BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp1039_c0_seq1-m.157 5prime_partial 184-663(-) 160 (-)
         (159 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|409075154|gb|EKM75538.1| hypothetical protein AGABI1DRAFT_116...   199   2e-49   Agaricus bisporus var. burnettii JB137-S8
gi|302689311|ref|XP_003034335.1| 60S ribosomal protein L25 [Schi...   196   2e-48   Schizophyllum commune H4-8
gi|353244155|emb|CCA75599.1| probable RPL25-ribosomal protein L2...   195   4e-48   Serendipita indica DSM 11827
gi|511005546|gb|EPB86882.1| 60S ribosomal protein L25 [Mucor cir...   195   4e-48   Mucor circinelloides f. circinelloides 1006PhL
gi|511002985|gb|EPB84404.1| 50S ribosomal protein L23Ae [Mucor c...   194   4e-48   Mucor circinelloides f. circinelloides 1006PhL
gi|409040209|gb|EKM49697.1| hypothetical protein PHACADRAFT_2142...   194   7e-48   Phanerochaete carnosa HHB-10118-sp
gi|296425039|ref|XP_002842051.1| 60S ribosomal protein L25 [Tube...   194   8e-48   Tuber melanosporum Mel28
gi|392579981|gb|EIW73108.1| hypothetical protein TREMEDRAFT_3715...   193   1e-47   Tremella mesenterica DSM 1558
gi|395328248|gb|EJF60641.1| hypothetical protein DICSQDRAFT_1707...   192   2e-47   Dichomitus squalens LYAD-421 SS1
gi|58264518|ref|XP_569415.1| ribosomal protein [Cryptococcus neo...   192   3e-47   Cryptococcus neoformans var. neoformans JEC21
gi|390603000|gb|EIN12392.1| hypothetical protein PUNSTDRAFT_9707...   192   3e-47   Punctularia strigosozonata HHB-11173 SS5
gi|321254662|ref|XP_003193153.1| ribosomal protein [Cryptococcus...   192   3e-47   Cryptococcus gattii WM276
gi|299743972|ref|XP_001836111.2| ribosomal protein rpl23a [Copri...   191   6e-47   Coprinopsis cinerea okayama7#130
gi|511000645|gb|EPB82170.1| 50S ribosomal protein L23Ae [Mucor c...   190   8e-47   Mucor circinelloides f. circinelloides 1006PhL
gi|392560917|gb|EIW54099.1| hypothetical protein TRAVEDRAFT_5182...   189   1e-46   Trametes versicolor FP-101664 SS1
gi|403412778|emb|CCL99478.1| predicted protein [Fibroporia radic...   189   2e-46   Fibroporia radiculosa
gi|389744640|gb|EIM85822.1| hypothetical protein STEHIDRAFT_1315...   188   5e-46   Stereum hirsutum FP-91666 SS1
gi|242206798|ref|XP_002469254.1| 60S ribosomal protein L23a [Pos...   188   5e-46   Postia placenta Mad-698-R
gi|213409297|ref|XP_002175419.1| 60S ribosomal protein L25 [Schi...   188   5e-46   Schizosaccharomyces japonicus yFS275
gi|19111959|ref|NP_595167.1| 60S ribosomal protein L25 [Schizosa...   187   6e-46   Schizosaccharomyces pombe 972h-
gi|501750299|emb|CCG84928.1| protein of unknown function [Taphri...   187   6e-46   Taphrina deformans PYCC 5710
gi|336369765|gb|EGN98106.1| hypothetical protein SERLA73DRAFT_13...   187   1e-45   Serpula lacrymans var. lacrymans S7.3
gi|401884101|gb|EJT48274.1| ribosomal protein [Trichosporon asah...   186   1e-45   Trichosporon asahii var. asahii CBS 2479
gi|406695927|gb|EKC99224.1| ribosomal protein [Trichosporon asah...   186   1e-45   Trichosporon asahii var. asahii CBS 8904
gi|384487609|gb|EIE79789.1| hypothetical protein RO3G_04494 [Rhi...   186   2e-45   Rhizopus delemar RA 99-880
gi|19112896|ref|NP_596104.1| 60S ribosomal protein L25 [Schizosa...   186   2e-45   Schizosaccharomyces pombe 972h-
gi|213406515|ref|XP_002174029.1| 60S ribosomal protein L25 [Schi...   186   3e-45   Schizosaccharomyces japonicus yFS275
gi|393243039|gb|EJD50555.1| hypothetical protein AURDEDRAFT_1604...   185   3e-45   Auricularia subglabra TFB-10046 SS5
gi|170112748|ref|XP_001887575.1| 60S ribosomal protein L25 [Lacc...   185   4e-45   Laccaria bicolor S238N-H82
gi|384494965|gb|EIE85456.1| 60S ribosomal protein L23 [Rhizopus ...   184   5e-45   Rhizopus delemar RA 99-880
gi|449548725|gb|EMD39691.1| hypothetical protein CERSUDRAFT_1120...   184   6e-45   Gelatoporia subvermispora B
gi|331211677|ref|XP_003307108.1| 60S ribosomal protein L25 [Pucc...   183   1e-44   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|378730379|gb|EHY56838.1| 50S ribosomal protein L23Ae [Exophia...   183   2e-44   Exophiala dermatitidis NIH/UT8656
gi|392591912|gb|EIW81239.1| hypothetical protein CONPUDRAFT_9025...   182   2e-44   Coniophora puteana RWD-64-598 SS2
gi|358057018|dbj|GAA96925.1| hypothetical protein E5Q_03599 [Mix...   182   3e-44   Mixia osmundae IAM 14324
gi|303319371|ref|XP_003069685.1| 60S ribosomal protein L25 [Cocc...   181   5e-44   Coccidioides posadasii C735 delta SOWgp
gi|470317453|gb|EMR09165.1| hypothetical protein PNEG_02505 [Pne...   181   6e-44   Pneumocystis murina B123
gi|406861776|gb|EKD14829.1| 60S ribosomal protein L25 [Marssonin...   181   6e-44   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|258571421|ref|XP_002544514.1| 60S ribosomal protein L23a [Unc...   180   1e-43   Uncinocarpus reesii 1704
gi|512201080|gb|EPE29912.1| Ribosomal proteins S24e, L23 and L15...   179   2e-43   Glarea lozoyensis ATCC 20868
gi|367027222|ref|XP_003662895.1| hypothetical protein MYCTH_2304...   179   2e-43   Myceliophthora thermophila ATCC 42464
gi|52346130|ref|NP_001005109.1| 60S ribosomal protein L23a [Xeno...   179   2e-43   Xenopus tropicalis [western clawed frog]
gi|295660583|ref|XP_002790848.1| 60S ribosomal protein L25 [Para...   179   2e-43   
gi|494829976|gb|EON66545.1| large subunit ribosomal protein L23A...   179   2e-43   Coniosporium apollinis CBS 100218
gi|71051661|gb|AAH98550.1| Ribosomal protein L23a [Danio rerio]       179   2e-43   Danio rerio [leopard danio]
gi|225562243|gb|EEH10523.1| 60S ribosomal protein L23 [Ajellomyc...   179   2e-43   Histoplasma capsulatum G186AR
gi|443917470|gb|ELU38184.1| pre-mRNA-splicing factor PRP46 [Rhiz...   179   2e-43   Rhizoctonia solani AG-1 IA
gi|505787930|ref|XP_004605078.1| PREDICTED: 60S ribosomal protei...   179   3e-43   Sorex araneus [Eurasian shrew]
gi|85109766|ref|XP_963077.1| 60S ribosomal protein L25 [Neurospo...   179   3e-43   Neurospora crassa OR74A
gi|240277326|gb|EER40835.1| 60S ribosomal protein L23 [Ajellomyc...   179   3e-43   Histoplasma capsulatum H143
gi|261190843|ref|XP_002621830.1| 60S ribosomal protein L25 [Ajel...   179   3e-43   Blastomyces gilchristii SLH14081
gi|400597092|gb|EJP64836.1| 60S ribosomal protein L23a [Beauveri...   179   3e-43   Beauveria bassiana ARSEF 2860
gi|320587875|gb|EFX00350.1| 60S ribosomal protein l23 [Grosmanni...   179   3e-43   Grosmannia clavigera kw1407
gi|119182708|ref|XP_001242474.1| 60S ribosomal protein L25 [Cocc...   179   3e-43   
gi|354487134|ref|XP_003505730.1| PREDICTED: 60S ribosomal protei...   179   3e-43   Cricetulus griseus [Chinese hamsters]
gi|229366302|gb|ACQ58131.1| 60S ribosomal protein L23a [Anoplopo...   178   3e-43   Anoplopoma fimbria
gi|147903795|ref|NP_001087299.1| 60S ribosomal protein L23a [Xen...   178   3e-43   Xenopus laevis [clawed frog]
gi|164690983|dbj|BAF98674.1| ribosomal protein L23a [Solea seneg...   178   4e-43   Solea senegalensis
gi|328852136|gb|EGG01284.1| hypothetical protein MELLADRAFT_5014...   178   4e-43   Melampsora larici-populina 98AG31
gi|171686614|ref|XP_001908248.1| hypothetical protein [Podospora...   178   4e-43   Podospora anserina S mat+
gi|291391735|ref|XP_002712333.1| PREDICTED: ribosomal protein L2...   178   4e-43   
gi|327291940|ref|XP_003230678.1| PREDICTED: 60S ribosomal protei...   178   4e-43   Anolis carolinensis [Carolina anole]
gi|239613220|gb|EEQ90207.1| ribosomal protein L23a [Ajellomyces ...   178   4e-43   Blastomyces dermatitidis ER-3
gi|213511340|ref|NP_001134773.1| 60S ribosomal protein L23a [Sal...   178   4e-43   Salmo salar
gi|198285535|gb|ACH85306.1| ribosomal protein L23a [Salmo salar]      178   4e-43   Salmo salar
gi|478518582|ref|XP_004433518.1| PREDICTED: 60S ribosomal protei...   178   5e-43   
gi|355770573|gb|EHH62883.1| hypothetical protein EGM_19719 [Maca...   178   5e-43   Macaca fascicularis [crab eating macaque]
gi|395536138|ref|XP_003770077.1| PREDICTED: 60S ribosomal protei...   178   5e-43   Sarcophilus harrisii
gi|403261837|ref|XP_003923316.1| PREDICTED: 60S ribosomal protei...   178   5e-43   
gi|441661201|ref|XP_003277177.2| PREDICTED: 60S ribosomal protei...   178   5e-43   Nomascus leucogenys [White-cheeked Gibbon]
gi|498981319|ref|XP_004550032.1| PREDICTED: 60S ribosomal protei...   178   5e-43   Maylandia zebra
gi|62660318|ref|XP_340851.2| PREDICTED: 60S ribosomal protein L2...   178   5e-43   
gi|327315383|ref|NP_001192153.1| 60S ribosomal protein L23a [Ory...   178   5e-43   Oryctolagus cuniculus [European rabbit]
gi|350534812|ref|NP_001232640.1| putative 60S ribosomal protein ...   177   5e-43   Taeniopygia guttata
gi|488515944|ref|XP_004449969.1| PREDICTED: 60S ribosomal protei...   177   6e-43   Dasypus novemcinctus
gi|500260146|gb|EOO02849.1| putative 60s ribosomal protein l25 p...   177   6e-43   Phaeoacremonium minimum UCRPA7
gi|336262043|ref|XP_003345807.1| 60S ribosomal protein L25 [Sord...   177   6e-43   Sordaria macrospora k-hell
gi|426227397|ref|XP_004007804.1| PREDICTED: 60S ribosomal protei...   177   6e-43   
gi|119571516|gb|EAW51131.1| ribosomal protein L23a, isoform CRA_...   177   6e-43   Homo sapiens [man]
gi|465993754|ref|XP_004267173.1| PREDICTED: 60S ribosomal protei...   177   6e-43   Orcinus orca [Orca]
gi|116192225|ref|XP_001221925.1| 60S ribosomal protein L25 [Chae...   177   6e-43   Chaetomium globosum CBS 148.51
gi|348518706|ref|XP_003446872.1| PREDICTED: 60S ribosomal protei...   177   6e-43   
gi|390462634|ref|XP_002747630.2| PREDICTED: 60S ribosomal protei...   177   6e-43   
gi|334324696|ref|XP_001375997.2| PREDICTED: 60S ribosomal protei...   177   6e-43   Monodelphis domestica
gi|15293915|gb|AAK95150.1| ribosomal protein L23a [Ictalurus pun...   177   6e-43   Ictalurus punctatus
gi|410915488|ref|XP_003971219.1| PREDICTED: 60S ribosomal protei...   177   6e-43   
gi|301753056|ref|XP_002912365.1| PREDICTED: 60S ribosomal protei...   177   6e-43   
gi|432897359|ref|XP_004076433.1| PREDICTED: 60S ribosomal protei...   177   7e-43   
gi|48597012|ref|NP_001001593.1| 60S ribosomal protein L23a [Dani...   177   7e-43   Danio rerio [leopard danio]
gi|389632321|ref|XP_003713813.1| 60S ribosomal protein L23a [Mag...   177   7e-43   Magnaporthe oryzae 70-15
gi|306549|gb|AAA35681.1| homology to rat ribosomal protein L23, ...   177   7e-43   Homo sapiens [man]
gi|16741485|gb|AAH16558.1| Rpl23a protein, partial [Mus musculus]     177   7e-43   Mus musculus [mouse]
gi|20071865|gb|AAH26656.1| Rpl23a protein, partial [Mus musculus...   177   7e-43   Mus musculus [mouse]
gi|402086845|gb|EJT81743.1| 60S ribosomal protein L23a [Gaeumann...   177   8e-43   Gaeumannomyces graminis var. tritici R3-111a-1
gi|326936224|ref|XP_003214156.1| PREDICTED: 60S ribosomal protei...   177   8e-43   
gi|404015|gb|AAA03341.1| ribosomal protein L23a, partial [Homo s...   177   8e-43   Homo sapiens [man]
gi|17105394|ref|NP_000975.2| 60S ribosomal protein L23a [Homo sa...   177   8e-43   Homo sapiens [man]
gi|293345157|ref|XP_001073396.2| PREDICTED: 60S ribosomal protei...   177   8e-43   
gi|402911471|ref|XP_003918349.1| PREDICTED: 60S ribosomal protei...   177   9e-43   
gi|322700194|gb|EFY91950.1| 60S ribosomal protein L25 [Metarhizi...   177   9e-43   Metarhizium acridum CQMa 102
gi|440904517|gb|ELR55017.1| 60S ribosomal protein L23a, partial ...   177   1e-42   Bos mutus
gi|348567969|ref|XP_003469771.1| PREDICTED: 60S ribosomal protei...   177   1e-42   Cavia porcellus [guinea pig]
gi|348567967|ref|XP_003469770.1| PREDICTED: 60S ribosomal protei...   177   1e-42   Cavia porcellus [guinea pig]
gi|488515942|ref|XP_004449968.1| PREDICTED: 60S ribosomal protei...   177   1e-42   
gi|344290549|ref|XP_003417000.1| PREDICTED: 60S ribosomal protei...   177   1e-42   
gi|465792779|emb|CCU98021.1| unnamed protein product [Malassezia...   176   1e-42   Malassezia sympodialis ATCC 42132
gi|281350542|gb|EFB26126.1| hypothetical protein PANDA_000109 [A...   176   2e-42   Ailuropoda melanoleuca
gi|169765287|ref|XP_001817115.1| 60S ribosomal protein L25 [Aspe...   176   2e-42   Aspergillus oryzae RIB40
gi|440632254|gb|ELR02173.1| large subunit ribosomal protein L23A...   176   2e-42   Pseudogymnoascus destructans 20631-21
gi|367050618|ref|XP_003655688.1| 60S ribosomal protein L25 [Thie...   176   2e-42   Thielavia terrestris NRRL 8126
gi|296191511|ref|XP_002743650.1| PREDICTED: 60S ribosomal protei...   176   2e-42   
gi|242794709|ref|XP_002482430.1| 60S ribosomal protein L25 [Tala...   176   2e-42   Talaromyces stipitatus ATCC 10500
gi|380474400|emb|CCF45798.1| ribosomal protein L23 [Colletotrich...   176   2e-42   Colletotrichum higginsianum
gi|351710149|gb|EHB13068.1| 60S ribosomal protein L23a [Heteroce...   176   2e-42   Heterocephalus glaber [naked mole rat]
gi|345327764|ref|XP_001512932.2| PREDICTED: 60S ribosomal protei...   176   2e-42   
gi|448533613|ref|XP_003870667.1| Rpl25 rRNA-binding ribosomal pr...   176   2e-42   Candida orthopsilosis Co 90-125
gi|355750095|gb|EHH54433.1| hypothetical protein EGM_15272 [Maca...   176   2e-42   Macaca fascicularis [crab eating macaque]
gi|109078134|ref|XP_001099556.1| PREDICTED: 60S ribosomal protei...   176   2e-42   
gi|346322082|gb|EGX91681.1| 60S ribosomal protein L23 [Cordyceps...   176   2e-42   Cordyceps militaris CM01
gi|310793193|gb|EFQ28654.1| ribosomal protein L23 [Glomerella gr...   176   2e-42   Colletotrichum graminicola M1.001
gi|322711949|gb|EFZ03522.1| 60S ribosomal protein L25 [Metarhizi...   176   3e-42   
gi|291389010|ref|XP_002711010.1| PREDICTED: ribosomal protein L2...   176   3e-42   
gi|459372936|gb|EMG50275.1| hypothetical protein G210_4692 [Cand...   176   3e-42   Candida maltosa Xu316
gi|148692922|gb|EDL24869.1| mCG1034428 [Mus musculus]                 175   3e-42   Mus musculus [mouse]
gi|119599019|gb|EAW78613.1| hCG16001, isoform CRA_a [Homo sapiens]    175   3e-42   Homo sapiens [man]
gi|472387721|ref|XP_004413198.1| PREDICTED: 60S ribosomal protei...   175   3e-42   
gi|296204840|ref|XP_002749504.1| PREDICTED: 60S ribosomal protei...   175   3e-42   
gi|291384263|ref|XP_002708737.1| PREDICTED: ribosomal protein L2...   175   3e-42   
gi|296480490|tpg|DAA22605.1| TPA: ribosomal protein L23a-like [B...   175   3e-42   Bos taurus [bovine]
gi|296484156|tpg|DAA26271.1| TPA: ribosomal protein L23a-like [B...   175   3e-42   Bos taurus [bovine]
gi|291396319|ref|XP_002714524.1| PREDICTED: ribosomal protein L2...   175   3e-42   
gi|472356490|ref|XP_004397885.1| PREDICTED: 60S ribosomal protei...   175   3e-42   
gi|119599020|gb|EAW78614.1| hCG16001, isoform CRA_b [Homo sapiens]    175   3e-42   Homo sapiens [man]
gi|47227151|emb|CAG00513.1| unnamed protein product [Tetraodon n...   175   4e-42   Tetraodon nigroviridis
gi|504168676|ref|XP_004593973.1| PREDICTED: 60S ribosomal protei...   175   4e-42   Ochotona princeps [southern American pika]
gi|166952305|gb|ABZ04235.1| ribosomal protein rpl23a [Lineus vir...   175   4e-42   Lineus viridis
gi|156064031|ref|XP_001597937.1| 60S ribosomal protein L25 [Scle...   175   4e-42   Sclerotinia sclerotiorum 1980 UF-70
gi|358380056|gb|EHK17735.1| hypothetical protein TRIVIDRAFT_1831...   175   4e-42   Trichoderma virens Gv29-8
gi|327301405|ref|XP_003235395.1| 60S ribosomal protein L25 [Tric...   175   4e-42   Trichophyton rubrum CBS 118892
gi|471407667|ref|XP_004385420.1| PREDICTED: 60S ribosomal protei...   174   5e-42   Trichechus manatus latirostris
gi|149702854|ref|XP_001499298.1| PREDICTED: 60S ribosomal protei...   174   5e-42   Equus caballus [domestic horse]
gi|109120362|ref|XP_001117952.1| PREDICTED: 60S ribosomal protei...   174   5e-42   
gi|109089832|ref|XP_001095173.1| PREDICTED: 60S ribosomal protei...   174   5e-42   
gi|340959351|gb|EGS20532.1| 60S ribosomal protein L25-like prote...   174   5e-42   Chaetomium thermophilum var. thermophilum DSM 1495
gi|393212451|gb|EJC97951.1| hypothetical protein FOMMEDRAFT_9786...   174   5e-42   Fomitiporia mediterranea MF3/22
gi|351715399|gb|EHB18318.1| 60S ribosomal protein L23a [Heteroce...   174   5e-42   Heterocephalus glaber [naked mole rat]
gi|149266479|ref|XP_001476183.1| PREDICTED: 60S ribosomal protei...   174   6e-42   
gi|466087256|ref|XP_004286026.1| PREDICTED: 60S ribosomal protei...   174   6e-42   
gi|403281989|ref|XP_003932449.1| PREDICTED: 60S ribosomal protei...   174   6e-42   
gi|498981315|ref|XP_004550031.1| PREDICTED: 60S ribosomal protei...   174   6e-42   
gi|402883333|ref|XP_003905174.1| PREDICTED: 60S ribosomal protei...   174   6e-42   
gi|109076051|ref|XP_001097637.1| PREDICTED: 60S ribosomal protei...   174   6e-42   
gi|296210305|ref|XP_002751913.1| PREDICTED: 60S ribosomal protei...   174   6e-42   
gi|430811954|emb|CCJ30603.1| unnamed protein product [Pneumocyst...   174   7e-42   Pneumocystis jirovecii
gi|355567623|gb|EHH23964.1| hypothetical protein EGK_07538 [Maca...   174   7e-42   Macaca mulatta [rhesus macaque]
gi|1574942|gb|AAB17510.1| ribosomal protein L23a [Homo sapiens]       174   8e-42   Homo sapiens [man]
gi|403290615|ref|XP_003936407.1| PREDICTED: 60S ribosomal protei...   174   8e-42   
gi|359318950|ref|XP_003638956.1| PREDICTED: 60S ribosomal protei...   174   8e-42   
gi|354543080|emb|CCE39798.1| hypothetical protein CPAR2_602160 [...   174   8e-42   Candida parapsilosis
gi|302502009|ref|XP_003012996.1| hypothetical protein ARB_00879 ...   174   9e-42   Arthroderma benhamiae CBS 112371
gi|340518442|gb|EGR48683.1| hypothetical protein TRIREDRAFT_6159...   174   9e-42   Trichoderma reesei QM6a
gi|344258446|gb|EGW14550.1| 60S ribosomal protein L23a [Cricetul...   174   9e-42   Cricetulus griseus [Chinese hamsters]
gi|485917148|gb|EOD44201.1| putative 60s ribosomal protein l25 p...   174   1e-41   Neofusicoccum parvum UCRNP2
gi|115438528|ref|XP_001218089.1| 60S ribosomal protein L25 [Aspe...   173   1e-41   Aspergillus terreus NIH2624
gi|296817353|ref|XP_002849013.1| 60S ribosomal protein L25 [Arth...   173   1e-41   Arthroderma otae CBS 113480
gi|212536036|ref|XP_002148174.1| 60S ribosomal protein L23 [Tala...   173   1e-41   Talaromyces marneffei ATCC 18224
gi|471574598|gb|EMR72412.1| putative 60s ribosomal protein l25 p...   173   1e-41   Eutypa lata UCREL1
gi|358420065|ref|XP_003584411.1| PREDICTED: 60S ribosomal protei...   173   1e-41   
gi|119498617|ref|XP_001266066.1| 60S ribosomal protein L25 [Neos...   173   1e-41   Aspergillus fischeri NRRL 181
gi|470423489|ref|XP_004337603.1| ribosomal protein L23, putative...   173   1e-41   Acanthamoeba castellanii str. Neff
gi|457866957|emb|CCQ18589.1| 60S ribosomal protein L14/L17/L23 [...   173   2e-41   Sycon ciliatum
gi|358373324|dbj|GAA89923.1| 60S ribosomal protein L23 [Aspergil...   173   2e-41   Aspergillus kawachii IFO 4308
gi|504175923|ref|XP_004597470.1| PREDICTED: 60S ribosomal protei...   173   2e-41   
gi|70998694|ref|XP_754069.1| 60S ribosomal protein L23 [Aspergil...   173   2e-41   Aspergillus fumigatus Af293
gi|335301731|ref|XP_001928884.3| PREDICTED: 60S ribosomal protei...   173   2e-41   
gi|472352956|ref|XP_004396150.1| PREDICTED: 60S ribosomal protei...   172   2e-41   
gi|298707885|emb|CBJ30282.1| conserved unknown protein [Ectocarp...   172   2e-41   Ectocarpus siliculosus
gi|121712574|ref|XP_001273898.1| 60S ribosomal protein L25 [Aspe...   172   2e-41   Aspergillus clavatus NRRL 1
gi|443899005|dbj|GAC76338.1| 60s ribosomal protein L23 [Pseudozy...   172   2e-41   Moesziomyces antarcticus T-34
gi|296189809|ref|XP_002742928.1| PREDICTED: 60S ribosomal protei...   172   2e-41   
gi|291409800|ref|XP_002721195.1| PREDICTED: ribosomal protein L2...   172   2e-41   
gi|126326630|ref|XP_001371028.1| PREDICTED: 60S ribosomal protei...   172   2e-41   
gi|145253881|ref|XP_001398453.1| 60S ribosomal protein L25 [Aspe...   172   2e-41   Aspergillus niger CBS 513.88
gi|449459936|ref|XP_004147702.1| PREDICTED: 60S ribosomal protei...   172   2e-41   Cucumis sativus [cucumbers]
gi|241956506|ref|XP_002420973.1| 60S ribosomal protein L25 [Cand...   172   3e-41   Candida dubliniensis CD36
gi|22758866|gb|AAN05592.1| ribosomal protein L23a [Argopecten ir...   172   3e-41   Argopecten irradians
gi|507628118|ref|XP_004627114.1| PREDICTED: 60S ribosomal protei...   172   3e-41   
gi|403289760|ref|XP_003936011.1| PREDICTED: 60S ribosomal protei...   172   3e-41   
gi|443699145|gb|ELT98756.1| hypothetical protein CAPTEDRAFT_1583...   172   3e-41   Capitella teleta
gi|291383583|ref|XP_002708813.1| PREDICTED: ribosomal protein L2...   172   3e-41   
gi|472585461|gb|EMS23015.1| 60S ribosomal protein l23a [Rhodospo...   172   3e-41   Rhodotorula toruloides NP11
gi|448090707|ref|XP_004197140.1| Piso0_004378 [Millerozyma farin...   172   3e-41   Millerozyma farinosa CBS 7064
gi|315049151|ref|XP_003173950.1| 60S ribosomal protein L25 [Arth...   172   3e-41   Microsporum gypseum CBS 118893
gi|344267825|ref|XP_003405766.1| PREDICTED: 60S ribosomal protei...   172   3e-41   
gi|71023831|ref|XP_762145.1| hypothetical protein UM05998.1 [Ust...   171   4e-41   
gi|358399122|gb|EHK48465.1| hypothetical protein TRIATDRAFT_2553...   171   4e-41   Trichoderma atroviride IMI 206040
gi|65332270|gb|AAY42210.1| ribosomal protein L23 [Haemaphysalis ...   171   4e-41   Haemaphysalis qinghaiensis
gi|241671010|ref|XP_002399960.1| 60S ribosomal protein L23, puta...   171   4e-41   Ixodes scapularis [blacklegged tick]
gi|501304935|dbj|GAC94204.1| 60S ribosomal protein [Pseudozyma h...   171   4e-41   Pseudozyma hubeiensis SY62
gi|512906932|ref|XP_004900973.1| PREDICTED: 60S ribosomal protei...   171   4e-41   
gi|296204599|ref|XP_002749339.1| PREDICTED: 60S ribosomal protei...   171   4e-41   
gi|512824450|ref|XP_004880390.1| PREDICTED: 60S ribosomal protei...   171   5e-41   
gi|154298856|ref|XP_001549849.1| 60S ribosomal protein L25 [Botr...   171   5e-41   Botrytis cinerea B05.10
gi|160550243|gb|ABX44826.1| putative 60S ribosomal protein RPL23...   171   5e-41   Flustra foliacea
gi|109132348|ref|XP_001097481.1| PREDICTED: 60S ribosomal protei...   171   6e-41   
gi|507930959|ref|XP_004676723.1| PREDICTED: 60S ribosomal protei...   171   6e-41   
gi|399168928|emb|CCE30216.1| probable ribosomal protein L23a, cy...   171   6e-41   Claviceps purpurea 20.1
gi|397521145|ref|XP_003830663.1| PREDICTED: 60S ribosomal protei...   171   6e-41   
gi|109497962|ref|XP_001065345.1| PREDICTED: 60S ribosomal protei...   171   8e-41   
gi|395862975|ref|XP_003803690.1| PREDICTED: 60S ribosomal protei...   171   8e-41   
gi|466014863|ref|XP_004271012.1| PREDICTED: 60S ribosomal protei...   171   8e-41   
gi|470326773|ref|XP_004364786.1| ribosomal protein L23a [Capsasp...   170   9e-41   Capsaspora owczarzaki ATCC 30864
gi|109148510|ref|XP_001082946.1| PREDICTED: 60S ribosomal protei...   170   9e-41   
gi|343427760|emb|CBQ71286.1| probable RPL25-ribosomal protein L2...   170   9e-41   Sporisorium reilianum SRZ2
gi|477531033|gb|ENH82756.1| 60s ribosomal protein l25 [Colletotr...   170   9e-41   Colletotrichum orbiculare MAFF 240422
gi|50421963|ref|XP_459542.1| 60S ribosomal protein L25 [Debaryom...   170   1e-40   Debaryomyces hansenii CBS767
gi|332848771|ref|XP_003315715.1| PREDICTED: 60S ribosomal protei...   170   1e-40   
gi|297473712|ref|XP_002686795.1| PREDICTED: 60S ribosomal protei...   170   1e-40   
gi|291398680|ref|XP_002715960.1| PREDICTED: ribosomal protein L2...   170   1e-40   
gi|388857284|emb|CCF49126.1| probable RPL25-ribosomal protein L2...   170   1e-40   Ustilago hordei
gi|440904377|gb|ELR54901.1| hypothetical protein M91_21712 [Bos ...   170   1e-40   Bos mutus
gi|348690126|gb|EGZ29940.1| hypothetical protein PHYSODRAFT_3537...   170   1e-40   Phytophthora sojae
gi|46111223|ref|XP_382669.1| hypothetical protein FG02493.1 [Fus...   169   2e-40   
gi|296195807|ref|XP_002745549.1| PREDICTED: 60S ribosomal protei...   169   2e-40   
gi|291403595|ref|XP_002718133.1| PREDICTED: ribosomal protein L2...   169   2e-40   
gi|291387949|ref|XP_002710512.1| PREDICTED: ribosomal protein L2...   169   2e-40   
gi|395847432|ref|XP_003796379.1| PREDICTED: 60S ribosomal protei...   169   2e-40   
gi|67903738|ref|XP_682125.1| hypothetical protein AN8856.2 [Aspe...   169   2e-40   Aspergillus nidulans FGSC A4
