPKLLQHIGDGFAFMGEHKGEFDVIITDSSDPIGPAESLFEKPYYELMKA 183

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+P GI+ TQGECQWLHLDLI ++ S+C+ LYPVV Y Y TIPTYPSGQIGF+LCS++ 
Sbjct: 184 ALKPNGIVCTQGECQWLHLDLIKEMTSFCKTLYPVVRYGYCTIPTYPSGQIGFMLCSLNP 243

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQF 295
           K    +P+RKWS EE EKL  RYYNS IH AAF+LPQF
Sbjct: 244 KTKFNEPVRKWSREELEKLNLRYYNSAIHSAAFVLPQF 281



>gi|347447556|pdb|3RW9|A Chain A, Crystal Structure Of Human Spermidine Synthase In Complex
           With Decarboxylated S-Adenosylhomocysteine
 gi|347447557|pdb|3RW9|B Chain B, Crystal Structure Of Human Spermidine Synthase In Complex
           With Decarboxylated S-Adenosylhomocysteine
          Length = 304

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 225/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 18  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 77

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 78  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 137

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 138 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 197

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 198 ALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 257

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P++  ++++  ++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 258 STNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS 304



>gi|114553926|ref|XP_514381.2| PREDICTED: spermidine synthase isoform 3 [Pan troglodytes]
          Length = 302

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 225/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P++  ++++  ++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 256 STNFQEPVQPLTKQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS 302



>gi|531202|gb|AAA36633.1| spermidine synthase [Homo sapiens]
          Length = 302

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 225/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + KVT+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKVTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGEC+WLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGVLCCQGECEWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P++  ++++  ++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 256 STNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS 302



>gi|149695532|ref|XP_001490409.1| PREDICTED: spermidine synthase-like [Equus caballus]
          Length = 285

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 226/284 (79%), Gaps = 1/284 (0%)

Query: 22  GWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFS 81
           G FRE  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERDEFS
Sbjct: 2   GLFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKSYGNVLVLDGVIQCTERDEFS 61

Query: 82  YQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLP 141
           YQEMI ++P+  H NP  VL+I      VLREV KH S++ +V C+IDE VI++SKK+LP
Sbjct: 62  YQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHSSLESVVQCEIDEDVIQVSKKFLP 121

Query: 142 KMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALR 201
            MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK AL+
Sbjct: 122 GMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALK 181

Query: 202 PGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVN 261
             GI+  QGECQWLHLDLI +++ +C+ L+PVV+YAY TIPTYPSGQIGF+LCS +   N
Sbjct: 182 EDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVDYAYCTIPTYPSGQIGFMLCSKNPNTN 241

Query: 262 LKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
            ++P+++ ++++ E++  +YYNS +H+AAF+LP+F + AL   S
Sbjct: 242 FREPVQQLTQKQVEQMQLKYYNSAVHQAAFVLPEFARKALNDVS 285



>gi|383873318|ref|NP_001244736.1| spermidine synthase [Macaca mulatta]
          Length = 302

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 224/287 (78%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
             N ++P++  ++ +  ++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 256 STNFQEPVQPLTQHQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS 302



>gi|254569166|ref|XP_002491693.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238031490|emb|CAY69413.1| hypothetical protein PAS_chr2-1_0885 [Komagataella pastoris GS115]
          Length = 293

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 174/287 (60%), Positives = 223/287 (77%), Gaps = 1/287 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           +HP I+DGWF E   T+WPGQAM L++E++L  E+SLYQDVLIF+ST YG VLVLDG +Q
Sbjct: 5   THPLIKDGWFMEISDTMWPGQAMSLKVEKILHVEQSLYQDVLIFQSTDYGNVLVLDGAIQ 64

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMI H+ +N H NP  VLVI      VLREV KHE V++ VLCDIDE+V 
Sbjct: 65  VTERDEFSYQEMIAHLALNSHPNPRKVLVIGGGDGGVLREVIKHECVEKAVLCDIDEAVP 124

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
           RLSK YLP+MA  + +PKVT+HIGDGF+FL +  N+FD+IITD+SDP GPA SLF+  YF
Sbjct: 125 RLSKIYLPEMAKSYKHPKVTLHIGDGFKFLDEYKNTFDVIITDSSDPEGPAASLFEKPYF 184

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           +L+ +AL   G+I+TQGE  WLH+++I  ++  C E++PVVEYAY TIPTYPSGQIGF++
Sbjct: 185 KLLNDALTEKGVITTQGENIWLHMEIIKNLKKACLEVFPVVEYAYCTIPTYPSGQIGFMV 244

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           CS D   +LK PLR +S+  E++  RYYN +IHEA+FILP + ++AL
Sbjct: 245 CSKDPNASLKFPLRSFSDTFEKEHLRYYNKKIHEASFILPTWARDAL 291



>gi|44888568|gb|AAS48112.1| chimeric spermidine synthase/saccharopine dehydrogenase
           [Cryptococcus neoformans var. grubii]
 gi|405121933|gb|AFR96701.1| chimeric spermidine synthase/saccharopine dehydrogenase
           [Cryptococcus neoformans var. grubii H99]
          Length = 750

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 169/292 (57%), Positives = 221/292 (75%), Gaps = 6/292 (2%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           M+ + SHP I DGWFRE  T WPGQAM L+++++L  EKSL+QDVL+F+S  YG VLVLD
Sbjct: 1   MAVSQSHPNIVDGWFREINTQWPGQAMTLKVKQILHQEKSLFQDVLVFESETYGNVLVLD 60

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
           GV+Q TERDEFSYQEMITH+PM  H NPENVLVI      V+REV KH+SVK++ LCDID
Sbjct: 61  GVIQATERDEFSYQEMITHLPMASHPNPENVLVIGGGDGGVIREVLKHKSVKKVTLCDID 120

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIR+SK++LP M+  + + +V VHIGDGF+FL +  N +D+IITD+SDPVGPAE+LFQ
Sbjct: 121 EAVIRVSKQWLPLMSDCYKDSRVEVHIGDGFKFLPEHKNEYDVIITDSSDPVGPAEALFQ 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF+L+K AL+ GG +STQ EC W+HL LI  ++  C +L+PVV+Y +TTIPTYP+GQI
Sbjct: 181 PPYFQLLKEALKEGGSVSTQAECLWVHLPLIKTLKETCSKLFPVVKYGFTTIPTYPAGQI 240

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           G ++CS D   +L  PLR   +       RYYNS++H AAF +P+F +  L+
Sbjct: 241 GIMVCSKDSTRDLTVPLRAVPD------TRYYNSEVHRAAFTIPEFGRAMLE 286



>gi|431906335|gb|ELK10532.1| Mannan-binding lectin serine protease 2, partial [Pteropus alecto]
          Length = 905

 Score =  363 bits (933), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 162/277 (58%), Positives = 219/277 (79%), Gaps = 1/277 (0%)

Query: 22  GWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFS 81
           GWFRE   LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERDEFS
Sbjct: 1   GWFRETCGLWPGQALSLQVEQLLHHQRSRYQDILVFRSKSYGNVLVLDGVIQCTERDEFS 60

Query: 82  YQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLP 141
           YQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK+LP
Sbjct: 61  YQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHSSVESVVQCEIDEDVIQVSKKFLP 120

Query: 142 KMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALR 201
            MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK AL+
Sbjct: 121 GMAIGYSSSKLTLHVGDGFEFMKQNRDAFDVIITDSSDPMGPAESLFKESYYQLMKTALK 180

Query: 202 PGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVN 261
             GI+  QGECQWLHLDLI  +Q +CR L+PVV YAY TIPTYPSGQIGF+LCS +   N
Sbjct: 181 EDGILCCQGECQWLHLDLIKDMQHFCRSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPNTN 240

Query: 262 LKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTK 297
             +P+++ ++++ E++  RYYNS +H AAF+LP+F +
Sbjct: 241 FLEPVQQLTQKQVEQMQLRYYNSDVHRAAFVLPEFAR 277



>gi|350585594|ref|XP_003481998.1| PREDICTED: spermidine synthase [Sus scrofa]
          Length = 302

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 159/284 (55%), Positives = 225/284 (79%), Gaps = 1/284 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWF E  +LWPGQA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFHETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKSYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH +V+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPAVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+ + + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAVSYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV+YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEEGILCCQGECQWLHLDLIKEMRQFCKSLFPVVDYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNALK 301
             N ++P++  ++++ E++  RYYNS +H AAF+LP+F + AL 
Sbjct: 256 STNFREPVQLLTQKQVEQRQLRYYNSDVHRAAFVLPEFARKALN 299



>gi|472581620|gb|EMS19348.1| saccharopine dehydrogenase (NADP+, L-glutamate forming)
           [Rhodosporidium toruloides NP11]
          Length = 791

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 173/299 (57%), Positives = 214/299 (71%), Gaps = 11/299 (3%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPG-----QAMCLEIEEVLCHEKSLYQDVLIFKSTHYGI 64
           M+   SHP I DGWFRE    WPG     QAM L +++VL  EKSLYQDVL+F+ST +G 
Sbjct: 37  MAAELSHPLIVDGWFREISEQWPGDGTAGQAMTLRVKKVLHTEKSLYQDVLVFESTDHGN 96

Query: 65  VLVLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIV 124
           VLVLDG +QC ERDEFSYQEMI H+P+  H NPE VLVI      VLREV KH SVK   
Sbjct: 97  VLVLDGAIQCVERDEFSYQEMIAHLPLASHPNPEKVLVIGGGDGGVLREVLKHPSVKSAT 156

Query: 125 LCDIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPA 184
           LCDIDE+V R+SK++LP MA GF++P+VTV IGDGF+FL DK N FD+IITD+SDPVGPA
Sbjct: 157 LCDIDEAVPRVSKQFLPHMAAGFNDPRVTVFIGDGFKFLDDKKNEFDVIITDSSDPVGPA 216

Query: 185 ESLFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTY 244
            SLFQ  YF+L+K +LR GG ISTQGEC WLHL LI  + S  R L+P  E+ +T+IPTY
Sbjct: 217 NSLFQKPYFQLLKESLREGGTISTQGECVWLHLPLINDLMSMSRTLFPKAEFGWTSIPTY 276

Query: 245 PSGQIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           PSG IGF++ ++D K +L+ PLR      + + CRY++  IH  AF LP F +  + +S
Sbjct: 277 PSGTIGFVVATLDGKRDLRTPLR------DIQGCRYWSKAIHRQAFTLPAFAQAVVDKS 329



>gi|344302668|gb|EGW32942.1| hypothetical protein SPAPADRAFT_60281 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 296

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 168/296 (56%), Positives = 224/296 (75%), Gaps = 2/296 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   SHP I+DGWF E   T+WPGQAM L++E+VL  E+S YQDVL+FKS+ YG VLVL
Sbjct: 1   MAQELSHPSIKDGWFAEISETMWPGQAMSLQVEKVLHVEQSKYQDVLVFKSSTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           DG +Q TERDEFSYQEMITH+ +N H NP+  LVI      VLRE+ KHES++E  LCDI
Sbjct: 61  DGCIQVTERDEFSYQEMITHLALNSHPNPKKALVIGGGDGGVLREILKHESIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP+M+  +++P+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLF
Sbjct: 121 DETVIEVSKKYLPEMSKSYNDPRTKVHIGDGFKFLAEYKNQFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YFEL+++AL   G+I+TQ E  W+H+D+I++++  C++++PV EYAYT IPTYPSG 
Sbjct: 181 QKPYFELLRDALTEKGVITTQAENMWIHMDIISKLKKDCQDVFPVAEYAYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           IGF++CS D   ++ KP+R  WS+E   K  +YYN +IHEA+FILP +    L ++
Sbjct: 241 IGFMVCSKDKNADVTKPIRFDWSDEFVSKNLKYYNKRIHEASFILPTWADEKLNKN 296



>gi|354548134|emb|CCE44870.1| hypothetical protein CPAR2_406730 [Candida parapsilosis]
          Length = 297

 Score =  362 bits (930), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 170/297 (57%), Positives = 221/297 (74%), Gaps = 2/297 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I+DGWF E   T+WPGQAM L++++VL  EKS YQDVL+FKS  YG VLVL
Sbjct: 1   MSEQLTHPSIKDGWFAEISETMWPGQAMSLKVDKVLHVEKSKYQDVLVFKSETYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEFSYQEMI H+ +N H NP+  LVI      VLRE+ KHES++E  LCDI
Sbjct: 61  DNCIQVTERDEFSYQEMIAHLALNSHPNPKKALVIGGGDGGVLREILKHESIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKK+LP+M+  + +P+  VHIGDGF+FL +  N FD+IITD+SDP GPAE+LF
Sbjct: 121 DETVIEVSKKFLPEMSKSYQDPRTKVHIGDGFKFLEEYKNQFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF+L+K+AL   G+I+TQ E  W+H+D+I++++  C E++PV EYAYT IPTYPSG 
Sbjct: 181 QKPYFQLLKDALTEKGVITTQAENMWIHMDIISKLKKECGEIFPVAEYAYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           IGF++CS D   N+KKP+R  WS+E   K  +YYN QIHEA+FILP +    L +SS
Sbjct: 241 IGFMVCSKDPNANVKKPVRFDWSDEFVAKNLKYYNKQIHEASFILPNWADQKLNKSS 297



>gi|241951762|ref|XP_002418603.1| spermidine synthase, putative [Candida dubliniensis CD36]
 gi|223641942|emb|CAX43906.1| spermidine synthase, putative [Candida dubliniensis CD36]
          Length = 297

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 169/295 (57%), Positives = 220/295 (74%), Gaps = 2/295 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I+DGWF E   T+WPGQAM L++E+VL  EKS YQDVL+FKST YG VLVL
Sbjct: 1   MAQELTHPAIKDGWFAEISDTMWPGQAMSLKVEKVLHVEKSKYQDVLVFKSTTYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEFSYQEMITH+ +N H NP+  LVI      VLRE+ KHES++E  LCDI
Sbjct: 61  DNCIQVTERDEFSYQEMITHLALNSHPNPKKALVIGGGDGGVLREILKHESIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP MA  +++P+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLF
Sbjct: 121 DETVIEVSKKYLPNMAKSYEDPRTRVHIGDGFKFLEEYKNQFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF+L+K+AL   G+I+TQ E  W+H+D+I++++  C E++PV EYAYT IPTYPSG 
Sbjct: 181 QKPYFQLLKDALTEKGVITTQAENMWIHMDIISKLKKDCNEIFPVAEYAYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           IGF++CS D   ++ KP+R  W++E   K  +YYN +IHEAAF+LP +    L +
Sbjct: 241 IGFMVCSKDPNADVSKPIRFDWTDEFVAKNLKYYNKKIHEAAFVLPTWADQVLNK 295



>gi|119592082|gb|EAW71676.1| spermidine synthase, isoform CRA_b [Homo sapiens]
          Length = 313

 Score =  362 bits (929), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 223/282 (79%), Gaps = 1/282 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNA 299
             N ++P++  ++++  ++  +YYNS +H AAF+LP+F + +
Sbjct: 256 STNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKS 297



>gi|15077763|gb|AAK83327.1| chimeric spermidine synthase/saccharopine dehydrogenase
           [Cryptococcus neoformans]
          Length = 748

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 168/289 (58%), Positives = 218/289 (75%), Gaps = 6/289 (2%)

Query: 13  TTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVV 72
           + SHP I DGWFRE  T WPGQAM L+++++L  EKSL+QDVL+F+S  YG VLVLDGV+
Sbjct: 2   SQSHPNIVDGWFREINTQWPGQAMTLKVKQILHQEKSLFQDVLVFESETYGNVLVLDGVI 61

Query: 73  QCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESV 132
           Q TERDEFSYQEMITH+PM  H NPENVLVI      V+REV KH+SVK++ LCDIDE+V
Sbjct: 62  QATERDEFSYQEMITHLPMASHPNPENVLVIGGGDGGVIREVLKHKSVKKVTLCDIDEAV 121

Query: 133 IRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKY 192
           IR+SK++LP M+  + + +V VHIGDGF+FL +  N +D+IITD+SDPVGPAE+LFQ  Y
Sbjct: 122 IRVSKQWLPLMSDCYKDSRVEVHIGDGFKFLPEHKNEYDVIITDSSDPVGPAEALFQPPY 181

