BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10398_c0_seq1-m.155 complete 92-754(-) 221 (-)
         (220 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|296417829|ref|XP_002838553.1| hypothetical protein [Tuber mel...    91   2e-16   Tuber melanosporum Mel28
gi|260940949|ref|XP_002615314.1| hypothetical protein CLUG_04195...    87   4e-15   Clavispora lusitaniae ATCC 42720
gi|406604116|emb|CCH44339.1| Nucleus export protein BRL1 [Wicker...    85   1e-14   Wickerhamomyces ciferrii
gi|470318146|gb|EMR09825.1| hypothetical protein PNEG_02006 [Pne...    84   2e-14   Pneumocystis murina B123
gi|448098209|ref|XP_004198868.1| Piso0_002261 [Millerozyma farin...    83   4e-14   Millerozyma farinosa CBS 7064
gi|150864386|ref|XP_001383173.2| hypothetical protein PICST_3017...    83   5e-14   Scheffersomyces stipitis CBS 6054
gi|146552037|gb|ABQ42194.1| Brr6-like protein number 1 [Pneumocy...    82   7e-14   Pneumocystis carinii
gi|344234899|gb|EGV66767.1| hypothetical protein CANTEDRAFT_1121...    82   7e-14   Candida tenuis ATCC 10573
gi|430814033|emb|CCJ28674.1| unnamed protein product [Pneumocyst...    81   1e-13   Pneumocystis jirovecii
gi|448102094|ref|XP_004199719.1| Piso0_002261 [Millerozyma farin...    81   2e-13   Millerozyma farinosa CBS 7064
gi|401888605|gb|EJT52559.1| nuclear membrane protein,putative [T...    80   2e-13   Trichosporon asahii var. asahii CBS 2479
gi|50554203|ref|XP_504510.1| YALI0E28512p [Yarrowia lipolytica] ...    79   7e-13   Yarrowia lipolytica CLIB122
gi|254567255|ref|XP_002490738.1| Essential nuclear envelope inte...    79   1e-12   Komagataella phaffii GS115
gi|345569415|gb|EGX52281.1| hypothetical protein AOL_s00043g70 [...    78   2e-12   Arthrobotrys oligospora ATCC 24927
gi|385304194|gb|EIF48222.1| essential nuclear envelope integral ...    77   3e-12   Brettanomyces bruxellensis AWRI1499
gi|294658778|ref|XP_461111.2| DEHA2F17248p [Debaryomyces hanseni...    77   3e-12   Debaryomyces hansenii CBS767
gi|156058532|ref|XP_001595189.1| hypothetical protein SS1G_03278...    77   3e-12   Sclerotinia sclerotiorum 1980 UF-70
gi|209882009|ref|XP_002142442.1| hypothetical protein [Cryptospo...    77   4e-12   Cryptosporidium muris RN66
gi|358054542|dbj|GAA99468.1| hypothetical protein E5Q_06167 [Mix...    76   8e-12   Mixia osmundae IAM 14324
gi|66357170|ref|XP_625763.1| hypothetical protein [Cryptosporidi...    75   9e-12   Cryptosporidium parvum Iowa II
gi|67594689|ref|XP_665834.1| hypothetical protein [Cryptosporidi...    75   1e-11   Cryptosporidium hominis TU502


>gi|296417829|ref|XP_002838553.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634496|emb|CAZ82744.1| unnamed protein product [Tuber melanosporum]
          Length = 440

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 109 FVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWENCMNQ 168
           F F +T+  D  ++VE Y ++  +++ +C+ +Y+ENRC+P  R P +E  CT WE CMN+
Sbjct: 257 FCFYLTVRRDVDQKVEEYSAEIVQEMSQCAREYVENRCDPGMRVPAMEIRCTAWERCMNR 316

Query: 169 DPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFLAIIF 211
           DP  +V  + + A+ FA II+ F+E +SY+  +   +F  I+F
Sbjct: 317 DP-TLVGRARVSAETFAEIINSFIEPISYKTMVSPPLFCIILF 358