gi|426224807|ref|XP_004006560.1| PREDICTED: 60S ribosomal protei...   169   2e-40   
gi|395846026|ref|XP_003795716.1| PREDICTED: 60S ribosomal protei...   169   2e-40   Otolemur garnettii
gi|460408177|ref|XP_004249523.1| PREDICTED: 60S ribosomal protei...   169   2e-40   Solanum lycopersicum
gi|402223095|gb|EJU03160.1| hypothetical protein DACRYDRAFT_2144...   169   2e-40   Dacryopinax primogenitus
gi|507630571|ref|XP_004627727.1| PREDICTED: 60S ribosomal protei...   169   2e-40   Octodon degus
gi|429855712|gb|ELA30656.1| 60s ribosomal protein l25 [Colletotr...   169   2e-40   Colletotrichum gloeosporioides Nara gc5
gi|342877001|gb|EGU78532.1| hypothetical protein FOXB_10962 [Fus...   169   3e-40   Fusarium oxysporum Fo5176
gi|322797842|gb|EFZ19750.1| hypothetical protein SINV_11268 [Sol...   169   3e-40   Solenopsis invicta [imported red fire ant]
gi|94388474|ref|XP_989377.1| PREDICTED: 60S ribosomal protein L2...   169   3e-40   
gi|453084047|gb|EMF12092.1| 60S ribosomal protein L23 [Mycosphae...   169   3e-40   Sphaerulina musiva SO2202
gi|109088540|ref|XP_001106213.1| PREDICTED: 60S ribosomal protei...   169   3e-40   
gi|449300951|gb|EMC96962.1| hypothetical protein BAUCODRAFT_6826...   168   3e-40   Baudoinia panamericana UAMH 10762
gi|403218113|emb|CCK72605.1| hypothetical protein KNAG_0K02420 [...   168   4e-40   Kazachstania naganishii CBS 8797
gi|296189977|ref|XP_002742995.1| PREDICTED: 60S ribosomal protei...   168   4e-40   
gi|291403698|ref|XP_002718173.1| PREDICTED: ribosomal protein L2...   168   4e-40   
gi|408391738|gb|EKJ71106.1| hypothetical protein FPSE_08612 [Fus...   168   4e-40   Fusarium pseudograminearum CS3096
gi|344289030|ref|XP_003416249.1| PREDICTED: 60S ribosomal protei...   168   4e-40   
gi|291385358|ref|XP_002709221.1| PREDICTED: ribosomal protein L2...   168   4e-40   
gi|426367416|ref|XP_004050728.1| PREDICTED: 60S ribosomal protei...   168   5e-40   Gorilla gorilla gorilla [lowland gorilla]
gi|307178254|gb|EFN67039.1| 60S ribosomal protein L23a [Camponot...   168   5e-40   Camponotus floridanus
gi|156843423|ref|XP_001644779.1| hypothetical protein Kpol_1020p...   168   5e-40   Vanderwaltozyma polyspora DSM 70294
gi|119571803|gb|EAW51418.1| hCG2001000 [Homo sapiens]                 168   5e-40   Homo sapiens [man]
gi|24266954|gb|AAN52376.1| ribosomal protein L23a [Branchiostoma...   168   5e-40   Branchiostoma belcheri
gi|431890969|gb|ELK01848.1| 60S ribosomal protein L23a [Pteropus...   167   6e-40   Pteropus alecto
gi|388579699|gb|EIM20020.1| hypothetical protein WALSEDRAFT_2130...   167   6e-40   Wallemia mellicola CBS 633.66
gi|291238351|ref|XP_002739091.1| PREDICTED: ribosomal protein L2...   167   6e-40   Saccoglossus kowalevskii
gi|301119741|ref|XP_002907598.1| 60S ribosomal protein L23a [Phy...   167   7e-40   Phytophthora infestans T30-4
gi|345782994|ref|XP_003432359.1| PREDICTED: 60S ribosomal protei...   167   7e-40   
gi|157488547|gb|ABV57814.1| hypothetical protein [Claviceps fusi...   167   7e-40   Claviceps fusiformis
gi|126137143|ref|XP_001385095.1| 60S ribosomal protein L25 [Sche...   167   8e-40   Scheffersomyces stipitis CBS 6054
gi|45187707|ref|NP_983930.1| ADL166Wp [Ashbya gossypii ATCC 1089...   167   1e-39   Eremothecium gossypii ATCC 10895
gi|398393998|ref|XP_003850458.1| 60S ribosomal protein L25 [Zymo...   167   1e-39   Zymoseptoria tritici IPO323
gi|512191481|gb|EPE07242.1| 60s ribosomal protein l25 [Ophiostom...   167   1e-39   Ophiostoma piceae UAMH 11346
gi|325189571|emb|CCA24057.1| 60S ribosomal protein L23a putative...   167   1e-39   Albugo laibachii Nc14
gi|296236331|ref|XP_002763277.1| PREDICTED: 60S ribosomal protei...   167   1e-39   
gi|255081478|ref|XP_002507961.1| predicted protein [Micromonas s...   167   1e-39   Micromonas commoda
gi|132823|sp|P08792.1|RL25_PICJA RecName: Full=60S ribosomal pro...   166   1e-39   Cyberlindnera jadinii [Torula yeast]
gi|303278566|ref|XP_003058576.1| predicted protein [Micromonas p...   166   1e-39   Micromonas pusilla CCMP1545
gi|505759435|gb|EOR03526.1| 60S ribosomal protein L23a [Wallemia...   166   1e-39   Wallemia ichthyophaga EXF-994
gi|397505804|ref|XP_003823437.1| PREDICTED: 60S ribosomal protei...   166   1e-39   
gi|291400935|ref|XP_002716723.1| PREDICTED: ribosomal protein L2...   166   1e-39   
gi|302406024|ref|XP_003000848.1| 60S ribosomal protein L25 [Vert...   166   2e-39   Verticillium alfalfae VaMs.102
gi|198415788|ref|XP_002126257.1| PREDICTED: 60S ribosomal protei...   166   2e-39   Ciona intestinalis [sea vase]
gi|260820644|ref|XP_002605644.1| hypothetical protein BRAFLDRAFT...   166   2e-39   Branchiostoma floridae
gi|94388464|ref|XP_989011.1| PREDICTED: 60S ribosomal protein L2...   166   2e-39   
gi|291408007|ref|XP_002720207.1| PREDICTED: ribosomal protein L2...   166   2e-39   
gi|344300073|gb|EGW30413.1| 60S ribosomal protein L25 [Spathaspo...   166   2e-39   Spathaspora passalidarum NRRL Y-27907
gi|355562362|gb|EHH18956.1| hypothetical protein EGK_19549 [Maca...   166   2e-39   Macaca mulatta [rhesus macaque]
gi|156402495|ref|XP_001639626.1| predicted protein [Nematostella...   166   2e-39   Nematostella vectensis
gi|291384156|ref|XP_002708516.1| PREDICTED: ribosomal protein L2...   166   2e-39   
gi|397484949|ref|XP_003813626.1| PREDICTED: 60S ribosomal protei...   166   2e-39   
gi|291398192|ref|XP_002715786.1| PREDICTED: ribosomal protein L2...   166   2e-39   
gi|169611795|ref|XP_001799315.1| hypothetical protein SNOG_09012...   166   3e-39   
gi|255943725|ref|XP_002562630.1| Pc20g00680 [Penicillium chrysog...   166   3e-39   
gi|302892015|ref|XP_003044889.1| 60S ribosomal protein L25 [Nect...   166   3e-39   
gi|345563371|gb|EGX46372.1| hypothetical protein AOL_s00109g130 ...   165   3e-39   
gi|504137044|ref|XP_004580984.1| PREDICTED: 60S ribosomal protei...   165   3e-39   
gi|296237622|ref|XP_002763824.1| PREDICTED: uncharacterized prot...   165   3e-39   
gi|109501749|ref|XP_573792.2| PREDICTED: 60S ribosomal protein L...   165   3e-39   
gi|505798040|ref|XP_004607381.1| PREDICTED: 60S ribosomal protei...   165   3e-39   
gi|366997655|ref|XP_003683564.1| 60S ribosomal protein L25 [Tetr...   165   3e-39   
gi|403279909|ref|XP_003945210.1| PREDICTED: LOW QUALITY PROTEIN:...   165   3e-39   
gi|293341751|ref|XP_001055403.2| PREDICTED: 60S ribosomal protei...   165   3e-39   
gi|291398768|ref|XP_002715994.1| PREDICTED: ribosomal protein L2...   165   3e-39   
gi|332025485|gb|EGI65648.1| 60S ribosomal protein L23a [Acromyrm...   165   3e-39   
gi|159145636|gb|ABW90355.1| putative ribosomal protein L23a [Sip...   165   3e-39   
gi|425766594|gb|EKV05198.1| 60S ribosomal protein L23 [Penicilli...   165   3e-39   
gi|307211204|gb|EFN87404.1| 60S ribosomal protein L23a [Harpegna...   165   3e-39   
gi|291389497|ref|XP_002711287.1| PREDICTED: ribosomal protein L2...   165   3e-39   
gi|50556926|ref|XP_505871.1| 60S ribosomal protein L25 [Yarrowia...   165   3e-39   
gi|428166323|gb|EKX35301.1| large subunit ribosomal protein L23A...   165   4e-39   
gi|384247353|gb|EIE20840.1| ribosomal protein L23a component of ...   165   4e-39   
gi|344231215|gb|EGV63097.1| 60S ribosomal protein L25 [Candida t...   165   4e-39   
gi|426387598|ref|XP_004060252.1| PREDICTED: 60S ribosomal protei...   165   4e-39   
gi|320581429|gb|EFW95650.1| 60S ribosomal protein L25 [Ogataea p...   165   4e-39   
gi|511870728|ref|XP_004756137.1| PREDICTED: 60S ribosomal protei...   165   5e-39   
gi|156547850|ref|XP_001604487.1| PREDICTED: 60S ribosomal protei...   165   5e-39   
gi|70909771|emb|CAJ17311.1| ribosomal protein L23Ae [Cicindela c...   165   5e-39   
gi|164661515|ref|XP_001731880.1| hypothetical protein MGL_1148 [...   164   5e-39   
gi|64446643|gb|AAY41435.1| ribosomal protein L23a [Anopheles ste...   164   6e-39   
gi|354485040|ref|XP_003504692.1| PREDICTED: 60S ribosomal protei...   164   6e-39   
gi|397494661|ref|XP_003818192.1| PREDICTED: 60S ribosomal protei...   164   7e-39   
gi|405970574|gb|EKC35468.1| 60S ribosomal protein L23a [Crassost...   164   7e-39   
gi|451854396|gb|EMD67689.1| hypothetical protein COCSADRAFT_3447...   164   8e-39   
gi|367008210|ref|XP_003678605.1| 60S ribosomal protein L25 [Toru...   164   8e-39   
gi|66549799|ref|XP_393135.2| PREDICTED: 60S ribosomal protein L2...   164   9e-39   
gi|469664431|gb|AGH70170.1| 60S ribosomal protein L23a [Placozoa...   164   9e-39   
gi|307211205|gb|EFN87405.1| 60S ribosomal protein L23a [Harpegna...   164   9e-39   
gi|350421481|ref|XP_003492856.1| PREDICTED: 60S ribosomal protei...   164   9e-39   
gi|452982570|gb|EME82329.1| hypothetical protein MYCFIDRAFT_5266...   164   1e-38   
gi|196011728|ref|XP_002115727.1| expressed hypothetical protein ...   164   1e-38   
gi|6324445|ref|NP_014514.1| ribosomal 60S subunit protein L25 [S...   164   1e-38   
gi|149236185|ref|XP_001523970.1| 60S ribosomal protein L25 [Lodd...   164   1e-38   
gi|440894398|gb|ELR46866.1| hypothetical protein M91_08369 [Bos ...   164   1e-38   
gi|221114063|ref|XP_002159053.1| PREDICTED: 60S ribosomal protei...   164   1e-38   
gi|380018994|ref|XP_003693403.1| PREDICTED: 60S ribosomal protei...   164   1e-38   
gi|363748801|ref|XP_003644618.1| hypothetical protein Ecym_2044 ...   163   1e-38   
gi|383860114|ref|XP_003705536.1| PREDICTED: 60S ribosomal protei...   163   1e-38   
gi|444518338|gb|ELV12100.1| 60S ribosomal protein L23a [Tupaia c...   163   1e-38   
gi|478255203|gb|ENN75432.1| hypothetical protein YQE_07983, part...   163   1e-38   
gi|395838328|ref|XP_003792068.1| PREDICTED: 60S ribosomal protei...   163   1e-38   
gi|340726895|ref|XP_003401787.1| PREDICTED: 60S ribosomal protei...   163   1e-38   
gi|452841461|gb|EME43398.1| hypothetical protein DOTSEDRAFT_7270...   163   1e-38   
gi|332374406|gb|AEE62344.1| unknown [Dendroctonus ponderosae]         163   1e-38   
gi|291391577|ref|XP_002712232.1| PREDICTED: ribosomal protein L2...   163   1e-38   
gi|482812614|gb|EOA89333.1| hypothetical protein SETTUDRAFT_1597...   163   1e-38   
gi|395829672|ref|XP_003787971.1| PREDICTED: 60S ribosomal protei...   163   2e-38   
gi|355753866|gb|EHH57831.1| hypothetical protein EGM_07558, part...   163   2e-38   
gi|50308567|ref|XP_454286.1| 60S ribosomal protein L25 [Kluyvero...   163   2e-38   
gi|452825288|gb|EME32286.1| 60S ribosomal protein L23Ae [Galdier...   163   2e-38   
gi|320176|pir||S30000 ribosomal protein L23a.e - yeast (Kluyvero...   162   2e-38
gi|366992087|ref|XP_003675809.1| hypothetical protein NCAS_0C045...   162   2e-38   
gi|302803891|ref|XP_002983698.1| hypothetical protein SELMODRAFT...   162   2e-38   
gi|255717452|ref|XP_002555007.1| 60S ribosomal protein L25 [Lach...   162   2e-38   
gi|344289273|ref|XP_003416369.1| PREDICTED: 60S ribosomal protei...   162   2e-38   
gi|402879875|ref|XP_003903549.1| PREDICTED: 60S ribosomal protei...   162   2e-38   
gi|402592490|gb|EJW86418.1| hypothetical protein WUBG_02667 [Wuc...   162   3e-38   
gi|302854441|ref|XP_002958728.1| component of cytosolic 80S ribo...   162   3e-38   
gi|444709964|gb|ELW50959.1| 60S ribosomal protein L23a [Tupaia c...   162   3e-38   
gi|170573360|ref|XP_001892438.1| 60S ribosomal protein L23a [Bru...   162   3e-38   
gi|260947544|ref|XP_002618069.1| conserved hypothetical protein ...   162   3e-38   
gi|406604088|emb|CCH44439.1| 60S ribosomal protein L25-B [Wicker...   162   3e-38   
gi|396495279|ref|XP_003844508.1| similar to 60S ribosomal protei...   162   3e-38   
gi|91090868|ref|XP_967229.1| PREDICTED: similar to ribosomal pro...   162   3e-38   
gi|365758524|gb|EHN00361.1| Rpl25p [Saccharomyces cerevisiae x S...   162   3e-38   
gi|270014014|gb|EFA10462.1| hypothetical protein TcasGA2_TC01270...   162   3e-38   
gi|312071031|ref|XP_003138420.1| 60S ribosomal protein L23a [Loa...   162   3e-38   
gi|224091993|ref|XP_002309429.1| predicted protein [Populus tric...   162   4e-38   
gi|351695788|gb|EHA98706.1| 60S ribosomal protein L23a [Heteroce...   162   4e-38   
gi|296482643|tpg|DAA24758.1| TPA: ribosomal protein L23a-like [B...   162   4e-38   
gi|158295212|ref|XP_316083.3| AGAP006037-PA [Anopheles gambiae s...   162   4e-38   
gi|315115345|gb|ADT80645.1| ribosomal protein L23A [Euphydryas a...   162   4e-38   
gi|94388507|ref|XP_001002269.1| PREDICTED: 60S ribosomal protein...   161   4e-38   
gi|158187778|gb|ABW23178.1| ribosomal protein rpl23a [Arenicola ...   161   5e-38   
gi|357603654|gb|EHJ63866.1| ribosomal protein L23A [Danaus plexi...   161   5e-38   
gi|342356331|gb|AEL28824.1| ribosomal protein L23A [Heliconius m...   161   6e-38   
gi|351710950|gb|EHB13869.1| 60S ribosomal protein L23a [Heteroce...   161   6e-38   
gi|410075657|ref|XP_003955411.1| hypothetical protein KAFR_0A084...   161   6e-38   
gi|444314859|ref|XP_004178087.1| hypothetical protein TBLA_0A077...   160   7e-38   
gi|264667331|gb|ACY71251.1| ribosomal protein L23A [Chrysomela t...   160   9e-38   
gi|328770955|gb|EGF80996.1| hypothetical protein BATDEDRAFT_2458...   160   9e-38   
gi|268306478|gb|ACY95360.1| ribosomal protein L23A [Manduca sexta]    160   9e-38   
gi|395821754|ref|XP_003784199.1| PREDICTED: 60S ribosomal protei...   160   1e-37   
gi|321473980|gb|EFX84946.1| hypothetical protein DAPPUDRAFT_3145...   160   1e-37   
gi|242014788|ref|XP_002428067.1| Nucleolin, putative [Pediculus ...   160   1e-37   
gi|159474676|ref|XP_001695451.1| ribosomal protein L23a, compone...   160   1e-37   
gi|440907368|gb|ELR57522.1| hypothetical protein M91_15908 [Bos ...   160   1e-37   
gi|112984266|ref|NP_001037229.1| ribosomal protein L23A [Bombyx ...   160   1e-37   
gi|513005610|ref|XP_004864270.1| PREDICTED: 60S ribosomal protei...   160   1e-37   
gi|507115939|emb|CDF39358.1| unnamed protein product [Chondrus c...   160   1e-37   
gi|389610761|dbj|BAM18991.1| ribosomal protein L23A [Papilio pol...   160   1e-37   
gi|403307138|ref|XP_003944065.1| PREDICTED: 60S ribosomal protei...   159   2e-37   
gi|70909775|emb|CAJ17313.1| ribosomal protein L23Ae [Georissus s...   159   2e-37   
gi|115921067|ref|XP_792948.2| PREDICTED: 60S ribosomal protein L...   159   2e-37   
gi|183979309|dbj|BAG30757.1| ribosomal protein L23A [Papilio xut...   159   2e-37   
gi|189189962|ref|XP_001931320.1| 60S ribosomal protein L25 [Pyre...   159   2e-37   
gi|297662040|ref|XP_002809530.1| PREDICTED: 60S ribosomal protei...   159   2e-37   
gi|296212375|ref|XP_002752805.1| PREDICTED: 60S ribosomal protei...   159   3e-37   
gi|340377755|ref|XP_003387394.1| PREDICTED: 60S ribosomal protei...   159   3e-37   
gi|225718482|gb|ACO15087.1| 60S ribosomal protein L23a [Caligus ...   158   5e-37   
gi|57087657|ref|XP_536893.1| PREDICTED: 60S ribosomal protein L2...   158   5e-37   
gi|377833664|ref|XP_003689374.1| PREDICTED: 60S ribosomal protei...   158   5e-37   
gi|61654660|gb|AAX48856.1| L23a [Suberites domuncula]                 158   5e-37   
gi|254579575|ref|XP_002495773.1| 60S ribosomal protein L25 [Zygo...   158   5e-37   
gi|225714192|gb|ACO12942.1| 60S ribosomal protein L23a [Lepeopht...   157   6e-37   
gi|507655419|ref|XP_004705066.1| PREDICTED: 60S ribosomal protei...   157   7e-37   
gi|512826914|ref|XP_004881030.1| PREDICTED: 60S ribosomal protei...   157   8e-37   
gi|397507158|ref|XP_003824075.1| PREDICTED: 60S ribosomal protei...   157   9e-37   
gi|426393113|ref|XP_004062877.1| PREDICTED: 60S ribosomal protei...   157   1e-36   
gi|148684301|gb|EDL16248.1| mCG49127 [Mus musculus]                   157   1e-36   
gi|344264307|ref|XP_003404234.1| PREDICTED: 60S ribosomal protei...   157   1e-36   
gi|440912261|gb|ELR61845.1| hypothetical protein M91_14635, part...   157   1e-36   
gi|440899993|gb|ELR51224.1| hypothetical protein M91_19137 [Bos ...   157   1e-36   
gi|501290543|dbj|BAN20210.1| ribosomal protein L23A [Riptortus p...   157   1e-36   
gi|354481680|ref|XP_003503029.1| PREDICTED: 60S ribosomal protei...   156   1e-36   
gi|226533865|gb|ACO71285.1| ribosomal protein L23a (predicted) [...   156   2e-36   
gi|225713790|gb|ACO12741.1| 60S ribosomal protein L23a [Lepeopht...   155   3e-36   
gi|391342462|ref|XP_003745539.1| PREDICTED: 60S ribosomal protei...   155   3e-36   
gi|401404664|ref|XP_003881782.1| hypothetical protein NCLIV_0154...   155   3e-36   
gi|82883044|ref|XP_890230.1| PREDICTED: 60S ribosomal protein L2...   155   3e-36   
gi|444732514|gb|ELW72805.1| 60S ribosomal protein L23a [Tupaia c...   155   4e-36   
gi|50294205|ref|XP_449514.1| 60S ribosomal protein L25 [Candida ...   155   5e-36   
gi|221486217|gb|EEE24487.1| ribosomal protein L23A, putative [To...   154   6e-36   
gi|237834391|ref|XP_002366493.1| ribosomal protein L23a, putativ...   154   7e-36   
gi|225435084|ref|XP_002284445.1| PREDICTED: 60S ribosomal protei...   154   9e-36   
gi|344276067|ref|XP_003409831.1| PREDICTED: 60S ribosomal protei...   154   1e-35   
gi|193690532|ref|XP_001942614.1| PREDICTED: hypothetical protein...   153   1e-35   
gi|449266003|gb|EMC77130.1| 60S ribosomal protein L23a, partial ...   153   1e-35   
gi|345800307|ref|XP_003434678.1| PREDICTED: 60S ribosomal protei...   153   1e-35   
gi|449445292|ref|XP_004140407.1| PREDICTED: 60S ribosomal protei...   153   2e-35   
gi|449445294|ref|XP_004140408.1| PREDICTED: 60S ribosomal protei...   153   2e-35   
gi|449464192|ref|XP_004149813.1| PREDICTED: 60S ribosomal protei...   153   2e-35   
gi|449445296|ref|XP_004140409.1| PREDICTED: 60S ribosomal protei...   152   2e-35   
gi|49036456|sp|Q9AT35.1|RL23A_DAUCA RecName: Full=60S ribosomal ...   152   2e-35   
gi|511839688|ref|XP_004744354.1| PREDICTED: 60S ribosomal protei...   152   3e-35   
gi|255582362|ref|XP_002531970.1| 60S ribosomal protein L23a, put...   152   4e-35   
gi|351727270|ref|NP_001236899.1| uncharacterized protein LOC1005...   152   4e-35   
gi|109472499|ref|XP_001058885.1| PREDICTED: 60S ribosomal protei...   151   5e-35   
gi|507625604|ref|XP_004626464.1| PREDICTED: 60S ribosomal protei...   151   5e-35   
gi|4326|emb|CAA25506.1| ribosomal protein L25 [Saccharomyces cer...   151   6e-35   
gi|412993704|emb|CCO14215.1| unknown [Bathycoccus prasinos]           151   6e-35   
gi|512844202|ref|XP_004885430.1| PREDICTED: 60S ribosomal protei...   151   6e-35   
gi|482560697|gb|EOA24888.1| hypothetical protein CARUB_v10018178...   151   6e-35   
gi|307103804|gb|EFN52061.1| hypothetical protein CHLNCDRAFT_1392...   151   6e-35   
gi|392341048|ref|XP_003754232.1| PREDICTED: 60S ribosomal protei...   150   7e-35   
gi|168017545|ref|XP_001761308.1| predicted protein [Physcomitrel...   150   8e-35   
gi|167536702|ref|XP_001750022.1| hypothetical protein [Monosiga ...   150   8e-35   
gi|168066780|ref|XP_001785310.1| predicted protein [Physcomitrel...   150   8e-35   
gi|168039292|ref|XP_001772132.1| predicted protein [Physcomitrel...   150   9e-35   
gi|351724617|ref|NP_001236040.1| uncharacterized protein LOC1005...   150   9e-35   
gi|168016934|ref|XP_001761003.1| predicted protein [Physcomitrel...   150   1e-34   
gi|226526926|gb|ACO71283.1| ribosomal protein L23a (predicted) [...   150   1e-34   
gi|356568957|ref|XP_003552674.1| PREDICTED: 60S ribosomal protei...   150   1e-34   
gi|15233226|ref|NP_191088.1| 60S ribosomal protein L23a-2 [Arabi...   150   1e-34   
gi|70663909|emb|CAE01636.3| OSJNBa0029H02.21 [Oryza sativa Japon...   150   1e-34   
gi|502102473|ref|XP_004492087.1| PREDICTED: 60S ribosomal protei...   150   1e-34   
gi|194747078|ref|XP_001955981.1| GF24974 [Drosophila ananassae] ...   150   1e-34   
gi|254574310|ref|XP_002494264.1| 60S ribosomal protein L25 [Koma...   150   1e-34   
gi|498930973|ref|XP_004519023.1| PREDICTED: 60S ribosomal protei...   150   1e-34   
gi|326430750|gb|EGD76320.1| ribosomal protein L23a [Salpingoeca ...   150   1e-34   
gi|339245423|ref|XP_003378637.1| 60S ribosomal protein L23a [Tri...   150   2e-34   
gi|297603002|ref|NP_001053226.2| Os04g0501000 [Oryza sativa Japo...   150   2e-34   
gi|38048707|gb|AAR10256.1| similar to Drosophila melanogaster Rp...   150   2e-34   
gi|385303433|gb|EIF47506.1| 60s ribosomal protein l25 [Dekkera b...   150   2e-34   
gi|148666881|gb|EDK99297.1| mCG130432 [Mus musculus]                  149   2e-34   
gi|125548918|gb|EAY94740.1| hypothetical protein OsI_16517 [Oryz...   149   2e-34   
gi|225439858|ref|XP_002278186.1| PREDICTED: 60S ribosomal protei...   149   2e-34   
gi|363807122|ref|NP_001242083.1| uncharacterized protein LOC1007...   149   2e-34   
gi|356539066|ref|XP_003538021.1| PREDICTED: 60S ribosomal protei...   149   2e-34   
gi|119508258|gb|ABL75704.1| IP17216p [Drosophila melanogaster]        149   2e-34   
gi|195135380|ref|XP_002012112.1| GI16793 [Drosophila mojavensis]...   149   2e-34   
gi|218195150|gb|EEC77577.1| hypothetical protein OsI_16522 [Oryz...   149   2e-34   
gi|24655502|ref|NP_523886.1| ribosomal protein L23A [Drosophila ...   149   2e-34   
gi|255580570|ref|XP_002531109.1| 60S ribosomal protein L23a, put...   149   2e-34   
gi|195490514|ref|XP_002093170.1| RpL23A [Drosophila yakuba] >gi|...   149   2e-34   
gi|198465687|ref|XP_001353729.2| GA20736 [Drosophila pseudoobscu...   149   3e-34   
gi|462401713|gb|EMJ07270.1| hypothetical protein PRUPE_ppa012784...   149   3e-34   
gi|7340791|emb|CAA63107.1| ribosomal protein L23 [Spinacia olera...   149   3e-34   
gi|268579203|ref|XP_002644584.1| C. briggsae CBR-RPL-25.1 protei...   149   3e-34   
gi|195012266|ref|XP_001983557.1| GH15515 [Drosophila grimshawi] ...   149   3e-34   
gi|356558314|ref|XP_003547452.1| PREDICTED: 60S ribosomal protei...   149   3e-34   
gi|195169140|ref|XP_002025385.1| GL12432 [Drosophila persimilis]...   149   3e-34   
gi|449017213|dbj|BAM80615.1| 60S ribosomal protein L23A [Cyanidi...   149   3e-34   
gi|226503351|ref|NP_001150284.1| 60S ribosomal protein L23a prec...   149   3e-34   
gi|195427183|ref|XP_002061657.1| GK17068 [Drosophila willistoni]...   149   3e-34   
gi|403257922|ref|XP_003921538.1| PREDICTED: 60S ribosomal protei...   149   3e-34   
gi|395862553|ref|XP_003803508.1| PREDICTED: 60S ribosomal protei...   149   3e-34   
gi|89513308|gb|ABD74513.1| ribosomal protein L23a [Pteris vittata]    149   3e-34   
gi|195375183|ref|XP_002046381.1| GJ12535 [Drosophila virilis] >g...   149   4e-34   
gi|460408454|ref|XP_004249660.1| PREDICTED: 60S ribosomal protei...   148   4e-34   
gi|502082010|ref|XP_004487038.1| PREDICTED: 60S ribosomal protei...   148   4e-34   
gi|115436432|ref|NP_001042974.1| Os01g0348700 [Oryza sativa Japo...   148   4e-34   
gi|226498552|ref|NP_001147165.1| 60S ribosomal protein L23a [Zea...   148   5e-34   
gi|397521734|ref|XP_003830943.1| PREDICTED: 60S ribosomal protei...   148   5e-34   
gi|297816820|ref|XP_002876293.1| 60S ribosomal protein L23A [Ara...   148   5e-34   
gi|195615220|gb|ACG29440.1| 60S ribosomal protein L23a [Zea mays...   148   5e-34   
gi|462415007|gb|EMJ19744.1| hypothetical protein PRUPE_ppa012791...   148   5e-34   
gi|470116903|ref|XP_004294612.1| PREDICTED: 60S ribosomal protei...   148   6e-34   
gi|195658729|gb|ACG48832.1| 60S ribosomal protein L23a [Zea mays...   148   6e-34   
gi|224140109|ref|XP_002323429.1| predicted protein [Populus tric...   148   6e-34   
gi|502145131|ref|XP_004505894.1| PREDICTED: 60S ribosomal protei...   148   6e-34   
gi|357164513|ref|XP_003580079.1| PREDICTED: 60S ribosomal protei...   147   7e-34   
gi|224106545|ref|XP_002314202.1| predicted protein [Populus tric...   147   7e-34   
gi|470143808|ref|XP_004307560.1| PREDICTED: 60S ribosomal protei...   147   7e-34   
gi|194697084|gb|ACF82626.1| unknown [Zea mays] >gi|195615414|gb|...   147   7e-34   
gi|357454083|ref|XP_003597322.1| 60S ribosomal protein L23a [Med...   147   7e-34   
gi|7711063|emb|CAA63112.1| ribosomal protein L23 [Spinacia olera...   147   7e-34   
gi|392348899|ref|XP_003750232.1| PREDICTED: 60S ribosomal protei...   147   8e-34   
gi|91178059|gb|ABE27283.1| L23A ribosomal protein natural varian...   147   8e-34   
gi|17569427|ref|NP_508808.1| Protein RPL-25.1 [Caenorhabditis el...   147   9e-34   
gi|508726446|gb|EOY18343.1| Ribosomal protein L23AB isoform 1 [T...   147   9e-34   
gi|195656249|gb|ACG47592.1| 60S ribosomal protein L23a [Zea mays]     147   1e-33   