Query: 193 FELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFI 252
           F+L+K AL+ GG +STQ EC W+HL LI  ++  C +L+PVV+Y +TTIPTYP+GQIG +
Sbjct: 182 FQLLKEALKEGGSVSTQAECLWVHLPLIKTLKETCSKLFPVVKYGFTTIPTYPAGQIGIM 241

Query: 253 LCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           +CS D   +L  PLR           RYYNS++H AAF +P+F +  L+
Sbjct: 242 VCSKDSTRDLTVPLRAVPTP------RYYNSEVHRAAFTIPEFGRAMLE 284



>gi|74138635|dbj|BAE27138.1| unnamed protein product [Mus musculus]
          Length = 302

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 224/284 (78%), Gaps = 1/284 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H N   VL+I      VLREV KH SV+ +V C+IDE VI +SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNQRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+GF + K+T+H+GDGFEF++   ++FD+IITD+SDP+G AESLF+  Y++LMK 
Sbjct: 136 FLPGMAVGFSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGHAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV+YAY +IPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVDYAYCSIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALK 301
             N ++P+++ ++ + E++  +YYNS +H AAF+LP+FT+ AL 
Sbjct: 256 STNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLPEFTRKALN 299



>gi|395329578|gb|EJF61964.1| saccharopine dehydrogenase [Dichomitus squalens LYAD-421 SS1]
          Length = 753

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 174/287 (60%), Positives = 222/287 (77%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  YG VL+LDGV+QC
Sbjct: 5   THPSIKDGWFREISSQWPGQAMTLKVNKILHVEKSLYQDVLVFESATYGNVLILDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI HIP+  H +P+ VLVI      V+REV KH+SV+E+VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHIPLASHPDPKKVLVIGGGDGGVVREVLKHDSVQEVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP M+   ++P+VTV +GDGF+FL D  +++D+IITD+SDPVGPA SLFQ  YFE
Sbjct: 125 VSKQYLPHMSALLNDPRVTVFVGDGFKFLADNTSTYDVIITDSSDPVGPAASLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+++AL PGG ISTQGEC W+HLDLI  +    R L+PV EYAYTTIPTYPSGQIGF++ 
Sbjct: 185 LLRDALTPGGHISTQGECLWIHLDLIQDLLKTTRSLFPVAEYAYTTIPTYPSGQIGFMVA 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S +   +L KPLR      E    RYYN+++H AAF+LP+F +  LK
Sbjct: 245 SKEAGRDLSKPLR------EVPGTRYYNAEVHRAAFVLPEFGRALLK 285



>gi|426381292|ref|XP_004057284.1| PREDICTED: spermidine synthase-like [Gorilla gorilla gorilla]
          Length = 297

 Score =  359 bits (921), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 160/293 (54%), Positives = 224/293 (76%), Gaps = 4/293 (1%)

Query: 12  GTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGV 71
             +S   I++GWF E  +LWPGQA+ L++E++L H +S YQD+L+F+S  YG VLVLDGV
Sbjct: 9   AASSPAAIREGWFCETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGV 68

Query: 72  VQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDES 131
           +QCTERDEFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE 
Sbjct: 69  IQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDED 128

Query: 132 VIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVK 191
            I++SKK+LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  
Sbjct: 129 AIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKES 188

Query: 192 YFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGF 251
           Y++LMK AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF
Sbjct: 189 YYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGF 248

Query: 252 ILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           +LCS + + N ++P+++ ++ +     +YYNS +H AAF+LP+F + AL   S
Sbjct: 249 MLCSKNPRTNFQEPVQQVAQMQ----LKYYNSDVHRAAFVLPEFARKALNDVS 297



>gi|196007934|ref|XP_002113833.1| hypothetical protein TRIADDRAFT_57643 [Trichoplax adhaerens]
 gi|190584237|gb|EDV24307.1| hypothetical protein TRIADDRAFT_57643 [Trichoplax adhaerens]
          Length = 291

 Score =  359 bits (921), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 164/281 (58%), Positives = 213/281 (75%), Gaps = 8/281 (2%)

Query: 21  DGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEF 80
           DGWFRE  +LWPGQA  L+++E+L   +S YQD+ +FKS  YG VLVLDGV+Q TERDEF
Sbjct: 16  DGWFREFSSLWPGQAFTLQVDEILYQGRSKYQDIAVFKSKTYGNVLVLDGVIQLTERDEF 75

Query: 81  SYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYL 140
           SYQEMI+ +P+N H NP NVL+I      VLREV KH +VK++  C+IDE VI +SKKYL
Sbjct: 76  SYQEMISFLPLNSHPNPSNVLIIGGGDGGVLREVVKHPAVKKVTQCEIDEDVINVSKKYL 135

Query: 141 PKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNAL 200
           P  ++GF + KVTVHIGDG  F+++  + FD+IITD+SDP+GPA SLF+ +Y+ELMK AL
Sbjct: 136 PSTSVGFQSEKVTVHIGDGLAFMKNHKSEFDVIITDSSDPIGPASSLFEKEYYELMKTAL 195

Query: 201 RPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKV 260
            P       GECQWLHL LI  +Q++C+ +YPVV+YAYTTIPTYPSGQIG +LCS+D+K 
Sbjct: 196 AP-------GECQWLHLSLIKTMQNFCKTVYPVVDYAYTTIPTYPSGQIGLLLCSLDEKT 248

Query: 261 NLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
           N ++PL K+S  E +K   RYYN  +H A+F+LP+F + AL
Sbjct: 249 NFREPLYKFSPAEVKKFNLRYYNVDVHRASFVLPEFARKAL 289



>gi|409075374|gb|EKM75755.1| hypothetical protein AGABI1DRAFT_64147 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 759

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 219/287 (76%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I DGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  +G VLVLDGV+QC
Sbjct: 5   SHPSIVDGWFREISSQWPGQAMTLKVNKILHVEKSLYQDVLVFESETFGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  H NP+ VLV+      V+REV KH++V+++VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHLPLASHPNPKKVLVVGGGDGGVVREVLKHDTVEQVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP M+    +P+VTVHIGDGF+FL +  N++D+IITD+SDPVGPAESLFQ  YFE
Sbjct: 125 VSKQYLPHMSGLLADPRVTVHIGDGFKFLSNNQNTYDVIITDSSDPVGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ NAL PGG ISTQGECQW+ L LI  ++    E++   EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLHNALTPGGHISTQGECQWIQLSLIQDLKRVTTEIFQTTEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           +     +L+ P+R      E K  +YYN  IH  AF+LP+FT++ L+
Sbjct: 245 AKAPGRDLRTPVR------EVKNTKYYNKDIHRTAFVLPEFTRSVLE 285



>gi|156387866|ref|XP_001634423.1| predicted protein [Nematostella vectensis]
 gi|156221506|gb|EDO42360.1| predicted protein [Nematostella vectensis]
          Length = 288

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 165/284 (58%), Positives = 213/284 (75%), Gaps = 1/284 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
           +I +GWF E    WPGQAM +E+EEV+   KS +Q++L+FKS  +G VLVLDGV+QCT+R
Sbjct: 3   RIHNGWFSEINKQWPGQAMSIEVEEVIYEGKSKFQEILVFKSKSFGTVLVLDGVIQCTDR 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEFSYQEMI+ +P+N H NP+ VLVI      V+RE +KH SV+ IV C+IDE VI +SK
Sbjct: 63  DEFSYQEMISMLPLNSHPNPKKVLVIGGGDGGVIREASKHPSVESIVQCEIDEDVINISK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           KYLP MA+G+ +PK+T HIGDGFE++++  N FD+IITD+SDPVGPAE+LFQ  Y+ELMK
Sbjct: 123 KYLPNMAVGYTSPKLTQHIGDGFEYMKNHENEFDVIITDSSDPVGPAEALFQQSYYELMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            AL+P G++  QGECQW+HL LI  +  +C+ L+ VV Y YTTIPTYP GQIGF+LCS D
Sbjct: 183 RALKPDGLLCCQGECQWIHLPLIKSMVEFCKTLFSVVSYGYTTIPTYPCGQIGFMLCSKD 242

Query: 258 DKVNLKKPLRKWSEEEEEKLC-RYYNSQIHEAAFILPQFTKNAL 300
                + P    S+++ E L  RYYNS IH+AAF+LPQF K  L
Sbjct: 243 KNTRFENPKIVLSDQQVEDLGFRYYNSDIHKAAFVLPQFAKKGL 286



>gi|448523556|ref|XP_003868892.1| Spe3 protein [Candida orthopsilosis Co 90-125]
 gi|380353232|emb|CCG25988.1| Spe3 protein [Candida orthopsilosis]
          Length = 297

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 220/297 (74%), Gaps = 2/297 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           MS   +HP I+DGWF E   T+WPGQAM L++++VL  EKS YQDVL+FKS  YG VLVL
Sbjct: 1   MSEQLTHPSIKDGWFAEISETMWPGQAMSLKVDKVLHVEKSKYQDVLVFKSETYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEFSYQEMI H+ +N H NP+  LVI      VLRE+ KHES++E  LCDI
Sbjct: 61  DNCIQVTERDEFSYQEMIAHLALNSHPNPKKALVIGGGDGGVLREILKHESIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP+M+  + +P+  VHIGDGF+FL +  N FD+IITD+SDP GPAE+LF
Sbjct: 121 DETVIEVSKKYLPEMSKSYQDPRTKVHIGDGFKFLEEYKNQFDVIITDSSDPEGPAETLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF+L+K+AL   G+I+TQ E  W+H+D+I++++  C E++PV EYAYT IPTYPSG 
Sbjct: 181 QKPYFQLLKDALTEKGVITTQAENIWIHMDIISKLKKDCAEIFPVAEYAYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           IGF++CS D   N++KP+R  WS+E   K  +YYN +IHEA+FILP +    L + +
Sbjct: 241 IGFMVCSKDPNANVRKPIRFDWSDEFVAKNLKYYNREIHEASFILPNWADQKLNKGN 297



>gi|409041357|gb|EKM50842.1| hypothetical protein PHACADRAFT_262714, partial [Phanerochaete
           carnosa HHB-10118-sp]
          Length = 748

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 169/287 (58%), Positives = 223/287 (77%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   THPSIRDGWFREISSQWPGQAMTLKVRKILHVEKSLYQDVLVFESETYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  H NPE VLVI      V+REV KH SVK +VLCDIDE+V+R
Sbjct: 65  TERDEFSYQEMIAHLPLASHPNPEKVLVIGGGDGGVVREVLKHASVKNVVLCDIDEAVVR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +S+++LP M+   D+ +VT+HIGDGF+FL D  +++D+IITD+SDPVGPAESLFQ  YFE
Sbjct: 125 VSRQFLPHMSALLDDARVTIHIGDGFKFLADNTSTYDVIITDSSDPVGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  AL PGG I+TQ EC W+HLDLI ++ +   +++PV EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLHGALAPGGHIATQAECLWIHLDLIKELVATVGKIFPVAEYAYTTIPTYPSGQIGFLIC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S +   ++++PLR+ S        RYYN ++H AAF+LP+F++  L+
Sbjct: 245 SKESGRSMREPLRQVSP------TRYYNDKVHRAAFVLPEFSRAFLE 285



>gi|409041361|gb|EKM50846.1| hypothetical protein PHACADRAFT_187523 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 749

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 172/290 (59%), Positives = 221/290 (76%), Gaps = 6/290 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP IQDGWFRE  + WPGQAM L++ ++L  EKS YQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   SHPSIQDGWFREISSQWPGQAMTLKVRKILHVEKSFYQDVLVFESETYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  HSNPE VLVI      V+REV KH SV+ +VLCDIDE+V+R
Sbjct: 65  TERDEFSYQEMIAHLPLASHSNPEKVLVIGGGDGGVVREVLKHASVRNVVLCDIDEAVVR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +S+++LP M+   D+ +VT+HIGDGF+FL D  +++D+IITD+SDPVGPAESLFQ  YFE
Sbjct: 125 VSRQFLPHMSALLDDARVTIHIGDGFKFLADNTSTYDVIITDSSDPVGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  AL PGG I+TQ ECQW+HL LI +V    R ++PVV YAYTTIPTYP GQIGF++C
Sbjct: 185 LLHGALAPGGHIATQAECQWIHLPLIAEVIRTARRIFPVVGYAYTTIPTYPCGQIGFLVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           S D+  ++++P+R+          RYYN+ IH AAF LP+F++  L+  S
Sbjct: 245 SKDEGRDIREPVRQVEP------TRYYNTGIHRAAFTLPEFSRVCLEEGS 288



>gi|426327781|ref|XP_004024689.1| PREDICTED: spermidine synthase [Gorilla gorilla gorilla]
          Length = 300

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 159/283 (56%), Positives = 221/283 (78%), Gaps = 4/283 (1%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L   +S YQD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 16  IREGWFRETCSLWPGQALSLQVEQLLHPRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD 75

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK
Sbjct: 76  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKK 135

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK 
Sbjct: 136 FLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKT 195

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  G++  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 196 ALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP 255

Query: 259 KVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             N ++P+++ ++ +     +YYNS +H AAF+LP+F + A K
Sbjct: 256 STNFQEPVQQVAQMQ----LKYYNSDVHRAAFVLPEFARFARK 294



>gi|392575275|gb|EIW68409.1| hypothetical protein TREMEDRAFT_74272 [Tremella mesenterica DSM
           1558]
          Length = 749

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 167/290 (57%), Positives = 220/290 (75%), Gaps = 6/290 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I DGWFRE  + WPGQAM L+++E+L  EKSLYQDVL+F S  YG VLVLDG +QC
Sbjct: 5   SHPAIVDGWFREISSQWPGQAMTLKVKEILHVEKSLYQDVLVFNSETYGNVLVLDGAIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEF+YQEMITHIPM  H +P++VLVI      V+REV KH+SV+++ LCDIDE+VIR
Sbjct: 65  TERDEFAYQEMITHIPMASHPDPKHVLVIGGGDGGVIREVLKHKSVEKVTLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP M+  + + +V VHIGDGF+FL D  +S+D+IITD+SDPVGPAE+LF+  YF+
Sbjct: 125 VSKEYLPAMSACYKDKRVEVHIGDGFKFLPDHKDSYDVIITDSSDPVGPAEALFKPDYFK 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+K +L+ GG ISTQ EC WLHL L+ +++  C +L+PV E+A+TTIPTYPSGQI  ++C
Sbjct: 185 LLKESLKKGGNISTQAECLWLHLPLMRELKQNCSKLFPVCEFAFTTIPTYPSGQISVMIC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           S ++   +  PLR  S+       RYYNS IH+AAF LP+F +  L+  +
Sbjct: 245 SKEEGRKVTVPLRAVSD------TRYYNSAIHKAAFTLPEFGRAILEEGT 288



>gi|302684945|ref|XP_003032153.1| hypothetical protein SCHCODRAFT_257151 [Schizophyllum commune H4-8]
 gi|300105846|gb|EFI97250.1| hypothetical protein SCHCODRAFT_257151 [Schizophyllum commune H4-8]
          Length = 755

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 213/286 (74%), Gaps = 6/286 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I+DGWFRE  + WPGQAM L++  +L  EKS YQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   SHPSIRDGWFRETSSQWPGQAMSLKVNRILHVEKSTYQDVLVFESATYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+P+  H  P+ VLV+      V+REV K++ V+++VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLPLASHPCPKQVLVVGGGDGGVVREVLKYDCVEQVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP M+    +PKVTVHIGDGF FL D   ++D+IITD+SDPVGPAESLFQ  YFE
Sbjct: 125 VSKQYLPHMSSLLASPKVTVHIGDGFSFLADNRATYDVIITDSSDPVGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  AL PGG  ++Q EC WLHL LI  V S  R+++PVVEYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLHAALAPGGTTASQSECLWLHLPLIKDVVSMARDIFPVVEYAYTTIPTYPSGQIGFLVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           S D   +L+ P R            YYN+ +H AAF+LP+F ++ L
Sbjct: 245 SKDADGDLRSPARAVPGTA------YYNADVHRAAFVLPEFARSVL 284



>gi|501310359|dbj|GAC99128.1| spermidine synthase [Pseudozyma hubeiensis SY62]
          Length = 744