>gi|260940949|ref|XP_002615314.1| hypothetical protein CLUG_04195 [Clavispora lusitaniae ATCC 42720]
 gi|238850604|gb|EEQ40068.1| hypothetical protein CLUG_04195 [Clavispora lusitaniae ATCC 42720]
          Length = 303

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 65/109 (59%), Gaps = 2/109 (1%)

Query: 96  IKAVISAASLAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYL 155
           +  VI AA L   + F+ T+  D    V++Y SDA  +I  CS +Y  NRCN   RAP L
Sbjct: 130 LNVVIVAALLYLGYTFVRTVRRDIAHRVDMYTSDAVHEISRCSREYYRNRCNGHARAPAL 189

Query: 156 EENCTFWENCMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVF 204
           E +CT WE CMN+DP  + + + + A+  A +++ F+  LS+++ + VF
Sbjct: 190 EHSCTQWEKCMNRDPQQLGR-ARVTAETLADVVNGFVRPLSWKS-VAVF 236



>gi|406604116|emb|CCH44339.1| Nucleus export protein BRL1 [Wickerhamomyces ciferrii]
          Length = 566

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 81/141 (57%), Gaps = 12/141 (8%)

Query: 81  FRRLFDNFLWFCL-------WNIKAVISAASLAFTFVFLITLNADHQKEVEIYMSDAARK 133
           F+ L D  L + L       +N+  +I +  L F + F+ T+ AD + +V+ Y SD  ++
Sbjct: 342 FKSLIDPELPYILSLYLQLIFNV--LIVSILLYFIYSFISTVKADVENKVDSYASDIIQE 399

Query: 134 IKECSLKYIENRCNPATRAPYLEENCTFWENCMNQDPNNIVKSSEIYAKQFARIISIFLE 193
           I  CS +Y+ N C P  R   LE  C+ WE CMNQDP  + + ++I A+ FA II+ F++
Sbjct: 400 IALCSREYLRNNCQPGQRVVALEAACSQWEKCMNQDPTTVGR-AKIGAETFAEIINGFIK 458

Query: 194 NLSYEARIMVFIFLAIIFCYI 214
            +S+++  M+F+FL  +   +
Sbjct: 459 PISWKS--MIFLFLITVGSLV 477



>gi|470318146|gb|EMR09825.1| hypothetical protein PNEG_02006 [Pneumocystis murina B123]
          Length = 370

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 105 LAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWEN 164
           L F   F+ T+  D  ++V+ Y ++  +++  CS +Y ENRC+P  R P +E  CT WE 
Sbjct: 208 LYFVIAFVRTIQRDVDQKVDEYSAEILQEMSLCSKEYTENRCSPDHRVPAMERACTAWER 267

Query: 165 CMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFLAIIFCYIAIKH 218
           CMN+DP  +V  +++ A+ FA II+ F+E +SY  + M+F  L IIF  + + +
Sbjct: 268 CMNRDP-TVVGRAKVSAETFAEIINSFIEPISY--KTMIFCIL-IIFGSVFVSN 317



>gi|448098209|ref|XP_004198868.1| Piso0_002261 [Millerozyma farinosa CBS 7064]
 gi|359380290|emb|CCE82531.1| Piso0_002261 [Millerozyma farinosa CBS 7064]
          Length = 393

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 73/116 (62%), Gaps = 9/116 (7%)

Query: 99  VISAASLAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNP---ATRAPYL 155
           V+S A L   + F+ T+ AD   + E Y+SDA ++I  CS +Y  N+C+P     RAP L
Sbjct: 181 VVSIA-LYLAYSFIKTVKADVNIKTENYISDALQEISLCSREYYRNKCDPEGGKVRAPAL 239