>gi|409075154|gb|EKM75538.1| hypothetical protein AGABI1DRAFT_116365 [Agaricus bisporus var.
           burnettii JB137-S8]
 gi|426195559|gb|EKV45488.1| hypothetical protein AGABI2DRAFT_137061 [Agaricus bisporus var.
           bisporus H97]
          Length = 158

 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (86%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K RTS +FHRPKTLRL R+PKY RKS++H PR+DQY+ I +PLNTESAMKKI
Sbjct: 33  GAHSHSSRKTRTSVSFHRPKTLRLPREPKYERKSINHAPRMDQYRTIVSPLNTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIKDAVKKLYDVDA K+NTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 93  EEHNTLVFIVDVRANKRQIKDAVKKLYDVDAAKVNTLIRPDGKKKAYVRLTADADALDVA 152

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 153 NKIGFI 158



>gi|302689311|ref|XP_003034335.1| 60S ribosomal protein L25 [Schizophyllum commune H4-8]
 gi|300108030|gb|EFI99432.1| hypothetical protein SCHCODRAFT_84735 [Schizophyllum commune H4-8]
          Length = 154

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/126 (74%), Positives = 109/126 (86%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +KPR S +FHRPKTLRL R+PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 29  GVHSHSSRKPRFSVSFHRPKTLRLPREPKYPRKSVPHAPRMDQFRTIVSPLNTESAMKKI 88

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIKDAVKKLYDV A ++NTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 89  EEHNTLVFIVDLKANKRQIKDAVKKLYDVQAARVNTLIRPDGKKKAYVRLTADHDALDVA 148

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 149 NKIGFI 154



>gi|353244155|emb|CCA75599.1| probable RPL25-ribosomal protein L23a.e [Piriformospora indica DSM
           11827]
          Length = 152

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 107/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G    IK+K RTS +FHRPKTLRL R PKYPR S+ H PR+DQY+ I +PLNTESAMKKI
Sbjct: 27  GASSTIKRKTRTSVSFHRPKTLRLPRAPKYPRTSIPHAPRMDQYRTIVSPLNTESAMKKI 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQI++AVKKLYDV A KINTLIRP+G KKAYVRLTSD DAL+VA
Sbjct: 87  EEHNTLVFIVDVKANKRQIREAVKKLYDVQAAKINTLIRPDGKKKAYVRLTSDFDALDVA 146

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 147 NKIGFI 152



>gi|511005546|gb|EPB86882.1| 60S ribosomal protein L25 [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 144

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 110/126 (87%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVHGK  +K RTST FH PKTL L+R PKY RKS++H PR+DQY++I+ PLNTE+AMKKI
Sbjct: 19  GVHGKAVRKIRTSTHFHIPKTLVLNRAPKYARKSVAHAPRMDQYRVIRQPLNTETAMKKI 78

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTL F+VD +ANK QIKDAVK+LYDV+A KINTLIRP+G KKA+VRLT+DVDAL+VA
Sbjct: 79  EEHNTLTFLVDVKANKNQIKDAVKRLYDVEAAKINTLIRPDGYKKAFVRLTADVDALDVA 138

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 139 NKIGFI 144



>gi|511002985|gb|EPB84404.1| 50S ribosomal protein L23Ae [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 163

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 110/126 (87%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVHGK  +K RTST FH PKTL L+R PKY RKS++H PR+DQY++I+ PLNTE+AMKKI
Sbjct: 38  GVHGKAVRKIRTSTHFHIPKTLVLNRAPKYARKSVAHAPRMDQYRVIRQPLNTETAMKKI 97

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTL F+VD +ANK QIKDAVK+LYDV+A KINTLIRP+G KKA+VRLT+DVDAL+VA
Sbjct: 98  EEHNTLTFLVDVKANKNQIKDAVKRLYDVEAAKINTLIRPDGYKKAFVRLTADVDALDVA 157

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 158 NKIGFI 163



>gi|409040209|gb|EKM49697.1| hypothetical protein PHACADRAFT_214214 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 158

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 94/126 (74%), Positives = 108/126 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G + +  +K RTS +FHRPKTLRL R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 33  GTNSQAHRKKRTSVSFHRPKTLRLPRNPKYPRKSIPHVPRMDQFRTIVSPLNTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD QANKRQIKDAVKKLYDV A K+NTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 93  EEHNTLVFIVDIQANKRQIKDAVKKLYDVQAAKVNTLIRPDGKKKAYVRLTADHDALDVA 152

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 153 NKIGFI 158



>gi|296425039|ref|XP_002842051.1| 60S ribosomal protein L25 [Tuber melanosporum Mel28]
 gi|295638308|emb|CAZ86242.1| unnamed protein product [Tuber melanosporum]
          Length = 155

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 93/120 (77%), Positives = 106/120 (88%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G HGKI +K RTSTTFHRPKTL L+R PKYPRKS+ H PRLDQYK+I +PLNTESAMKKI
Sbjct: 29  GTHGKITRKVRTSTTFHRPKTLALARAPKYPRKSIPHAPRLDQYKVIVHPLNTESAMKKI 88

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIKDA+KKLYDVD  K+NTLIRP+GTKKA+ RLT DVDAL++A
Sbjct: 89  EENNTLVFIVDIKANKRQIKDAIKKLYDVDTVKVNTLIRPDGTKKAFARLTPDVDALDIA 148



>gi|392579981|gb|EIW73108.1| hypothetical protein TREMEDRAFT_37151 [Tremella mesenterica DSM
           1558]
          Length = 158

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 94/126 (74%), Positives = 107/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      +K R S TFHRPKTLRL R P+YPRKS+ H PR+DQ++ I++PLNTESAMKKI
Sbjct: 33  GTQSHKSRKVRYSVTFHRPKTLRLPRNPRYPRKSVPHLPRMDQFRTIRHPLNTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANKRQIKDAVKKLYDV+A K+NTLIRP+G KKAYVRLT+D DALEVA
Sbjct: 93  EDHNTLVFIVDLKANKRQIKDAVKKLYDVEAAKVNTLIRPDGLKKAYVRLTADHDALEVA 152

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 153 NKIGFI 158



>gi|395328248|gb|EJF60641.1| hypothetical protein DICSQDRAFT_170796 [Dichomitus squalens
           LYAD-421 SS1]
          Length = 156

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 106/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K R S +FHRPKTLRL R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 31  GTHAHAARKVRYSVSFHRPKTLRLPRNPKYPRKSIPHAPRMDQFRTIVSPLNTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFI D +ANKRQIKDAVKKLYDV A K+NTLIRP+GTKKAYVRLT+D DAL+VA
Sbjct: 91  EEHNTLVFITDIRANKRQIKDAVKKLYDVQAAKVNTLIRPDGTKKAYVRLTADHDALDVA 150

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 151 NKIGFI 156



>gi|58264518|ref|XP_569415.1| ribosomal protein [Cryptococcus neoformans var. neoformans JEC21]
 gi|134110177|ref|XP_776299.1| 60S ribosomal protein L25 [Cryptococcus neoformans var. neoformans
           B-3501A]
 gi|50258971|gb|EAL21652.1| hypothetical protein CNBC6880 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57225647|gb|AAW42108.1| ribosomal protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|405118869|gb|AFR93642.1| ribosomal protein L23a [Cryptococcus neoformans var. grubii H99]
          Length = 154

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 106/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      +K RTS TFHRP TLRL R PKYPRKS+ H PR+DQ++ I++PLNTESAMKKI
Sbjct: 29  GTQSTSVRKVRTSVTFHRPSTLRLPRAPKYPRKSVHHLPRMDQFRTIQHPLNTESAMKKI 88

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKR IKDAVKKLYDV+A K+NTLIRP+G KKAYVRLT+D DALEVA
Sbjct: 89  EEHNTLVFIVDIKANKRNIKDAVKKLYDVEAAKVNTLIRPDGRKKAYVRLTADFDALEVA 148

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 149 NKIGFI 154



>gi|390603000|gb|EIN12392.1| hypothetical protein PUNSTDRAFT_97078 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 160

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 107/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K R S +FHRPKTLRL R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 35  GTHAHAARKVRNSVSFHRPKTLRLPRDPKYPRKSIPHVPRMDQFRTIVSPLNTESAMKKI 94

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NKRQIKDAVKKLYDV+A KINTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 95  EEHNTLVFIVDIRSNKRQIKDAVKKLYDVNAAKINTLIRPDGKKKAYVRLTADHDALDVA 154

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 155 NKIGFI 160



>gi|321254662|ref|XP_003193153.1| ribosomal protein [Cryptococcus gattii WM276]
 gi|317459622|gb|ADV21366.1| ribosomal protein, putative [Cryptococcus gattii WM276]
          Length = 154

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 106/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      +K RTS TFHRP TLRL R PKYPRKS+ H PR+DQ++ I++PLNTESAMKKI
Sbjct: 29  GTQSTSVRKVRTSVTFHRPSTLRLPRAPKYPRKSVHHLPRMDQFRTIQHPLNTESAMKKI 88

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKR IKDAVKKLYDV+A K+NTLIRP+G KKAYVRLT+D DALEVA
Sbjct: 89  EEHNTLVFIVDLKANKRNIKDAVKKLYDVEAAKVNTLIRPDGRKKAYVRLTADFDALEVA 148

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 149 NKIGFI 154



>gi|299743972|ref|XP_001836111.2| ribosomal protein rpl23a [Coprinopsis cinerea okayama7#130]
 gi|298405904|gb|EAU85713.2| ribosomal protein rpl23a [Coprinopsis cinerea okayama7#130]
          Length = 240

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 108/126 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +    +K RTS +F+RPKTLRL+R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 115 GANSHRSRKTRTSVSFYRPKTLRLARDPKYPRKSIPHAPRMDQFRTIVSPLNTESAMKKI 174

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIKDAVKKLYDV A KINTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 175 EEHNTLVFIVDVKANKRQIKDAVKKLYDVQAAKINTLIRPDGKKKAYVRLTADHDALDVA 234

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 235 NKIGFI 240



>gi|511000645|gb|EPB82170.1| 50S ribosomal protein L23Ae [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 154

 Score =  190 bits (483), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 110/126 (87%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+GK  +K RTST FH PKTL LSR PKY RKS++H PR+DQY++I+ PLNTE+AMKKI
Sbjct: 29  GVNGKAVRKIRTSTHFHIPKTLVLSRAPKYARKSVAHAPRMDQYRVIRQPLNTETAMKKI 88

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTL F+VD +ANK QIKDAVK+LYDV+A KINTLIRP+G KKA+VRLT+DVDAL+VA
Sbjct: 89  EEHNTLTFLVDVKANKNQIKDAVKRLYDVEAAKINTLIRPDGYKKAFVRLTADVDALDVA 148

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 149 NKIGFI 154



>gi|392560917|gb|EIW54099.1| hypothetical protein TRAVEDRAFT_51824 [Trametes versicolor
           FP-101664 SS1]
          Length = 156

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K R S +FHRPKTLRL R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 31  GTHAHAARKVRYSVSFHRPKTLRLPRTPKYPRKSIPHAPRMDQFRTIVSPLNTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFI D +ANKRQIKDAVKKLYDV A K+NTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 91  EEHNTLVFITDIRANKRQIKDAVKKLYDVQAAKVNTLIRPDGKKKAYVRLTADHDALDVA 150

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 151 NKIGFI 156



>gi|403412778|emb|CCL99478.1| predicted protein [Fibroporia radiculosa]
          Length = 157

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 105/126 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K R S +F RPKTLRL+R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 32  GTHAHGARKTRFSVSFRRPKTLRLARDPKYPRKSIPHAPRMDQFRTIVSPLNTESAMKKI 91

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANKRQIKDAVKKLYDV A K+NTLIRP+G KKAYVRLT D DAL+VA
Sbjct: 92  EDNNTLVFIVDIKANKRQIKDAVKKLYDVQAAKVNTLIRPDGKKKAYVRLTPDHDALDVA 151

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 152 NKIGFI 157



>gi|389744640|gb|EIM85822.1| hypothetical protein STEHIDRAFT_131551 [Stereum hirsutum FP-91666
           SS1]
          Length = 162

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVHG   +K R + +FHRPKTLRL R PKY RKS+ H PR+D+++ I +PLNTESAMKKI
Sbjct: 37  GVHGHHSRKVRYTVSFHRPKTLRLPRDPKYQRKSVHHVPRMDEFRTIVSPLNTESAMKKI 96

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NKRQIKDAVKKL+DV A KINTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 97  EEHNTLVFIVDLKSNKRQIKDAVKKLWDVQAAKINTLIRPDGKKKAYVRLTADHDALDVA 156

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 157 NKIGFI 162



>gi|242206798|ref|XP_002469254.1| 60S ribosomal protein L23a [Postia placenta Mad-698-R]
 gi|242217604|ref|XP_002474600.1| 60S ribosomal protein L23a [Postia placenta Mad-698-R]
 gi|242224012|ref|XP_002477539.1| 60S ribosomal protein L23a [Postia placenta Mad-698-R]
 gi|220722777|gb|EED77263.1| 60S ribosomal protein L23a [Postia placenta Mad-698-R]
 gi|220726235|gb|EED80191.1| 60S ribosomal protein L23a [Postia placenta Mad-698-R]
 gi|220731714|gb|EED85556.1| 60S ribosomal protein L23a [Postia placenta Mad-698-R]
          Length = 158

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 106/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +  I +K R S +F RPKTLRL+R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 33  GTNSHIARKVRYSVSFRRPKTLRLARDPKYPRKSIPHVPRMDQFRTIVSPLNTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIKDAVKKLYDV A KINTLIRP+G KKAYVRLT D DAL+VA
Sbjct: 93  EENNTLVFIVDLRANKRQIKDAVKKLYDVQAAKINTLIRPDGKKKAYVRLTPDHDALDVA 152

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 153 NKIGFI 158



>gi|213409297|ref|XP_002175419.1| 60S ribosomal protein L25 [Schizosaccharomyces japonicus yFS275]
 gi|212003466|gb|EEB09126.1| 60S ribosomal protein L25-B [Schizosaccharomyces japonicus yFS275]
          Length = 141

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 107/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH K+ +K RTS TFHRP TLRL+RKPKY RKS++H  RLD++KII +P+NTESAMKKI
Sbjct: 16  GVHNKLVRKVRTSATFHRPNTLRLARKPKYARKSVNHATRLDEFKIIVSPVNTESAMKKI 75

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF    +ANK  IK AVKKLYDV+A K+NTLIRPNGTKKAYV+L++D DAL+VA
Sbjct: 76  EDDNTLVFTCHLKANKHTIKAAVKKLYDVEAVKVNTLIRPNGTKKAYVKLSADADALDVA 135

Query: 154 NKIGFI 159
           N+IGF+
Sbjct: 136 NRIGFL 141



>gi|19111959|ref|NP_595167.1| 60S ribosomal protein L25 [Schizosaccharomyces pombe 972h-]
 gi|1710523|sp|Q10330.1|RL25A_SCHPO RecName: Full=60S ribosomal protein L25-A
 gi|5817284|emb|CAB53734.1| 60S ribosomal protein L25 (predicted) [Schizosaccharomyces pombe]
          Length = 141

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 109/126 (86%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H K+ KK RTSTTF RPKTL+LSRKPKY RKS++H PRLD+YKII NP+N+ESAMKKI
Sbjct: 16  GIHNKVAKKVRTSTTFRRPKTLQLSRKPKYARKSVAHAPRLDEYKIIVNPINSESAMKKI 75

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF V  +ANK  IK+AV+KLY V+  KINTLIRPNGTKKA+V+L++D DAL+VA
Sbjct: 76  EDDNTLVFHVHLKANKFTIKEAVRKLYSVEPVKINTLIRPNGTKKAFVKLSADADALDVA 135

Query: 154 NKIGFI 159
           N+IGF+
Sbjct: 136 NRIGFL 141



>gi|501750299|emb|CCG84928.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 154

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H  + KK RT+TTF RPKTL L+RKP YPRKS+ H PRLD YKII +PLNTESAMKKI
Sbjct: 29  GNHSSVTKKVRTNTTFRRPKTLALARKPSYPRKSVPHLPRLDAYKIIVSPLNTESAMKKI 88