 Score =  355 bits (911), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 167/271 (61%), Positives = 212/271 (78%), Gaps = 8/271 (2%)

Query: 36  MCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHIPMNCHS 95
           M LE++ +L HEKSL+QDVL+F+ST +G VLVLDGV+QCTERDEFSYQEMI H+P+  H 
Sbjct: 1   MSLEVQRILHHEKSLFQDVLVFESTTFGNVLVLDGVIQCTERDEFSYQEMIAHLPIASHP 60

Query: 96  NPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDNPKVTVH 155
           NPE VLVI      VLREV KH+SVKE VLCDIDE+V R+SK+YLP MA G  +PK TV 
Sbjct: 61  NPERVLVIGGGDGGVLREVVKHDSVKEAVLCDIDEAVPRVSKQYLPHMAEGLTHPKSTVI 120

Query: 156 IGDGFEFLRDKVN--SFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQGECQ 213
           IGDGF+FL+D  N  SFD+IITD+SDPVGPAE+LFQ  YF L+K AL+PGG ISTQ EC 
Sbjct: 121 IGDGFKFLQDPKNKASFDVIITDSSDPVGPAEALFQQPYFALLKGALKPGGHISTQAECV 180

Query: 214 WLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRKWSEEE 273
           W+HL+LI +++   +EL+PV +YA+TTIPTYPSGQIGF++CS+D   N+++PLR      
Sbjct: 181 WIHLNLIGELRRSTKELFPVADYAFTTIPTYPSGQIGFVVCSLDANRNVREPLR------ 234

Query: 274 EEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           E   CRYYNSQ+H+AAF +P+F +  ++  +
Sbjct: 235 EVPNCRYYNSQVHKAAFTVPEFARKVIEDGA 265



>gi|50420767|ref|XP_458921.1| DEHA2D10472p [Debaryomyces hansenii CBS767]
 gi|49654588|emb|CAG87075.1| DEHA2D10472p [Debaryomyces hansenii CBS767]
          Length = 297

 Score =  355 bits (911), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 168/297 (56%), Positives = 218/297 (73%), Gaps = 2/297 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I+DGWF E   T+WPGQAM L++E+VL  EKS YQDVL+FKST YG VLVL
Sbjct: 1   MAQELTHPSIKDGWFAEISDTMWPGQAMSLKVEKVLHVEKSKYQDVLVFKSTDYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +QCTERDEFSYQEMI H+ +N H NP+  LVI      VLRE+ KHES++E  LCDI
Sbjct: 61  DDCIQCTERDEFSYQEMIAHLALNSHPNPKKALVIGGGDGGVLREILKHESIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP+M+  + NP+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLF
Sbjct: 121 DETVIEVSKKYLPEMSQSYKNPRTKVHIGDGFKFLAEYKNQFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YF L+K+AL   G+I+TQ E  +LH+++I++++  C+E++PV EY YT IPTYPSG 
Sbjct: 181 QKPYFRLLKDALTEKGVITTQAENIFLHMEIISRLKKDCKEIFPVAEYGYTMIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           IGF++CS D   N+ KPLR  W +E   K  +YYN +IHEA F+LP +    L + +
Sbjct: 241 IGFMVCSKDPNANVTKPLRFDWDDEFVRKNLKYYNKKIHEACFVLPTWADEKLNKQN 297



>gi|326427880|gb|EGD73450.1| spermidine synthase [Salpingoeca sp. ATCC 50818]
          Length = 290

 Score =  353 bits (906), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 165/284 (58%), Positives = 210/284 (73%), Gaps = 2/284 (0%)

Query: 19  IQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
           ++ GWF E  P +WPGQ M LE E+VL   KS YQ +++FKS  YG VLVLDGV+Q TER
Sbjct: 4   MKKGWFSELSPEMWPGQCMSLEYEKVLEDIKSDYQHIVVFKSKTYGNVLVLDGVIQITER 63

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DE  YQEMITH+PM CH NPE VL+I      VLREV +H  VKE+  C+ID  VI LSK
Sbjct: 64  DECGYQEMITHLPMFCHPNPERVLIIGGGDGGVLREVLRHPCVKEVTQCEIDGKVIELSK 123

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           K+LP +A  FD+P+  V +GDGF+F+++   SFD+IITD+SDP+GPA SLF+ +Y+ LMK
Sbjct: 124 KHLPGIASCFDDPRANVIVGDGFKFMKEHEGSFDVIITDSSDPIGPASSLFEKEYYHLMK 183

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            ALRPGGI+ +QGEC WLHLDLI  +Q +C+ELYP V YAY T+PTYPSGQIGF LCS+D
Sbjct: 184 TALRPGGIVCSQGECVWLHLDLIKSMQDFCKELYPTVGYAYATVPTYPSGQIGFTLCSLD 243

Query: 258 DKVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNAL 300
           D  +L  P R  ++E+ +E   +YYN+ +H AAF+LPQF +  L
Sbjct: 244 DSADLAHPCRTLTQEQVQEMGLQYYNTDVHTAAFVLPQFARKKL 287



>gi|426198024|gb|EKV47950.1| hypothetical protein AGABI2DRAFT_184364 [Agaricus bisporus var.
           bisporus H97]
          Length = 759

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 168/287 (58%), Positives = 217/287 (75%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I DGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  +G VLVLDGV+QC
Sbjct: 5   SHPSIVDGWFREISSQWPGQAMTLKVNKILHVEKSLYQDVLVFESETFGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  H NP+ VLV+      V+REV KH++V+++VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHLPLASHPNPKKVLVVGGGDGGVVREVLKHDTVEQVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP M+    + +VTVHIGDGF+FL +  N++D+IITD+SDPVGPAESLFQ  YFE
Sbjct: 125 VSKQYLPHMSSLLSDSRVTVHIGDGFKFLSNNQNTYDVIITDSSDPVGPAESLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ NAL PGG ISTQGECQW+ L LI  ++    E++   EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLHNALTPGGHISTQGECQWIQLSLIQDLKRVTSEIFQTTEYAYTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           +     +L+  +R      E K  +YYN  IH  AF+LP+FT++ L+
Sbjct: 245 AKAPGRDLRTSIR------EVKNTKYYNKDIHRTAFVLPEFTRSVLE 285



>gi|392588756|gb|EIW78088.1| saccharopine dehydrogenase [Coniophora puteana RWD-64-598 SS2]
          Length = 755

 Score =  352 bits (903), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 172/287 (59%), Positives = 222/287 (77%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I DGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   SHPSIVDGWFREISSQWPGQAMTLKVNKILHVEKSLYQDVLVFESQTYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+PM  H NP+ VLVI      V+REV KH++V+ +VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMITHLPMASHPNPKQVLVIGGGDGGVVREVLKHDTVESVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP M+    +P+VTV+IGDGF+FL D  N++D+IITD+SDPVGPAESLFQ  YF+
Sbjct: 125 VSKQYLPHMSSLLADPRVTVYIGDGFKFLADNQNTYDVIITDSSDPVGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG ISTQ EC W+HL LI  +++  + L+ V EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLHDALAPGGQISTQCECLWIHLPLINNLRAMTKGLFQVSEYAYTTIPTYPSGQIGFLVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S  +  NL++P+      +  K  RYYN+ +H AAF+LP+F ++ L+
Sbjct: 245 SKAEGRNLREPV------QTVKGTRYYNADVHRAAFVLPEFARSMLE 285



>gi|392559013|gb|EIW52198.1| saccharopine dehydrogenase [Trametes versicolor FP-101664 SS1]
          Length = 753

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 221/287 (77%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +H  I+DGWFRE  + WPGQAM L++  +L  EKSLYQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   THRSIKDGWFREISSQWPGQAMTLKVNRILHVEKSLYQDVLVFESATYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  H NP+ VLVI      V+REV KH++V+++VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHLPLASHPNPKKVLVIGGGDGGVVREVLKHDTVEQVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK++LP M+   ++P+VTV +GDGF+FL D  +++D+IITD+SDPVGPA SLFQ  YFE
Sbjct: 125 VSKQFLPHMSSLLNDPRVTVFVGDGFKFLADNTSTYDVIITDSSDPVGPAASLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+++AL PGG ISTQGEC W+HL LI  +    R L+PV EYA+TTIPTYPSGQIGF++C
Sbjct: 185 LLRDALTPGGHISTQGECLWIHLALIEDLLKTTRSLFPVSEYAFTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S +   +L KPLR           RYYNS++H+AAF+LP+F ++ LK
Sbjct: 245 SKEAGRDLSKPLRTVPN------TRYYNSEVHKAAFVLPEFGRSLLK 285



>gi|406699216|gb|EKD02426.1| spermidine synthase [Trichosporon asahii var. asahii CBS 8904]
          Length = 757

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 159/283 (56%), Positives = 212/283 (74%), Gaps = 6/283 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I DGWFRE    WPGQAM L++  +L HEKSL+QDVL+F+S  YG VLVLDG +Q 
Sbjct: 9   SHPSIVDGWFREISPQWPGQAMTLKVNRILHHEKSLFQDVLVFESETYGNVLVLDGAIQV 68

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+PMN H NPE VLVI      V+RE  K+++VK++ LCDIDE+VIR
Sbjct: 69  TERDEFSYQEMITHLPMNSHPNPERVLVIGGGDGGVIREALKYDTVKKVTLCDIDEAVIR 128

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK++LP ++  +D+P+V V IGDGF+FL +  N +D+I+TD+SDPVGPA +LF+  YF 
Sbjct: 129 VSKQFLPGLSKCYDDPRVEVFIGDGFKFLPEHENEYDVIVTDSSDPVGPAAALFEAPYFT 188

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L++NALR GG +STQGE  WLHL LI +++   ++L+PV EYA +TIPTYPSG +GF++C
Sbjct: 189 LLRNALREGGHMSTQGESIWLHLPLIKELRETTKKLFPVAEYATSTIPTYPSGSMGFLVC 248

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTK 297
           S +    + KP+R   +      C+YYN  +H AAF+LP+F +
Sbjct: 249 SKEPTRQMNKPIRDVPD------CKYYNKDVHTAAFVLPEFGR 285



>gi|344234284|gb|EGV66154.1| spermine synthase [Candida tenuis ATCC 10573]
 gi|344234285|gb|EGV66155.1| hypothetical protein CANTEDRAFT_112601 [Candida tenuis ATCC 10573]
          Length = 296

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 166/295 (56%), Positives = 218/295 (73%), Gaps = 2/295 (0%)

Query: 10  MSGTTSHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVL 68
           M+   +HP I+DGWF E   T+WPGQAM L +++VL  E+S YQDVL+F+ST YG VLVL
Sbjct: 1   MAQELTHPSIKDGWFAEISNTMWPGQAMSLRVKKVLHAERSKYQDVLVFESTDYGNVLVL 60

Query: 69  DGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDI 128
           D  +Q TERDEF+YQEMI H+ +N H NP+  LVI      VLRE+ KH S++E  LCDI
Sbjct: 61  DNCIQVTERDEFAYQEMIAHLAINSHPNPKKALVIGGGDGGVLREILKHSSIEEAWLCDI 120

Query: 129 DESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLF 188
           DE+VI +SKKYLP+M+  + +P+V VHIGDGF+FL +  N FD+IITD+SDP GPAESLF
Sbjct: 121 DEAVIEVSKKYLPEMSKSYADPRVHVHIGDGFKFLAEYKNQFDVIITDSSDPEGPAESLF 180

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
           Q  YFEL+K+AL   G+ISTQ E  +LH+ +I+Q++  C+ ++PV EYAYT IPTYPSG 
Sbjct: 181 QKPYFELLKDALTEKGVISTQAENLFLHMPIISQLKKDCQAIFPVAEYAYTLIPTYPSGS 240

Query: 249 IGFILCSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           IGF++CS D   N+KKP+R +WS+E   K  +YY  +IHEA+F+LP F    L +
Sbjct: 241 IGFMVCSKDKNANVKKPVRFEWSDEFVAKNLKYYTKEIHEASFVLPNFAHQILNK 295



>gi|353227289|emb|CCA77802.1| probable chimeric spermidine synthase/saccharopine reductase
           [Piriformospora indica DSM 11827]
          Length = 751

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 171/287 (59%), Positives = 217/287 (75%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE  + WPGQAM L++  +L  EKSLYQDVL+F+S  +G VLVLDGV+QC
Sbjct: 5   THPSIKDGWFREISSQWPGQAMTLKVNRILHVEKSLYQDVLVFESETFGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI HIP+  H NP+ VLVI      V+REV +HESV+E+VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHIPLASHPNPKKVLVIGGGDGGVVREVLRHESVQEVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP M+   D+ +V V +GDGF+FL D  +++D+IITD+SDPVGPAESLFQ  YF+
Sbjct: 125 VSKQYLPHMSELLDSSRVRVFVGDGFKFLADNTSTYDVIITDSSDPVGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG ISTQGEC W+HL LI    +  +E++PVVEYA+TTIPTYPSGQIGF L 
Sbjct: 185 LLHDALAPGGSISTQGECLWIHLPLIKNTNTMVKEIFPVVEYAFTTIPTYPSGQIGFCLA 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S D   +++ P+RK          RYYN  +H AAFILP+F +  L+
Sbjct: 245 SKDATRDMRTPVRKVEG------TRYYNEDVHRAAFILPEFGRRILE 285



>gi|401888169|gb|EJT52134.1| chimeric spermidine synthase/saccharopine dehydrogenase
           [Trichosporon asahii var. asahii CBS 2479]
          Length = 757

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 158/283 (55%), Positives = 213/283 (75%), Gaps = 6/283 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I DGWFRE    WPGQAM L++  +L HEKSL+QDVL+F+S  YG VLVLDG +Q 
Sbjct: 9   SHPSIVDGWFREISPQWPGQAMTLKVNRILHHEKSLFQDVLVFESETYGNVLVLDGAIQV 68

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITH+PMN H NPE VLVI      V+RE   +++VK++ LCDIDE+VIR
Sbjct: 69  TERDEFSYQEMITHLPMNSHPNPERVLVIGGGDGGVIREALMYDTVKKVTLCDIDEAVIR 128

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK++LP ++  +D+P+V V IGDGF+FL +  N +D+I+TD+SDPVGPA +LF+  YF 
Sbjct: 129 VSKQFLPGLSKCYDDPRVEVFIGDGFKFLPEHENEYDVIVTDSSDPVGPAAALFEAPYFT 188

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L++NALR GG +STQGE  WLHL LI +++   ++L+PV EYA +TIPTYPSG +GF++C
Sbjct: 189 LLRNALREGGHMSTQGESIWLHLPLIKELRETTKKLFPVAEYATSTIPTYPSGSMGFLVC 248

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTK 297
           S +    + KP+R+  +      C+YYN+ +H AAF+LP+F +
Sbjct: 249 SKEPTRQMNKPIRQVPD------CKYYNNDVHTAAFVLPEFGR 285



>gi|126138914|ref|XP_001385980.1| hypothetical protein PICST_84352 [Scheffersomyces stipitis CBS
           6054]
 gi|126093258|gb|ABN67951.1| spermidine synthase [Scheffersomyces stipitis CBS 6054]
          Length = 300

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 164/292 (56%), Positives = 216/292 (73%), Gaps = 2/292 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           +HP I+DGWF E   T+WPGQAM L++E+VL  EKS YQDVL+FKS  YG VLVLD  +Q
Sbjct: 8   THPSIKDGWFAEVSDTMWPGQAMSLKVEKVLHTEKSKYQDVLVFKSETYGNVLVLDNCIQ 67

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMITH+ +N H NP+  LVI      VLRE+ KHES++E  LCDIDE+VI
Sbjct: 68  VTERDEFSYQEMITHLALNSHPNPKKALVIGGGDGGVLREILKHESIEEAWLCDIDETVI 127

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
            +SKKYLP+M+  +++P+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLFQ  YF
Sbjct: 128 EVSKKYLPEMSKSYNDPRTKVHIGDGFKFLAEYKNQFDVIITDSSDPEGPAESLFQKPYF 187

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           EL+  AL   G+I+TQ E  WLH+ +I++++  C++++ V EY YT IPTYPSG IGF++
Sbjct: 188 ELLSGALTEKGVITTQAENIWLHMPIISKLKQDCKQIFAVAEYGYTMIPTYPSGSIGFMV 247