Query: 156 EENCTFWENCMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFLAIIF 211
           E+ CT W  CMN+DP  +V  S++ A+ FA I++ F++ +S++A     +F++I+F
Sbjct: 240 EKACTMWSKCMNRDP-TLVGRSKLSAETFADIVNGFVKPISWKA----LVFISILF 290



>gi|150864386|ref|XP_001383173.2| hypothetical protein PICST_30171 [Scheffersomyces stipitis CBS
           6054]
 gi|149385642|gb|ABN65144.2| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 453

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query: 105 LAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWEN 164
           L F F+F+ T+ AD   ++E+Y+S+A  +I +C   Y  N CN   RAP LE  CT WE 
Sbjct: 247 LYFVFIFIKTIRADINHKLEVYISNAFAEIAKCERAYQRNNCN--RRAPLLEAKCTEWEK 304

Query: 165 CMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMV--FIFLAIIFCYIAIKHHR 220
           CMN DP  ++  S+I A+ FA I++ F+  +S+++ + +   IF +++   +A   +R
Sbjct: 305 CMNSDP-QLIGKSKITAETFADIVNGFIRPISWKSLVFLVCLIFGSLLVTNLAFGSYR 361



>gi|146552037|gb|ABQ42194.1| Brr6-like protein number 1 [Pneumocystis carinii]
 gi|146552039|gb|ABQ42195.1| Brr6-like protein number 1 [Pneumocystis carinii]
          Length = 370

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 69/114 (60%), Gaps = 4/114 (3%)

Query: 105 LAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWEN 164
           L F   F+ T+  D  ++V+ Y ++  +++  CS +Y ENRC+P  R P +E  C  WE 
Sbjct: 208 LYFVIAFVRTIQRDVDQKVDEYSAEILQEMSLCSKEYTENRCSPDHRVPAMERACAAWER 267

Query: 165 CMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFLAIIFCYIAIKH 218
           CMN+DP  +V  +++ A+ FA II+ F+E +SY  + M+F  L IIF  + I +
Sbjct: 268 CMNRDP-TVVGRAKVSAETFAEIINSFIEPISY--KTMIFCIL-IIFGSVFISN 317



>gi|344234899|gb|EGV66767.1| hypothetical protein CANTEDRAFT_112181 [Candida tenuis ATCC 10573]
 gi|344234900|gb|EGV66768.1| hypothetical protein CANTEDRAFT_112181 [Candida tenuis ATCC 10573]
          Length = 293

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 71/116 (61%), Gaps = 3/116 (2%)

Query: 107 FTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWENCM 166
           F  +F+ T+ +D   ++E+Y++D+ ++I +CS +Y  NRCN     P LE  CT W  CM
Sbjct: 128 FVVIFITTIRSDINNKLELYITDSLQEISKCSREYYRNRCNDDKVPPVLENQCTSWLKCM 187

Query: 167 NQDPNNIVKSSEIYAKQFARIISIFLENLSYEAR--IMVFIFLAIIFCYIAIKHHR 220
           N+DP  ++  S I A+  A I++ F++ +S++A   +++ IF +++   +A   +R
Sbjct: 188 NRDP-QLIGKSRITAETLADILNGFVKPISWKAMFFLLIAIFGSLVITNVAFNTYR 242



>gi|430814033|emb|CCJ28674.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 374

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 63/101 (62%), Gaps = 3/101 (2%)

Query: 107 FTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWENCM 166
           F   F+ T+  D  ++VE Y ++  +++  CS +Y ENRC+P  R P +E  CT WE CM
Sbjct: 216 FAITFVRTIQRDVDQKVEEYSAEILQEMSLCSKEYTENRCSPDYRVPAMERACTTWERCM 275

Query: 167 NQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFL 207
           N+DP  +V  +++ A+ FA II+ F++ +SY  + M+F  L
Sbjct: 276 NRDP-TVVGRAKVSAETFAEIINSFIDPISY--KTMIFCIL 313