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKR IK+AVKKLY+VDA  +NTLIRP+GTKKAY+RL+ DVDAL++A
Sbjct: 89  EENNTLVFIVDIKANKRTIKEAVKKLYNVDALNVNTLIRPDGTKKAYIRLSPDVDALDIA 148

Query: 154 NKIGFI 159
           N IG++
Sbjct: 149 NTIGYV 154



>gi|336369765|gb|EGN98106.1| hypothetical protein SERLA73DRAFT_138376 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336382539|gb|EGO23689.1| hypothetical protein SERLADRAFT_391973 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 157

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K R S +F+RPKTLRL R PKY RKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 32  GVHSHSSRKTRYSVSFYRPKTLRLPRDPKYQRKSVPHVPRMDQFRTIVSPLNTESAMKKI 91

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NKRQIKDAVKKLYDV A+KINTLIRP+G KKAYVRL +D DAL+VA
Sbjct: 92  EEHNTLVFIVDIKSNKRQIKDAVKKLYDVQAEKINTLIRPDGKKKAYVRLAADHDALDVA 151

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 152 NKIGFI 157



>gi|401884101|gb|EJT48274.1| ribosomal protein [Trichosporon asahii var. asahii CBS 2479]
          Length = 156

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/123 (73%), Positives = 104/123 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      KK RTS TFHRPKTLRL+R PKYPRKS+ H PR+DQ++ I+ P++TESAMKKI
Sbjct: 29  GTQSHATKKVRTSATFHRPKTLRLARAPKYPRKSIPHLPRMDQFRTIQFPVSTESAMKKI 88

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANKR IKDAVKKLYDV+A KINTLIRP+G KKAYVRLT+D DALEVA
Sbjct: 89  EDHNTLVFIVDLRANKRNIKDAVKKLYDVEAAKINTLIRPDGKKKAYVRLTADYDALEVA 148

Query: 154 NKI 156
           NK+
Sbjct: 149 NKV 151



>gi|406695927|gb|EKC99224.1| ribosomal protein [Trichosporon asahii var. asahii CBS 8904]
          Length = 152

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/123 (73%), Positives = 104/123 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      KK RTS TFHRPKTLRL+R PKYPRKS+ H PR+DQ++ I+ P++TESAMKKI
Sbjct: 25  GTQSHATKKVRTSATFHRPKTLRLARAPKYPRKSIPHLPRMDQFRTIQFPVSTESAMKKI 84

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANKR IKDAVKKLYDV+A KINTLIRP+G KKAYVRLT+D DALEVA
Sbjct: 85  EDHNTLVFIVDLRANKRNIKDAVKKLYDVEAAKINTLIRPDGKKKAYVRLTADYDALEVA 144

Query: 154 NKI 156
           NK+
Sbjct: 145 NKV 147



>gi|384487609|gb|EIE79789.1| hypothetical protein RO3G_04494 [Rhizopus delemar RA 99-880]
 gi|384499611|gb|EIE90102.1| 60S ribosomal protein L23 [Rhizopus delemar RA 99-880]
          Length = 146

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 106/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVHGK  +K RT+T FHRPKTL L R PKY RKS++H PR+DQY+I++ PLNTE+AMKKI
Sbjct: 21  GVHGKSVRKVRTTTHFHRPKTLVLKRAPKYARKSVAHAPRMDQYRIVRQPLNTETAMKKI 80

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTL F+VD +ANK QIKDAVK+LYDV+   +NTLI  +G KKA+VRLT+DVDAL+VA
Sbjct: 81  EEHNTLTFLVDVKANKHQIKDAVKRLYDVEVAAVNTLITTSGNKKAFVRLTADVDALDVA 140

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 141 NKIGFI 146



>gi|19112896|ref|NP_596104.1| 60S ribosomal protein L25 [Schizosaccharomyces pombe 972h-]
 gi|6093882|sp|O74391.1|RL25B_SCHPO RecName: Full=60S ribosomal protein L25-B
 gi|3560137|emb|CAA20724.1| 60S ribosomal protein L25 (predicted) [Schizosaccharomyces pombe]
          Length = 141

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H K+ +K RTSTTF RPKTL L+RKPKY RKS+ H  RLD+YKII NP+N+ESAMKKI
Sbjct: 16  GIHNKVARKVRTSTTFRRPKTLELARKPKYARKSVPHASRLDEYKIIVNPINSESAMKKI 75

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF V  +ANK  IK+AVKKLY VDA KINTLIRPNGTKKA+V+L++D DAL+VA
Sbjct: 76  EDDNTLVFHVHLKANKFTIKNAVKKLYSVDAVKINTLIRPNGTKKAFVKLSADADALDVA 135

Query: 154 NKIGFI 159
           N+IGF+
Sbjct: 136 NRIGFL 141



>gi|213406515|ref|XP_002174029.1| 60S ribosomal protein L25 [Schizosaccharomyces japonicus yFS275]
 gi|212002076|gb|EEB07736.1| 60S ribosomal protein L25 [Schizosaccharomyces japonicus yFS275]
          Length = 141

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 107/126 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H K+ +K RTS +FHRP TLRL+RKPKY RKS++H  RLD++KII +P+NTESAMKKI
Sbjct: 16  GIHNKLVRKVRTSASFHRPNTLRLARKPKYARKSVNHATRLDEFKIIVSPVNTESAMKKI 75

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF    +ANK  IK AVKKLYDV+A K+NTLIRPNGTKKAYV+L++D DAL+VA
Sbjct: 76  EDDNTLVFTTHLKANKHTIKAAVKKLYDVEAVKVNTLIRPNGTKKAYVKLSADADALDVA 135

Query: 154 NKIGFI 159
           N+IGF+
Sbjct: 136 NRIGFL 141



>gi|393243039|gb|EJD50555.1| hypothetical protein AURDEDRAFT_160456 [Auricularia delicata
           TFB-10046 SS5]
          Length = 163

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G     ++K RTS +FHRPKTLRL+R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 38  GTRSHAQRKVRTSVSFHRPKTLRLARDPKYPRKSIPHAPRMDQFRTIVSPLNTESAMKKI 97

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIKDAVKKLY+V A  +NTLIRP+G KKAYVRLT D DAL+VA
Sbjct: 98  EEHNTLVFIVDVRANKRQIKDAVKKLYNVSALSVNTLIRPDGKKKAYVRLTPDHDALDVA 157

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 158 NKIGVI 163



>gi|170112748|ref|XP_001887575.1| 60S ribosomal protein L25 [Laccaria bicolor S238N-H82]
 gi|164637477|gb|EDR01762.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 186

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 104/123 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G HG   +K R S +FHRPKTLRL R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 61  GAHGHSSRKTRYSVSFHRPKTLRLPRDPKYPRKSIPHAPRMDQFRTIVSPLNTESAMKKI 120

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NKRQIKDAVKKLYDV A K+NTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 121 EEHNTLVFIVDIKSNKRQIKDAVKKLYDVQAAKVNTLIRPDGKKKAYVRLTADHDALDVA 180

Query: 154 NKI 156
           NK+
Sbjct: 181 NKV 183



>gi|384494965|gb|EIE85456.1| 60S ribosomal protein L23 [Rhizopus delemar RA 99-880]
 gi|384500164|gb|EIE90655.1| hypothetical protein RO3G_15366 [Rhizopus delemar RA 99-880]
          Length = 144

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 105/126 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH K  +K RT+T FHRPKTL L R PKY RKS++H PR+DQY+I++ PLNTE+AMKKI
Sbjct: 19  GVHSKSVRKVRTTTHFHRPKTLVLKRAPKYARKSVAHAPRMDQYRIVRQPLNTETAMKKI 78

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTL F+VD +ANK QIKDAVK+LYDV+   +NTLI  +G KKA+VRLT+DVDAL+VA
Sbjct: 79  EEHNTLTFLVDVKANKHQIKDAVKRLYDVEVATVNTLITTSGNKKAFVRLTADVDALDVA 138

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 139 NKIGFI 144



>gi|449548725|gb|EMD39691.1| hypothetical protein CERSUDRAFT_112000, partial [Ceriporiopsis
           subvermispora B]
          Length = 167

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 90/122 (73%), Positives = 102/122 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K RTS +FHRPKTLRL R PKYPRKS+ H PR+DQ++ I +PLNTESAMKKI
Sbjct: 33  GAHAHRARKIRTSVSFHRPKTLRLPRDPKYPRKSIPHAPRMDQFRTIVSPLNTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIKDAVKKLYDV   KINTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 93  EEHNTLVFIVDIKANKRQIKDAVKKLYDVQTAKINTLIRPDGKKKAYVRLTADHDALDVA 152

Query: 154 NK 155
           NK
Sbjct: 153 NK 154



>gi|331211677|ref|XP_003307108.1| 60S ribosomal protein L25 [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|2507312|sp|P51997.2|RL25_PUCGR RecName: Full=60S ribosomal protein L25
 gi|1707876|gb|AAB41938.1| ribosomal protein L25 [Puccinia graminis f. sp. avenae]
 gi|309297511|gb|EFP74102.1| 60S ribosomal protein L25 [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 158

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 104/126 (82%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G   K +++ RTS TF RPKTLRLSRKPKYPR S+ H PR+D Y+ +  PLNTESAMKKI
Sbjct: 33  GTSSKTQRRIRTSVTFRRPKTLRLSRKPKYPRTSVPHAPRMDAYRTLVRPLNTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTL+FIVD +ANKRQI DAVKKLYDV   ++NTLIRP+G KKA+VRLT +VDAL++A
Sbjct: 93  EDNNTLLFIVDLKANKRQIADAVKKLYDVTPLRVNTLIRPDGKKKAFVRLTPEVDALDIA 152

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 153 NKIGFI 158



>gi|378730379|gb|EHY56838.1| 50S ribosomal protein L23Ae [Exophiala dermatitidis NIH/UT8656]
          Length = 154

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (86%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H    +K R STTFHRPKTL LSR PKYPRKS+ H PRLD++K+I +PLNTESAMKKI
Sbjct: 28  GIHSDKARKIRKSTTFHRPKTLVLSRSPKYPRKSIPHVPRLDEHKVIIHPLNTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVDT+ANKRQIKDA+KKLYDVD  KINTLIRP+G KKA+ RLT+DVDAL++A
Sbjct: 88  EEHNTLVFIVDTKANKRQIKDALKKLYDVDTVKINTLIRPDGKKKAFARLTTDVDALDIA 147



>gi|392591912|gb|EIW81239.1| hypothetical protein CONPUDRAFT_90251 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 158

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 105/126 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      +K R S +FHRPKTLRL+R+PKYPRKS+ H PR+DQ++ I  P+NTESAMKKI
Sbjct: 33  GTRSHSSRKVRYSVSFHRPKTLRLAREPKYPRKSIPHAPRMDQFRTIVAPVNTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVF+VD ++NKRQIKDAVKKLYDV A KINTLIRP+G KKAYVRL +D DAL+VA
Sbjct: 93  EEHNTLVFLVDIKSNKRQIKDAVKKLYDVQAAKINTLIRPDGKKKAYVRLAADHDALDVA 152

Query: 154 NKIGFI 159
           NK+G++
Sbjct: 153 NKVGYL 158



>gi|358057018|dbj|GAA96925.1| hypothetical protein E5Q_03599 [Mixia osmundae IAM 14324]
          Length = 203

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 104/126 (82%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K RTS +FHRPKTLRL+RKP Y RK+++H PR+DQY+ I +PL TESAMKKI
Sbjct: 35  GNHSHTLRKIRTSVSFHRPKTLRLARKPTYQRKAVTHLPRMDQYRCIIHPLATESAMKKI 94

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIKDAVKKLY VDA KINTLIRP+G KKA+VRL  DVDALEVA
Sbjct: 95  EDHNTLVFIVDIKANKYQIKDAVKKLYQVDALKINTLIRPDGKKKAFVRLNPDVDALEVA 154

Query: 154 NKIGFI 159
           NK+ ++
Sbjct: 155 NKVDWL 160



>gi|303319371|ref|XP_003069685.1| 60S ribosomal protein L25 [Coccidioides posadasii C735 delta SOWgp]
 gi|240109371|gb|EER27540.1| 60S ribosomal protein L23a, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|392865371|gb|EAS31153.2| 60S ribosomal protein L25 [Coccidioides immitis RS]
          Length = 152

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    KK RTSTTFHRPKTL+LSR PKYPRKS+ H  RLD +K+I +PLNTESAMKKI
Sbjct: 26  GVHSHKVKKVRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKVIVHPLNTESAMKKI 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+KKLYDVD  KINTLIRP+G+KKA+ RLT DVDAL++A
Sbjct: 86  EENNTLVFIVDVKANKRQIKQAIKKLYDVDTVKINTLIRPDGSKKAFARLTPDVDALDIA 145



>gi|470317453|gb|EMR09165.1| hypothetical protein PNEG_02505 [Pneumocystis murina B123]
          Length = 163

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 105/126 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H K+K++ RTS TF RPKTLRLSRKP Y RKS+ H PRLD+YKI+  P+NTES+MKKI
Sbjct: 38  GNHSKLKRRVRTSATFRRPKTLRLSRKPLYLRKSIPHVPRLDEYKILICPMNTESSMKKI 97

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVF V+ +ANK QIK A KKLYDVD  K+NTLI PNG KKAYV+LT+D+DAL+VA
Sbjct: 98  EENNTLVFRVNIKANKHQIKKAFKKLYDVDILKVNTLISPNGIKKAYVKLTADMDALDVA 157

Query: 154 NKIGFI 159
           NKIGF+
Sbjct: 158 NKIGFV 163



>gi|406861776|gb|EKD14829.1| 60S ribosomal protein L25 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 168

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 86/120 (71%), Positives = 105/120 (87%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K R STTFHRPKTL+LSR PKYPRKS+ H PRLD++K+I +PLNTESAMKKI
Sbjct: 42  GVHSHKVRKVRLSTTFHRPKTLQLSRAPKYPRKSVPHEPRLDEHKVIIHPLNTESAMKKI 101

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NKRQIK+A+KKLYD+D  KINTLIRP+G+KKA+ RLT+DVDAL++A
Sbjct: 102 EENNTLVFIVDIRSNKRQIKEALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIA 161



>gi|258571421|ref|XP_002544514.1| 60S ribosomal protein L23a [Uncinocarpus reesii 1704]
 gi|237904784|gb|EEP79185.1| 60S ribosomal protein L23a [Uncinocarpus reesii 1704]
          Length = 174

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/119 (73%), Positives = 102/119 (85%)

Query: 35  VHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIE 94
           VH    KK RTSTTFHRPKTL+LSR PKYPRKS+ H  RLD +K+I +PLNTESAMKKIE
Sbjct: 49  VHSHKVKKVRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKVIVHPLNTESAMKKIE 108

Query: 95  DTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           + NTLVFIVD +ANKRQIK A+KKLYDVD  KINTLIRP+G+KKA+ RLT+DVDAL++A
Sbjct: 109 ENNTLVFIVDVKANKRQIKQAIKKLYDVDTVKINTLIRPDGSKKAFARLTADVDALDIA 167



>gi|512201080|gb|EPE29912.1| Ribosomal proteins S24e, L23 and L15e [Glarea lozoyensis ATCC
           20868]
          Length = 156

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/120 (72%), Positives = 104/120 (86%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K R STTFHRPKTL+LSR PKYPRKS+ H PRLD++K+I +PLNTESAMKKI
Sbjct: 30  GVHSHKVRKVRKSTTFHRPKTLQLSRSPKYPRKSVPHQPRLDEHKVIIHPLNTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK+A+KKLYD+D  KINTLIRP+G+KKA+ RLT DVDAL++A
Sbjct: 90  EENNTLVFIVDIKANKRQIKEALKKLYDIDTIKINTLIRPDGSKKAFARLTPDVDALDIA 149



>gi|367027222|ref|XP_003662895.1| hypothetical protein MYCTH_2304055 [Myceliophthora thermophila ATCC
           42464]
 gi|347010164|gb|AEO57650.1| hypothetical protein MYCTH_2304055 [Myceliophthora thermophila ATCC
           42464]
          Length = 156

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   K K RTSTTFHRPKTL LSR PKYPRKS+ H PRLD++K+I +PLNTE A+KKI
Sbjct: 30  GVHSHKKTKVRTSTTFHRPKTLVLSRAPKYPRKSVPHEPRLDEHKVIIHPLNTEGALKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKA+ RLT+DVDAL++ 
Sbjct: 90  EEQNTLVFIVDVKANKAQIKQALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIA 149

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 150 ATKLGLV 156



>gi|52346130|ref|NP_001005109.1| 60S ribosomal protein L23a [Xenopus (Silurana) tropicalis]
 gi|50370206|gb|AAH77046.1| MGC89958 protein [Xenopus (Silurana) tropicalis]
          Length = 155

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPTRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D QK+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVQKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|295660583|ref|XP_002790848.1| 60S ribosomal protein L25 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|225685072|gb|EEH23356.1| 60S ribosomal protein L25 [Paracoccidioides brasiliensis Pb03]
 gi|226281401|gb|EEH36967.1| 60S ribosomal protein L23a [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226294384|gb|EEH49804.1| 60S ribosomal protein L23a [Paracoccidioides brasiliensis Pb18]
          Length = 153

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K RTSTTFHRPKTL+LSR PKYPRKS+ H  RLDQ+KII +PLNTESAMKKI
Sbjct: 27  GVHAHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDQHKIIIHPLNTESAMKKI 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+K LYDVD  KINTLIRP+G+KKA+ RLT DVDAL++A
Sbjct: 87  EENNTLVFIVDVKANKRQIKQALKTLYDVDTVKINTLIRPDGSKKAFARLTPDVDALDIA 146



>gi|494829976|gb|EON66545.1| large subunit ribosomal protein L23Ae [Coniosporium apollinis CBS
           100218]
          Length = 157

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/120 (72%), Positives = 104/120 (86%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+    +K R ST+FHRPKTL+LSR PKYPRK++ H PRLDQ+KII +PLNTESAMKKI
Sbjct: 31  GVNSSKVRKVRLSTSFHRPKTLQLSRSPKYPRKAIPHEPRLDQHKIIVHPLNTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK+A+KKLYDVD  KINTLIRP+G+KKA+ RLT DVDAL++A
Sbjct: 91  EENNTLVFIVDVKANKRQIKEALKKLYDVDCVKINTLIRPDGSKKAFARLTPDVDALDIA 150



>gi|71051661|gb|AAH98550.1| Ribosomal protein L23a [Danio rerio]
          Length = 155

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 101/126 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + KKK RT+ TFHRPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSQKKKKIRTTPTFHRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD++  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKHAVKKLYDIEVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|225562243|gb|EEH10523.1| 60S ribosomal protein L23 [Ajellomyces capsulatus G186AR]
          Length = 153

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K RTSTTFHRPKTL+LSR PKYPRKS+ H  RLD +KII +PLNTESAMKKI
Sbjct: 27  GVHSHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKIIVHPLNTESAMKKI 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+K LYDVD  KINTLIRP+GTKKA+ RLT DVDAL++A
Sbjct: 87  EENNTLVFIVDVKANKRQIKQALKTLYDVDTVKINTLIRPDGTKKAFARLTPDVDALDIA 146



>gi|443917470|gb|ELU38184.1| pre-mRNA-splicing factor PRP46 [Rhizoctonia solani AG-1 IA]
          Length = 832

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 104/124 (83%)

Query: 36  HGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIED 95
           +GK ++K RTS +FHRPKTLRL R PKYPRKS+ H PR+D+Y+ I +P+ TESAMKKIED
Sbjct: 38  NGKAQRKVRTSVSFHRPKTLRLPRTPKYPRKSIPHAPRMDEYRTIVHPVVTESAMKKIED 97

Query: 96  TNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVANK 155
            NTLVFIVD ++NKRQIK AVKKLYDVD  KINTLIRP+G KKAYVRLT D +AL+VANK
Sbjct: 98  HNTLVFIVDLKSNKRQIKAAVKKLYDVDIAKINTLIRPDGRKKAYVRLTPDHEALDVANK 157

Query: 156 IGFI 159
            G +
Sbjct: 158 GGVL 161



>gi|505787930|ref|XP_004605078.1| PREDICTED: 60S ribosomal protein L23a [Sorex araneus]
          Length = 156

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSQKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|85109766|ref|XP_963077.1| 60S ribosomal protein L25 [Neurospora crassa OR74A]
 gi|28924728|gb|EAA33841.1| 60S ribosomal protein L25 [Neurospora crassa OR74A]
 gi|336469469|gb|EGO57631.1| 60S ribosomal protein L25 [Neurospora tetrasperma FGSC 2508]
 gi|350290887|gb|EGZ72101.1| 60S ribosomal protein L25 [Neurospora tetrasperma FGSC 2509]
          Length = 156

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/127 (68%), Positives = 106/127 (83%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   K K R STTFHRPKTL+LSR PKYPRKS+ H PRLD++K+I +PLNTE A+KKI
Sbjct: 30  GVHSHKKTKVRYSTTFHRPKTLQLSRAPKYPRKSIPHEPRLDEHKVIVHPLNTEGALKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKA+ RLT+DVDAL++ 
Sbjct: 90  EEQNTLVFIVDVKANKAQIKQALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIA 149

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 150 ATKLGLV 156



>gi|240277326|gb|EER40835.1| 60S ribosomal protein L23 [Ajellomyces capsulatus H143]
 gi|325091756|gb|EGC45066.1| 60S ribosomal protein [Ajellomyces capsulatus H88]
          Length = 153

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 101/120 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K RTSTTFHRPKTL+LSR PKYPRKS+ H  RLD +KII +PLNTESAMKKI
Sbjct: 27  GVHSHKVRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKIIVHPLNTESAMKKI 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+K LYDVD  KINTLIRP+GTKKA+ RLT DVDAL++A
Sbjct: 87  EENNTLVFIVDVKANKRQIKQALKTLYDVDTVKINTLIRPDGTKKAFARLTPDVDALDIA 146



>gi|261190843|ref|XP_002621830.1| 60S ribosomal protein L25 [Ajellomyces dermatitidis SLH14081]
 gi|239590874|gb|EEQ73455.1| ribosomal protein L23a [Ajellomyces dermatitidis SLH14081]
          Length = 153

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/120 (72%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K RTSTTFHRPKTL+LSR PKYPRKS+ H  RLD ++II +PLNTESAMKKI
Sbjct: 27  GVHSHKVRKARTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHRIIIHPLNTESAMKKI 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+K LYDVD  KINTLIRP+G+KKA+ RLT+DVDAL++A
Sbjct: 87  EENNTLVFIVDIKANKRQIKQALKTLYDVDTVKINTLIRPDGSKKAFARLTADVDALDIA 146



>gi|400597092|gb|EJP64836.1| 60S ribosomal protein L23a [Beauveria bassiana ARSEF 2860]
          Length = 152

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 107/127 (84%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H + ++K R STTFH+PKTL L+RKPK+PRKS+ H PRLD++KI+ +PLNTESAMKK+
Sbjct: 26  GTHAQKQRKVRLSTTFHQPKTLALARKPKFPRKSIPHLPRLDEHKIVIHPLNTESAMKKM 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+GTKKAY RLT DVDAL++ 
Sbjct: 86  EENNTLVFIVDIKANKAQIKGALKKLYDIDTVKINTLIRPDGTKKAYARLTPDVDALDIA 145

Query: 153 ANKIGFI 159
           ANK+  +
Sbjct: 146 ANKLSLV 152



>gi|320587875|gb|EFX00350.1| 60S ribosomal protein l23 [Grosmannia clavigera kw1407]
          Length = 152

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/120 (71%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K R +T+FHRPKTL+LSR PKYPRKS+ H PRLD++K+I +PLNTESAMKKI
Sbjct: 26  GVHAHKAQKARYTTSFHRPKTLQLSRAPKYPRKSIPHAPRLDEHKVIVHPLNTESAMKKI 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+GTKKAY RLT DVDAL++A
Sbjct: 86  EENNTLVFIVDIKANKAQIKLALKKLYDIDVVKINTLIRPDGTKKAYARLTPDVDALDIA 145



>gi|119182708|ref|XP_001242474.1| 60S ribosomal protein L25 [Coccidioides immitis RS]
 gi|320040873|gb|EFW22806.1| 60S ribosomal protein L23 [Coccidioides posadasii str. Silveira]
          Length = 155

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/119 (73%), Positives = 101/119 (84%)

Query: 35  VHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIE 94
           VH    KK RTSTTFHRPKTL+LSR PKYPRKS+ H  RLD +K+I +PLNTESAMKKIE
Sbjct: 30  VHSHKVKKVRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHKVIVHPLNTESAMKKIE 89

Query: 95  DTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           + NTLVFIVD +ANKRQIK A+KKLYDVD  KINTLIRP+G+KKA+ RLT DVDAL++A
Sbjct: 90  ENNTLVFIVDVKANKRQIKQAIKKLYDVDTVKINTLIRPDGSKKAFARLTPDVDALDIA 148



>gi|354487134|ref|XP_003505730.1| PREDICTED: 60S ribosomal protein L23a-like [Cricetulus griseus]
 gi|344240138|gb|EGV96241.1| 60S ribosomal protein L23a [Cricetulus griseus]
          Length = 156

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLQRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDAKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|229366302|gb|ACQ58131.1| 60S ribosomal protein L23a [Anoplopoma fimbria]
          Length = 155

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSQRKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|147903795|ref|NP_001087299.1| 60S ribosomal protein L23a [Xenopus laevis]
 gi|51873786|gb|AAH78526.1| MGC85348 protein [Xenopus laevis]
          Length = 155

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPTRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVK+LYD+D QK+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKQAVKQLYDIDVQKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|164690983|dbj|BAF98674.1| ribosomal protein L23a [Solea senegalensis]
          Length = 152

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 27  GVHSQRKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 87  EDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 146

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 147 NKIGII 152



>gi|328852136|gb|EGG01284.1| hypothetical protein MELLADRAFT_50145 [Melampsora larici-populina
           98AG31]
          Length = 158

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 104/126 (82%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G   K +++ RTS TF RPKTL+L+RKPKYPRKS+ H PR+D ++ +  PLNTESAMKKI
Sbjct: 33  GTTSKTQRRVRTSVTFRRPKTLQLARKPKYPRKSVPHAPRMDAFRTLIRPLNTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTL+FIVD +ANKRQI DAVKKLY+V   +INTLIRP+G KKA+VRL  +VDAL++A
Sbjct: 93  EDNNTLLFIVDLKANKRQIADAVKKLYEVTPARINTLIRPDGKKKAFVRLQPEVDALDIA 152

