BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10401_c0_seq1-m.158 complete 439-843(-) 135 (-)
         (134 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|170049407|ref|XP_001855904.1| anaphase-promoting complex subu...   123   1e-26   Culex quinquefasciatus
gi|157117126|ref|XP_001652947.1| anaphase-promoting complex [Aed...   123   2e-26   Aedes aegypti
gi|168015724|ref|XP_001760400.1| predicted protein [Physcomitrel...   119   3e-25   Physcomitrella patens
gi|114051628|ref|NP_001040166.1| anaphase promoting complex subu...   118   6e-25   Bombyx mori [silk moth]
gi|158300919|ref|XP_320716.4| AGAP011799-PA [Anopheles gambiae s...   118   6e-25   Anopheles gambiae str. PEST
gi|357619554|gb|EHJ72080.1| anaphase promoting complex subunit 1...   117   7e-25   Danaus plexippus [American monarch]
gi|66531676|ref|XP_396738.2| PREDICTED: anaphase-promoting compl...   117   8e-25   Apis mellifera [European honey bee]
gi|193606239|ref|XP_001950033.1| PREDICTED: anaphase-promoting c...   117   1e-24   Acyrthosiphon pisum
gi|298711511|emb|CBJ26599.1| Putative subunit of the Anaphase Pr...   117   1e-24   Ectocarpus siliculosus
gi|478253336|gb|ENN73697.1| hypothetical protein YQE_09694, part...   116   2e-24   Dendroctonus ponderosae
gi|507686390|ref|XP_004640766.1| PREDICTED: anaphase-promoting c...   116   2e-24   Octodon degus
gi|380023096|ref|XP_003695365.1| PREDICTED: anaphase-promoting c...   116   2e-24   Apis florea [dwarf honeybee]
gi|72013135|ref|XP_783681.1| PREDICTED: anaphase-promoting compl...   115   3e-24   
gi|291239008|ref|XP_002739417.1| PREDICTED: anaphase promoting c...   115   3e-24   Saccoglossus kowalevskii
gi|307195501|gb|EFN77387.1| Anaphase-promoting complex subunit 1...   115   3e-24   Harpegnathos saltator
gi|332375763|gb|AEE63022.1| unknown [Dendroctonus ponderosae]         115   3e-24   Dendroctonus ponderosae
gi|506968775|gb|AGM32731.1| APC10 subunit of the anaphase-promot...   115   3e-24   Coptotermes formosanus
gi|332016291|gb|EGI57204.1| Anaphase-promoting complex subunit 1...   115   3e-24   Acromyrmex echinatior
gi|322799261|gb|EFZ20652.1| hypothetical protein SINV_01375 [Sol...   115   3e-24   Solenopsis invicta [imported red fire ant]
gi|307191142|gb|EFN74840.1| Anaphase-promoting complex subunit 1...   115   3e-24   Camponotus floridanus
gi|443684651|gb|ELT88523.1| hypothetical protein CAPTEDRAFT_1623...   115   4e-24   Capitella teleta
gi|297293455|ref|XP_001094665.2| PREDICTED: anaphase-promoting c...   115   5e-24   
gi|119625457|gb|EAX05052.1| anaphase promoting complex subunit 1...   115   5e-24   Homo sapiens [man]
gi|383859168|ref|XP_003705068.1| PREDICTED: anaphase-promoting c...   115   5e-24   Megachile rotundata
gi|260806773|ref|XP_002598258.1| hypothetical protein BRAFLDRAFT...   115   5e-24   Branchiostoma floridae
gi|242006722|ref|XP_002424196.1| anaphase-promoting complex subu...   115   5e-24   Pediculus humanus corporis [human body lice]
gi|512934663|ref|XP_004907714.1| PREDICTED: anaphase-promoting c...   115   5e-24   
gi|332217333|ref|XP_003257814.1| PREDICTED: anaphase-promoting c...   115   5e-24   Nomascus leucogenys [White-cheeked Gibbon]
gi|35900980|ref|NP_081180.1| anaphase-promoting complex subunit ...   115   5e-24   Mus musculus [mouse]