Query: 254 CSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           CS D   ++ KP+R  WS+E   K  +YYN +IHEAAF+LP +    L +++
Sbjct: 248 CSKDPNADVTKPIRFDWSDEFVSKNLKYYNKRIHEAAFVLPTWADEILNKNN 299



>gi|392339226|ref|XP_003753758.1| PREDICTED: LOW QUALITY PROTEIN: spermidine synthase-like [Rattus
           norvegicus]
          Length = 329

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 158/283 (55%), Positives = 221/283 (78%), Gaps = 1/283 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWFRE  +LWPGQA+ L++E++L   +S YQD+L+F+S  YG VLVLD V+QCTERD
Sbjct: 43  IREGWFRETCSLWPGQALSLQVEQLLHQRRSRYQDILVFRSKTYGNVLVLDSVIQCTERD 102

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI ++P+  H NP  VL+I      +L EV KH SV+ +V C+IDE VI +SKK
Sbjct: 103 EFSYQEMIANLPLCSHPNPRKVLIIGGGDXGILXEVVKHPSVESVVQCEIDEDVIEVSKK 162

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA+G+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+   ++LMK 
Sbjct: 163 FLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESCYQLMKT 222

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS + 
Sbjct: 223 ALKEDGILRCQGECQWLHLDLIKEMRHFCKSLFPVVSYAYCTIPTYPSGQIGFMLCSKNP 282

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
             N ++P+++ ++ + E++  +YYNS +H AAF+LP+FT  AL
Sbjct: 283 STNFREPVQQLTQVQVEQMQLKYYNSDMHRAAFVLPEFTPKAL 325



>gi|390597080|gb|EIN06480.1| saccharopine dehydrogenase [Punctularia strigosozonata HHB-11173
           SS5]
          Length = 754

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 171/287 (59%), Positives = 217/287 (75%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I DGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   THPSIVDGWFREISSQWPGQAMTLKVRKILHVEKSLYQDVLVFESETYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMITHIP+  H NP+ VLVI      V+REV KHESV E+VLCDIDE+V+R
Sbjct: 65  TERDEFSYQEMITHIPLASHPNPKKVLVIGGGDGGVVREVLKHESVDEVVLCDIDETVVR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK++LP M+    NP+V V IGDGF+FL++  +++D IITD+SDPVGPAE+LF+  YF+
Sbjct: 125 VSKQFLPHMSSLLSNPRVRVFIGDGFKFLQENTSTYDAIITDSSDPVGPAEALFEKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG ISTQGEC WLHL LI  +    + L+PV EYA+TTIPTYPSGQIGF++C
Sbjct: 185 LLHDALAPGGHISTQGECLWLHLPLIKDLNKMTQGLFPVAEYAFTTIPTYPSGQIGFVIC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S +   +LK P+RK          RYYN  +H AAF+LP+F +  L+
Sbjct: 245 SKEAGRDLKTPVRKVEG------TRYYNDAVHRAAFVLPEFGRAMLE 285



>gi|198427208|ref|XP_002128514.1| PREDICTED: spermidine synthase [Ciona intestinalis]
          Length = 307

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 212/287 (73%), Gaps = 1/287 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
           +++  WF E  +LWPGQ M LE+EEVL HE+S YQDVL+FKS  YG VLVLDGV+QCTER
Sbjct: 3   ELKLNWFSELNSLWPGQCMSLEVEEVLFHERSKYQDVLVFKSKTYGNVLVLDGVIQCTER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMI H+P+  H NP+NVLVI      V+REV KH SV  I  C+ID+ VI +S+
Sbjct: 63  DEFAYQEMIAHLPLFSHPNPKNVLVIGGGDGGVIREVLKHSSVVSITQCEIDQVVIDVSR 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           K+LP M+   D+P+VT  +GDG  F+R+    FD+IITD+SDP GPAE+LF+  Y++LM+
Sbjct: 123 KFLPSMSKSMDDPRVTQFVGDGLAFMREHKAEFDVIITDSSDPQGPAEALFEKPYYQLMQ 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            AL+ GGII  QGEC WLHL LI  ++ +C  ++P V Y Y TIPTYPSGQIGF+LCS +
Sbjct: 183 KALKDGGIICAQGECVWLHLSLICNMKKFCETVFPSVAYGYCTIPTYPSGQIGFMLCSQN 242

Query: 258 DKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRS 303
            + N K+P R  S +E  K+  +YYNS +H+AAF+LPQF K+AL+ +
Sbjct: 243 KETNFKEPCRVLSCDEVNKMELKYYNSDVHKAAFVLPQFAKSALENN 289



>gi|403418525|emb|CCM05225.1| predicted protein [Fibroporia radiculosa]
          Length = 747

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 169/283 (59%), Positives = 219/283 (77%), Gaps = 6/283 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SH  I+DGWFRE  + WPGQAM L+++++L  EKSLYQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   SHRSIKDGWFREISSQWPGQAMTLKVKKILHVEKSLYQDVLVFESETYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  H NP+ VLVI      V+REV KH++V+ +VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHLPLASHPNPKKVLVIGGGDGGVVREVLKHDTVENVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP M+    +P+VTV++GDGF+FL D V+S+D IITD+SDPVGPA SLFQ  YFE
Sbjct: 125 VSKQYLPHMSSLLSDPRVTVYVGDGFKFLEDNVSSYDAIITDSSDPVGPAASLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+  AL PGG ISTQ EC WLHL LI +++   + L+PV EYA+TTIPTYPSGQIGF++C
Sbjct: 185 LLHGALTPGGHISTQAECLWLHLPLINELRQTTQSLFPVAEYAFTTIPTYPSGQIGFVVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTK 297
           S +   ++K P+R  S        RYYN+++H+AAF+LP+F +
Sbjct: 245 SKEAGRDVKVPIRTVSP------TRYYNAEVHKAAFVLPEFGR 281



>gi|336369311|gb|EGN97653.1| hypothetical protein SERLA73DRAFT_92863 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336382096|gb|EGO23247.1| hypothetical protein SERLADRAFT_362472 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 754

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 166/287 (57%), Positives = 222/287 (77%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   THPSIKDGWFREISSQWPGQAMTLKVNKILHMEKSLYQDVLVFESETYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  H NP+ VLVI      V+REV KH++V+++VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHLPLASHPNPKKVLVIGGGDGGVVREVLKHDTVEQVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK YLP M+    +P+VTV +GDGF+FL D   ++D+IITD+SDPVGPAESLFQ  YF+
Sbjct: 125 VSKTYLPHMSSLLSSPRVTVFVGDGFKFLADNEATYDVIITDSSDPVGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG ISTQGE  WLHL LI+++++  RE++ V EYA+TTIPTYPSGQIGF++C
Sbjct: 185 LLHDALTPGGHISTQGESLWLHLPLISELRNMTREIFAVSEYAFTTIPTYPSGQIGFVVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           S +   +L+ P+RK ++        YYN  +H +AF+LP+F + +L+
Sbjct: 245 SKEKGRDLRTPVRKIAD------TLYYNENVHRSAFVLPEFARASLE 285



>gi|507112387|emb|CDF36070.1| putrescine aminopropyltransferase (spermidine synthase) [Chondrus
           crispus]
          Length = 290

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 161/283 (56%), Positives = 213/283 (75%), Gaps = 2/283 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I+DGWF EK  LWPGQAM LE+ E+L H ++ +QD+L+F+S  YG VLVLDGV+QCTERD
Sbjct: 9   IKDGWFMEKGALWPGQAMSLEVAEILHHGRTKFQDLLVFRSKAYGNVLVLDGVIQCTERD 68

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           E++YQEMI H+P+ CH NPE VLVI      VLREV KH SVK+ VLC+IDE VI  SKK
Sbjct: 69  EYAYQEMIAHLPLFCHPNPERVLVIGGGDGGVLREVLKHSSVKKAVLCEIDEGVIEASKK 128

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           Y P M+  F + +V + I DG  +++D  + +DIIITD+SDP+GPAE LF+  ++E M  
Sbjct: 129 YFPAMSCSFQDERVELKIMDGAVYMKDHQDEYDIIITDSSDPIGPAEVLFEKPFYESMYR 188

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           +LR GGI++TQGEC WLHL+LIT + + CRE+Y  VEYA+T+IPTYPSGQIG ++C+   
Sbjct: 189 SLRDGGIVATQGECMWLHLNLITPLMASCREIYSTVEYAFTSIPTYPSGQIGVLMCA-KQ 247

Query: 259 KVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
             NLK+P R  S+E +E   +YYNS+IH ++F+LP+F K AL+
Sbjct: 248 GCNLKEPCRSPSDEMQESF-QYYNSEIHTSSFVLPEFAKRALR 289



>gi|393233308|gb|EJD40881.1| saccharopine dehydrogenase [Auricularia delicata TFB-10046 SS5]
          Length = 750

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 169/288 (58%), Positives = 218/288 (75%), Gaps = 7/288 (2%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           M+G T HP I+DGWFRE  + WPGQAM L++  +L  EKSLYQDVL+F+S  YG VLVLD
Sbjct: 1   MAGLT-HPSIKDGWFREISSQWPGQAMTLKVNRILHVEKSLYQDVLVFESETYGNVLVLD 59

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
           GV+QCTERDEFSYQEMI H+P++ H NP+ VLVI      V+REV KH+SV E+VLCDID
Sbjct: 60  GVIQCTERDEFSYQEMIAHLPLSSHPNPKKVLVIGGGDGGVVREVLKHDSVDEVVLCDID 119

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E+VIR+SK YLP M+   ++P+V VHIGDGF+FL D  +++D+IITD+SDPVGPA SLFQ
Sbjct: 120 EAVIRVSKIYLPHMSALLESPRVRVHIGDGFKFLSDNTSTYDVIITDSSDPVGPAASLFQ 179

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             YF+L+ +AL PGG ISTQGE  WLHL LI +++    +++PV EYA+TTIPTYPSG I
Sbjct: 180 KPYFQLLHDALAPGGHISTQGEAMWLHLPLIRELRQITSKIFPVSEYAFTTIPTYPSGHI 239

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTK 297
           GF++CS +   +++ PLR        K  RY+N  +H AAF+LP+F +
Sbjct: 240 GFVICSKEKGRDMRTPLRTL------KGTRYWNPDVHRAAFVLPEFAR 281



>gi|328351802|emb|CCA38201.1| spermidine synthase [Komagataella pastoris CBS 7435]
          Length = 273

 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 165/271 (60%), Positives = 212/271 (78%)

Query: 30  LWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHI 89
           +WPGQAM L++E++L  E+SLYQDVLIF+ST YG VLVLDG +Q TERDEFSYQEMI H+
Sbjct: 1   MWPGQAMSLKVEKILHVEQSLYQDVLIFQSTDYGNVLVLDGAIQVTERDEFSYQEMIAHL 60

Query: 90  PMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDN 149
            +N H NP  VLVI      VLREV KHE V++ VLCDIDE+V RLSK YLP+MA  + +
Sbjct: 61  ALNSHPNPRKVLVIGGGDGGVLREVIKHECVEKAVLCDIDEAVPRLSKIYLPEMAKSYKH 120

Query: 150 PKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQ 209
           PKVT+HIGDGF+FL +  N+FD+IITD+SDP GPA SLF+  YF+L+ +AL   G+I+TQ
Sbjct: 121 PKVTLHIGDGFKFLDEYKNTFDVIITDSSDPEGPAASLFEKPYFKLLNDALTEKGVITTQ 180

Query: 210 GECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRKW 269
           GE  WLH+++I  ++  C E++PVVEYAY TIPTYPSGQIGF++CS D   +LK PLR +
Sbjct: 181 GENIWLHMEIIKNLKKACLEVFPVVEYAYCTIPTYPSGQIGFMVCSKDPNASLKFPLRSF 240

Query: 270 SEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           S+  E++  RYYN +IHEA+FILP + ++AL
Sbjct: 241 SDTFEKEHLRYYNKKIHEASFILPTWARDAL 271



>gi|358058660|dbj|GAA95623.1| hypothetical protein E5Q_02279 [Mixia osmundae IAM 14324]
          Length = 746

 Score =  346 bits (887), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 166/289 (57%), Positives = 215/289 (74%), Gaps = 6/289 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I DGWF E+ + WPGQAM L++E+VL  EKS +QDVL+FKST YG VLVLDG +Q 
Sbjct: 5   SHPGIVDGWFHERSSQWPGQAMSLQVEKVLHVEKSKFQDVLVFKSTDYGNVLVLDGAIQA 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI  +P+  H +P++VLV+      VLREV KH SVK  +L DIDE+V R
Sbjct: 65  TERDEFSYQEMIAFLPLASHPDPQDVLVVGGGDGGVLREVLKHPSVKRAILVDIDEAVPR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK YLP MA GF++P+V V IGDGFE+L++    FD+I TD+SDPVGPA SLFQ  YFE
Sbjct: 125 VSKLYLPGMAAGFNDPRVEVIIGDGFEYLKNNKAKFDVITTDSSDPVGPANSLFQKPYFE 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L++++L+PGG ISTQ EC WLHL LI+Q+    + L+PVVEYAYT+IPTYPSG IGFI+C
Sbjct: 185 LLRDSLKPGGAISTQAECIWLHLPLISQLVQDTKTLFPVVEYAYTSIPTYPSGTIGFIVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           S+D K +L+ PL    +       RY+N  +H A+F+LP+F +  ++ +
Sbjct: 245 SLDPKRDLRSPLVTIRD------TRYWNPTVHRASFVLPEFVRKPVEAA 287



>gi|470302017|ref|XP_004347506.1| spermidine synthase [Capsaspora owczarzaki ATCC 30864]
 gi|320169898|gb|EFW46797.1| spermidine synthase [Capsaspora owczarzaki ATCC 30864]
          Length = 353

 Score =  345 bits (886), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 151/283 (53%), Positives = 215/283 (75%), Gaps = 1/283 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           IQDGWF EK  LWPGQ + L++++VL H KS +QD+L+F+S  YG VLVLDG VQ TERD
Sbjct: 6   IQDGWFTEKSDLWPGQGLALKVKQVLHHAKSDFQDILVFQSESYGNVLVLDGAVQVTERD 65

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EF+YQEMI H+P+  H  P++VL++      V+REV KH++V+ I LC+ID  VI ++KK
Sbjct: 66  EFAYQEMIAHLPLCIHPYPKSVLIVGGGDGGVIREVIKHQAVEHITLCEIDPQVIEVAKK 125

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP +A+GF++P+VTVH+GDG E+++    +FD+IITD+SDP+GPA +LF+  ++  M+N
Sbjct: 126 YLPSLAVGFNDPRVTVHVGDGVEYMKQHAGNFDVIITDSSDPIGPASALFEQPFYAAMRN 185

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+P GI+ TQ E  WLHLDLI  ++ +C +L+PVV YA+T+IPTYP GQIGF++CS++ 
Sbjct: 186 ALKPNGIVCTQAESIWLHLDLICNMKRFCSKLFPVVGYAWTSIPTYPCGQIGFMICSLNP 245

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
              L++P R +S+ + + L  RYYN +IH ++F LPQF + AL
Sbjct: 246 LTELEQPTRSFSDTQLKSLPLRYYNKRIHTSSFTLPQFAQVAL 288



>gi|328863223|gb|EGG12323.1| hypothetical protein MELLADRAFT_28197 [Melampsora larici-populina
           98AG31]
          Length = 285

 Score =  345 bits (886), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 168/292 (57%), Positives = 216/292 (73%), Gaps = 8/292 (2%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           +SG T HP +QDGWF+E+  LWPGQA  L++++VL  +KS +QDVL+F+S  +G VLVLD
Sbjct: 1   ISGLT-HPSVQDGWFKEEIPLWPGQATSLQVKKVLHVDKSKFQDVLLFESVAHGNVLVLD 59

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
           G +QC E DEFSYQEMI HIP+N H NPE+ LVI      VLREV KH SVK  VLCDID
Sbjct: 60  GAIQCVEIDEFSYQEMIAHIPLNSHPNPEHFLVIGGGDGGVLREVLKHPSVKTAVLCDID 119

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPV-GPAESLF 188
           E+  R+SK YLP MA+G ++P+VT+ I DGF+ LRD+V  FD+IITD+SDP  GPA++LF
Sbjct: 120 EAFPRVSKDYLPHMAVGVNDPRVTLFIRDGFQALRDQVGKFDVIITDSSDPNEGPAQTLF 179