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 153 NKIGFI 158



>gi|171686614|ref|XP_001908248.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943268|emb|CAP68921.1| unnamed protein product [Podospora anserina S mat+]
          Length = 156

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/127 (68%), Positives = 106/127 (83%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   K K R STTFHRPKTL+LSR PKYPRKS+ H PRLD++K+I +PLNTE A+KKI
Sbjct: 30  GVHAHKKTKVRHSTTFHRPKTLQLSRAPKYPRKSIPHAPRLDEHKVIIHPLNTEGALKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKA+ RLT+DVDAL++ 
Sbjct: 90  EEQNTLVFIVDVKANKAQIKLALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIA 149

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 150 ATKLGLV 156



>gi|291391735|ref|XP_002712333.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLQRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|327291940|ref|XP_003230678.1| PREDICTED: 60S ribosomal protein L23a-like [Anolis carolinensis]
          Length = 155

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSHKKKKMRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|239613220|gb|EEQ90207.1| ribosomal protein L23a [Ajellomyces dermatitidis ER-3]
 gi|327357503|gb|EGE86360.1| 60S ribosomal protein L23 [Ajellomyces dermatitidis ATCC 18188]
          Length = 153

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/120 (72%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K RTSTTFHRPKTL+LSR PKYPRKS+ H  RLD ++II +PLNTESAMKKI
Sbjct: 27  GVHSHKVRKVRTSTTFHRPKTLQLSRSPKYPRKSIPHETRLDHHRIIIHPLNTESAMKKI 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+K LYDVD  KINTLIRP+G+KKA+ RLT+DVDAL++A
Sbjct: 87  EENNTLVFIVDIKANKRQIKQALKTLYDVDTVKINTLIRPDGSKKAFARLTADVDALDIA 146



>gi|213511340|ref|NP_001134773.1| 60S ribosomal protein L23a [Salmo salar]
 gi|209735916|gb|ACI68827.1| 60S ribosomal protein L23a [Salmo salar]
 gi|223646328|gb|ACN09922.1| 60S ribosomal protein L23a [Salmo salar]
 gi|223672175|gb|ACN12269.1| 60S ribosomal protein L23a [Salmo salar]
          Length = 155

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSQRKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDIKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|198285535|gb|ACH85306.1| ribosomal protein L23a [Salmo salar]
          Length = 154

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 29  GVHSQRKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 88

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 89  EDNNTLVFIVDIKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 148

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 149 NKIGII 154



>gi|478518582|ref|XP_004433518.1| PREDICTED: 60S ribosomal protein L23a-like [Ceratotherium simum
           simum]
          Length = 163

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 38  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 97

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 98  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 157

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 158 NKIGII 163



>gi|355770573|gb|EHH62883.1| hypothetical protein EGM_19719 [Macaca fascicularis]
          Length = 156

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKTRTSPTFRRPKTLRLWRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|395536138|ref|XP_003770077.1| PREDICTED: 60S ribosomal protein L23a-like [Sarcophilus harrisii]
          Length = 156

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|403261837|ref|XP_003923316.1| PREDICTED: 60S ribosomal protein L23a-like [Saimiri boliviensis
           boliviensis]
          Length = 156

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|441661201|ref|XP_003277177.2| PREDICTED: 60S ribosomal protein L23a isoform 1 [Nomascus
           leucogenys]
          Length = 222

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 97  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 156

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 157 EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 216

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 217 NKIGII 222



>gi|498981319|ref|XP_004550032.1| PREDICTED: 60S ribosomal protein L23a-like isoform X2 [Maylandia
           zebra]
          Length = 170

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 45  GVHSHRKKKVRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 104

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 105 EDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 164

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 165 NKIGII 170



>gi|62660318|ref|XP_340851.2| PREDICTED: 60S ribosomal protein L23a-like [Rattus norvegicus]
 gi|293341658|ref|XP_002725000.1| PREDICTED: 60S ribosomal protein L23a-like [Rattus norvegicus]
          Length = 156

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|327315383|ref|NP_001192153.1| 60S ribosomal protein L23a [Oryctolagus cuniculus]
 gi|291386554|ref|XP_002709804.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
 gi|291389578|ref|XP_002711383.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
 gi|291394102|ref|XP_002713618.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
 gi|291400168|ref|XP_002716453.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
 gi|291409070|ref|XP_002720819.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|350534812|ref|NP_001232640.1| putative 60S ribosomal protein L23a variant 1 [Taeniopygia guttata]
 gi|363741140|ref|XP_415820.3| PREDICTED: 60S ribosomal protein L23a [Gallus gallus]
 gi|197127802|gb|ACH44300.1| putative 60S ribosomal protein L23a variant 1 [Taeniopygia guttata]
 gi|197127803|gb|ACH44301.1| putative 60S ribosomal protein L23a variant 1 [Taeniopygia guttata]
 gi|197127804|gb|ACH44302.1| putative 60S ribosomal protein L23a variant 1 [Taeniopygia guttata]
          Length = 155

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|488515944|ref|XP_004449969.1| PREDICTED: 60S ribosomal protein L23a isoform 2 [Dasypus
           novemcinctus]
          Length = 156

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|500260146|gb|EOO02849.1| putative 60s ribosomal protein l25 protein [Togninia minima UCRPA7]
          Length = 156

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 86/120 (71%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K R +T+FHRPKTL+LSR PKYPRKS+ H PRLD++KII +PLNTESAMKKI
Sbjct: 30  GVHSHKARKVRLTTSFHRPKTLQLSRAPKYPRKSVPHEPRLDEHKIIVHPLNTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTL+RP+GTKKAY RLT DVDAL++A
Sbjct: 90  EENNTLVFIVDIKANKAQIKGALKKLYDIDTVKINTLVRPDGTKKAYARLTPDVDALDIA 149



>gi|336262043|ref|XP_003345807.1| 60S ribosomal protein L25 [Sordaria macrospora k-hell]
 gi|380088581|emb|CCC13467.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 185

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 105/127 (82%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH     K R STTFH+PKTL+LSR PKYPRKS+ H PRLD++K+I +PLNTE A+KKI
Sbjct: 59  GVHSHKATKVRHSTTFHQPKTLQLSRAPKYPRKSIPHAPRLDEHKVIVHPLNTEGALKKI 118

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKA+ RLT+DVDAL++ 
Sbjct: 119 EEQNTLVFIVDVKANKAQIKQALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIA 178

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 179 ATKLGLV 185



>gi|426227397|ref|XP_004007804.1| PREDICTED: 60S ribosomal protein L23a-like [Ovis aries]
 gi|296470827|tpg|DAA12942.1| TPA: ribosomal protein L23a-like [Bos taurus]
 gi|296486466|tpg|DAA28579.1| TPA: ribosomal protein L23a-like [Bos taurus]
          Length = 158

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 33  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 93  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 152

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 153 NKIGII 158



>gi|119571516|gb|EAW51131.1| ribosomal protein L23a, isoform CRA_a [Homo sapiens]
 gi|261858706|dbj|BAI45875.1| ribosomal protein L23a [synthetic construct]
          Length = 194

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 69  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 128

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 129 EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 188

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 189 NKIGII 194



>gi|465993754|ref|XP_004267173.1| PREDICTED: 60S ribosomal protein L23a [Orcinus orca]
          Length = 156

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|116192225|ref|XP_001221925.1| 60S ribosomal protein L25 [Chaetomium globosum CBS 148.51]
 gi|88181743|gb|EAQ89211.1| 60S ribosomal protein L25 [Chaetomium globosum CBS 148.51]
          Length = 156

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 87/127 (68%), Positives = 105/127 (82%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   + K R STTFHRPKTL LSR PKYPRKS+ H PRLD++KII +PLNTE A+KKI
Sbjct: 30  GVHAHKRTKVRLSTTFHRPKTLVLSRAPKYPRKSVPHEPRLDEHKIIVHPLNTEGALKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKA+ RLT+DVDAL++ 
Sbjct: 90  EEQNTLVFIVDVKANKAQIKQALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIA 149

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 150 ATKLGLV 156



>gi|348518706|ref|XP_003446872.1| PREDICTED: 60S ribosomal protein L23a-like [Oreochromis niloticus]
          Length = 155

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSHRKKKVRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|390462634|ref|XP_002747630.2| PREDICTED: 60S ribosomal protein L23a-like [Callithrix jacchus]
          Length = 156

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFWRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|334324696|ref|XP_001375997.2| PREDICTED: 60S ribosomal protein L23a-like [Monodelphis domestica]
          Length = 154

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 29  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 88

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 89  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 148

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 149 NKIGII 154



>gi|15293915|gb|AAK95150.1| ribosomal protein L23a [Ictalurus punctatus]
          Length = 153

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 28  GVHSHRKKKVRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 88  EDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 147

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 148 NKIGII 153



>gi|410915488|ref|XP_003971219.1| PREDICTED: 60S ribosomal protein L23a-like [Takifugu rubripes]
          Length = 155

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + +KK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSQRRKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|301753056|ref|XP_002912365.1| PREDICTED: 60S ribosomal protein L23a-like [Ailuropoda melanoleuca]
 gi|327239300|gb|AEA39517.1| ribosomal protein L23A [Ailuropoda melanoleuca]
          Length = 156

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|432897359|ref|XP_004076433.1| PREDICTED: 60S ribosomal protein L23a-like [Oryzias latipes]
          Length = 155

 Score =  177 bits (450), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|48597012|ref|NP_001001593.1| 60S ribosomal protein L23a [Danio rerio]
 gi|45504891|gb|AAS66970.1| ribosomal protein L23a [Danio rerio]
          Length = 155

 Score =  177 bits (450), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + KKK RT+ TFHRPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSQKKKKIRTTPTFHRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKK YD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKHAVKKPYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|389632321|ref|XP_003713813.1| 60S ribosomal protein L23a [Magnaporthe oryzae 70-15]
 gi|59803060|gb|AAX07700.1| 60S ribosomal protein L23-like protein [Magnaporthe grisea]
 gi|351646146|gb|EHA54006.1| 60S ribosomal protein L23a [Magnaporthe oryzae 70-15]
 gi|440475781|gb|ELQ44443.1| 60S ribosomal protein L23a [Magnaporthe oryzae Y34]
 gi|440489383|gb|ELQ69039.1| 60S ribosomal protein L23a [Magnaporthe oryzae P131]
          Length = 157

 Score =  177 bits (450), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 87/120 (72%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   + K R +T+FHRPKTL+LSR PKYPRKS+ H PRLD++KII +PLNTESAMKKI
Sbjct: 31  GVHAHKRVKARYTTSFHRPKTLQLSRAPKYPRKSVPHLPRLDEHKIIVHPLNTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G KKAYVRLT DVDAL++A
Sbjct: 91  EENNTLVFIVDIKANKAQIKQALKKLYDLDVLKINTLIRPDGQKKAYVRLTPDVDALDIA 150



>gi|306549|gb|AAA35681.1| homology to rat ribosomal protein L23, partial [Homo sapiens]
          Length = 147

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 22  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 81

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 82  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 141

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 142 NKIGII 147



>gi|16741485|gb|AAH16558.1| Rpl23a protein, partial [Mus musculus]
          Length = 149

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 24  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 83

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 84  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 143

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 144 NKIGII 149



>gi|20071865|gb|AAH26656.1| Rpl23a protein, partial [Mus musculus]
 gi|66911100|gb|AAH96637.1| Rpl23a protein, partial [Mus musculus]
          Length = 155

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|402086845|gb|EJT81743.1| 60S ribosomal protein L23a [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 157

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   K K R +T+FHRPKTL+LSR PKYPRKS+ H PRLD++KII +PLNTESAMKKI
Sbjct: 31  GVHSHKKVKARYTTSFHRPKTLQLSRAPKYPRKSVPHLPRLDEHKIIVHPLNTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G KKAYVRLT DVDAL++A
Sbjct: 91  EENNTLVFIVDIKANKAQIKGALKKLYDLDVLKINTLIRPDGRKKAYVRLTPDVDALDIA 150



>gi|326936224|ref|XP_003214156.1| PREDICTED: 60S ribosomal protein L23a-like, partial [Meleagris
           gallopavo]
          Length = 146

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 21  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 80

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 81  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 140

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 141 NKIGII 146



>gi|404015|gb|AAA03341.1| ribosomal protein L23a, partial [Homo sapiens]
          Length = 156

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|17105394|ref|NP_000975.2| 60S ribosomal protein L23a [Homo sapiens]
 gi|46430508|ref|NP_997406.1| 60S ribosomal protein L23a [Mus musculus]
 gi|114051890|ref|NP_001039423.1| 60S ribosomal protein L23a [Bos taurus]
 gi|157818939|ref|NP_001101753.1| 60S ribosomal protein L23a [Rattus norvegicus]
 gi|295148212|ref|NP_001171148.1| 60S ribosomal protein L23a [Ovis aries]
 gi|302148505|ref|NP_001180494.1| 60S ribosomal protein L23a [Macaca mulatta]
 gi|73957982|ref|XP_535387.2| PREDICTED: 60S ribosomal protein L23a-like [Canis lupus familiaris]
 gi|74000803|ref|XP_852639.1| PREDICTED: 60S ribosomal protein L23a-like [Canis lupus familiaris]
 gi|109098123|ref|XP_001099812.1| PREDICTED: 60S ribosomal protein L23a-like isoform 4 [Macaca
           mulatta]
 gi|109098129|ref|XP_001099514.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Macaca
           mulatta]
 gi|109110993|ref|XP_001111837.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Macaca
           mulatta]
 gi|114590195|ref|XP_001159035.1| PREDICTED: 60S ribosomal protein L23a-like [Pan troglodytes]
 gi|114668476|ref|XP_511361.2| PREDICTED: 60S ribosomal protein L23a isoform 8 [Pan troglodytes]
 gi|114668482|ref|XP_001144156.1| PREDICTED: 60S ribosomal protein L23a isoform 4 [Pan troglodytes]
 gi|296202178|ref|XP_002748286.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Callithrix
           jacchus]
 gi|297263185|ref|XP_002798760.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
 gi|297263188|ref|XP_002798761.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
 gi|297263191|ref|XP_002798762.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
 gi|297270596|ref|XP_002800087.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Macaca
           mulatta]
 gi|297700378|ref|XP_002827226.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Pongo abelii]
 gi|311267953|ref|XP_003131820.1| PREDICTED: 60S ribosomal protein L23a-like [Sus scrofa]
 gi|332256146|ref|XP_003277178.1| PREDICTED: 60S ribosomal protein L23a isoform 2 [Nomascus
           leucogenys]
 gi|335308671|ref|XP_003361329.1| PREDICTED: 60S ribosomal protein L23a-like [Sus scrofa]
 gi|354503617|ref|XP_003513877.1| PREDICTED: 60S ribosomal protein L23a-like [Cricetulus griseus]
 gi|390463351|ref|XP_003733018.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Callithrix
           jacchus]
 gi|397483092|ref|XP_003812739.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Pan paniscus]
 gi|397483094|ref|XP_003812740.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Pan paniscus]
 gi|402878552|ref|XP_003902943.1| PREDICTED: 60S ribosomal protein L23a-like [Papio anubis]
 gi|402883335|ref|XP_003905175.1| PREDICTED: 60S ribosomal protein L23a-like [Papio anubis]
 gi|402899165|ref|XP_003912574.1| PREDICTED: 60S ribosomal protein L23a isoform 1 [Papio anubis]
 gi|402899167|ref|XP_003912575.1| PREDICTED: 60S ribosomal protein L23a isoform 2 [Papio anubis]
 gi|402899169|ref|XP_003912576.1| PREDICTED: 60S ribosomal protein L23a isoform 3 [Papio anubis]
 gi|410051659|ref|XP_003953137.1| PREDICTED: 60S ribosomal protein L23a [Pan troglodytes]
 gi|410051661|ref|XP_003953138.1| PREDICTED: 60S ribosomal protein L23a [Pan troglodytes]
 gi|410980325|ref|XP_003996528.1| PREDICTED: 60S ribosomal protein L23a [Felis catus]
 gi|426348915|ref|XP_004042067.1| PREDICTED: 60S ribosomal protein L23a isoform 1 [Gorilla gorilla
           gorilla]
 gi|426348917|ref|XP_004042068.1| PREDICTED: 60S ribosomal protein L23a isoform 2 [Gorilla gorilla
           gorilla]
 gi|426348919|ref|XP_004042069.1| PREDICTED: 60S ribosomal protein L23a isoform 3 [Gorilla gorilla
           gorilla]
 gi|426348921|ref|XP_004042070.1| PREDICTED: 60S ribosomal protein L23a isoform 4 [Gorilla gorilla
           gorilla]
 gi|441661204|ref|XP_004091486.1| PREDICTED: 60S ribosomal protein L23a [Nomascus leucogenys]
 gi|441661207|ref|XP_004091487.1| PREDICTED: 60S ribosomal protein L23a [Nomascus leucogenys]
 gi|472360231|ref|XP_004399724.1| PREDICTED: 60S ribosomal protein L23a [Odobenus rosmarus divergens]
 gi|472372390|ref|XP_004405677.1| PREDICTED: 60S ribosomal protein L23a-like [Odobenus rosmarus
           divergens]
 gi|507561968|ref|XP_004664678.1| PREDICTED: 60S ribosomal protein L23a [Jaculus jaculus]
 gi|507954388|ref|XP_004684909.1| PREDICTED: 60S ribosomal protein L23a [Condylura cristata]
 gi|51338615|sp|P62752.1|RL23A_RAT RecName: Full=60S ribosomal protein L23a
 gi|51338637|sp|P62750.1|RL23A_HUMAN RecName: Full=60S ribosomal protein L23a
 gi|51338638|sp|P62751.1|RL23A_MOUSE RecName: Full=60S ribosomal protein L23a
 gi|108860929|sp|Q24JY1.1|RL23A_BOVIN RecName: Full=60S ribosomal protein L23a
 gi|187609318|pdb|2ZKR|SS Chain s, Structure Of A Mammalian Ribosomal 60s Subunit Within An
           80s Complex Obtained By Docking Homology Models Of The
           Rna And Proteins Into An 8.7 A Cryo-Em Map
 gi|485601439|pdb|3J3B|X Chain X, Structure Of The Human 60s Ribosomal Proteins
 gi|57690|emb|CAA46336.1| ribosomal protein L23a [Rattus rattus]
 gi|1399086|gb|AAB03210.1| ribosomal protein L23a [Homo sapiens]
 gi|2739452|gb|AAC51934.1| ribosomal protein L23A [Homo sapiens]
 gi|15680215|gb|AAH14459.1| Ribosomal protein L23a [Homo sapiens]
 gi|20987630|gb|AAH29892.1| Ribosomal protein L23a [Mus musculus]
 gi|33317318|gb|AAQ04686.1| ribosomal protein L23a [Mus musculus]
 gi|37046838|gb|AAH58041.1| Ribosomal protein L23a [Homo sapiens]
 gi|56541040|gb|AAH86883.1| Ribosomal protein L23a [Mus musculus]
 gi|56541042|gb|AAH86884.1| Ribosomal protein L23a [Mus musculus]
 gi|74182925|dbj|BAE20441.1| unnamed protein product [Mus musculus]
 gi|74212389|dbj|BAE30943.1| unnamed protein product [Mus musculus]
 gi|89994075|gb|AAI14201.1| Ribosomal protein L23a [Bos taurus]
 gi|116138405|gb|AAI25641.1| Ribosomal protein L23a [Mus musculus]
 gi|116138949|gb|AAI25643.1| Ribosomal protein L23a [Mus musculus]
 gi|119571517|gb|EAW51132.1| ribosomal protein L23a, isoform CRA_b [Homo sapiens]
 gi|148680975|gb|EDL12922.1| mCG10806 [Mus musculus]
 gi|149053505|gb|EDM05322.1| rCG33340 [Rattus norvegicus]
 gi|189053253|dbj|BAG35059.1| unnamed protein product [Homo sapiens]
 gi|197246791|gb|AAI68782.1| Ribosomal protein L23a [Rattus norvegicus]
 gi|290766477|gb|ADD60241.1| ribosomal protein L23a [Ovis aries]
 gi|296476842|tpg|DAA18957.1| TPA: 60S ribosomal protein L23a [Bos taurus]
          Length = 156

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|293345157|ref|XP_001073396.2| PREDICTED: 60S ribosomal protein L23a-like [Rattus norvegicus]
 gi|293357037|ref|XP_574848.3| PREDICTED: 60S ribosomal protein L23a-like [Rattus norvegicus]
          Length = 173

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 48  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 107

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 108 EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 167

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 168 NKIGII 173



>gi|402911471|ref|XP_003918349.1| PREDICTED: 60S ribosomal protein L23a-like [Papio anubis]
          Length = 156

 Score =  177 bits (449), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLPRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|322700194|gb|EFY91950.1| 60S ribosomal protein L25 [Metarhizium acridum CQMa 102]
          Length = 174

 Score =  177 bits (449), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 87/125 (69%), Positives = 106/125 (84%), Gaps = 1/125 (0%)

Query: 36  HGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIED 95
           H   ++K RTST+FHRPKTL LSR PKYPRKS+ H PRLD++KI+ +PLNTESAMKK+E+
Sbjct: 50  HAHKQRKVRTSTSFHRPKTLVLSRAPKYPRKSIPHQPRLDEHKIVIHPLNTESAMKKMEE 109

Query: 96  TNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV-AN 154
            NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKAYVRLT DVDAL++ AN
Sbjct: 110 NNTLVFIVDVKANKAQIKLALKKLYDIDTVKINTLIRPDGSKKAYVRLTPDVDALDIAAN 169

Query: 155 KIGFI 159
           K+  +
Sbjct: 170 KLSLV 174



>gi|440904517|gb|ELR55017.1| 60S ribosomal protein L23a, partial [Bos grunniens mutus]
          Length = 162

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL  ESAMKKI
Sbjct: 37  GVHSHKKKKIRTSPTFQRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTIESAMKKI 96

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 97  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 156

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 157 NKIGII 162



>gi|348567969|ref|XP_003469771.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Cavia
           porcellus]
          Length = 153

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 28  GIHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 88  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 147

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 148 NKIGII 153



>gi|348567967|ref|XP_003469770.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Cavia
           porcellus]
 gi|512990404|ref|XP_004857066.1| PREDICTED: 60S ribosomal protein L23a [Heterocephalus glaber]
          Length = 156

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GIHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|488515942|ref|XP_004449968.1| PREDICTED: 60S ribosomal protein L23a isoform 1 [Dasypus
           novemcinctus]
          Length = 157

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NK+ F+
Sbjct: 151 NKVSFL 156



>gi|344290549|ref|XP_003417000.1| PREDICTED: 60S ribosomal protein L23a-like [Loxodonta africana]
          Length = 184

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NK+ F+
Sbjct: 151 NKVSFL 156



>gi|465792779|emb|CCU98021.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 151

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (86%)

Query: 45  TSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDTNTLVFIVD 104
           TS +FHRPKTLRL+R PKYPRKS  H PR D +KI+  PLNTESAMKKIE+ NTLVFIVD
Sbjct: 37  TSPSFHRPKTLRLARNPKYPRKSAPHAPRTDAHKILLFPLNTESAMKKIEEVNTLVFIVD 96

Query: 105 TQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVANKIGFI 159
            +ANKRQIK A+KK+YDVDA K+NTLIRP+G KKA++RLT+D DAL+V+N+IGFI
Sbjct: 97  RKANKRQIKQALKKVYDVDAAKVNTLIRPDGKKKAFIRLTADEDALDVSNRIGFI 151



>gi|281350542|gb|EFB26126.1| hypothetical protein PANDA_000109 [Ailuropoda melanoleuca]
          Length = 148

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 23  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 82

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 83  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 142

Query: 154 NKIGFI 159
           NK+ F+
Sbjct: 143 NKVSFL 148



>gi|169765287|ref|XP_001817115.1| 60S ribosomal protein L25 [Aspergillus oryzae RIB40]
 gi|238503416|ref|XP_002382941.1| 60S ribosomal protein L25 [Aspergillus flavus NRRL3357]
 gi|83764969|dbj|BAE55113.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220690412|gb|EED46761.1| 60S ribosomal protein L23 [Aspergillus flavus NRRL3357]
          Length = 154

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/120 (71%), Positives = 100/120 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV     +K RTSTTFHRPKTL LSR PKYPRKS+ H PRLD +K+I  PLNTESAMKKI
Sbjct: 28  GVGAHKARKVRTSTTFHRPKTLELSRSPKYPRKSIPHAPRLDSHKVILYPLNTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+KKLYDVD  K+NTL+RP+G+KKA+ RLT DVDAL++A
Sbjct: 88  EENNTLVFIVDVKANKRQIKLALKKLYDVDTVKVNTLVRPDGSKKAFARLTPDVDALDIA 147



>gi|440632254|gb|ELR02173.1| large subunit ribosomal protein L23Ae [Geomyces destructans
           20631-21]
          Length = 156

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 103/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K R STTFHRPKTL LSR PKYPRKS+ H PRLD++++I +PLNTESAMKKI
Sbjct: 30  GVHSHKARKVRLSTTFHRPKTLILSRSPKYPRKSIPHQPRLDEHQVIIHPLNTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIV+ +ANKRQIK+A+KKLYD+D  KINTL+RP+G+KKA+ RLT DVDAL++A
Sbjct: 90  EENNTLVFIVNIKANKRQIKEALKKLYDIDTVKINTLVRPDGSKKAFARLTPDVDALDIA 149



>gi|367050618|ref|XP_003655688.1| 60S ribosomal protein L25 [Thielavia terrestris NRRL 8126]
 gi|347002952|gb|AEO69352.1| hypothetical protein THITE_71782 [Thielavia terrestris NRRL 8126]
          Length = 156

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/127 (68%), Positives = 105/127 (82%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   K K R +TTFHRPKTL LSR PKYPRKS+ H PRLD++K+I +PLNTE A+KKI
Sbjct: 30  GVHTHKKLKVRHTTTFHRPKTLVLSRAPKYPRKSIPHEPRLDEHKVIVHPLNTEGALKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+GTKKA+ RLT+DVDAL++ 
Sbjct: 90  EEQNTLVFIVDVKANKAQIKQALKKLYDIDTVKINTLIRPDGTKKAFARLTADVDALDIA 149

