BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10389_c0_seq1-m.151 complete 207-1178(-) 324 (-)
         (323 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|389744341|gb|EIM85524.1| hypothetical protein STEHIDRAFT_1401...    73   9e-11   Stereum hirsutum FP-91666 SS1


>gi|389744341|gb|EIM85524.1| hypothetical protein STEHIDRAFT_140142 [Stereum hirsutum FP-91666
           SS1]
          Length = 315

 Score = 73.2 bits (178), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 82/185 (44%), Gaps = 22/185 (11%)

Query: 44  DENLVENNPLDVNLQDFLKGDINSTLIKLLNNALNGDGEALDDDQKAQQNGKRAANGVKK 103
           D  L   NP   N   +++       +     A NG  +A + D   +   K+    +KK
Sbjct: 64  DPKLYAANP---NFVPYMQQQPPQQQVASPAVARNGKRKAGEVDGAVEDGSKKKRGPIKK 120

Query: 104 STRKPRPPRDPNAPTKPQNAFILFQKEVASQVKAENPDKQWPEIVHLISARWKGLQKEEK 163
                  P+DPNAP +P +++I FQ E+ +Q+K E P    PE++  IS RW  L   +K
Sbjct: 121 -------PKDPNAPKRPASSYIYFQNEIRNQLKQEFPTISQPELLARISKRWGELTPVQK 173

Query: 164 EIYEHRFEEAKQTYETELKTYMEKKNKDLVVTAVDPDGVEENNDTSDSVTPDSESITSQS 223
           E+YE R   AK  YET+   Y    N D          V  +N  S  + P + +    S
Sbjct: 174 EVYEKRQATAKAQYETDKAAY--DANHD----------VSHDNSPSSPIVPATPAPVPAS 221

Query: 224 DEEDE 228
            E ++
Sbjct: 222 PEPEQ 226