>gi|448102094|ref|XP_004199719.1| Piso0_002261 [Millerozyma farinosa CBS 7064]
 gi|359381141|emb|CCE81600.1| Piso0_002261 [Millerozyma farinosa CBS 7064]
          Length = 393

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 72/116 (62%), Gaps = 9/116 (7%)

Query: 99  VISAASLAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNP---ATRAPYL 155
           V+S A L   + F+ T+ AD   + E Y+SDA ++I  CS +Y  N+C+P     RAP L
Sbjct: 181 VVSIA-LYLAYSFIKTVKADVNIKTENYISDALQEISLCSREYYRNKCDPEGGKVRAPAL 239

Query: 156 EENCTFWENCMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFLAIIF 211
           E+ CT W  CMN+DP  +V  S++ A+ FA I++ F++ +S++A      F++I+F
Sbjct: 240 EKACTMWSKCMNRDP-TLVGRSKLSAETFADIVNGFVKPISWKA----LFFISILF 290



>gi|401888605|gb|EJT52559.1| nuclear membrane protein,putative [Trichosporon asahii var. asahii
           CBS 2479]
 gi|406701994|gb|EKD05065.1| nuclear membrane protein,putative [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 418

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 64/110 (58%), Gaps = 3/110 (2%)

Query: 105 LAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWEN 164
           L     F+I +  D  + ++ Y  +  ++I +C+  Y+ NRC PATR P +E+ C+ WE 
Sbjct: 228 LYLALQFIIAIRRDVSERIDEYSVEILQEIAQCTQAYVTNRCEPATRVPAMEQACSAWET 287

Query: 165 CMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFLAIIFCYI 214
           CMN+DP  +V  + + A+ FA II+ F++++S   + M+F  L I    +
Sbjct: 288 CMNRDP-KVVGRARVGAETFADIINSFVDSISL--KTMLFSTLMIGLLVV 334



>gi|50554203|ref|XP_504510.1| YALI0E28512p [Yarrowia lipolytica]
 gi|49650379|emb|CAG80113.1| YALI0E28512p [Yarrowia lipolytica CLIB122]
          Length = 675

 Score = 79.3 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 61/111 (54%), Gaps = 1/111 (0%)

Query: 98  AVISAASLAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEE 157
           A+I A    F + F  T+  D   +V+ Y +D  +++  CS  Y+ N C P  R P LE 
Sbjct: 494 AIIMAVVSYFVWTFYSTVKRDVDMKVDEYSADILQEMAMCSKDYLANNCMPGKRVPALET 553

Query: 158 NCTFWENCMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFLA 208
            C  WE CMN+DP  IV  + + A+ FA II+ FL  +S+++ + V   LA
Sbjct: 554 MCNAWERCMNRDP-KIVGRARVSAETFAEIINGFLRPISFKSMVFVIFLLA 603



>gi|254567255|ref|XP_002490738.1| Essential nuclear envelope integral membrane protein required for
           nuclear transport [Komagataella pastoris GS115]
 gi|238030534|emb|CAY68458.1| Essential nuclear envelope integral membrane protein required for
           nuclear transport [Komagataella pastoris GS115]
 gi|328351123|emb|CCA37523.1| Nuclear hormone receptor family member nhr-6 [Komagataella pastoris
           CBS 7435]
          Length = 319

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 59/93 (63%), Gaps = 1/93 (1%)

Query: 107 FTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWENCM 166
           F + F+ T+ AD + ++E Y  D  ++I  CS +YI N C+P  R P LE++C  WE CM
Sbjct: 193 FVYSFVSTVRADVEHKIEDYALDILQEISVCSREYIRNNCDPLKRVPALEKSCLAWEKCM 252

Query: 167 NQDPNNIVKSSEIYAKQFARIISIFLENLSYEA 199
           N+DP  +V  +++ A+ FA II  F++ +S++ 
Sbjct: 253 NRDP-ALVGRAKLGAETFAEIIDGFVKPISWKT 284