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 150 ATKLGLV 156



>gi|296191511|ref|XP_002743650.1| PREDICTED: 60S ribosomal protein L23a-like [Callithrix jacchus]
          Length = 156

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFWRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED +TLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNSTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|242794709|ref|XP_002482430.1| 60S ribosomal protein L25 [Talaromyces stipitatus ATCC 10500]
 gi|218719018|gb|EED18438.1| 60S ribosomal protein L23 [Talaromyces stipitatus ATCC 10500]
          Length = 152

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G   K  +K RTSTTFH PKTL+LSR PKYPRKS+ H PRLD +K+I +PLNTESAMKKI
Sbjct: 26  GQGAKKLRKIRTSTTFHLPKTLQLSRSPKYPRKSVPHEPRLDHHKVIIHPLNTESAMKKI 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+KKLYDVD  KINTLIRP+G+KKAY RLT DVDAL++A
Sbjct: 86  EENNTLVFIVDVKANKRQIKAALKKLYDVDTVKINTLIRPDGSKKAYARLTPDVDALDIA 145



>gi|380474400|emb|CCF45798.1| ribosomal protein L23 [Colletotrichum higginsianum]
          Length = 157

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G HG  K K R +T+FHRPKTL +SR PKYPRKS+ H PRLD++K+I +PLNTESAMKKI
Sbjct: 31  GAHGHYKNKVRYTTSFHRPKTLVVSRAPKYPRKSVPHEPRLDEHKVIVHPLNTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NK QIK A+KKLYD+D  KINTLIRP+G+KKAY RLT DVDAL++A
Sbjct: 91  EENNTLVFIVDVKSNKAQIKQALKKLYDIDTVKINTLIRPDGSKKAYARLTPDVDALDIA 150



>gi|351710149|gb|EHB13068.1| 60S ribosomal protein L23a [Heterocephalus glaber]
          Length = 182

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK  TS TFH PKTLRL ++PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GIHSHKKKKVHTSPTFHHPKTLRLRQQPKYPRKSTPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDCDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|345327764|ref|XP_001512932.2| PREDICTED: 60S ribosomal protein L23a-like [Ornithorhynchus
           anatinus]
          Length = 195

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYP KS     +LD Y IIK PL TESAMKKI
Sbjct: 70  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPWKSAPRRNKLDHYAIIKFPLTTESAMKKI 129

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 130 EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 189

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 190 NKIGII 195



>gi|448533613|ref|XP_003870667.1| Rpl25 rRNA-binding ribosomal protein component of the 60S ribosomal
           subunit [Candida orthopsilosis Co 90-125]
 gi|380355022|emb|CCG24538.1| Rpl25 rRNA-binding ribosomal protein component of the 60S ribosomal
           subunit [Candida orthopsilosis]
          Length = 143

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 105/126 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+GK   K RTSTTF  PKTL+L+R+PKY RKS+ H  RLD YKII +P+ TE+AMKK+
Sbjct: 18  GVNGKKAVKVRTSTTFRLPKTLKLARQPKYQRKSVPHYNRLDAYKIIVSPIATETAMKKV 77

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED+NTLVF VD +ANK QIK AVK+LYDVD   +NTLIRPNGTKKAY+RLT+D DAL++A
Sbjct: 78  EDSNTLVFQVDIKANKHQIKQAVKELYDVDVDYVNTLIRPNGTKKAYLRLTADHDALDIA 137

Query: 154 NKIGFI 159
           NKIG+I
Sbjct: 138 NKIGYI 143



>gi|355750095|gb|EHH54433.1| hypothetical protein EGM_15272 [Macaca fascicularis]
          Length = 156

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKTRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED N LVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNILVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|109078134|ref|XP_001099556.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Macaca
           mulatta]
 gi|297294798|ref|XP_002804511.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
          Length = 156

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLWRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED N LVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNILVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|346322082|gb|EGX91681.1| 60S ribosomal protein L23 [Cordyceps militaris CM01]
          Length = 152

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 106/127 (83%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H + ++K R STTFH+PKTL L+R PK+PRKS+ H PRLD++KI+ +PLNTESAMKK+
Sbjct: 26  GTHSQKQRKVRLSTTFHQPKTLSLARNPKFPRKSIPHLPRLDEHKIVIHPLNTESAMKKM 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+GTKKAY RLT DVDAL++ 
Sbjct: 86  EENNTLVFIVDIKANKAQIKGALKKLYDIDTVKINTLIRPDGTKKAYARLTPDVDALDIA 145

Query: 153 ANKIGFI 159
           ANK+  +
Sbjct: 146 ANKLSLV 152



>gi|310793193|gb|EFQ28654.1| ribosomal protein L23 [Glomerella graminicola M1.001]
          Length = 157

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G HG  K K R +T+FHRPKTL +SR PKYPRKS+ H PRLD++K+I +PLNTESAMKKI
Sbjct: 31  GAHGHYKNKVRYTTSFHRPKTLVVSRAPKYPRKSVPHEPRLDEHKVIVHPLNTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NK QIK A+KKLYD+D  KINTLIRP+G+KKAY RLT DVDAL++A
Sbjct: 91  EENNTLVFIVDVKSNKAQIKQALKKLYDIDTVKINTLIRPDGSKKAYARLTPDVDALDIA 150



>gi|322711949|gb|EFZ03522.1| 60S ribosomal protein L25 [Metarhizium anisopliae ARSEF 23]
          Length = 174

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/125 (68%), Positives = 106/125 (84%), Gaps = 1/125 (0%)

Query: 36  HGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIED 95
           H   ++K RTST+FH+PKTL LSR PKYPRKS+ H PRLD++KI+ +PLNTESAMKK+E+
Sbjct: 50  HAHKQRKVRTSTSFHQPKTLVLSRAPKYPRKSIPHQPRLDEHKIVIHPLNTESAMKKMEE 109

Query: 96  TNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV-AN 154
            NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKAYVRLT DVDAL++ AN
Sbjct: 110 NNTLVFIVDVKANKAQIKLALKKLYDIDTVKINTLIRPDGSKKAYVRLTPDVDALDIAAN 169

Query: 155 KIGFI 159
           K+  +
Sbjct: 170 KLSLV 174



>gi|291389010|ref|XP_002711010.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLI P+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLISPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|459372936|gb|EMG50275.1| hypothetical protein G210_4692 [Candida maltosa Xu316]
          Length = 141

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 104/126 (82%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+GK   K RTSTTF  PKTL+L+R+PKY RKS+ H  RLD YKII  P+ TE+AMKK+
Sbjct: 16  GVNGKKALKVRTSTTFRLPKTLKLTRQPKYQRKSVPHYNRLDAYKIIVAPIATETAMKKV 75

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF VD +ANK QIK AVK+LYDVD + +NTLIRPNGTKKAY+RLTSD DAL++A
Sbjct: 76  EDGNTLVFQVDIKANKHQIKSAVKELYDVDVEYVNTLIRPNGTKKAYIRLTSDHDALDIA 135

Query: 154 NKIGFI 159
           N+IG+I
Sbjct: 136 NRIGYI 141



>gi|148692922|gb|EDL24869.1| mCG1034428 [Mus musculus]
          Length = 156

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KK  RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKMIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|119599019|gb|EAW78613.1| hCG16001, isoform CRA_a [Homo sapiens]
          Length = 156

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+N LIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNILIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|472387721|ref|XP_004413198.1| PREDICTED: 60S ribosomal protein L23a-like [Odobenus rosmarus
           divergens]
          Length = 158

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKK 
Sbjct: 33  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSTPRRNKLDHYAIIKFPLTTESAMKKT 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 93  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 152

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 153 NKIGII 158



>gi|296204840|ref|XP_002749504.1| PREDICTED: 60S ribosomal protein L23a-like [Callithrix jacchus]
          Length = 156

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK R S TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRKSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|291384263|ref|XP_002708737.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTL L R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLHLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|296480490|tpg|DAA22605.1| TPA: ribosomal protein L23a-like [Bos taurus]
          Length = 158

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS  F RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 33  GVHSHKKKKIRTSPPFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 93  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 152

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 153 NKIGII 158



>gi|296484156|tpg|DAA26271.1| TPA: ribosomal protein L23a-like [Bos taurus]
          Length = 158

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK  TS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 33  GVHSHKKKKIWTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 93  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 152

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 153 NKIGII 158



>gi|291396319|ref|XP_002714524.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYP KS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPWKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|472356490|ref|XP_004397885.1| PREDICTED: 60S ribosomal protein L23a-like [Odobenus rosmarus
           divergens]
          Length = 158

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y I K PL TESAMKKI
Sbjct: 33  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAITKFPLTTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 93  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 152

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 153 NKIGII 158



>gi|119599020|gb|EAW78614.1| hCG16001, isoform CRA_b [Homo sapiens]
          Length = 162

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 37  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 96

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+N LIRP+G KKAYVRL  D DAL+VA
Sbjct: 97  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNILIRPDGEKKAYVRLAPDYDALDVA 156

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 157 NKIGII 162



>gi|47227151|emb|CAG00513.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 155

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + +KK RTS TF RPKT RL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 30  GVHSQRRKKIRTSPTFRRPKTQRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 90  EDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|504168676|ref|XP_004593973.1| PREDICTED: 60S ribosomal protein L23a [Ochotona princeps]
          Length = 156

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKT RL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTQRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|166952305|gb|ABZ04235.1| ribosomal protein rpl23a [Lineus viridis]
          Length = 177

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV  K  +K RTS  F RPKTL+L+R PKYPR+S    PRLDQ+KI+K PL TESAMKKI
Sbjct: 52  GVQNKRSRKIRTSVHFRRPKTLKLARAPKYPRRSTPKRPRLDQFKIVKFPLTTESAMKKI 111

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF+VD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 112 EDNNTLVFVVDKRANKPQIKLAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 171

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 172 NKIGII 177



>gi|156064031|ref|XP_001597937.1| 60S ribosomal protein L25 [Sclerotinia sclerotiorum 1980 UF-70]
 gi|154690885|gb|EDN90623.1| 60S ribosomal protein L25 [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 154

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K R STTFHRPKTL+LSR PKYPR S+   PRLD++K+I +PLNTESAMKKI
Sbjct: 28  GVHSHKVRKVRLSTTFHRPKTLQLSRAPKYPRTSIVSQPRLDEHKVIIHPLNTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANK QIK+A+KKLYD+D  KINTLIRP+G+KKA+ RLT+DVDAL++A
Sbjct: 88  EENNTLVFIVDIKANKAQIKEALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIA 147



>gi|358380056|gb|EHK17735.1| hypothetical protein TRIVIDRAFT_183151 [Trichoderma virens Gv29-8]
          Length = 152

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 106/127 (83%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K R +T+FHRPKTL LSR P+YPRK+++HTPRLD++KII +PLNTESAMKK+
Sbjct: 26  GTHSTKNRKVRLTTSFHRPKTLVLSRAPRYPRKAINHTPRLDEHKIIIHPLNTESAMKKM 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKAY RLT DVDAL++ 
Sbjct: 86  EENNTLVFIVDVKANKAQIKLALKKLYDIDTVKINTLIRPDGSKKAYARLTPDVDALDIA 145

Query: 153 ANKIGFI 159
           ANK+  +
Sbjct: 146 ANKLSLV 152



>gi|327301405|ref|XP_003235395.1| 60S ribosomal protein L25 [Trichophyton rubrum CBS 118892]
 gi|326462747|gb|EGD88200.1| 60S ribosomal protein L23 [Trichophyton rubrum CBS 118892]
 gi|326468882|gb|EGD92891.1| 60S ribosomal protein L23 [Trichophyton tonsurans CBS 112818]
 gi|326480138|gb|EGE04148.1| 60S ribosomal protein L25 [Trichophyton equinum CBS 127.97]
          Length = 152

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (81%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K RTS TFHRPKTL+LSR PKYPRKS+ H PR+D +++I +PLNTESAMKKI
Sbjct: 26  GVHSHKVRKVRTSATFHRPKTLQLSRSPKYPRKSIPHVPRMDHHQVIVHPLNTESAMKKI 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFI D +ANKRQIK A+KKLYD+D  K+NTLIRP+G+KK + RLT D+DAL++ 
Sbjct: 86  EENNTLVFIADVKANKRQIKLALKKLYDIDTVKLNTLIRPDGSKKVFARLTPDIDALDIA 145

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 146 ATKLGIV 152



>gi|471407667|ref|XP_004385420.1| PREDICTED: 60S ribosomal protein L23a [Trichechus manatus
           latirostris]
          Length = 156

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF R KTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRSKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|149702854|ref|XP_001499298.1| PREDICTED: 60S ribosomal protein L23a-like [Equus caballus]
 gi|149724730|ref|XP_001504221.1| PREDICTED: 60S ribosomal protein L23a-like [Equus caballus]
          Length = 156

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV    KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVQSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|109120362|ref|XP_001117952.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
          Length = 156

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK  TS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKICTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|109089832|ref|XP_001095173.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Macaca
           mulatta]
 gi|297301386|ref|XP_002805777.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Macaca
           mulatta]
 gi|297301388|ref|XP_002805778.1| PREDICTED: 60S ribosomal protein L23a-like isoform 3 [Macaca
           mulatta]
 gi|297301390|ref|XP_002805779.1| PREDICTED: 60S ribosomal protein L23a-like isoform 4 [Macaca
           mulatta]
 gi|297301392|ref|XP_002805780.1| PREDICTED: 60S ribosomal protein L23a-like isoform 5 [Macaca
           mulatta]
 gi|297301394|ref|XP_002805781.1| PREDICTED: 60S ribosomal protein L23a-like isoform 6 [Macaca
           mulatta]
 gi|297301396|ref|XP_002805782.1| PREDICTED: 60S ribosomal protein L23a-like isoform 7 [Macaca
           mulatta]
          Length = 156

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D  AL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYHALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|340959351|gb|EGS20532.1| 60S ribosomal protein L25-like protein [Chaetomium thermophilum
           var. thermophilum DSM 1495]
          Length = 156

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 103/126 (81%), Gaps = 1/126 (0%)

Query: 35  VHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIE 94
           VH   K K R STTFHRPKTL LSR PKYPRKS+ H PRLD++KII +PLNTE A+KKIE
Sbjct: 31  VHSHKKTKVRKSTTFHRPKTLVLSRAPKYPRKSIPHEPRLDEHKIIIHPLNTEGALKKIE 90

Query: 95  DTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV-A 153
           + NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+GTKKA+ RLT DVDAL++ A
Sbjct: 91  EQNTLVFIVDVKANKAQIKQALKKLYDIDTVKINTLIRPDGTKKAFARLTPDVDALDIAA 150

Query: 154 NKIGFI 159
            K+G +
Sbjct: 151 TKLGLV 156



>gi|393212451|gb|EJC97951.1| hypothetical protein FOMMEDRAFT_97860, partial [Fomitiporia
           mediterranea MF3/22]
          Length = 135

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/124 (67%), Positives = 102/124 (82%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVHG   +K R S TFHRPKTLRL RKPKY RKS+ H PR+D ++ + +PLNTESAMKKI
Sbjct: 12  GVHGHRARKVRYSVTFHRPKTLRLPRKPKYLRKSVPHVPRMDAHRTVVSPLNTESAMKKI 71

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVF+VD +ANKRQIK AVK+L++V A  +NTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 72  EEHNTLVFLVDIKANKRQIKSAVKELWEVQAASVNTLIRPDGKKKAYVRLTADHDALDVA 131

Query: 154 NKIG 157
           NK+ 
Sbjct: 132 NKVS 135



>gi|351715399|gb|EHB18318.1| 60S ribosomal protein L23a [Heterocephalus glaber]
          Length = 156

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GIHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSTPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF VD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFTVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|149266479|ref|XP_001476183.1| PREDICTED: 60S ribosomal protein L23a-like [Mus musculus]
 gi|309263233|ref|XP_003085999.1| PREDICTED: 60S ribosomal protein L23a-like [Mus musculus]
          Length = 156

 Score =  174 bits (442), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF  PKTL+L R+PKYPRKS+    +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRWPKTLQLRRQPKYPRKSVPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|466087256|ref|XP_004286026.1| PREDICTED: 60S ribosomal protein L23a-like [Orcinus orca]
          Length = 156

 Score =  174 bits (442), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLITESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF VD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFTVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|403281989|ref|XP_003932449.1| PREDICTED: 60S ribosomal protein L23a-like [Saimiri boliviensis
           boliviensis]
          Length = 162

 Score =  174 bits (442), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y I K PL TESAMKKI
Sbjct: 37  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPGRNKLDHYAISKFPLTTESAMKKI 96

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 97  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 156

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 157 NKIGII 162



>gi|498981315|ref|XP_004550031.1| PREDICTED: 60S ribosomal protein L23a-like isoform X1 [Maylandia
           zebra]
          Length = 243

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 97/125 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 45  GVHSHRKKKVRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 104

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 105 EDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 164

Query: 154 NKIGF 158
           NK+  
Sbjct: 165 NKVSL 169



>gi|402883333|ref|XP_003905174.1| PREDICTED: 60S ribosomal protein L23a-like [Papio anubis]
          Length = 156

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYV L  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVGLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|109076051|ref|XP_001097637.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Macaca
           mulatta]
 gi|297293619|ref|XP_002804291.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Macaca
           mulatta]
 gi|297293621|ref|XP_002804292.1| PREDICTED: 60S ribosomal protein L23a-like isoform 3 [Macaca
           mulatta]
          Length = 156

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYP KS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPGKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|296210305|ref|XP_002751913.1| PREDICTED: 60S ribosomal protein L23a-like [Callithrix jacchus]
          Length = 156

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKL D+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLCDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|430811954|emb|CCJ30603.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 229

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 109/136 (80%), Gaps = 11/136 (8%)

Query: 35  VHGK---IKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMK 91
           +HG+   +K++ RTS TF RPKTLRL+RKP Y RKS+ HTPRLD+YK++  PLNTES+MK
Sbjct: 94  LHGRFCMLKRRVRTSATFRRPKTLRLARKPLYMRKSIPHTPRLDEYKVLVCPLNTESSMK 153

Query: 92  KIEDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQK--------INTLIRPNGTKKAYVRL 143
           KIE+ NTLVF V  +ANK QI+ A+KKLY+VD QK        INTLI PNGTKKAYV+L
Sbjct: 154 KIEENNTLVFRVHLRANKYQIQLALKKLYNVDVQKNRMSLWMEINTLICPNGTKKAYVKL 213

Query: 144 TSDVDALEVANKIGFI 159
           +SD+DAL+VANKIGF+
Sbjct: 214 SSDMDALDVANKIGFV 229



>gi|355567623|gb|EHH23964.1| hypothetical protein EGK_07538 [Macaca mulatta]
          Length = 156

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ N LVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EENNILVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|1574942|gb|AAB17510.1| ribosomal protein L23a [Homo sapiens]
          Length = 156

 Score =  174 bits (441), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y II  PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIINFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QI  AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQISQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|403290615|ref|XP_003936407.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Saimiri
           boliviensis boliviensis]
 gi|403290617|ref|XP_003936408.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Saimiri
           boliviensis boliviensis]
          Length = 156

 Score =  174 bits (441), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYV L  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVPLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|359318950|ref|XP_003638956.1| PREDICTED: 60S ribosomal protein L23a-like [Canis lupus familiaris]
          Length = 156

 Score =  174 bits (441), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF  PKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRPPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|354543080|emb|CCE39798.1| hypothetical protein CPAR2_602160 [Candida parapsilosis]
          Length = 143

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 104/126 (82%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+GK   K RTSTTF  PKTL+L+R+PKY RKS+ H  RLD YK+I  P+ TE+AMKK+
Sbjct: 18  GVNGKKAVKVRTSTTFRLPKTLKLARQPKYQRKSVPHYNRLDAYKVIVAPIATETAMKKV 77

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED+NTLVF VD +ANK QIK AVK+LYDVD   +NTLIRPNGTKKAY+RLT+D DAL++A
Sbjct: 78  EDSNTLVFQVDIKANKHQIKKAVKELYDVDVDYVNTLIRPNGTKKAYLRLTADHDALDIA 137

Query: 154 NKIGFI 159
           NKIG+I
Sbjct: 138 NKIGYI 143



>gi|302502009|ref|XP_003012996.1| hypothetical protein ARB_00879 [Arthroderma benhamiae CBS 112371]
 gi|291176557|gb|EFE32356.1| hypothetical protein ARB_00879 [Arthroderma benhamiae CBS 112371]
          Length = 152

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (81%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K RTS TFHRPKTL+LSR PKYPRKS+ H PR+D +++I +PLNTESAMKKI
Sbjct: 26  GVHSHKVRKVRTSATFHRPKTLQLSRSPKYPRKSIPHVPRMDYHQVIVHPLNTESAMKKI 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFI D +ANKRQIK A+KKLYD+D  K+NTLIRP+G+KK + RLT D+DAL++ 
Sbjct: 86  EENNTLVFIADVKANKRQIKLALKKLYDIDTVKLNTLIRPDGSKKVFARLTPDIDALDIA 145

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 146 ATKLGIV 152



>gi|340518442|gb|EGR48683.1| hypothetical protein TRIREDRAFT_61595 [Trichoderma reesei QM6a]
          Length = 141

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (82%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K R ST+FHRPKTL LSR P+YPRK+++H PRLD++K+I +PLNTESAMKK+
Sbjct: 15  GTHSTKNRKVRLSTSFHRPKTLVLSRAPRYPRKAINHVPRLDEHKVIIHPLNTESAMKKM 74

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKAY RLT DVDAL++ 
Sbjct: 75  EENNTLVFIVDVKANKAQIKLALKKLYDIDTVKINTLIRPDGSKKAYARLTPDVDALDIA 134

Query: 153 ANKIGFI 159
           ANK+  +
Sbjct: 135 ANKLSLV 141



>gi|344258446|gb|EGW14550.1| 60S ribosomal protein L23a [Cricetulus griseus]
          Length = 204

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NK+  +
Sbjct: 151 NKVSIL 156



>gi|485917148|gb|EOD44201.1| putative 60s ribosomal protein l25 protein [Neofusicoccum parvum
           UCRNP2]
          Length = 150

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 102/120 (85%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+    +K R STTFHRPKTL+LSR PKYPRKS+ H PRLD  K+I +PLNTESAMKKI
Sbjct: 24  GVNSHKVRKVRNSTTFHRPKTLQLSRAPKYPRKSIPHEPRLDASKVIVHPLNTESAMKKI 83

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK+++KKLYD++  K+NTLIRP+GTKKA+ RLT DVDAL++A
Sbjct: 84  EENNTLVFIVDVKANKRQIKESLKKLYDIETIKVNTLIRPDGTKKAFARLTPDVDALDIA 143



>gi|115438528|ref|XP_001218089.1| 60S ribosomal protein L25 [Aspergillus terreus NIH2624]
 gi|114188904|gb|EAU30604.1| 60S ribosomal protein L23A [Aspergillus terreus NIH2624]
          Length = 162

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (86%)

Query: 41  KKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDTNTLV 100
           +K RTSTTFHRPKTL LSR PKYPRKS+ H PRLD +K+I  PLNTESAMKKIE+ NTLV
Sbjct: 43  RKVRTSTTFHRPKTLELSRSPKYPRKSIPHGPRLDSHKVILYPLNTESAMKKIEENNTLV 102

Query: 101 FIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           FIVD +ANKRQIK A+KKLYDV+  K+NTL+RP+G+KKA+ RLT DVDAL++A
Sbjct: 103 FIVDVKANKRQIKQALKKLYDVETVKVNTLVRPDGSKKAFARLTPDVDALDIA 155



>gi|296817353|ref|XP_002849013.1| 60S ribosomal protein L25 [Arthroderma otae CBS 113480]
 gi|238839466|gb|EEQ29128.1| 60S ribosomal protein L23A [Arthroderma otae CBS 113480]
          Length = 153

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/127 (64%), Positives = 103/127 (81%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K RTS TFHRPKTL+LSR PKYPRKS+ H PRLD +++I +PLNTESAMKKI
Sbjct: 27  GAHSHKVRKVRTSATFHRPKTLQLSRSPKYPRKSIPHVPRLDHHQVIVHPLNTESAMKKI 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFI D +ANKRQIK A+KKLYD++  K+NTLIRP+G+KK + RLT D+DAL++ 
Sbjct: 87  EENNTLVFIADVKANKRQIKLALKKLYDIETVKLNTLIRPDGSKKVFARLTPDIDALDIA 146

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 147 ATKLGIV 153



>gi|212536036|ref|XP_002148174.1| 60S ribosomal protein L23 [Talaromyces marneffei ATCC 18224]
 gi|210070573|gb|EEA24663.1| 60S ribosomal protein L23 [Talaromyces marneffei ATCC 18224]
          Length = 233

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/120 (72%), Positives = 100/120 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G   K  +K RTSTTFH PKTL+LSR PKYPRKS+ H  RLD +K+I +PLNTESAMKKI
Sbjct: 107 GQGAKKLRKIRTSTTFHLPKTLQLSRSPKYPRKSVPHETRLDHHKVIVHPLNTESAMKKI 166

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+KKLYDVD  KINTLIRP+G+KKAY RLT DVDAL++A
Sbjct: 167 EENNTLVFIVDVKANKRQIKAALKKLYDVDTVKINTLIRPDGSKKAYARLTPDVDALDIA 226



>gi|471574598|gb|EMR72412.1| putative 60s ribosomal protein l25 protein [Eutypa lata UCREL1]
          Length = 154

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/147 (60%), Positives = 105/147 (71%)

Query: 7   MPPKKSADXXXXXXXXXXXXXXXXXXXGVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRK 66
           MPPK +                     G     K+K RTST+FHRPKTL+LSR PKY RK
Sbjct: 1   MPPKSTKGGAKPKGLKQANAAAKAVLRGDKAHAKRKVRTSTSFHRPKTLQLSRSPKYLRK 60

Query: 67  SLSHTPRLDQYKIIKNPLNTESAMKKIEDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQK 126
           S+ H PRLD++KII +PLNTESAMKKIE+ NTLVF+VD +ANK QIK A+KKLY +D  K
Sbjct: 61  SIPHVPRLDEHKIIIHPLNTESAMKKIEENNTLVFLVDIKANKAQIKQALKKLYQIDVVK 120