Query: 189 QVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQ 248
            + YF+ MKNALRP G ISTQGEC WL L LI  +    ++L+P V+YAYT+I TYPSG 
Sbjct: 180 GMPYFQFMKNALRPNGSISTQGECIWLPLPLIHSLIKGPKDLFPQVDYAYTSISTYPSGT 239

Query: 249 IGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           IGF++CS+D   NLKKPLR      + +  RYYN ++ EAAF+LP+F +  +
Sbjct: 240 IGFVVCSLDKDRNLKKPLR------QVRNTRYYNKRVDEAAFVLPEFARATI 285



>gi|449545146|gb|EMD36118.1| hypothetical protein CERSUDRAFT_85225 [Ceriporiopsis subvermispora
           B]
          Length = 753

 Score =  345 bits (885), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 165/282 (58%), Positives = 221/282 (78%), Gaps = 6/282 (2%)

Query: 16  HPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCT 75
           H  I+DGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  YG VLVLDGV+QCT
Sbjct: 6   HRCIRDGWFREISSQWPGQAMTLKVNKILHVEKSLYQDVLVFESETYGNVLVLDGVIQCT 65

Query: 76  ERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRL 135
           ERDEFSYQEMITH+P+  H NP+ VLVI      V+REV KH++V+++VLCDIDE+VIR+
Sbjct: 66  ERDEFSYQEMITHLPLASHPNPKKVLVIGGGDGGVVREVLKHDTVEQVVLCDIDEAVIRV 125

Query: 136 SKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFEL 195
           SK++LP M+   ++P+V V++GDGF+FL D  +++D IITD+SDPVGPA SLFQ  YFEL
Sbjct: 126 SKQFLPHMSGLLNDPRVVVYVGDGFKFLADNTSTYDAIITDSSDPVGPAASLFQKPYFEL 185

Query: 196 MKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCS 255
           +++AL PGG ISTQ EC WLHL LI +++   REL+PV EYA+TTIPTYPSGQIGF++CS
Sbjct: 186 LRDALAPGGHISTQAECLWLHLPLIRELRRTTRELFPVAEYAFTTIPTYPSGQIGFVVCS 245

Query: 256 IDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTK 297
            +   +LK P+R  +        +YYN+++H+AA++LP+F +
Sbjct: 246 KEAGRDLKTPVRAVTG------TKYYNAEVHKAAYVLPEFGR 281



>gi|444728183|gb|ELW68647.1| Serine/threonine-protein kinase mTOR [Tupaia chinensis]
          Length = 3780

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 153/274 (55%), Positives = 215/274 (78%), Gaps = 1/274 (0%)

Query: 32   PGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHIPM 91
            P QA+ L++E++L H++S YQD+L+F+S  YG VLVLDGV+QCTERDEFSYQEMI ++P+
Sbjct: 3507 PHQALSLQVEQLLHHQRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPL 3566

Query: 92   NCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDNPK 151
              H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK+LP MAIG+ + K
Sbjct: 3567 CSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSK 3626

Query: 152  VTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQGE 211
            +T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK AL+  G +  QGE
Sbjct: 3627 LTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGNLCCQGE 3686

Query: 212  CQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRKWSE 271
            CQWLHLDLI +++ +C+ L+PVV YAY TIPTYPSGQIGF+LCS +   N ++P+++ ++
Sbjct: 3687 CQWLHLDLIKEMRQFCKSLFPVVGYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQQLTQ 3746

Query: 272  EEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
            ++ E++  +YYNS +H AAF+LP+F + AL   S
Sbjct: 3747 KQVEQMQLKYYNSDVHRAAFVLPEFARKALNDVS 3780



>gi|443683877|gb|ELT87970.1| hypothetical protein CAPTEDRAFT_156944 [Capitella teleta]
          Length = 292

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 152/287 (52%), Positives = 214/287 (74%), Gaps = 1/287 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWF E   LWPGQ M LE+EEVL HEKS +QDV++ K+ H+G  L+LDGV+Q TE D
Sbjct: 4   IREGWFSEVNALWPGQCMSLEVEEVLLHEKSPFQDVMMLKTKHHGNALILDGVIQVTESD 63

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSY E+ +++P+N H NPE VL+I      + REV ++ +VK +  C+IDE V+   KK
Sbjct: 64  EFSYHEIGSNVPLNAHPNPEKVLIIGGGDGGMAREVCRNPAVKSVTQCEIDELVVNACKK 123

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP +A+GFD+PK+ + IGDGF+F+      FD+IITD+SDP GPA+ LF+  Y++LM  
Sbjct: 124 YLPNLAVGFDDPKMNLIIGDGFDFMGKHKGEFDVIITDSSDPFGPAKVLFEKPYYQLMME 183

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           ALRPGGII++QGEC WLHLDLI  +  +CRE++PVV+Y   ++PTYPSGQIGF+LCS++ 
Sbjct: 184 ALRPGGIIASQGECLWLHLDLIRDMFKFCREIFPVVDYTTVSVPTYPSGQIGFMLCSLNP 243

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRSS 304
           + N +KP+R +++EE E L  +YYN+++H A+F+LP F K  L+  +
Sbjct: 244 ETNFRKPVRTFTDEEIETLGLKYYNTEMHAASFVLPHFAKKVLEGKA 290



>gi|512853322|ref|XP_004916087.1| PREDICTED: spermidine synthase isoform X3 [Xenopus (Silurana)
           tropicalis]
          Length = 286

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 159/292 (54%), Positives = 211/292 (72%), Gaps = 32/292 (10%)

Query: 7   RLLMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVL 66
           R    G      +QDGWFRE  +LWPGQAM LE+EEVL H++S +Q++L+F+S  YG VL
Sbjct: 3   RAFCRGANMEKPVQDGWFRETCSLWPGQAMSLEVEEVLYHKQSSFQEILVFRSKTYGNVL 62

Query: 67  VLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLC 126
           VLDG++QCTERDEFSYQEMI ++P+  H NP                             
Sbjct: 63  VLDGLIQCTERDEFSYQEMIANLPLYSHPNPR---------------------------- 94

Query: 127 DIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAES 186
              + VI +SKKYLP MAIG+ +PK+T+H+GDGF+F++   ++FD+IITD+SDPVGPAES
Sbjct: 95  ---KEVINVSKKYLPGMAIGYSSPKLTLHVGDGFQFMKQNQDAFDVIITDSSDPVGPAES 151

Query: 187 LFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPS 246
           LF+  Y++LMK ALR GGI+  QGECQWLHLDLI ++  +C+ L+PVVEYAY TIPTYPS
Sbjct: 152 LFKESYYQLMKTALREGGILCCQGECQWLHLDLIKEMHQFCKTLFPVVEYAYCTIPTYPS 211

Query: 247 GQIGFILCSIDDKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTK 297
           GQIGF+LCS D   N K+P+++ S+E+ +K+  RYYNS+IH+AAF+LP+FT+
Sbjct: 212 GQIGFMLCSKDPSTNFKEPVQQLSQEQVDKMNLRYYNSRIHQAAFVLPEFTR 263



>gi|170089005|ref|XP_001875725.1| saccharopine dehydrogenase [Laccaria bicolor S238N-H82]
 gi|164648985|gb|EDR13227.1| saccharopine dehydrogenase [Laccaria bicolor S238N-H82]
          Length = 751

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 168/283 (59%), Positives = 217/283 (76%), Gaps = 6/283 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP +QDGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   THPSVQDGWFREISSQWPGQAMTLKVNKILHIEKSLYQDVLVFESETYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  H NP+ VLVI      V+REV KH++V+++VLCDIDE+V+R
Sbjct: 65  TERDEFSYQEMIAHLPLASHPNPKKVLVIGGGDGGVVREVLKHDTVEQVVLCDIDEAVVR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK+YLP M+    +PKVTV IGDGF+FL D   ++D+IITD+SDPVGPAESLFQ  YF+
Sbjct: 125 VSKQYLPHMSSLLASPKVTVFIGDGFKFLADNEATYDVIITDSSDPVGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG ISTQGEC WLHL LI +++    +L+ V EYAYTTIPTYPSGQIGFI+C
Sbjct: 185 LLHDALTPGGHISTQGECLWLHLPLIKELREMTSKLFAVSEYAYTTIPTYPSGQIGFIVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTK 297
           +     +L+ P+R      E K  +YYN+ +H +AF LP+F +
Sbjct: 245 AKAPGRDLRTPVR------EVKETKYYNAALHSSAFKLPEFAR 281



>gi|363751094|ref|XP_003645764.1| hypothetical protein Ecym_3464 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356889398|gb|AET38947.1| Hypothetical protein Ecym_3464 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 301

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 159/284 (55%), Positives = 216/284 (76%), Gaps = 1/284 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           +HP I+DGWFRE   T+ PGQA  L++E+VL HEKSLYQDVL+FKST++G VLVLD ++Q
Sbjct: 12  THPSIKDGWFREISETICPGQASTLKVEKVLHHEKSLYQDVLVFKSTNFGNVLVLDNMLQ 71

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
           CTE +E+SY EMIT++ MN H+NP+ VL+I      VLREV KHESV+E  LC+IDE+VI
Sbjct: 72  CTEANEYSYHEMITNLAMNSHANPKKVLIIGGGDGGVLREVLKHESVEEAWLCEIDEAVI 131

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
           R+SK++LP MA+ F +P+  +HIGDG EFL+   N+FD+IITD+SDP GPAE LF+  YF
Sbjct: 132 RVSKEFLPGMAVSFADPRANLHIGDGVEFLKKYPNTFDVIITDSSDPEGPAEELFKKPYF 191

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           EL+ N+L   G+ISTQ E  WLH  +IT ++  C E++P V YA  ++P YP+G IG+++
Sbjct: 192 ELLNNSLTSKGVISTQAESVWLHEHIITGLKKACSEIFPTVAYASQSVPFYPAGNIGYMV 251

Query: 254 CSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTK 297
           CS +  V++ KPLR  SEEEE K  R+Y+ ++HEA+F+LP F +
Sbjct: 252 CSKNKDVDVTKPLRYLSEEEEFKRYRFYSKKLHEASFVLPIFVR 295



>gi|190348490|gb|EDK40949.2| hypothetical protein PGUG_05047 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 336

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 167/290 (57%), Positives = 217/290 (74%), Gaps = 2/290 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           SHP I+DGWF E   T+WPGQAM L++E+VL  EKS YQDVL+FKST+YG VLVLD  +Q
Sbjct: 46  SHPSIKDGWFAEVSDTMWPGQAMSLKVEKVLHVEKSKYQDVLVFKSTNYGNVLVLDNCIQ 105

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMITH+ +N H NP+  LVI      VLRE+ KH S++E  LCDIDE+VI
Sbjct: 106 VTERDEFSYQEMITHLALNSHPNPKKALVIGGGDGGVLREILKHSSIEEAWLCDIDETVI 165

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
            +SKKYLP+M+  + +P+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLFQ  YF
Sbjct: 166 EVSKKYLPEMSKSYQDPRTKVHIGDGFKFLEEYKNQFDVIITDSSDPEGPAESLFQKPYF 225

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           EL+  AL   G+I+TQ E  WLH+D+I++++  C++++PV EY YT IPTYPSG IGF++
Sbjct: 226 ELLNGALTEKGVITTQAENIWLHMDIISKLKKDCKDIFPVAEYGYTMIPTYPSGSIGFMV 285

Query: 254 CSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           CS D    + KP R +WS++  +K  +YYN +IHEAAF+LP +  N L +
Sbjct: 286 CSKDKNAVVTKPARFEWSDDFVKKNLKYYNKKIHEAAFVLPTWADNVLNQ 335



>gi|321468222|gb|EFX79208.1| hypothetical protein DAPPUDRAFT_304917 [Daphnia pulex]
          Length = 298

 Score =  343 bits (880), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 158/283 (55%), Positives = 210/283 (74%), Gaps = 1/283 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           +++GWF E   LWPGQ + LE+EEVL  EKS +QD+L+ KS  YG VLVLDGV+QCTE D
Sbjct: 4   LKNGWFSELSPLWPGQCISLEVEEVLHQEKSEFQDILVLKSKTYGKVLVLDGVIQCTELD 63

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI+ +P+ CH NP+ VL++      V RE+ KH  V+ +V C+IDE V+ +SKK
Sbjct: 64  EFSYQEMISFLPITCHPNPQKVLIVGGGDGGVARELVKHPLVQSVVQCEIDERVVEVSKK 123

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP MA GF++ KVT+HIGDGFEF+++    FD+IITD+SDP+GPA SLFQ  YF+L+  
Sbjct: 124 FLPFMAKGFEDSKVTLHIGDGFEFIKNHPAEFDVIITDSSDPIGPAASLFQESYFQLLCQ 183

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+PGGI+ +QGE  W H  LI  +   C EL+PVV+YAYT IPTYP GQIGFILCS + 
Sbjct: 184 ALKPGGIVCSQGENAWFHSHLIAPLLKSCTELFPVVDYAYTCIPTYPGGQIGFILCSTNP 243

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
           +   + P+ + SE E EK+  RYY+S++H AAF++P+F + AL
Sbjct: 244 ETQFRTPIHQLSEAECEKMQLRYYSSEMHSAAFVVPRFARKAL 286



>gi|146414243|ref|XP_001483092.1| hypothetical protein PGUG_05047 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 336

 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 167/290 (57%), Positives = 217/290 (74%), Gaps = 2/290 (0%)

Query: 15  SHPQIQDGWFRE-KPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQ 73
           SHP I+DGWF E   T+WPGQAM L++E+VL  EKS YQDVL+FKST+YG VLVLD  +Q
Sbjct: 46  SHPSIKDGWFAEVSDTMWPGQAMSLKVEKVLHVEKSKYQDVLVFKSTNYGNVLVLDNCIQ 105

Query: 74  CTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVI 133
            TERDEFSYQEMITH+ +N H NP+  LVI      VLRE+ KH S++E  LCDIDE+VI
Sbjct: 106 VTERDEFSYQEMITHLALNSHPNPKKALVIGGGDGGVLREILKHSSIEEAWLCDIDETVI 165

Query: 134 RLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYF 193
            +SKKYLP+M+  + +P+  VHIGDGF+FL +  N FD+IITD+SDP GPAESLFQ  YF
Sbjct: 166 EVSKKYLPEMSKSYQDPRTKVHIGDGFKFLEEYKNQFDVIITDSSDPEGPAESLFQKPYF 225

Query: 194 ELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFIL 253
           EL+  AL   G+I+TQ E  WLH+D+I++++  C++++PV EY YT IPTYPSG IGF++
Sbjct: 226 ELLNGALTEKGVITTQAENIWLHMDIISKLKKDCKDIFPVAEYGYTMIPTYPSGSIGFMV 285

Query: 254 CSIDDKVNLKKPLR-KWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKR 302
           CS D    + KP R +WS++  +K  +YYN +IHEAAF+LP +  N L +
Sbjct: 286 CSKDKNAVVTKPARFEWSDDFVKKNLKYYNKKIHEAAFVLPTWADNVLNQ 335



>gi|389746615|gb|EIM87794.1| saccharopine dehydrogenase [Stereum hirsutum FP-91666 SS1]
          Length = 752

 Score =  342 bits (878), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 165/283 (58%), Positives = 215/283 (75%), Gaps = 6/283 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWFRE  + WPGQAM L++ ++L  EKSLYQDVL+F+S  YG VL+LDGV+QC
Sbjct: 5   THPSIKDGWFREISSQWPGQAMTLKVNKILHVEKSLYQDVLVFESETYGNVLILDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI HIP+  H NP+ VLVI      V+REV KH++V+E+VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHIPLASHPNPKKVLVIGGGDGGVVREVLKHDTVEEVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SKKYLP MA   D+P+V V +GDGF+FL +  +++D+IITD+SDPVGPA SLF+  YF+
Sbjct: 125 VSKKYLPHMAGLLDSPRVRVFVGDGFKFLAENTSTYDVIITDSSDPVGPAASLFEKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG ISTQ EC WLHL LI++++     ++P  EYAYTTIPTYPSGQIGF++C
Sbjct: 185 LLHDALTPGGHISTQAECLWLHLPLISKIRQDTLSIFPTAEYAYTTIPTYPSGQIGFLVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTK 297
           S +   +L  P+RK  +       RYYN  +H+ AF LP+F +
Sbjct: 245 SKEKGRDLTTPVRKVPD------TRYYNEAVHKVAFTLPEFGR 281