>gi|345569415|gb|EGX52281.1| hypothetical protein AOL_s00043g70 [Arthrobotrys oligospora ATCC
           24927]
          Length = 480

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 67/114 (58%), Gaps = 6/114 (5%)

Query: 103 ASLAFTFVFLI--TLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCT 160
           AS+   FV+L+  T+  D  K+++ Y + A  K+  C+ K +ENRC P    P + E C 
Sbjct: 254 ASVVMYFVYLVWSTIQKDVNKKIDDYTAVAQLKVAACNAKLVENRCQPGLMVPAMAEQCM 313

Query: 161 FWENCMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFLAIIFCYI 214
            W  C   DP N  + S++ A+ FA+II+ F+E++SY++  MVF  LA+ F  I
Sbjct: 314 EWRACAEMDPYNTGR-SQVSAETFAQIINGFVEHISYKS--MVFC-LALAFGCI 363



>gi|385304194|gb|EIF48222.1| essential nuclear envelope integral membrane protein required for
           nuclear transport [Dekkera bruxellensis AWRI1499]
          Length = 518

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 65/117 (55%), Gaps = 6/117 (5%)

Query: 96  IKAVISAASLAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYL 155
           +  V+ A  +A   +  +++  D  ++V+ Y+ +   KI  C  +Y+ N C P  RAP L
Sbjct: 287 MNTVVVACLIAIVIICFMSVKRDVDRKVQTYVIEMVHKINSCRREYLRNNCAPEMRAPAL 346

Query: 156 EENCTFWENCMNQDPNNIVKSSEIYAKQFARIISIFLENLSYE-----ARIMVFIFL 207
           E +CT WENCMN+DP ++V +S  Y +  A  ++ F  NLS+      A ++ FI +
Sbjct: 347 ENSCTEWENCMNEDPKSVV-TSVAYFEVMADCMNAFFHNLSFRTLCSMAGLLFFIVI 402



>gi|294658778|ref|XP_461111.2| DEHA2F17248p [Debaryomyces hansenii CBS767]
 gi|202953376|emb|CAG89493.2| DEHA2F17248p [Debaryomyces hansenii CBS767]
          Length = 436

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 71/121 (58%), Gaps = 6/121 (4%)

Query: 105 LAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRC---NPATRAPYLEENCTF 161
           L   F+F+ T+ +D   ++E Y SDA ++I  CS +Y  N+C   +   R P LE+ CT 
Sbjct: 222 LYLLFIFIRTIKSDISHKLETYTSDAIQEISLCSREYYRNKCSIEDGHKRVPALEKACTV 281

Query: 162 WENCMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMV--FIFLAIIFCYIAIKHH 219
           W  CMN+DP  ++  S+I A+ FA I++ F++ +++++   +   IF ++    IA+  +
Sbjct: 282 WSKCMNRDP-QLIGKSKITAETFADIVNGFVKPITWKSLFFMNFMIFGSLFITNIALGSY 340

Query: 220 R 220
           R
Sbjct: 341 R 341



>gi|156058532|ref|XP_001595189.1| hypothetical protein SS1G_03278 [Sclerotinia sclerotiorum 1980]
 gi|154701065|gb|EDO00804.1| hypothetical protein SS1G_03278 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 443

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 109 FVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWENCMNQ 168
           + F  T+ +D  K  +   ++   ++  C+ +Y ENRC P+ R P LE  C  WE CM  
Sbjct: 227 YSFWTTIRSDVDKASQKATAEVLSEMAHCAKQYAENRCEPSMRLPALETVCNNWEACMTM 286

Query: 169 DPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFLAI 209
           DPN++ + + I AK FA I+  F++ +SY+A I V + L +
Sbjct: 287 DPNSVGR-ARISAKTFAEILDSFIQPISYKAMIFVALILTL 326