Query: 127 INTLIRPNGTKKAYVRLTSDVDALEVA 153
           INTLIRP+GTKKAY RLT DVDAL++A
Sbjct: 121 INTLIRPDGTKKAYARLTPDVDALDIA 147



>gi|358420065|ref|XP_003584411.1| PREDICTED: 60S ribosomal protein L23a-like [Bos taurus]
          Length = 156

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF VD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFTVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NK G I
Sbjct: 151 NKTGII 156



>gi|119498617|ref|XP_001266066.1| 60S ribosomal protein L25 [Neosartorya fischeri NRRL 181]
 gi|119414230|gb|EAW24169.1| 60S ribosomal protein L23 [Neosartorya fischeri NRRL 181]
          Length = 154

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      +K RTSTTFHRPKTL+LSR PKYPRKS+ H PRLD +K++  PLNTESAMKKI
Sbjct: 28  GAGAHKSRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHEPRLDAHKVVLYPLNTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+KKLYDVD  K+NTL+RP+G+KKA+ RLT DVDAL++A
Sbjct: 88  EEHNTLVFIVDVKANKRQIKLALKKLYDVDTVKVNTLVRPDGSKKAFARLTPDVDALDIA 147



>gi|470423489|ref|XP_004337603.1| ribosomal protein L23, putative [Acanthamoeba castellanii str.
           Neff]
 gi|440794429|gb|ELR15590.1| ribosomal protein L23, putative [Acanthamoeba castellanii str.
           Neff]
          Length = 210

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 102/119 (85%)

Query: 41  KKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDTNTLV 100
           +K RT+  F RPKTLRL R PKYPR+S+  T +LDQ++++++PL TESAMKKIED NTLV
Sbjct: 92  RKVRTNVHFFRPKTLRLPRNPKYPRRSVPRTNKLDQFRVLRHPLTTESAMKKIEDNNTLV 151

Query: 101 FIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVANKIGFI 159
           FIVD +ANKRQIKDAVKK+YD+ A+K+NTL+RP+G KKAYVRLT D DAL++AN+IG I
Sbjct: 152 FIVDLKANKRQIKDAVKKMYDITAEKVNTLVRPDGKKKAYVRLTGDFDALDIANRIGII 210



>gi|457866957|emb|CCQ18589.1| 60S ribosomal protein L14/L17/L23 [Sycon ciliatum]
          Length = 150

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 102/126 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+ K K K RTS TF RPKTLRL R PKYPRKS+   P+LD++ IIK+PL TESAMKKI
Sbjct: 25  GVNAKGKAKTRTSVTFRRPKTLRLPRTPKYPRKSVPSRPKLDKFAIIKHPLTTESAMKKI 84

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK  IK AVK LY++D  K+NTL+RP+G KKA+VRL+SD DAL+VA
Sbjct: 85  EDNNTLVFIVDKRANKPSIKIAVKSLYEIDVMKVNTLVRPDGQKKAFVRLSSDYDALDVA 144

Query: 154 NKIGFI 159
           N+IG I
Sbjct: 145 NRIGII 150



>gi|358373324|dbj|GAA89923.1| 60S ribosomal protein L23 [Aspergillus kawachii IFO 4308]
          Length = 154

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (82%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      +K RTSTTFHRPKTL+LSR PKYPRKS+ H PRLD +K++  PLNTESAMKKI
Sbjct: 28  GAGAHKSRKVRTSTTFHRPKTLQLSRSPKYPRKSIPHVPRLDAHKVVLYPLNTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NKRQIK A+KKLYDVD  K+NTL+RP+G KKAY RLT DVDAL++A
Sbjct: 88  EENNTLVFIVDVKSNKRQIKLALKKLYDVDTVKVNTLVRPDGLKKAYARLTPDVDALDIA 147



>gi|504175923|ref|XP_004597470.1| PREDICTED: 60S ribosomal protein L23a-like [Ochotona princeps]
          Length = 156

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK  TS TF RPKT RL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIHTSPTFRRPKTQRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|70998694|ref|XP_754069.1| 60S ribosomal protein L23 [Aspergillus fumigatus Af293]
 gi|66851705|gb|EAL92031.1| 60S ribosomal protein L23 [Aspergillus fumigatus Af293]
 gi|159126197|gb|EDP51313.1| 60S ribosomal protein L23 [Aspergillus fumigatus A1163]
          Length = 144

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      +K RTSTTFHRPKTL+LSR PKYPRKS+ H PRLD +K++  PLNTESAMKKI
Sbjct: 18  GTGAHKSRKIRTSTTFHRPKTLQLSRSPKYPRKSIPHEPRLDAHKVVLYPLNTESAMKKI 77

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+KKLYDVD  K+NTL+RP+G+KKA+ RLT DVDAL++A
Sbjct: 78  EEHNTLVFIVDVKANKRQIKLALKKLYDVDTVKVNTLVRPDGSKKAFARLTPDVDALDIA 137



>gi|335301731|ref|XP_001928884.3| PREDICTED: 60S ribosomal protein L23a-like [Sus scrofa]
          Length = 156

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK RTS TF RPKTLRL R+PKYPRKS   T +LD Y II+  L TESAMKKI
Sbjct: 31  GIHSDKKKKIRTSPTFLRPKTLRLRRQPKYPRKSAPRTNKLDHYAIIRFYLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK  VKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQTVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDCDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|472352956|ref|XP_004396150.1| PREDICTED: 60S ribosomal protein L23a-like [Odobenus rosmarus
           divergens]
          Length = 156

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+   K+NTLIRP+G KKAYVRL  D DAL+V 
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIGMAKVNTLIRPDGEKKAYVRLAPDYDALDVV 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|298707885|emb|CBJ30282.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 144

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 102/123 (82%)

Query: 37  GKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDT 96
           GK + K RTS  FHRPKTL  +RKPKYP K++   P+++++++IK PL TESAMKKIED 
Sbjct: 22  GKRRAKVRTSVHFHRPKTLTHARKPKYPAKAVPRAPQMNKHRVIKFPLTTESAMKKIEDN 81

Query: 97  NTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVANKI 156
           NTLVFIVD ++NKRQIKDAVK LYD+++Q +NTLIRP+G KKAYVRLT D DALE+ANKI
Sbjct: 82  NTLVFIVDVKSNKRQIKDAVKALYDIESQNVNTLIRPDGKKKAYVRLTQDFDALEIANKI 141

Query: 157 GFI 159
           G I
Sbjct: 142 GII 144



>gi|121712574|ref|XP_001273898.1| 60S ribosomal protein L25 [Aspergillus clavatus NRRL 1]
 gi|119402051|gb|EAW12472.1| 60S ribosomal protein L23 [Aspergillus clavatus NRRL 1]
          Length = 154

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 98/112 (87%)

Query: 42  KPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDTNTLVF 101
           K RTSTTFHRPKTL+LSR PKYPRKS+ H PRLD +K++  PLNTESAMKKIE+ NTLVF
Sbjct: 36  KIRTSTTFHRPKTLQLSRSPKYPRKSIPHEPRLDAHKVVLFPLNTESAMKKIEEHNTLVF 95

Query: 102 IVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           IVD +ANKRQIK A+KKLYDVD  K+NTL+RP+G+KKA+ RLT DVDAL++A
Sbjct: 96  IVDVKANKRQIKLALKKLYDVDTVKVNTLVRPDGSKKAFARLTPDVDALDIA 147



>gi|443899005|dbj|GAC76338.1| 60s ribosomal protein L23 [Pseudozyma antarctica T-34]
          Length = 147

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 101/126 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G  G   +K RT TTF RPKTL L++ PKYPRK++ H PR+D ++ I  PLNTESAMKKI
Sbjct: 22  GTQGTKTRKVRTDTTFRRPKTLDLAKAPKYPRKAVPHAPRMDAFRTILYPLNTESAMKKI 81

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD  ANKRQI+ A+KKLYDV A KINTLIRP+G KKA+VRL+ D DAL+V+
Sbjct: 82  EENNTLVFIVDRAANKRQIEGALKKLYDVSAAKINTLIRPDGKKKAFVRLSPDQDALDVS 141

Query: 154 NKIGFI 159
           N+IGFI
Sbjct: 142 NRIGFI 147



>gi|296189809|ref|XP_002742928.1| PREDICTED: 60S ribosomal protein L23a-like [Callithrix jacchus]
          Length = 156

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK R S TF RPKTLRL R+PKYP+KS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRMSPTFRRPKTLRLRRQPKYPQKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G K AYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKNAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|291409800|ref|XP_002721195.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF  PKTLRL R+PKYP+KS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHRHNKKKIRTSPTFRWPKTLRLRRQPKYPQKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|126326630|ref|XP_001371028.1| PREDICTED: 60S ribosomal protein L23a-like [Monodelphis domestica]
          Length = 156

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK R S TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRMSPTFRRPKTLRLRRQPKYPRKSAPRRKKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLI+P+G KKAYVRL  D D L+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIQPDGEKKAYVRLAPDYDTLDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|145253881|ref|XP_001398453.1| 60S ribosomal protein L25 [Aspergillus niger CBS 513.88]
 gi|134084029|emb|CAL00567.1| unnamed protein product [Aspergillus niger]
 gi|350634101|gb|EHA22465.1| hypothetical protein ASPNIDRAFT_214126 [Aspergillus niger ATCC
           1015]
          Length = 154

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 99/120 (82%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      +K RTSTTFHRPKTL+LSR PKYPRKS+ H PRLD +K+I  PLNTESAMKKI
Sbjct: 28  GAGAHKARKVRTSTTFHRPKTLQLSRSPKYPRKSIPHVPRLDAHKVILYPLNTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NKRQIK A+KKLYDVD  K+NTL+RP+G KKA+ RLT DVDAL++A
Sbjct: 88  EENNTLVFIVDVKSNKRQIKLALKKLYDVDTVKVNTLVRPDGLKKAFARLTPDVDALDIA 147



>gi|449459936|ref|XP_004147702.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus]
 gi|449514958|ref|XP_004164525.1| PREDICTED: 60S ribosomal protein L23a-like [Cucumis sativus]
          Length = 153

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 100/119 (84%)

Query: 41  KKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDTNTLV 100
           KK RTS TFHRPKTL+  R PKYPR S++   +LDQY+I+K PL TESAMKKIED NTLV
Sbjct: 35  KKIRTSVTFHRPKTLKKDRNPKYPRISVTPRNKLDQYQILKYPLTTESAMKKIEDNNTLV 94

Query: 101 FIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVANKIGFI 159
           FIVD +ANK+ IKDAVKK+YD+  +K+NTLIRP+GTKKAYVRLT D DAL+VANKIG I
Sbjct: 95  FIVDIRANKKNIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII 153



>gi|241956506|ref|XP_002420973.1| 60S ribosomal protein L25 [Candida dubliniensis CD36]
 gi|223644316|emb|CAX41129.1| ribosomal protein, large subunit, putative [Candida dubliniensis
           CD36]
 gi|238883166|gb|EEQ46804.1| 60S ribosomal protein L25 [Candida albicans WO-1]
          Length = 142

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (81%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+GK   K RTSTTF  PKTL+L+R PKY RKS+ H  RLD +KII  P+ TE+AMKK+
Sbjct: 17  GVNGKKALKVRTSTTFRLPKTLKLTRSPKYQRKSVPHYNRLDAHKIIVAPIATETAMKKV 76

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF VD ++NK QIK AVK+LYDVDA  +NTLIRPNGTKKAY+RLTSD DAL++A
Sbjct: 77  EDGNTLVFQVDIKSNKHQIKSAVKELYDVDALYVNTLIRPNGTKKAYIRLTSDYDALDIA 136

Query: 154 NKIGFI 159
           N+IG+I
Sbjct: 137 NRIGYI 142



>gi|22758866|gb|AAN05592.1| ribosomal protein L23a [Argopecten irradians]
          Length = 170

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 101/126 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH K  +K RTS  F RPKTL+L R+PKYPRKS+  T  LD+Y+I+K PL TESAMKKI
Sbjct: 45  GVHDKRNRKVRTSVHFRRPKTLKLPREPKYPRKSVPKTATLDKYRIVKYPLTTESAMKKI 104

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF+VD +ANK Q+K AVKKLYD+D  K+NTL+RP+G KKAYVRL  D DAL+VA
Sbjct: 105 EDNNTLVFVVDKRANKPQVKLAVKKLYDIDVAKVNTLVRPDGEKKAYVRLAPDYDALDVA 164

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 165 NKIGII 170



>gi|507628118|ref|XP_004627114.1| PREDICTED: 60S ribosomal protein L23a-like [Octodon degus]
          Length = 156

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK RTS TF  PKTL L R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GIHSHKKKKIRTSPTFRCPKTLWLRRQPKYPRKSTPRRSKLDHYAIIKVPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|403289760|ref|XP_003936011.1| PREDICTED: 60S ribosomal protein L23a-like [Saimiri boliviensis
           boliviensis]
          Length = 156

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   +KK RTS TF +PKTLRL R PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKEKKIRTSPTFRQPKTLRLRRHPKYPRKSAPGRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDTDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|443699145|gb|ELT98756.1| hypothetical protein CAPTEDRAFT_158372 [Capitella teleta]
          Length = 181

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH  +KKK R+   F RP TLRL R PKYPRKS  H PR+DQYKIIK PL TESAMKKI
Sbjct: 56  GVHQSLKKKIRSKPRFTRPHTLRLPRTPKYPRKSTHHAPRMDQYKIIKYPLTTESAMKKI 115

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIV  +ANK QI+ AVKKLY +D  K+NTL RP+G KKAYVRL  D DAL+VA
Sbjct: 116 EDNNTLVFIVHQKANKPQIRMAVKKLYSIDVSKVNTLNRPDGEKKAYVRLAPDYDALDVA 175

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 176 NKIGII 181



>gi|291383583|ref|XP_002708813.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF +PKTLRL R+PKYPRKS     +LD Y II+ PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRQPKTLRLRRQPKYPRKSAPRRNKLDHYAIIEFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKA VRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKACVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|472585461|gb|EMS23015.1| 60S ribosomal protein l23a [Rhodosporidium toruloides NP11]
          Length = 172

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 100/123 (81%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G  G   +K RTS TFHRPKTL L R PKY RK+++  PR+D ++ I +PLNTESAMKKI
Sbjct: 25  GTSGTALRKVRTSVTFHRPKTLALPRAPKYQRKAVASLPRMDAFRTIVHPLNTESAMKKI 84

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANKRQIKDAV+KLY+V   KINTLIRP+G KKA+VRL +DVDALEVA
Sbjct: 85  EDHNTLVFIVDVKANKRQIKDAVRKLYEVKPLKINTLIRPDGRKKAFVRLEADVDALEVA 144

Query: 154 NKI 156
           NK+
Sbjct: 145 NKV 147



>gi|448090707|ref|XP_004197140.1| Piso0_004378 [Millerozyma farinosa CBS 7064]
 gi|448095129|ref|XP_004198171.1| Piso0_004378 [Millerozyma farinosa CBS 7064]
 gi|359378562|emb|CCE84821.1| Piso0_004378 [Millerozyma farinosa CBS 7064]
 gi|359379593|emb|CCE83790.1| Piso0_004378 [Millerozyma farinosa CBS 7064]
          Length = 144

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/126 (65%), Positives = 102/126 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G + K   K RT TTFHRPKTL+L+R PKY RKS+ H  RLD YKII +P+ TE+AMKK+
Sbjct: 19  GTNAKKALKVRTDTTFHRPKTLKLARNPKYTRKSVPHYNRLDAYKIIVSPIATETAMKKV 78

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED+NTLVF V  +ANK QIK AVK+LY+VD   INTL++PNGTKKAY+RLTSD DAL++A
Sbjct: 79  EDSNTLVFEVSMKANKHQIKSAVKELYEVDVDHINTLVKPNGTKKAYIRLTSDFDALDIA 138

Query: 154 NKIGFI 159
           N+IG+I
Sbjct: 139 NRIGYI 144



>gi|315049151|ref|XP_003173950.1| 60S ribosomal protein L25 [Arthroderma gypseum CBS 118893]
 gi|311341917|gb|EFR01120.1| 60S ribosomal protein L23a [Arthroderma gypseum CBS 118893]
          Length = 152

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/127 (63%), Positives = 103/127 (81%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K RTS TFHRPKTL+LSR PKYPRKS+ H PR+D +++I +PLNTESAMKKI
Sbjct: 26  GAHSHKVRKVRTSATFHRPKTLQLSRSPKYPRKSIPHVPRMDHHQVIVHPLNTESAMKKI 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFI D +ANKRQIK A+KKLYD++  K+NTLIRP+G+KK + RLT D+DAL++ 
Sbjct: 86  EENNTLVFIADVKANKRQIKLALKKLYDIETVKLNTLIRPDGSKKVFARLTPDIDALDIA 145

Query: 153 ANKIGFI 159
           A K+G +
Sbjct: 146 ATKLGIV 152



>gi|344267825|ref|XP_003405766.1| PREDICTED: 60S ribosomal protein L23a-like [Loxodonta africana]
          Length = 156

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PK P KS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKCPPKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|71023831|ref|XP_762145.1| hypothetical protein UM05998.1 [Ustilago maydis 521]
 gi|46101737|gb|EAK86970.1| hypothetical protein UM05998.1 [Ustilago maydis 521]
          Length = 147

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 101/126 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G  G   +K RT TTF RPKTL L++ P++PRKS+ H PR+D ++ I  PLNTESAMKKI
Sbjct: 22  GTSGSKVRKVRTDTTFRRPKTLDLAKNPRFPRKSVPHAPRMDAFRTILFPLNTESAMKKI 81

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD  ANKRQI+ A+KKLYDV A KINTLIRP+G KKA+VRLT D DAL+V+
Sbjct: 82  EENNTLVFIVDRAANKRQIEGALKKLYDVSAAKINTLIRPDGKKKAFVRLTPDQDALDVS 141

Query: 154 NKIGFI 159
           N+IGFI
Sbjct: 142 NRIGFI 147



>gi|358399122|gb|EHK48465.1| hypothetical protein TRIATDRAFT_255317 [Trichoderma atroviride IMI
           206040]
          Length = 152

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (82%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H    +K R +T+FHRPKTL LSR P++PRK+++H PRLD++KII +PLNTESAMKK+
Sbjct: 26  GTHSSKTRKVRQTTSFHRPKTLVLSRAPRFPRKAINHLPRLDEHKIIIHPLNTESAMKKM 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKAY RLT DVDAL++ 
Sbjct: 86  EENNTLVFIVDVKANKAQIKLALKKLYDIDTVKINTLIRPDGSKKAYARLTPDVDALDIA 145

Query: 153 ANKIGFI 159
           ANK+  +
Sbjct: 146 ANKLSLV 152



>gi|65332270|gb|AAY42210.1| ribosomal protein L23 [Haemaphysalis qinghaiensis]
 gi|113171055|gb|ABI30642.1| ribosomal protein L23 [Haemaphysalis longicornis]
 gi|126567153|gb|ABO20989.1| ribosomal protein L23 [Rhipicephalus microplus]
          Length = 135

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G HG   KK RTS  F RPKTL L R PKYPR+S+    RLDQ+ IIKNPL TESAMKKI
Sbjct: 10  GTHGTRTKKIRTSVKFRRPKTLSLPRNPKYPRRSVPTRTRLDQFSIIKNPLTTESAMKKI 69

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIV  +ANK QIK AVKKLYD+D   +NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 70  EDNNTLVFIVHLRANKHQIKTAVKKLYDIDVANVNTLIRPDGQKKAYVRLAPDYDALDVA 129

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 130 NKIGII 135



>gi|241671010|ref|XP_002399960.1| 60S ribosomal protein L23, putative [Ixodes scapularis]
 gi|215506218|gb|EEC15712.1| 60S ribosomal protein L23, putative [Ixodes scapularis]
          Length = 199

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 98/126 (77%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G HG   KK RTS  F RPKTL L RKPKYP++S+    RLDQ+ IIK+PL TESAMKKI
Sbjct: 74  GTHGTRTKKIRTSVKFRRPKTLSLPRKPKYPQRSVPRRTRLDQFSIIKHPLTTESAMKKI 133

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIV  +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 134 EDNNTLVFIVHLRANKHQIKAAVKKLYDIDVAKVNTLIRPDGQKKAYVRLAPDYDALDVA 193

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 194 NKIGII 199



>gi|501304935|dbj|GAC94204.1| 60S ribosomal protein [Pseudozyma hubeiensis SY62]
          Length = 147

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 101/126 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G  G   +K RT TTF RPKTL L++ P++PRKS+ H PR+D ++ I  PLNTESAMKKI
Sbjct: 22  GTSGSKVRKIRTDTTFRRPKTLDLAKNPRFPRKSVPHAPRMDAFRTILYPLNTESAMKKI 81

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD  ANKRQI+ A+KKLYDV A KINTLIRP+G KKA+VRLT D DAL+V+
Sbjct: 82  EENNTLVFIVDRAANKRQIEGALKKLYDVSAAKINTLIRPDGKKKAFVRLTPDQDALDVS 141

Query: 154 NKIGFI 159
           N+IGFI
Sbjct: 142 NRIGFI 147



>gi|512906932|ref|XP_004900973.1| PREDICTED: 60S ribosomal protein L23a [Heterocephalus glaber]
 gi|351710400|gb|EHB13319.1| 60S ribosomal protein L23a [Heterocephalus glaber]
          Length = 156

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 96/120 (80%)

Query: 40  KKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDTNTL 99
           KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKIED NTL
Sbjct: 37  KKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTL 96

Query: 100 VFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVANKIGFI 159
           VFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VANKIG I
Sbjct: 97  VFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII 156



>gi|296204599|ref|XP_002749339.1| PREDICTED: 60S ribosomal protein L23a-like [Callithrix jacchus]
          Length = 156

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF  PKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFWWPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E  NT+VFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EGNNTVVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGGKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|512824450|ref|XP_004880390.1| PREDICTED: 60S ribosomal protein L23a-like [Heterocephalus glaber]
 gi|351697395|gb|EHB00314.1| 60S ribosomal protein L23a [Heterocephalus glaber]
          Length = 156

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 98/125 (78%)

Query: 35  VHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIE 94
           +H   KKK RTS TF RPKTLRL ++PKYPRKS     +LD Y IIK PL TESAMKKIE
Sbjct: 32  IHSHKKKKIRTSPTFRRPKTLRLRQQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIE 91

Query: 95  DTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVAN 154
           D NTLVFIVD +ANK QIK AV+KLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VAN
Sbjct: 92  DNNTLVFIVDVKANKHQIKQAVEKLYDIDVAKVNTLIRPDGEKKAYVRLALDYDALDVAN 151

Query: 155 KIGFI 159
           KIG I
Sbjct: 152 KIGII 156



>gi|154298856|ref|XP_001549849.1| 60S ribosomal protein L25 [Botryotinia fuckeliana B05.10]
 gi|347836681|emb|CCD51253.1| similar to 60S ribosomal protein L23a [Botryotinia fuckeliana T4]
 gi|472237476|gb|EMR82371.1| putative 60s ribosomal protein l25 protein [Botryotinia fuckeliana
           BcDW1]
          Length = 154

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 101/120 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH    +K R STTF RPKTL+LSR PKYPR S+   PRLD++K+I +PLNTESAMKKI
Sbjct: 28  GVHSHKVRKVRLSTTFRRPKTLQLSRAPKYPRTSIVSQPRLDEHKVIIHPLNTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANK QIK+A+KKLYD+D  KINTLIRP+G+KKA+ RLT+DVDAL++A
Sbjct: 88  EENNTLVFIVDIKANKAQIKEALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIA 147



>gi|160550243|gb|ABX44826.1| putative 60S ribosomal protein RPL23A [Flustra foliacea]
          Length = 157

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G   + KKK R S  F RPKTL L R PKYPRKS    PRLDQ+KI+K PL TESAMKKI
Sbjct: 32  GTFTQRKKKVRNSVHFKRPKTLSLPRAPKYPRKSAPSRPRLDQFKIVKFPLTTESAMKKI 91

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK  IK AVKKLYD+D Q++NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 92  EDNNTLVFIVDKRANKNMIKTAVKKLYDIDVQRVNTLIRPDGEKKAYVRLAPDYDALDVA 151

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 152 NKIGII 157



>gi|109132348|ref|XP_001097481.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
          Length = 156

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK R S TF RPKTLRL R+PKYP KS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRMSPTFQRPKTLRLPRQPKYPWKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  + DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKPQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPNYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|507930959|ref|XP_004676723.1| PREDICTED: 60S ribosomal protein L23a-like [Condylura cristata]
          Length = 156

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK  TS+TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GIHSHKKKKIHTSSTFQRPKTLRLQRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NT IRP+G KKA VRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVTKVNTRIRPDGEKKACVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|399168928|emb|CCE30216.1| probable ribosomal protein L23a, cytosolic [Claviceps purpurea
           20.1]
          Length = 149

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 103/127 (81%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G H +   K RTST+FHRPKTL LSR PKY RK+++H PRLD +++I +PLNTESAMKK+
Sbjct: 23  GSHARKHVKTRTSTSFHRPKTLILSRSPKYMRKAIAHEPRLDAHRVIVHPLNTESAMKKM 82

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK ++KKLYD+D  KINTLIRP+G KKAY RLT DVDAL++ 
Sbjct: 83  EEHNTLVFIVDVRANKAQIKTSLKKLYDIDCVKINTLIRPDGKKKAYCRLTPDVDALDIA 142

Query: 153 ANKIGFI 159
           ANK+  +
Sbjct: 143 ANKLSLV 149



>gi|397521145|ref|XP_003830663.1| PREDICTED: 60S ribosomal protein L23a-like [Pan paniscus]
          Length = 156

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL  +PKYP+KS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFWRPKTLRLRGQPKYPQKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NK G I
Sbjct: 151 NKTGII 156



>gi|109497962|ref|XP_001065345.1| PREDICTED: 60S ribosomal protein L23a-like [Rattus norvegicus]
 gi|293341371|ref|XP_002724918.1| PREDICTED: 60S ribosomal protein L23a-like [Rattus norvegicus]
          Length = 156