>gi|302683522|ref|XP_003031442.1| hypothetical protein SCHCODRAFT_257519 [Schizophyllum commune H4-8]
 gi|300105134|gb|EFI96539.1| hypothetical protein SCHCODRAFT_257519 [Schizophyllum commune H4-8]
          Length = 752

 Score =  339 bits (870), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 167/290 (57%), Positives = 217/290 (74%), Gaps = 6/290 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP I+DGWF E  + WPGQAM L++ ++L  EKSLYQDVL+F+S  YG VLVLDGV+QC
Sbjct: 5   THPSIRDGWFSEISSQWPGQAMTLQVNKILHVEKSLYQDVLVFESATYGNVLVLDGVIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  H  P+ VLVI      V+REV KHESV+E+VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHLPLASHPKPKKVLVIGGGDGGVVREVLKHESVEEVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK++LP M+   ++PKV V IGDGF+FL +  +++D+IITD+SDPVGPAESLFQ  YF+
Sbjct: 125 VSKQFLPYMSSLLESPKVRVFIGDGFKFLAENESTYDVIITDSSDPVGPAESLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG ISTQ EC WLH  LI +++     ++P VEYA+TTIPTYPSGQIGF++C
Sbjct: 185 LLHDALTPGGHISTQAECLWLHTPLIAELKKMAATIFPTVEYAFTTIPTYPSGQIGFMVC 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           +     +L  PLR      + K   YYN Q+H+AAF+LP+F +  LK  +
Sbjct: 245 AKAADRDLSTPLR------QVKGNIYYNEQVHKAAFVLPEFGRQILKEGT 288



>gi|219130033|ref|XP_002185179.1| spermine/spermidine synthase [Phaeodactylum tricornutum CCAP
           1055/1]
 gi|217403358|gb|EEC43311.1| spermine/spermidine synthase [Phaeodactylum tricornutum CCAP
           1055/1]
          Length = 299

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 211/282 (74%), Gaps = 2/282 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I DGWF E+  LWPGQAM L++++VL H +SL+QDVL+F+STH+G VLVLDGVVQ TERD
Sbjct: 18  IVDGWFHERGVLWPGQAMSLQVKKVLYHGRSLFQDVLVFESTHHGTVLVLDGVVQVTERD 77

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EF+YQEMI HIP+  H +P+ VLVI      VLRE+A+H SV+EIV+C+ID+ VI +SKK
Sbjct: 78  EFAYQEMIAHIPLYAHPDPKKVLVIGGGDGGVLREIARHPSVEEIVICEIDKDVIEVSKK 137

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           +LP +A GFD+ +V VH+ DG EF+R   ++FD+I+TD+SDPVGPA  LF+  +F+ M  
Sbjct: 138 FLPSLAQGFDDARVKVHVMDGSEFMRANQDTFDVIVTDSSDPVGPASVLFETPFFKAMHG 197

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           +LR GGI+ TQGEC WLHLDLI  + +    +Y  VEYAYTTIPTYPSGQIGFI+ +   
Sbjct: 198 SLREGGIVCTQGECIWLHLDLIRPLINSIASVYTTVEYAYTTIPTYPSGQIGFIVAT-KG 256

Query: 259 KVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           + + + P+R+  +   ++L RYY   +H A+F+LP F + A+
Sbjct: 257 RGSCQSPVRQ-PDTTTQELLRYYTPHVHRASFVLPAFAQRAI 297



>gi|302422022|ref|XP_003008841.1| spermidine synthase [Verticillium albo-atrum VaMs.102]
 gi|261351987|gb|EEY14415.1| spermidine synthase [Verticillium albo-atrum VaMs.102]
          Length = 287

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 167/292 (57%), Positives = 209/292 (71%), Gaps = 25/292 (8%)

Query: 30  LWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHI 89
           +WPGQAM L++++V+ HEKS YQDVLIF+ST YG+V+VLD V+Q TERDEFSYQEMITH+
Sbjct: 1   MWPGQAMTLKVKKVVHHEKSKYQDVLIFESTDYGMVIVLDNVIQATERDEFSYQEMITHL 60

Query: 90  PMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDN 149
            MN H +P+ VLVI      VLREV KHE V+E +LCDIDE+VIRLSK+YLP M++GFD+
Sbjct: 61  AMNSHPDPKRVLVIGGGDGGVLREVVKHECVEEAILCDIDEAVIRLSKQYLPGMSVGFDH 120

Query: 150 PKVTVHIGDGFEFLRDKVNSFDIIITDASDPVG--------------------PAESLFQ 189
           PK   H+GDGF+FL D  NSFD+IITD+SDP G                     A S  +
Sbjct: 121 PKSKTHVGDGFKFLDDYKNSFDVIITDSSDPEGLPRCSSRSPTSSCSTTLCAMAASSPPK 180

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
           V    +   +L P        E QWLHL LIT+++  C E++PV EYAYTTIPTYPSGQI
Sbjct: 181 VPACSVALRSLDP-----PPTENQWLHLPLITKLRKDCNEIFPVAEYAYTTIPTYPSGQI 235

Query: 250 GFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           GF++C  D   N+++PLRKWS EEEEKLC+YYN+ IH+AAF+LP F K AL+
Sbjct: 236 GFMVCCKDANRNVREPLRKWSAEEEEKLCKYYNADIHKAAFVLPNFAKKALQ 287



>gi|330842026|ref|XP_003292987.1| spermidine synthase [Dictyostelium purpureum]
 gi|325076721|gb|EGC30485.1| spermidine synthase [Dictyostelium purpureum]
          Length = 284

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 161/284 (56%), Positives = 210/284 (73%), Gaps = 3/284 (1%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
           +IQ+GWF E    WPG    LE+E+VL HEKS YQD+L+FKS  +G VLVLDG +Q TER
Sbjct: 3   KIQNGWFSEISEFWPGHCFSLEVEKVLHHEKSQYQDILVFKSKSFGNVLVLDGAIQATER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEFSYQEMITHIP+  H NP+ VLV+      VLREV KH  V+ + LC+IDE VI  SK
Sbjct: 63  DEFSYQEMITHIPLFSHPNPKRVLVVGGGDGGVLREVVKHPLVESVTLCEIDEGVINASK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
            +LPKM +GF++PKVT+ IGDG EF+R +   FDIIITD+SDP+GPA+ LF+  Y+EL+K
Sbjct: 123 NFLPKMRVGFEHPKVTLFIGDGLEFMRKRKGEFDIIITDSSDPIGPAQGLFERPYYELLK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            AL PGGI+ +Q E  WLHLD I  +  +C+EL+P VEYAYT+IP+YP G IGFILCS+ 
Sbjct: 183 EALAPGGIVCSQAESLWLHLDTIKNLSGFCKELFPHVEYAYTSIPSYPGGSIGFILCSMG 242

Query: 258 DKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
              + KKP+R+ + + + ++ +YYN +IH+A+F+LPQF  N L 
Sbjct: 243 G--SCKKPVREIASDVQSQM-QYYNEEIHKASFVLPQFALNKLN 283



>gi|393213931|gb|EJC99425.1| spermidine synthase [Fomitiporia mediterranea MF3/22]
          Length = 747

 Score =  332 bits (851), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 160/287 (55%), Positives = 211/287 (73%), Gaps = 6/287 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I DGWFRE    WPGQAM L + ++L  EKS YQDVL+F+S  YG VLVLDG +QC
Sbjct: 5   SHPSIVDGWFREISHQWPGQAMTLRVNKILHVEKSKYQDVLVFESATYGNVLVLDGAIQC 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDE+SYQEMI H+P+  H NP+ VLVI      V+REV KHESV+ +VLCDIDE+VIR
Sbjct: 65  TERDEYSYQEMIAHLPLASHPNPKKVLVIGGGDGGVVREVLKHESVENVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK++LP M+    +P+VTV IGDGF++L D   ++D+IITD+SDP GPA SLFQ  YF+
Sbjct: 125 VSKQFLPHMSSLLSDPRVTVFIGDGFKYLADNTATYDVIITDSSDPAGPAASLFQKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG   +QGEC W+HL LI ++++  + L+P VEYA+TTIPTYP+GQIGF + 
Sbjct: 185 LIHDALTPGGHACSQGECLWIHLPLIHELRNTTKALFPTVEYAFTTIPTYPAGQIGFTMG 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
           + +   +LK PLR          CRYY++ +H AAF+LP+F ++ L+
Sbjct: 245 AKEAGRDLKTPLRNVPN------CRYYSADVHRAAFVLPEFGRSMLE 285



>gi|4903273|gb|AAD32851.1|AF069757_1 spermidine synthase [Dictyostelium discoideum]
          Length = 284

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 156/284 (54%), Positives = 209/284 (73%), Gaps = 3/284 (1%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
           +IQ+GWF E    WPG +  LE+E+VL HEKS YQD+L+FKS  +G VLVLDGV+Q TER
Sbjct: 3   KIQNGWFSEISEFWPGNSFSLEVEKVLHHEKSEYQDILVFKSKSFGNVLVLDGVIQATER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMITHIP+  H +P+ VLV+      VLREV KH  V+ + LC+ID+ VI  S+
Sbjct: 63  DEFAYQEMITHIPLFSHPSPKRVLVVGGGDGGVLREVVKHPLVESVTLCEIDKGVIEASR 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
            +LP M +GFD+PKVT+ IGDG EF+R +   FD+IITD+SDP+GPA+ LF+  Y+EL+K
Sbjct: 123 NFLPNMRVGFDHPKVTLFIGDGMEFMRQRKGEFDVIITDSSDPIGPAQGLFERAYYELLK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            AL PGGI+ +Q E  WLHLD I  + ++C+ELYP VEYAYT+IP+YP G IGFILCS+ 
Sbjct: 183 AALAPGGIVCSQCESMWLHLDTIKGLTTFCKELYPNVEYAYTSIPSYPGGSIGFILCSLG 242

Query: 258 DKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
                K P+R+ + E + ++ +YYN ++H+A+F+LPQF    L 
Sbjct: 243 GST--KAPIREITPEVQSQM-QYYNGEVHKASFVLPQFAAKKLN 283



>gi|66827309|ref|XP_647009.1| hypothetical protein DDB_G0268630 [Dictyostelium discoideum AX4]
 gi|166209896|sp|Q9XY92.2|SPEE_DICDI RecName: Full=Spermidine synthase; Short=SPDSY; AltName:
           Full=Putrescine aminopropyltransferase
 gi|60474968|gb|EAL72904.1| hypothetical protein DDB_G0268630 [Dictyostelium discoideum AX4]
          Length = 284

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 156/284 (54%), Positives = 208/284 (73%), Gaps = 3/284 (1%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
           +IQ+GWF E    WPG +  LE+E+VL HEKS YQD L+FKS  +G VLVLDGV+Q TER
Sbjct: 3   KIQNGWFSEISEFWPGNSFSLEVEKVLHHEKSEYQDFLVFKSKSFGNVLVLDGVIQATER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMITHIP+  H +P+ VLV+      VLREV KH  V+ + LC+ID+ VI  S+
Sbjct: 63  DEFAYQEMITHIPLFSHPSPKRVLVVGGGDGGVLREVVKHPLVESVTLCEIDKGVIEASR 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
            +LP M +GFD+PKVT+ IGDG EF+R +   FD+IITD+SDP+GPA+ LF+  Y+EL+K
Sbjct: 123 NFLPNMRVGFDHPKVTLFIGDGMEFMRQRKGEFDVIITDSSDPIGPAQGLFERAYYELLK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            AL PGGI+ +Q E  WLHLD I  + ++C+ELYP VEYAYT+IP+YP G IGFILCS+ 
Sbjct: 183 AALAPGGIVCSQCESMWLHLDTIKGLTTFCKELYPNVEYAYTSIPSYPGGSIGFILCSLG 242

Query: 258 DKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
                K P+R+ + E + ++ +YYN ++H+A+F+LPQF    L 
Sbjct: 243 GST--KAPIREITPEVQSQM-QYYNGEVHKASFVLPQFAAKKLN 283



>gi|169862955|ref|XP_001838101.1| spermidine synthase [Coprinopsis cinerea okayama7#130]
 gi|116500783|gb|EAU83678.1| spermidine synthase [Coprinopsis cinerea okayama7#130]
          Length = 750

 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 165/286 (57%), Positives = 210/286 (73%), Gaps = 6/286 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           SHP I DGWFRE    W GQAM L++ ++L  EKSLYQDVL+F+S  YG VLVLDGV+Q 
Sbjct: 5   SHPTIVDGWFREISPQWQGQAMTLKVNKILHVEKSLYQDVLVFESETYGNVLVLDGVIQA 64

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           TERDEFSYQEMI H+P+  H NP+ VLVI      V+REV KHE+V+++VLCDIDE+VIR
Sbjct: 65  TERDEFSYQEMIAHLPLAAHPNPKKVLVIGGGDGGVVREVLKHETVEQVVLCDIDEAVIR 124

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           ++K +LP M+   ++P+VTVHIGDGF+FL +   ++D+IITD+SDPVGPAE+LF+  YF+
Sbjct: 125 VAKIFLPHMSKLLESPRVTVHIGDGFKFLAEHEGTYDVIITDSSDPVGPAEALFEKPYFQ 184

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG ISTQGEC WLHL LI  +  + +E++  VEYAYT IPTYPSGQIG IL 
Sbjct: 185 LLHDALTPGGHISTQGECMWLHLQLIKDMLKFTKEIFTNVEYAYTMIPTYPSGQIGHILA 244

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
           +     +LK P+R          CRYYN  IH +AF+LP+F    L
Sbjct: 245 AKSPGRDLKTPVRDVPN------CRYYNKGIHASAFVLPEFVDALL 284



>gi|470649174|ref|XP_004328115.1| PREDICTED: spermidine synthase [Tursiops truncatus]
          Length = 282

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 155/293 (52%), Positives = 212/293 (72%), Gaps = 15/293 (5%)

Query: 10  MSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLD 69
           M   TS   +     R  P   PG+         LC     YQD+L+F+S  YG VLVLD
Sbjct: 1   MDSITSQIGVGTPILRPLPPDAPGR---------LC-----YQDILVFRSKSYGNVLVLD 46

Query: 70  GVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDID 129
           GV+QCTERDEFSYQEMI ++P+  H NP  VL+I      VLREV KH SV+ +V C+ID
Sbjct: 47  GVIQCTERDEFSYQEMIANLPLYSHPNPRKVLIIGGGDGGVLREVVKHSSVESVVQCEID 106

Query: 130 ESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQ 189
           E VI++SKK+LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+
Sbjct: 107 EDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFK 166

Query: 190 VKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQI 249
             Y++LMK AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV+YAY TIPTYPSGQI
Sbjct: 167 ESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVDYAYCTIPTYPSGQI 226

Query: 250 GFILCSIDDKVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNALK 301
           GF+LCS +   N ++P+++ ++++ EE   +YYNS +H+AAF+LP+F + AL 
Sbjct: 227 GFMLCSKNPSTNFREPVQQLTQKQVEEMQLKYYNSDVHQAAFVLPEFARKALN 279



>gi|440901449|gb|ELR52390.1| Spermidine synthase, partial [Bos grunniens mutus]
          Length = 256

 Score =  329 bits (844), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 147/255 (57%), Positives = 201/255 (78%), Gaps = 1/255 (0%)

Query: 44  LCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVI 103
           L H++S YQD+L+F+S  YG VLVLDGV+QCTERDEFSYQEMI ++P+  H NP  VL+I
Sbjct: 1   LHHQRSRYQDILVFRSKSYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLII 60

Query: 104 XXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFL 163
                 VLREV KH SV+ +V C+IDE VI++SKK+LP MA+G+ + K+T+H+GDGFEF+
Sbjct: 61  GGGDGGVLREVVKHSSVEAVVQCEIDEDVIQVSKKFLPSMAVGYSSSKLTLHVGDGFEFM 120

Query: 164 RDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQV 223
           +   ++FD+IITD+SDP+GPAESLF+  Y++LMK AL+  GI+  QGECQWLHLDLI ++
Sbjct: 121 KQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEM 180