>gi|209882009|ref|XP_002142442.1| hypothetical protein [Cryptosporidium muris RN66]
 gi|209558048|gb|EEA08093.1| hypothetical protein, conserved [Cryptosporidium muris RN66]
          Length = 319

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (59%)

Query: 118 DHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWENCMNQDPNNIVKSS 177
           D + +++I + +   ++  CS +Y +N+CNP  R P LE  C  WE CMNQDP  I + S
Sbjct: 201 DIESKIQISVRNLMEEMAICSRQYTDNKCNPNERVPALETKCIEWEKCMNQDPAIIARRS 260

Query: 178 EIYAKQFARIISIFLENLSYEARIMVFIFLAIIF 211
              A+    I++ FL+ LS+++ I++F  L  +F
Sbjct: 261 SFTAQTIGEILNTFLDQLSWKSAILIFGGLISLF 294



>gi|358054542|dbj|GAA99468.1| hypothetical protein E5Q_06167 [Mixia osmundae IAM 14324]
          Length = 379

 Score = 75.9 bits (185), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 63/107 (58%), Gaps = 2/107 (1%)

Query: 111 FLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRAPYLEENCTFWENCMNQDP 170
           F++T+  D    +  Y ++  +++++C   Y+ NRC P TR P++E  C  WE+CMN++P
Sbjct: 238 FVLTVRHDVSDRMTSYSTEILQEVEQCRQLYLANRCEPETRIPHMESTCQGWEHCMNRNP 297

Query: 171 NNIVKSSEIYAKQFARIISIFLENLSYEARI-MVFIFLAIIFCYIAI 216
             IV  + + A+    +I+ F+E +S+   I +V +F  ++ C  ++
Sbjct: 298 -KIVGRARVAAETLGEVINSFVEVMSWRTMIFLVLLFATLLVCTNSV 343



>gi|66357170|ref|XP_625763.1| hypothetical protein [Cryptosporidium parvum Iowa II]
 gi|46226940|gb|EAK87906.1| conserved hypothetical protein [Cryptosporidium parvum Iowa II]
          Length = 336

 Score = 75.5 bits (184), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 67/115 (58%), Gaps = 2/115 (1%)

Query: 93  LWNIKAVISAASLAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRA 152
           ++NI  V     + F  +F+I    D + +++I +++   ++  CS  Y++N+C+P  R 
Sbjct: 187 IFNIIIVFITLYIIFGIIFVIK--NDIESKIQISITNILDEMNICSKHYVDNKCHPEQRV 244

Query: 153 PYLEENCTFWENCMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFL 207
           P +E  CT WE CM+Q+P  I + S   A+    II+ FL+ +S+++ + +F F+
Sbjct: 245 PAMESKCTEWERCMSQNPTIIARKSIFTAQIIGEIINTFLDQISFKSALFIFGFI 299



>gi|67594689|ref|XP_665834.1| hypothetical protein [Cryptosporidium hominis TU502]
 gi|54656678|gb|EAL35601.1| hypothetical protein Chro.40190 [Cryptosporidium hominis]
          Length = 337

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 67/115 (58%), Gaps = 2/115 (1%)

Query: 93  LWNIKAVISAASLAFTFVFLITLNADHQKEVEIYMSDAARKIKECSLKYIENRCNPATRA 152
           ++NI  V     + F  +F+I    D + +++I +++   ++  CS  Y++N+C+P  R 
Sbjct: 188 IFNIIIVFITLYIIFGIIFVIK--NDIESKIQISITNILDEMNICSKHYVDNKCHPEQRV 245

Query: 153 PYLEENCTFWENCMNQDPNNIVKSSEIYAKQFARIISIFLENLSYEARIMVFIFL 207
           P +E  CT WE CM+Q+P  I + S   A+    II+ FL+ +S+++ + +F F+
Sbjct: 246 PAMESKCTEWERCMSQNPTIIARKSIFTAQIIGEIINTFLDQISFKSALFIFGFI 300