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKTRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED N LVF VD +ANK Q+K AVKKLYD+D  K+NT+IRP+G KKAYV L  D DAL+VA
Sbjct: 91  EDNNALVFTVDVKANKHQVKQAVKKLYDIDVAKVNTMIRPDGEKKAYVHLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|395862975|ref|XP_003803690.1| PREDICTED: 60S ribosomal protein L23a-like [Otolemur garnettii]
          Length = 155

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 98/126 (77%), Gaps = 1/126 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK RTS TF  PKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GIHSHKKKKIRTSPTFWWPKTLRLQRQPKYPRKSAPRRNKLDYYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  ED-NTLVFIVDVKANKYQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|466014863|ref|XP_004271012.1| PREDICTED: 60S ribosomal protein L23a-like [Orcinus orca]
          Length = 156

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKT RL ++PKYP+K      +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHTKKKIRTSPTFQRPKTPRLRKQPKYPQKGTPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED+NTLVFIVD +ANK QIK AVKKLYD D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDSNTLVFIVDVRANKHQIKQAVKKLYDTDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|470326773|ref|XP_004364786.1| ribosomal protein L23a [Capsaspora owczarzaki ATCC 30864]
 gi|320166975|gb|EFW43874.1| ribosomal protein L23a [Capsaspora owczarzaki ATCC 30864]
          Length = 157

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/126 (65%), Positives = 99/126 (78%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +G  K+K RT++TFHRPKTL L R PKYPR+S   T  LD Y IIK+PL +ESAMK I
Sbjct: 32  GTNGVAKRKIRTTSTFHRPKTLALPRAPKYPRRSAQRTNALDAYAIIKHPLTSESAMKLI 91

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           EDTNTLVFI D +ANK QIKDAV  LYD+ A +INTL+RP+G KKAYV+L +D +ALE+A
Sbjct: 92  EDTNTLVFITDVRANKAQIKDAVHSLYDIKAARINTLVRPDGFKKAYVKLAADQEALEIA 151

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 152 NKIGII 157



>gi|109148510|ref|XP_001082946.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
          Length = 156

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF  PKTLRL R+PKY RKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRGPKTLRLPRQPKYLRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|343427760|emb|CBQ71286.1| probable RPL25-ribosomal protein L23a.e [Sporisorium reilianum
           SRZ2]
          Length = 147

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G  G   +K RT TTF RPKTL L + P++PRKS+ H PR+D ++ I  PLNTESAMKKI
Sbjct: 22  GTSGSKVRKVRTDTTFRRPKTLDLPKAPRFPRKSVPHAPRMDAFRTILYPLNTESAMKKI 81

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD  ANKRQI+ A+KKLYDV A KINTLIRP+G KKA+VRLT D DAL+V+
Sbjct: 82  EENNTLVFIVDRAANKRQIEGALKKLYDVSAAKINTLIRPDGKKKAFVRLTPDQDALDVS 141

Query: 154 NKIGFI 159
           N+IGFI
Sbjct: 142 NRIGFI 147



>gi|477531033|gb|ENH82756.1| 60s ribosomal protein l25 [Colletotrichum orbiculare MAFF 240422]
          Length = 178

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +   K K R +T+FHRPKTL +SR PKYPRKS+ H PRLD++KII +PLNTESAMKKI
Sbjct: 52  GTNSHKKTKVRYTTSFHRPKTLVVSRAPKYPRKSIPHEPRLDEHKIIVHPLNTESAMKKI 111

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NK QIK A+KKLYD+D  KINTLIRP+G+KKAY RLT DVDAL++A
Sbjct: 112 EENNTLVFIVDVKSNKAQIKQALKKLYDIDTVKINTLIRPDGSKKAYARLTPDVDALDIA 171



>gi|50421963|ref|XP_459542.1| 60S ribosomal protein L25 [Debaryomyces hansenii CBS767]
 gi|49655210|emb|CAG87769.1| DEHA2E05104p [Debaryomyces hansenii CBS767]
          Length = 144

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 102/126 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G + K   K RT T+FHRPKTL+LSR PKY RKS+ H  RLD YKII +P+ +E+AMKK+
Sbjct: 19  GTNAKKSLKVRTDTSFHRPKTLKLSRSPKYSRKSVPHYNRLDAYKIIVSPIASETAMKKV 78

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED N LVF VD ++NK QIK AVK+LYDVD + +NTL+RPNGTKKAY+RLT+D DAL++A
Sbjct: 79  EDGNILVFQVDLKSNKNQIKSAVKELYDVDVEYVNTLVRPNGTKKAYIRLTADHDALDIA 138

Query: 154 NKIGFI 159
           N+IG+I
Sbjct: 139 NRIGYI 144



>gi|332848771|ref|XP_003315715.1| PREDICTED: 60S ribosomal protein L23a-like [Pan troglodytes]
          Length = 156

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF +PKTLRL R+PKYP+KS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRQPKTLRLWRQPKYPQKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLI P+G KKAYVRL    DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIWPDGEKKAYVRLAPGYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|297473712|ref|XP_002686795.1| PREDICTED: 60S ribosomal protein L23a [Bos taurus]
 gi|358411789|ref|XP_001250166.3| PREDICTED: 60S ribosomal protein L23a isoform 1 [Bos taurus]
 gi|296488551|tpg|DAA30664.1| TPA: ribosomal protein L23a-like [Bos taurus]
          Length = 156

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD   IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHDAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD D  K+NTLIRP+G KK YVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDTDVAKVNTLIRPDGEKKVYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|291398680|ref|XP_002715960.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL  +PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRWQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD D  K+NTLI P+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDTDVAKVNTLISPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           +KIG I
Sbjct: 151 SKIGII 156



>gi|388857284|emb|CCF49126.1| probable RPL25-ribosomal protein L23a.e [Ustilago hordei]
          Length = 151

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G  G   +K RT TTF RPKTL L++ PK+PRK++ H PR+D ++ I  PLNTESAMKKI
Sbjct: 26  GTSGAKVRKVRTDTTFRRPKTLDLAKNPKFPRKAIPHAPRMDAFRTILYPLNTESAMKKI 85

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NT+VFIVD  ANKRQI+ A+KKLYDV A KINTLIRP+G KKA+VRLT D DAL+V+
Sbjct: 86  EENNTIVFIVDRAANKRQIEGALKKLYDVSAAKINTLIRPDGKKKAFVRLTPDQDALDVS 145

Query: 154 NKIGFI 159
           N+IGF+
Sbjct: 146 NRIGFL 151



>gi|440904377|gb|ELR54901.1| hypothetical protein M91_21712 [Bos grunniens mutus]
          Length = 158

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK R S TF RPKTLRL R+PKYP KS     +L  Y IIK PL TESAMKKI
Sbjct: 33  GVHSHKKKKIRMSPTFRRPKTLRLRRQPKYPLKSAPRRNKLVHYAIIKFPLTTESAMKKI 92

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 93  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 152

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 153 NKIGII 158



>gi|348690126|gb|EGZ29940.1| hypothetical protein PHYSODRAFT_353704 [Phytophthora sojae]
          Length = 148

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/126 (66%), Positives = 102/126 (80%), Gaps = 1/126 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G HGK+ K  RT   F++PKTL+L+R P+Y RKS+    +LD+Y+IIK PL TESAMKKI
Sbjct: 24  GSHGKVLK-IRTKVHFYKPKTLQLARAPRYARKSVPSRNKLDKYRIIKAPLTTESAMKKI 82

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF+VD  ANKRQIKDAVK+LYD+   K+NTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 83  EDNNTLVFLVDLLANKRQIKDAVKQLYDIKVAKVNTLIRPDGQKKAYVRLTADYDALDVA 142

Query: 154 NKIGFI 159
           N+IG I
Sbjct: 143 NRIGVI 148



>gi|46111223|ref|XP_382669.1| hypothetical protein FG02493.1 [Fusarium graminearum PH-1]
          Length = 173

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 103/127 (81%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +   K K R ST+FHRPKTL  SR PKYPR+S+ H PRLD++K++ +PLNTESAMKK+
Sbjct: 47  GTNSHKKVKARYSTSFHRPKTLITSRAPKYPRRSIPHQPRLDEHKVVIHPLNTESAMKKM 106

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKAY RLT DVDAL++ 
Sbjct: 107 EENNTLVFIVDVKANKAQIKLALKKLYDIDCLKINTLIRPDGSKKAYARLTPDVDALDIA 166

Query: 153 ANKIGFI 159
           ANK+  +
Sbjct: 167 ANKLSLV 173



>gi|296195807|ref|XP_002745549.1| PREDICTED: 60S ribosomal protein L23a-like [Callithrix jacchus]
          Length = 265

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESA KKI
Sbjct: 140 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESARKKI 199

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYV L  D +AL+VA
Sbjct: 200 EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVPLAPDYNALDVA 259

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 260 NKIGII 265



>gi|291403595|ref|XP_002718133.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK R S TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRMSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +AN+ QIK AVKKLYD+D  K+NTLI P+G KKA VRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANEHQIKQAVKKLYDIDVAKVNTLISPDGEKKACVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|291387949|ref|XP_002710512.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRK      +LD   IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLPRQPKYPRKIAPRRNKLDHCAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKA VRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKACVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|395847432|ref|XP_003796379.1| PREDICTED: 60S ribosomal protein L23a-like [Otolemur garnettii]
          Length = 156

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H + KKK RTS TF + KTLRL R+PKYP KS S   +LD Y IIK PL TESAMKKI
Sbjct: 31  GIHSQKKKKIRTSPTFQQAKTLRLRRQPKYPWKSASKRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+N LIRP+G KKAYV L  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKYQIKQAVKKLYDIDVAKVNILIRPDGEKKAYVLLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|67903738|ref|XP_682125.1| hypothetical protein AN8856.2 [Aspergillus nidulans FGSC A4]
 gi|40740954|gb|EAA60144.1| hypothetical protein AN8856.2 [Aspergillus nidulans FGSC A4]
 gi|259482927|tpe|CBF77869.1| TPA: 60S ribosomal protein L23 (AFU_orthologue; AFUA_5G05630)
           [Aspergillus nidulans FGSC A4]
          Length = 153

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 97/120 (80%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G      +K RTSTTFHRPKTL+LSR PKYPR S+ H PRLD  KII  PLNTESAMKKI
Sbjct: 27  GAGAHKTRKIRTSTTFHRPKTLQLSRSPKYPRVSVPHLPRLDAAKIILYPLNTESAMKKI 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+KKLYDV+  K+NTL+RP+G KKA+ RLT DVDAL++A
Sbjct: 87  EENNTLVFIVDVKANKRQIKAALKKLYDVETVKVNTLVRPDGLKKAFARLTPDVDALDIA 146



>gi|426224807|ref|XP_004006560.1| PREDICTED: 60S ribosomal protein L23a-like [Ovis aries]
          Length = 156

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYP KS     +LD Y IIK PL TESA+KKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPWKSAPRRNKLDHYAIIKFPLTTESAVKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF VD +ANK QIK AVKKLYD D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFTVDVKANKHQIKQAVKKLYDTDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|395846026|ref|XP_003795716.1| PREDICTED: 60S ribosomal protein L23a-like [Otolemur garnettii]
 gi|395846028|ref|XP_003795717.1| PREDICTED: 60S ribosomal protein L23a-like [Otolemur garnettii]
          Length = 156

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK RTS TF  PKTLRL R+PKYPRKS     +LD Y IIK PL TESA+KKI
Sbjct: 31  GIHSHKKKKIRTSPTFRWPKTLRLQRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAIKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK A KKLYD+D  K+NTLIRP+G KKA+VRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAAKKLYDIDVAKVNTLIRPDGEKKAHVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|460408177|ref|XP_004249523.1| PREDICTED: 60S ribosomal protein L23a-like [Solanum lycopersicum]
          Length = 154

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/122 (68%), Positives = 100/122 (81%)

Query: 38  KIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDTN 97
           K+ K+ RT  TFHRPKTL+  R PKYPR S     RLDQY+I++ PL TESAMKKIED N
Sbjct: 33  KMSKRIRTKVTFHRPKTLKKDRNPKYPRISAPGRNRLDQYQILQCPLTTESAMKKIEDNN 92

Query: 98  TLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVANKIG 157
           TLVFIVD  A+K++I+DAVKK+YD+ A+K+NTLIRP+GTKKAYVRLT D DAL+VANKIG
Sbjct: 93  TLVFIVDIHADKKKIRDAVKKMYDIQAKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIG 152

Query: 158 FI 159
            I
Sbjct: 153 II 154



>gi|402223095|gb|EJU03160.1| hypothetical protein DACRYDRAFT_21442 [Dacryopinax sp. DJM-731 SS1]
          Length = 164

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/126 (65%), Positives = 104/126 (82%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +    KK RTS TF RPKTL+L + P+YPRKS+ H PR+D ++ I +P++TESAMKKI
Sbjct: 39  GTNSHKSKKIRTSVTFRRPKTLQLPKNPRYPRKSIPHAPRMDAHRTIISPVSTESAMKKI 98

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVF+V+ ++NK+QIK AVK+LYD DA KINTLIRP+G KKAYVRLT+D DAL+VA
Sbjct: 99  EEHNTLVFLVNLRSNKKQIKAAVKELYDADAVKINTLIRPDGKKKAYVRLTADHDALDVA 158

Query: 154 NKIGFI 159
           NKIGFI
Sbjct: 159 NKIGFI 164



>gi|507630571|ref|XP_004627727.1| PREDICTED: 60S ribosomal protein L23a-like [Octodon degus]
          Length = 155

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 98/126 (77%), Gaps = 1/126 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK RTS TF RPKTL L R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GIHSHKKKKIRTSPTFRRPKTLWLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G +KAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDG-EKAYVRLAPDYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|429855712|gb|ELA30656.1| 60s ribosomal protein l25 [Colletotrichum gloeosporioides Nara gc5]
          Length = 156

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +   K K R +T+FHRPKTL +SR PKYPRKS+ H PRLD++KII +PLNTESAMKKI
Sbjct: 30  GTNSHKKTKVRYTTSFHRPKTLVVSRAPKYPRKSIPHEPRLDEHKIIIHPLNTESAMKKI 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD ++NK QIK A+KKLYD+D  KINTLIRP+G+KKAY RLT DVDAL++A
Sbjct: 90  EENNTLVFIVDIKSNKAQIKQALKKLYDIDTVKINTLIRPDGSKKAYARLTPDVDALDIA 149



>gi|342877001|gb|EGU78532.1| hypothetical protein FOXB_10962 [Fusarium oxysporum Fo5176]
 gi|475673591|gb|EMT70702.1| 60S ribosomal protein L25 [Fusarium oxysporum f. sp. cubense race
           4]
 gi|477522573|gb|ENH74640.1| 60S ribosomal protein L25 [Fusarium oxysporum f. sp. cubense race
           1]
          Length = 153

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 103/127 (81%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +   K K R ST+FHRPKTL  SR PKYPR+S+ H PRLD++KII +PLNTESAMKK+
Sbjct: 27  GSNSHKKVKARFSTSFHRPKTLITSRAPKYPRRSIPHQPRLDEHKIIVHPLNTESAMKKM 86

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD ++NK QIK A+KKLYD+D  KINTLIRP+GTKKAY RLT DVDAL++ 
Sbjct: 87  EENNTLVFIVDIKSNKAQIKLALKKLYDIDCVKINTLIRPDGTKKAYARLTPDVDALDIA 146

Query: 153 ANKIGFI 159
           ANK+  +
Sbjct: 147 ANKLSLV 153



>gi|322797842|gb|EFZ19750.1| hypothetical protein SINV_11268 [Solenopsis invicta]
          Length = 240

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVHG   +K RTS  FHRPKT R  R PKYPRKS+ +  R+D + IIK PL TE+AMKKI
Sbjct: 115 GVHGSRVRKIRTSVHFHRPKTFRPPRMPKYPRKSVPNRNRMDAFNIIKFPLTTEAAMKKI 174

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIV T ANK  IK ++KKLYDVD  K+NTLIRP+G KKAYVRLT D DAL+VA
Sbjct: 175 EDNNTLVFIVHTHANKYHIKASIKKLYDVDVAKVNTLIRPDGKKKAYVRLTRDYDALDVA 234

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 235 NKIGII 240



>gi|94388474|ref|XP_989377.1| PREDICTED: 60S ribosomal protein L23a-like [Mus musculus]
 gi|94388502|ref|XP_001002232.1| PREDICTED: 60S ribosomal protein L23a-like [Mus musculus]
          Length = 155

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 95/120 (79%)

Query: 40  KKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKIEDTNTL 99
           KKK RTS TF RPKTL+L R+PKYPRKS     +LD Y IIK PL TESAMKKIED NTL
Sbjct: 36  KKKIRTSPTFRRPKTLQLWRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTL 95

Query: 100 VFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVANKIGFI 159
           VFIVD +ANK QIK AVKKLYD+D  K+NTLIRPN  KKAYVRL  D DAL+VANKIG I
Sbjct: 96  VFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPNREKKAYVRLAPDYDALDVANKIGII 155



>gi|453084047|gb|EMF12092.1| 60S ribosomal protein L23 [Mycosphaerella populorum SO2202]
          Length = 154

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+     K R STTFH+PKTL LSR PKYPR+S+   PRLD  K+I +PLNTESAMKKI
Sbjct: 28  GVNSHKVTKVRKSTTFHQPKTLTLSRAPKYPRRSIPRQPRLDAGKVIIHPLNTESAMKKI 87

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK+A+KKLYDVD  KINTLIRP+G+KKA+ RLT+DVDAL++A
Sbjct: 88  EENNTLVFIVDVKANKRQIKEALKKLYDVDTIKINTLIRPDGSKKAFARLTADVDALDIA 147



>gi|109088540|ref|XP_001106213.1| PREDICTED: 60S ribosomal protein L23a-like isoform 3 [Macaca
           mulatta]
 gi|109088542|ref|XP_001106404.1| PREDICTED: 60S ribosomal protein L23a-like isoform 6 [Macaca
           mulatta]
 gi|109088544|ref|XP_001106463.1| PREDICTED: 60S ribosomal protein L23a-like isoform 7 [Macaca
           mulatta]
 gi|109088554|ref|XP_001106333.1| PREDICTED: 60S ribosomal protein L23a-like isoform 5 [Macaca
           mulatta]
 gi|297300709|ref|XP_002805644.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
 gi|297300713|ref|XP_002805645.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
 gi|297300715|ref|XP_002805646.1| PREDICTED: 60S ribosomal protein L23a-like [Macaca mulatta]
          Length = 156

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF  PKTLRL R+PKY RKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKIRTSPTFRGPKTLRLPRQPKYLRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           +KIG I
Sbjct: 151 DKIGII 156



>gi|449300951|gb|EMC96962.1| hypothetical protein BAUCODRAFT_68260, partial [Baudoinia
           compniacensis UAMH 10762]
          Length = 145

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 101/120 (84%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GV+    +K RT+T+FHRPKTL LSR PKYPRKS+ H PRLD  K+I +PLNTESAMKKI
Sbjct: 19  GVNSHKVRKVRTNTSFHRPKTLTLSRAPKYPRKSVPHEPRLDAGKVIIHPLNTESAMKKI 78

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           E+ NTLVFIVD +ANKRQIK A+KKLYDV+  +I+TLIRP+G+KKA+ RLT DVDAL++A
Sbjct: 79  EENNTLVFIVDVKANKRQIKMALKKLYDVECVRISTLIRPDGSKKAFARLTPDVDALDIA 138



>gi|403218113|emb|CCK72605.1| hypothetical protein KNAG_0K02420 [Kazachstania naganishii CBS
           8797]
          Length = 142

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +GK   K RTS TF  PKTL+L+R PKY  KS+ H  RLD YK+I+ P+ +E+AMKK+
Sbjct: 17  GTNGKKALKVRTSATFRLPKTLKLTRTPKYATKSVPHYNRLDSYKVIEQPITSETAMKKV 76

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF V  +ANK QIK AVK+LY+VD Q +NTL+RPNGTKKAYVRLTSD DAL++A
Sbjct: 77  EDGNTLVFQVSMKANKYQIKKAVKELYEVDVQSVNTLVRPNGTKKAYVRLTSDYDALDIA 136

Query: 154 NKIGFI 159
           N+IG+I
Sbjct: 137 NRIGYI 142



>gi|296189977|ref|XP_002742995.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Callithrix
           jacchus]
          Length = 156

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK  TS TF RPKT RL R+PKYPRKS     +LD Y IIK PL TESAMKKI
Sbjct: 31  GVHSHKKKKICTSPTFRRPKTPRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKK YD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKPYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|291403698|ref|XP_002718173.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF RPKTLRL R+PKYPRKS     +LD Y IIK PL TESA+KKI
Sbjct: 31  GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAVKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AV+KLYD+D  K+NTLI P+G KKA VRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVRKLYDIDVAKVNTLISPDGEKKANVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|408391738|gb|EKJ71106.1| hypothetical protein FPSE_08612 [Fusarium pseudograminearum CS3096]
          Length = 151

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 103/127 (81%), Gaps = 1/127 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +   K K R ST+FHRPKTL  SR PKYPR+S+ H PRLD++K++ +PLNTESAMKK+
Sbjct: 25  GTNSHKKVKARYSTSFHRPKTLITSRAPKYPRRSIPHQPRLDEHKVVIHPLNTESAMKKM 84

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEV- 152
           E+ NTLVFIVD +ANK QIK A+KKLYD+D  KINTLIRP+G+KKAY RLT DVDAL++ 
Sbjct: 85  EENNTLVFIVDVKANKAQIKLALKKLYDIDCLKINTLIRPDGSKKAYARLTPDVDALDIA 144

Query: 153 ANKIGFI 159
           ANK+  +
Sbjct: 145 ANKLSLV 151



>gi|344289030|ref|XP_003416249.1| PREDICTED: 60S ribosomal protein L23a-like [Loxodonta africana]
          Length = 177

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 94/126 (74%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK   S  F RPKTLRL R+PKYPRKS     +LD Y  IK PL TESAMKKI
Sbjct: 31  GVHSHKKKKICISPAFQRPKTLRLRRQPKYPRKSAPRRNKLDHYATIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+N LIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDIKANKHQIKQAVKKLYDIDVAKVNALIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156



>gi|291385358|ref|XP_002709221.1| PREDICTED: ribosomal protein L23a-like [Oryctolagus cuniculus]
          Length = 156

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G+H   KKK RTS TF +PKTLRL R+PKYP+KS     +LD   IIK PL TESAMKKI
Sbjct: 31  GIHSHKKKKIRTSPTFRQPKTLRLRRQPKYPQKSAPRRNKLDHSAIIKFPLTTESAMKKI 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIVD +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL  D DAL+VA
Sbjct: 91  EDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA 150

Query: 154 NKIGFI 159
           NK G I
Sbjct: 151 NKTGII 156



>gi|426367416|ref|XP_004050728.1| PREDICTED: 60S ribosomal protein L23a-like isoform 1 [Gorilla
           gorilla gorilla]
 gi|426367418|ref|XP_004050729.1| PREDICTED: 60S ribosomal protein L23a-like isoform 2 [Gorilla
           gorilla gorilla]
          Length = 155

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 88/126 (69%), Positives = 98/126 (77%), Gaps = 1/126 (0%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH + KKK  TS TF RPKTLRL R+P+YPRKS     +LD Y IIK PL TESAMKK 
Sbjct: 31  GVHSQ-KKKIHTSPTFRRPKTLRLRRQPEYPRKSAPRKNKLDHYAIIKFPLTTESAMKKT 89

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIV  +ANK QIK AVKKLYD+D  K+NTLIRP+G KKAYVRL +D DAL+VA
Sbjct: 90  EDNNTLVFIVVVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAADYDALDVA 149

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 150 NKIGII 155



>gi|307178254|gb|EFN67039.1| 60S ribosomal protein L23a [Camponotus floridanus]
          Length = 240

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 97/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVHG   +K RTS  FHRPKT R  R PKYPRKS+ +  R+D + IIK PL TE+AMKKI
Sbjct: 115 GVHGSRVRKIRTSVHFHRPKTFRPPRNPKYPRKSVPNRNRMDAFNIIKFPLTTEAAMKKI 174

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVFIV T ANK  IK ++KKLYDVD  K+NTL+RP+G KKAYVRLT D DAL+VA
Sbjct: 175 EDNNTLVFIVHTSANKYHIKASIKKLYDVDVAKVNTLMRPDGKKKAYVRLTRDYDALDVA 234

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 235 NKIGII 240



>gi|156843423|ref|XP_001644779.1| hypothetical protein Kpol_1020p29 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115429|gb|EDO16921.1| hypothetical protein Kpol_1020p29 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 142

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           G +GK   K RTS TF  PKTL+L+R PKY  KS+ H  RLD YK+I+ P+N+E+AMK +
Sbjct: 17  GTNGKKALKVRTSATFRLPKTLKLARSPKYASKSVPHYERLDSYKVIEKPINSETAMKLV 76

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF V  +ANK QIK AVK+LY+VD Q +NTLIRPNGTKKA+VRLTSD DAL++A
Sbjct: 77  EDGNTLVFQVSLKANKYQIKRAVKELYEVDVQSVNTLIRPNGTKKAFVRLTSDFDALDIA 136

Query: 154 NKIGFI 159
           N+IG+I
Sbjct: 137 NRIGYI 142



>gi|119571803|gb|EAW51418.1| hCG2001000 [Homo sapiens]
          Length = 156

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 96/126 (76%)

Query: 34  GVHGKIKKKPRTSTTFHRPKTLRLSRKPKYPRKSLSHTPRLDQYKIIKNPLNTESAMKKI 93
           GVH   KKK RTS TF +PKTLRL R+PKYPRKS     +LD Y IIK PL TESAMKK 
Sbjct: 31  GVHSHKKKKIRTSPTFRQPKTLRLWRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKT 90

Query: 94  EDTNTLVFIVDTQANKRQIKDAVKKLYDVDAQKINTLIRPNGTKKAYVRLTSDVDALEVA 153
           ED NTLVF+VD +ANK QIK AVKKLYD+D  K+NTLI P+G KKAYVRL    DAL+VA
Sbjct: 91  EDNNTLVFLVDVKANKHQIKQAVKKLYDIDVAKVNTLIWPDGEKKAYVRLAPGYDALDVA 150

Query: 154 NKIGFI 159
           NKIG I
Sbjct: 151 NKIGII 156