Query: 224 QSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRKWSEEE-EEKLCRYYN 282
           + +C+ L+PVV+YAY TIPTYPSGQIGF+LCS +   N ++PL+   +++ EE   +YYN
Sbjct: 181 RHFCKSLFPVVDYAYCTIPTYPSGQIGFMLCSKNPSTNFREPLQPLMQKQVEEMQLKYYN 240

Query: 283 SQIHEAAFILPQFTK 297
           S +H AAF+LP+F +
Sbjct: 241 SDVHRAAFVLPEFAR 255



>gi|167519370|ref|XP_001744025.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163777987|gb|EDQ91603.1| predicted protein [Monosiga brevicollis MX1]
          Length = 300

 Score =  328 bits (842), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 204/288 (70%), Gaps = 2/288 (0%)

Query: 18  QIQDGWFREKPT-LWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTE 76
           ++  GWF E  + +WPGQAM L  EE+L   +S +Q V I K+  YG  L LDGV+Q TE
Sbjct: 4   RLAKGWFSEVSSEMWPGQAMSLAYEEILEDVQSDFQHVQILKTKTYGNALCLDGVIQITE 63

Query: 77  RDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLS 136
           RDEFSYQEM+ H+PM  H NPE+VL+I      VLREV KH ++K +  C+ID +VI L 
Sbjct: 64  RDEFSYQEMMVHVPMFSHPNPEHVLIIGGGDGGVLREVLKHPALKSVTQCEIDGTVIELC 123

Query: 137 KKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELM 196
           KK+LP +A  F +PK  V +GDGFE+++     FD+IITD+SDP+GPA SLF+ +Y+ L+
Sbjct: 124 KKHLPSIAQSFHHPKANVIVGDGFEYMKQHQQEFDVIITDSSDPIGPASSLFEKEYYSLV 183

Query: 197 KNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSI 256
           ++ALR GGI+  QGEC WLHLDLI  +Q + R LYPVV+Y Y TIPTYPSGQIGFILCS 
Sbjct: 184 RSALRDGGIMCAQGECIWLHLDLIKSMQEFSRTLYPVVDYGYLTIPTYPSGQIGFILCSK 243

Query: 257 DDKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRS 303
           + + N + PLR+ S E+   +  RYYN  IH A+F+LPQF + AL+ +
Sbjct: 244 NSETNFRVPLRRASSEDMRNMHLRYYNPDIHSASFVLPQFARLALEEA 291



>gi|340376656|ref|XP_003386848.1| PREDICTED: spermidine synthase-like [Amphimedon queenslandica]
          Length = 288

 Score =  328 bits (842), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 159/283 (56%), Positives = 209/283 (73%), Gaps = 1/283 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           ++DGWF E   LWPG+   L+++E+L  E+S YQD++IFKS  YG+VLVLDGV+QCTERD
Sbjct: 4   VKDGWFSEINDLWPGECFSLKVDEILHQERSQYQDIMIFKSKAYGMVLVLDGVIQCTERD 63

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI H+P+  H NP++VL+I      V+REV KH SV+++ LC+IDE VI LSKK
Sbjct: 64  EFSYQEMIAHLPLFSHPNPKSVLIIGGGDGGVVREVIKHPSVEQVHLCEIDERVIELSKK 123

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP ++    +PKVTVH+ DG +FL D VN FD+IITD+SDP+GPA  LF+  Y+E  KN
Sbjct: 124 YLPSLSSALSSPKVTVHVKDGVKFLEDHVNEFDVIITDSSDPIGPAIPLFERPYYEKTKN 183

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+ GG++  QGEC WL L LI+   S+C  ++PV  YAYTTIPTYP GQIGF L S D 
Sbjct: 184 ALKDGGVLCCQGECVWLDLKLISSCMSHCHSVFPVASYAYTTIPTYPCGQIGFFLASKDK 243

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
            +  ++P R  S+EE +++  +YYN+ IH A+F+LPQF K AL
Sbjct: 244 NMVFEEPTRCVSDEEVKRMKLKYYNAAIHRASFVLPQFVKEAL 286



>gi|470241718|ref|XP_004352434.1| spermidine synthase [Dictyostelium fasciculatum]
 gi|328867727|gb|EGG16109.1| spermidine synthase [Dictyostelium fasciculatum]
          Length = 285

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 206/283 (72%), Gaps = 2/283 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
           QI  GWF E    WPG +  L++E+VL HEK+ YQD+L+FKS  +G VLVLDGV+Q TER
Sbjct: 3   QINKGWFSEISEFWPGNSFSLQVEQVLHHEKTQYQDILVFKSKTFGNVLVLDGVIQATER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMI H  +  H NP+ VLV+      VLREV KH+ V+ + LC+ID+ VI  S+
Sbjct: 63  DEFAYQEMIAHPALFAHPNPKKVLVVGGGDGGVLREVVKHDCVESVTLCEIDKGVIDASR 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           KYLP MA+GFD+PKVT+ IGDG EF+R +   FD+IITD+SDP+GPA+ LF+  Y+EL+K
Sbjct: 123 KYLPNMAVGFDHPKVTLFIGDGLEFMRQRKGEFDVIITDSSDPIGPAQGLFERAYYELLK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            AL  GGI+ +Q E  WLHLD +  + ++C+EL+PVVEYAYT+IP+YP G IG ++CS  
Sbjct: 183 EALAEGGILCSQAESLWLHLDTVKGLTTFCKELFPVVEYAYTSIPSYPGGSIGLLICS-K 241

Query: 258 DKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
              + K P+R+ S E  EK+ +YYN Q+H+A+F+LPQF    L
Sbjct: 242 SNTSCKSPIRQVSSEILEKM-QYYNEQVHKASFVLPQFASKQL 283



>gi|385302583|gb|EIF46709.1| spermidine synthase [Dekkera bruxellensis AWRI1499]
          Length = 283

 Score =  327 bits (838), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 154/244 (63%), Positives = 192/244 (78%)

Query: 47  EKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXX 106
           +KS YQDVL+FKST YG VLVLDGV+Q TERDEF+YQEMITH+ MN H NP+ VLVI   
Sbjct: 3   KKSKYQDVLVFKSTDYGNVLVLDGVIQVTERDEFAYQEMITHLAMNSHPNPKKVLVIGGG 62

Query: 107 XXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDK 166
              VLRE+ KHE+V+E  LCDID++VI+ SKKYLP ++  +D+PKV VHIGDGFEFL+  
Sbjct: 63  DGGVLREILKHETVEEAHLCDIDDAVIKASKKYLPGLSKSYDDPKVHVHIGDGFEFLKKY 122

Query: 167 VNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSY 226
            N+FD+IITD+SDP GPAESLFQ  YF+L+  AL   G+++TQGEC WLH+ LI +V   
Sbjct: 123 XNTFDVIITDSSDPEGPAESLFQXPYFKLLSXALTEKGVMTTQGECIWLHMPLIKKVVDD 182

Query: 227 CRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIH 286
           CR+++P V+YAY TIPTYPSGQIGF++CS +   NLKKPLR    E+E KL +YYN +IH
Sbjct: 183 CRKVFPTVDYAYCTIPTYPSGQIGFMVCSKNPSANLKKPLRSVDPEKERKLYKYYNXEIH 242

Query: 287 EAAF 290
           EA+F
Sbjct: 243 EASF 246



>gi|397614365|gb|EJK62755.1| hypothetical protein THAOC_16622 [Thalassiosira oceanica]
          Length = 322

 Score =  327 bits (838), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 154/281 (54%), Positives = 206/281 (73%), Gaps = 2/281 (0%)

Query: 21  DGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEF 80
           DGWF E+  LWPGQA  L+++EVL H+KS +QDVL+F S  +G VLVLDGV+QCT+RDE+
Sbjct: 40  DGWFHERGPLWPGQAFTLQVKEVLYHQKSKFQDVLVFDSETHGRVLVLDGVIQCTQRDEY 99

Query: 81  SYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYL 140
           SYQEMI H+P+  H NPE VLVI      VLRE+A+H  VK+IV+C++DE VI +SKKY+
Sbjct: 100 SYQEMIAHVPLFSHPNPERVLVIGGGDGGVLREIARHPCVKDIVICELDEDVINVSKKYM 159

Query: 141 PKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNAL 200
           P MA G+D+P+V VH+ DG +F+ +  +SFD+IITD+SDPVGPA  LF+  ++  M  AL
Sbjct: 160 PFMAKGYDDPRVKVHVMDGAKFMEENQSSFDVIITDSSDPVGPACVLFETPFYRAMHGAL 219

Query: 201 RPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSI-DDK 259
           R GGII TQGEC WLH+DLI  + +  + L+  VEYAY TIP+YPSGQIGFI+ +   + 
Sbjct: 220 REGGIICTQGECVWLHVDLIRPLVNSIKPLFKTVEYAYCTIPSYPSGQIGFIIATKGGEG 279

Query: 260 VNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
              K P+R+ ++E   K  RYY  +IH A+F+LP F + A+
Sbjct: 280 KGCKAPIRE-ADEGTLKALRYYTPEIHRASFVLPAFARRAI 319



>gi|512899761|ref|XP_004924726.1| PREDICTED: spermidine synthase-like isoform X1 [Bombyx mori]
 gi|512899765|ref|XP_004924727.1| PREDICTED: spermidine synthase-like isoform X2 [Bombyx mori]
          Length = 287

 Score =  326 bits (835), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 203/284 (71%), Gaps = 1/284 (0%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
           +++  WF E   +WPG     E++EVL  EKS YQ++ +F +T  G VLVLDG++QCT++
Sbjct: 3   KLKTNWFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQK 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEFSYQEMI+ +P+ CH NPENVL++      V REVAKH  VK IVL +ID+ VI LSK
Sbjct: 63  DEFSYQEMISFLPLCCHKNPENVLIVGGGDGGVAREVAKHPQVKHIVLVEIDDRVIELSK 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           +YLP MA+GFD+PK+T+H+GDGFEF+++    FD+IITD+SDPVGPA +LFQ  YF LMK
Sbjct: 123 RYLPFMAVGFDSPKLTLHVGDGFEFMKNHRQEFDVIITDSSDPVGPAVNLFQKNYFSLMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
           +AL+P GI+ +Q    W  ++L+T   ++C+  +P   Y YT++PTYPSGQIGF++ S+ 
Sbjct: 183 SALKPDGIVCSQAGTIWNDIELVTNTLNFCKNQFPAAAYCYTSVPTYPSGQIGFVIGSLT 242

Query: 258 DKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNAL 300
             +   +P   ++ +EEE +  RYYNS++H AAF LP F K  L
Sbjct: 243 KDIKFNEPQLTFTRDEEEAMNLRYYNSEVHRAAFALPTFVKYKL 286



>gi|380021423|ref|XP_003694565.1| PREDICTED: spermidine synthase-like [Apis florea]
          Length = 293

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 204/286 (71%), Gaps = 1/286 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I+ GWF E   LWPG ++ LE+ +VL  E+S YQDV++ ++  +G  L+LDG++QCTERD
Sbjct: 4   IKPGWFSEINDLWPGVSLSLEVVKVLHRERSQYQDVMVLETKSHGRTLILDGIIQCTERD 63

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI  +P+  H NP+ VL++      V REVAKH  V+ IV  +ID  V+ +SKK
Sbjct: 64  EFSYQEMIAFLPLCSHPNPKTVLIVGGGDGGVAREVAKHPQVERIVQVEIDPKVLEVSKK 123

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP M +G D+PKVT++IGDGF+FL+     FD+IITD+SDPVGPAE LFQ  YF LMK+
Sbjct: 124 YLPSMGVGLDHPKVTLNIGDGFQFLKQHSGQFDVIITDSSDPVGPAECLFQESYFNLMKS 183

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+PGGI+ +Q    WL+LD +TQ    C+ L+PV  Y   ++PTYP+GQIGF+L  ++ 
Sbjct: 184 ALKPGGIVCSQAGTAWLNLDHVTQTLQRCKSLFPVASYGVVSVPTYPTGQIGFVLGGLNP 243

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRS 303
             N K+P + +++ E +++  +YYN Q+H AAFILP+F + AL ++
Sbjct: 244 GTNFKEPTKVFNDTELDQMNMKYYNDQVHRAAFILPRFIRKALDKA 289



>gi|340384244|ref|XP_003390624.1| PREDICTED: spermidine synthase-like, partial [Amphimedon
           queenslandica]
          Length = 470

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/289 (55%), Positives = 210/289 (72%), Gaps = 4/289 (1%)

Query: 10  MSGTTSHPQI--QDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLV 67
           MS TT  P +  +DGWF E   LWPG+   L+++E+L  E+S YQD++IFKS  YG+VLV
Sbjct: 1   MSDTTV-PSVVSRDGWFSEINDLWPGECFSLKVDEILHQERSQYQDIMIFKSKAYGMVLV 59

Query: 68  LDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCD 127
           LDGV+QCTERDEFSYQEMI H+P+  H NP++VL+I      V+REV KH  V+++ LC+
Sbjct: 60  LDGVIQCTERDEFSYQEMIAHLPLFSHPNPKSVLIIGGGDGGVVREVIKHPCVEQVHLCE 119

Query: 128 IDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESL 187
           IDE VI LSKKYLP ++    +PKVTVH+ DG +FL D VN FD+IITD+SDP+GPA  L
Sbjct: 120 IDERVIELSKKYLPSLSSALSSPKVTVHVKDGVKFLEDHVNEFDVIITDSSDPIGPAIPL 179

Query: 188 FQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSG 247
           F+  Y+E  KNAL+ GG++  QGEC WL L LI+   S+C  ++PV  YAYTTIPTYP G
Sbjct: 180 FERPYYEKTKNALKDGGVLCCQGECVWLDLKLISSCMSHCHSVFPVASYAYTTIPTYPCG 239

Query: 248 QIGFILCSIDDKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQF 295
           QIGF L S D  +  ++P R  S+EE +++  +YYN+ IH A+F+LPQF
Sbjct: 240 QIGFFLASKDKNMVFEEPTRCVSDEEVKRMKLKYYNAAIHRASFVLPQF 288



>gi|426240325|ref|XP_004014060.1| PREDICTED: spermidine synthase [Ovis aries]
          Length = 302

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 209/279 (74%), Gaps = 6/279 (2%)

Query: 32  PGQAMCL--EIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHI 89
           PG ++    +I+ V+ + +   +D+L+F+S  YG VLVLDGV+QCTERDEFSYQEMI ++
Sbjct: 24  PGTSLSFSGQIQTVVNYGRERIRDILVFRSKSYGNVLVLDGVIQCTERDEFSYQEMIANL 83

Query: 90  PMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDN 149
           P+  H NP  VL+I      VLREV KH SV+ +V C+IDE VI++SKK+LP MA+G+ +
Sbjct: 84  PLCSHPNPRKVLIIGGGDGGVLREVVKHSSVESVVQCEIDEDVIQVSKKFLPSMAVGYSS 143

Query: 150 PKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGGIISTQ 209
            K+T+H+GDGFEF++   ++FD+IITD+SDP+GPAESLF+  Y++LMK AL+  GI+  Q
Sbjct: 144 SKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQ 203

Query: 210 GE---CQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKKPL 266
           GE   CQWLHLDLI +++ +C+ L+PVV+YAY TIPTYPSGQIGF+LCS +   N ++PL
Sbjct: 204 GEGARCQWLHLDLIKEMRQFCKALFPVVDYAYCTIPTYPSGQIGFMLCSKNPSTNFREPL 263

Query: 267 RKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNALKRSS 304
           +   +++ EE   +YYNS +H AAF+LP+F + AL   S
Sbjct: 264 QLLMQKQVEEMQLKYYNSDVHRAAFVLPEFARKALNDVS 302



>gi|512929859|ref|XP_004906528.1| PREDICTED: spermidine synthase [Heterocephalus glaber]
          Length = 418

 Score =  323 bits (828), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 142/251 (56%), Positives = 196/251 (78%), Gaps = 1/251 (0%)

Query: 55  LIFKSTHYGIVLVLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREV 114
           L  +S  YG VLVLDGV+QCTERDEFSYQEMI ++P+  H NP  VL+I      VLREV
Sbjct: 168 LSLRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREV 227

Query: 115 AKHESVKEIVLCDIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIII 174
            KH SV+ +V C+IDE VI++SKK+LP MA+G+ +PK+T+H+GDGFEF++   ++FD+II
Sbjct: 228 VKHPSVESVVQCEIDEDVIQVSKKFLPGMAVGYSSPKLTLHVGDGFEFMKQNQDAFDVII 287

Query: 175 TDASDPVGPAESLFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVV 234
           TD+SDP+GPAESLF+  Y++LMK AL+  GI+  QGECQWLHLDLI  ++ +CR L+PVV
Sbjct: 288 TDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKAMRQFCRSLFPVV 347

Query: 235 EYAYTTIPTYPSGQIGFILCSIDDKVNLKKPLRKWSEEE-EEKLCRYYNSQIHEAAFILP 293
            YAY TIPTYPSGQIGF+LCS +   N ++P+++ ++ + E++  +YYN+++H AAF+LP
Sbjct: 348 GYAYCTIPTYPSGQIGFMLCSKNASTNFREPVQQLTQAQVEQRQLKYYNAEVHRAAFVLP 407

Query: 294 QFTKNALKRSS 304
           +F + AL  +S
Sbjct: 408 EFARKALNDAS 418



>gi|341893542|gb|EGT49477.1| hypothetical protein CAEBREN_25958 [Caenorhabditis brenneri]
          Length = 314

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 212/278 (76%), Gaps = 1/278 (0%)

Query: 25  REKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQE 84
           +E    WPGQA  L+++ VL H KS YQDVL+F+ST YG VLVLDG+VQ TERDEFSYQE
Sbjct: 37  QEMGGAWPGQAFSLQVKGVLFHAKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQE 96

Query: 85  MITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMA 144
           M+ H+PM  H NP+ VL+I      +LREV KH++V+++V+C+ID+ VI ++KKYLP M+
Sbjct: 97  MLAHLPMFAHPNPKKVLIIGGGDGGILREVLKHDTVEKVVMCEIDQMVIDVAKKYLPGMS 156

Query: 145 IGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGG 204
            GF +PK+ + +GDGFEFL++ VN FD+IITD+SDPVGPAESLF   Y+EL+  AL+  G
Sbjct: 157 SGFTHPKLDLFVGDGFEFLKNHVNEFDVIITDSSDPVGPAESLFGKTYYELLAAALKADG 216

Query: 205 IISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKK 264
           I+S+QGE  WLHL+LI+ + ++ ++++P V+YA + + TYPSG +G+++C+ +   ++ K
Sbjct: 217 ILSSQGESCWLHLNLISHLVAFNKKIFPTVKYAQSIVSTYPSGCMGYLICAKNAATDVTK 276

Query: 265 PLRKWSEEE-EEKLCRYYNSQIHEAAFILPQFTKNALK 301
           P R  S+E+ +E   R+YNS++H AAF+LPQF K AL+
Sbjct: 277 PARILSDEQVKEMKLRFYNSEVHGAAFVLPQFVKAALE 314



>gi|471906724|emb|CCO28739.1| spermidine synthase [Rhizoctonia solani AG-1 IB]
          Length = 333

 Score =  323 bits (827), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 157/289 (54%), Positives = 212/289 (73%), Gaps = 6/289 (2%)

Query: 15  SHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQC 74
           +HP + DGWFRE  + WPGQAM L++  +L  EKS YQDVL+F+S  +G VLVLDGV+QC
Sbjct: 4   THPSVVDGWFREINSQWPGQAMTLKVNRILHVEKSKYQDVLVFESETFGNVLVLDGVIQC 63

Query: 75  TERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIR 134
           +ERDEFSYQEMI HIP+  H NP+ VLVI      V+REV KH +V+E+VLCDIDE+VIR
Sbjct: 64  SERDEFSYQEMIAHIPLASHPNPKKVLVIGGGDGGVVREVLKHNTVEEVVLCDIDEAVIR 123

Query: 135 LSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFE 194
           +SK YLP M+    + +VTV+IGDGF +L+     FD I+TD+SDPVGPA++LF+  YF+
Sbjct: 124 VSKTYLPHMSNLLADKRVTVYIGDGFAYLQKNTAQFDCIVTDSSDPVGPAKALFEKPYFQ 183

Query: 195 LMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILC 254
           L+ +AL PGG ISTQGE  W+HLDLI ++     +++PV +YA+TTIPTYPSGQIGF+L 
Sbjct: 184 LLYDALAPGGHISTQGEALWIHLDLINELLDTVGKIFPVADYAFTTIPTYPSGQIGFMLG 243

Query: 255 SIDDKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALKRS 303
           S +   +L+ P+R+         C+Y+N  +H AAF+LP+F ++ L+  
Sbjct: 244 SKEPGRDLRTPVRQLEG------CKYWNQDVHRAAFVLPEFARSMLREG 286



>gi|281204635|gb|EFA78830.1| spermidine synthase [Polysphondylium pallidum PN500]
          Length = 284

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 152/284 (53%), Positives = 206/284 (72%), Gaps = 3/284 (1%)

Query: 18  QIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTER 77
           QI++GWF E    WPG +  L++EEVL HEKS YQD+L+FKS  +G VLVLDGV+Q TER
Sbjct: 3   QIRNGWFSEISEFWPGNSFSLQVEEVLHHEKSEYQDILVFKSKTFGNVLVLDGVIQATER 62

Query: 78  DEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSK 137
           DEF+YQEMITH+PM  H NP+ VLV+      VLREV KH+ V+ + LC+ID+ VI  S+
Sbjct: 63  DEFAYQEMITHVPMFGHPNPKKVLVVGGGDGGVLREVVKHDCVESVTLCEIDKGVIEASR 122

Query: 138 KYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           ++LPKMA+GFD+PKV + IGDG EF+R     FD+IITD+SDP+GPA+ LF+  Y+EL+ 
Sbjct: 123 RFLPKMAVGFDHPKVNLFIGDGLEFMRKHKGEFDVIITDSSDPIGPAQGLFERAYYELLN 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
            AL PGGI+ +Q E  WLHL  +  + ++C+E++P VEYAYT+IP+YP G IG ++C   
Sbjct: 183 EALAPGGIVCSQAESLWLHLATVKGLTTFCKEIFPHVEYAYTSIPSYPGGSIGLLICGT- 241

Query: 258 DKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNALK 301
            K + K P+R  + E  EK+ +YYN  +H+A+F+LPQF    L 
Sbjct: 242 -KNSSKTPVRPITPEIIEKM-QYYNEAVHKASFVLPQFAVKELN 283



>gi|25154106|ref|NP_496723.2| Protein SPDS-1, isoform a [Caenorhabditis elegans]
 gi|83754206|pdb|2B2C|A Chain A, Cloning, Expression, Characterisation And Three-
           Dimensional Structure Determination Of The
           Caenorhabditis Elegans Spermidine Synthase
 gi|83754207|pdb|2B2C|B Chain B, Cloning, Expression, Characterisation And Three-
           Dimensional Structure Determination Of The
           Caenorhabditis Elegans Spermidine Synthase
 gi|13785161|emb|CAC37332.1| spermidine synthase [Caenorhabditis elegans]
 gi|21615516|emb|CAB60361.2| Protein SPDS-1, isoform a [Caenorhabditis elegans]
          Length = 314

 Score =  322 bits (825), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 210/278 (75%), Gaps = 1/278 (0%)

Query: 25  REKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERDEFSYQE 84
           +E    WPGQA  L++++VL HEKS YQDVL+F+ST YG VLVLDG+VQ TERDEFSYQE
Sbjct: 37  QEMGGAWPGQAFSLQVKKVLFHEKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQE 96

Query: 85  MITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKKYLPKMA 144
           M+ H+PM  H +P+ VL+I      +LREV KHESV+++ +C+IDE VI ++KK+LP M+
Sbjct: 97  MLAHLPMFAHPDPKRVLIIGGGDGGILREVLKHESVEKVTMCEIDEMVIDVAKKFLPGMS 156

Query: 145 IGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKNALRPGG 204
            GF +PK+ +  GDGFEFL++  N FD+IITD+SDPVGPAESLF   Y+EL+++AL+  G
Sbjct: 157 CGFSHPKLDLFCGDGFEFLKNHKNEFDVIITDSSDPVGPAESLFGQSYYELLRDALKEDG 216

Query: 205 IISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDDKVNLKK 264
           I+S+QGE  WLHL LI  + ++ R+++P V YA + + TYPSG +G+++C+ +   ++  
Sbjct: 217 ILSSQGESVWLHLPLIAHLVAFNRKIFPAVTYAQSIVSTYPSGSMGYLICAKNANRDVTT 276

Query: 265 PLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALK 301
           P R  + E+ + L  R+YNS++H+AAF+LPQF KNAL+
Sbjct: 277 PARTLTAEQIKALNLRFYNSEVHKAAFVLPQFVKNALE 314



>gi|466001508|gb|EMP41527.1| Serine/threonine-protein kinase mTOR [Chelonia mydas]
          Length = 1912

 Score =  322 bits (825), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 143/239 (59%), Positives = 190/239 (79%), Gaps = 1/239 (0%)

Query: 62   YGIVLVLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVK 121
            YG VLVLDGV+QCTERDEFSYQEMI ++P+  H +P  VL+I      VLREV KH SV 
Sbjct: 1539 YGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPDPRKVLIIGGGDGGVLREVVKHPSVD 1598

Query: 122  EIVLCDIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPV 181
             +V C+IDE VI++SKKYLP MA+G+ +PK+T+H+GDGFEF++    +FD+IITD+SDP+
Sbjct: 1599 SVVQCEIDEDVIQVSKKYLPGMAVGYSSPKLTLHVGDGFEFMKQNQEAFDVIITDSSDPM 1658

Query: 182  GPAESLFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTI 241
            GPAESLF+  Y++LMK ALR  GI+  QGECQWLHLDLI +++ +C+ L+PVVEYAY TI
Sbjct: 1659 GPAESLFKESYYQLMKTALREDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVEYAYCTI 1718

Query: 242  PTYPSGQIGFILCSIDDKVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNA 299
            PTYPSGQIGF+LCS +   N ++P+++ S+++ EK+  +YYNS IH+AAFILP+F +  
Sbjct: 1719 PTYPSGQIGFMLCSKNPSTNFREPMQQLSQQQVEKMNLKYYNSDIHQAAFILPEFARKG 1777



>gi|110762382|ref|XP_001120306.1| PREDICTED: spermidine synthase [Apis mellifera]
          Length = 293

 Score =  322 bits (824), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 145/286 (50%), Positives = 203/286 (70%), Gaps = 1/286 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I+ GWF E   LWPG ++ LE+ +VL  E+S YQDV++ ++  +G  L+LDG++QCTERD
Sbjct: 4   IKPGWFSEINDLWPGVSLSLEVVKVLHRERSQYQDVMVLETKSHGRTLILDGIIQCTERD 63

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EFSYQEMI  +P+  H NP+ VL++      V REVAKH  V+ IV  +ID  V+ +SKK
Sbjct: 64  EFSYQEMIAFLPLCSHPNPKTVLIVGGGDGGVAREVAKHPQVERIVQVEIDPKVLEVSKK 123

Query: 139 YLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMKN 198
           YLP M +G D+PKVT++IGDGF+FL+     FD+IITD+SDPVGPAE LFQ  YF LMK+
Sbjct: 124 YLPSMGVGLDHPKVTLNIGDGFQFLKQHSGQFDVIITDSSDPVGPAECLFQESYFNLMKS 183

Query: 199 ALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSIDD 258
           AL+P GI+ +Q    WL+LD +TQ    C+ L+PV  Y   ++PTYP+GQIGF+L  ++ 
Sbjct: 184 ALKPDGIVCSQAGTAWLNLDHVTQTLQRCKSLFPVASYGVVSVPTYPTGQIGFVLGGLNP 243

Query: 259 KVNLKKPLRKWSEEEEEKL-CRYYNSQIHEAAFILPQFTKNALKRS 303
           + N K+P + +++ E +++  +YYN Q+H AAFILP+F   AL +S
Sbjct: 244 ETNFKEPTKVFNDTELDQMNMKYYNDQVHRAAFILPRFITKALDKS 289



>gi|300121366|emb|CBK21746.2| unnamed protein product [Blastocystis hominis]
          Length = 288

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 203/283 (71%), Gaps = 2/283 (0%)

Query: 19  IQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKSTHYGIVLVLDGVVQCTERD 78
           I++GWF E  TLW GQ   L+++EVL HEKS YQD+L+F S  YG VLVLDGV+Q TERD
Sbjct: 3   IENGWFYESETLWSGQRFGLKVKEVLYHEKSKYQDILVFDSESYGRVLVLDGVIQVTERD 62

Query: 79  EFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESVKEIVLCDIDESVIRLSKK 138
           EF+YQEMITH+P+  H NP+NVL++      VLREVAKH  V+ IV+C+IDE V+ ++KK
Sbjct: 63  EFAYQEMITHLPLFAHRNPKNVLIVGGGDGGVLREVAKHPGVERIVMCEIDEGVVDVAKK 122

Query: 139 YL-PKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDPVGPAESLFQVKYFELMK 197
           Y     A+ FD+P++ +   D   F++D+V+ FD+II D+SDPVGPAESL+   ++  MK
Sbjct: 123 YFTASTAVAFDDPRLELLFMDAALFVKDQVDQFDVIIVDSSDPVGPAESLYTNSFYNTMK 182

Query: 198 NALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTTIPTYPSGQIGFILCSID 257
           +ALR GGII TQGECQWLHL LI +V +    LY  V YAYTTIPTYP GQIGFIL   D
Sbjct: 183 SALRKGGIICTQGECQWLHLPLIKRVMNNAATLYSSVRYAYTTIPTYPCGQIGFILAVKD 242

Query: 258 DKVNLKKPLRKWSEEEEEKLCRYYNSQIHEAAFILPQFTKNAL 300
            + +L  P  +  +E   KL RYY+ +IHEA+F+LP+F +  L
Sbjct: 243 CEDDLSHPNHEIPQEMLPKL-RYYSKEIHEASFVLPEFARKEL 284



>gi|1167999|gb|AAB35050.1| spermidine synthase, putrescine aminopropyltransferase, PAPT {EC
           2.5.1.6} [rats, Peptide, 297 aa]
          Length = 297

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 148/287 (51%), Positives = 214/287 (74%), Gaps = 4/287 (1%)

Query: 1   IEEKFSRLLMSGTTSHPQIQDGWFREKPTLWPGQAMCLEIEEVLCHEKSLYQDVLIFKST 60
           ++ +F R   +G    P I++GWFRE  +L   QA+ L++E++L H +S YQD+L+F+S 
Sbjct: 1   MKREFRR--TTGPLPGPAIREGWFRETCSL-SCQALSLQVEQLLHHRRSRYQDILVFRSK 57

Query: 61  HYGIVLVLDGVVQCTERDEFSYQEMITHIPMNCHSNPENVLVIXXXXXXVLREVAKHESV 120
            YG VLVLDGV+QCTE+DEFSYQEMI ++P+  H NP  VL+I      VLREV KH SV
Sbjct: 58  TYGNVLVLDGVIQCTEKDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSV 117

Query: 121 KEIVLCDIDESVIRLSKKYLPKMAIGFDNPKVTVHIGDGFEFLRDKVNSFDIIITDASDP 180
           + +V C+IDE VI +SKK+LP MAIG+ + K+T+H+GDGFEF++   ++FD+IITD+SDP
Sbjct: 118 ESVVQCEIDEDVIEVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDP 177

Query: 181 VGPAESLFQVKYFELMKNALRPGGIISTQGECQWLHLDLITQVQSYCRELYPVVEYAYTT 240
           +GPAESLF+  Y++LMK AL+  GI+  QGECQWLHLDLI +++ +C+ L+PVV YAY T
Sbjct: 178 MGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVSYAYCT 237

Query: 241 IPTYPSGQIGFILCSIDDKVNLKKPLRKWSEEEEEKL-CRYYNSQIH 286
           I +Y SG++G +LCS +   N ++P+++  + + E++  +YYNS +H
Sbjct: 238 IGSYGSGEMGLMLCSKNPSTNFREPVQQLRQAQVEQMQLKYYNSDMH 284