gi|507705099|ref|XP_004645503.1| PREDICTED: anaphase-promoting c...   115   6e-24   Octodon degus
gi|291401170|ref|XP_002716972.1| PREDICTED: anaphase promoting c...   114   6e-24   
gi|301096061|ref|XP_002897129.1| anaphase-promoting complex subu...   114   6e-24   Phytophthora infestans T30-4
gi|224049376|ref|XP_002188840.1| PREDICTED: anaphase-promoting c...   114   6e-24   
gi|148678931|gb|EDL10878.1| anaphase promoting complex subunit 1...   114   6e-24   Mus musculus [mouse]
gi|56605928|ref|NP_001008467.1| anaphase-promoting complex subun...   114   6e-24   Gallus gallus [bantam]
gi|149635632|ref|XP_001514225.1| PREDICTED: anaphase-promoting c...   114   6e-24   Ornithorhynchus anatinus [duck-billed platypus]
gi|147899801|ref|NP_001089271.1| anaphase promoting complex subu...   114   6e-24   Xenopus laevis [clawed frog]
gi|62858451|ref|NP_001016392.1| anaphase promoting complex subun...   114   6e-24   Xenopus tropicalis [western clawed frog]
gi|295444976|ref|NP_001171398.1| anaphase promoting complex subu...   114   6e-24   Sus scrofa [pigs]
gi|326918378|ref|XP_003205466.1| PREDICTED: anaphase-promoting c...   114   6e-24   Meleagris gallopavo [common turkey]
gi|505792795|ref|XP_004606254.1| PREDICTED: anaphase-promoting c...   114   6e-24   Sorex araneus [Eurasian shrew]
gi|4836700|gb|AAD30527.1| anaphase promoting complex subunit 10 ...   114   6e-24   Homo sapiens [man]
gi|150170706|ref|NP_055700.2| anaphase-promoting complex subunit...   114   6e-24   Homo sapiens [man]
gi|90085633|dbj|BAE91557.1| unnamed protein product [Macaca fasc...   114   6e-24   Macaca fascicularis [crab eating macaque]
gi|327273880|ref|XP_003221707.1| PREDICTED: anaphase-promoting c...   114   6e-24   Anolis carolinensis [Carolina anole]
gi|126331333|ref|XP_001367156.1| PREDICTED: anaphase-promoting c...   114   6e-24   Monodelphis domestica
gi|340729497|ref|XP_003403037.1| PREDICTED: anaphase-promoting c...   114   6e-24   Bombus terrestris [large earth bumblebee]
gi|91081555|ref|XP_975078.1| PREDICTED: similar to anaphase prom...   114   6e-24   
gi|375493585|ref|NP_001243638.1| anaphase-promoting complex subu...   114   7e-24   Homo sapiens [man]
gi|332820473|ref|XP_001141102.2| PREDICTED: anaphase-promoting c...   114   7e-24   
gi|5262509|emb|CAB45705.1| hypothetical protein [Homo sapiens] >...   114   7e-24   Homo sapiens [man]
gi|507671085|ref|XP_004708754.1| PREDICTED: anaphase-promoting c...   114   7e-24   Echinops telfairi [lesser hedgehog tenrec]
gi|410038764|ref|XP_003950472.1| PREDICTED: anaphase-promoting c...   114   7e-24   
gi|402870559|ref|XP_003899281.1| PREDICTED: anaphase-promoting c...   114   7e-24   
gi|348582258|ref|XP_003476893.1| PREDICTED: anaphase-promoting c...   114   7e-24   Cavia porcellus [guinea pig]
gi|148234881|ref|NP_001089057.1| uncharacterized protein LOC5950...   114   7e-24   Xenopus laevis [clawed frog]
gi|375493587|ref|NP_001243639.1| anaphase-promoting complex subu...   114   7e-24   Homo sapiens [man]
gi|410038762|ref|XP_003950471.1| PREDICTED: anaphase-promoting c...   114   7e-24   
gi|332217335|ref|XP_003257815.1| PREDICTED: anaphase-promoting c...   114   8e-24   Nomascus leucogenys [White-cheeked Gibbon]
gi|499050789|ref|XP_004575911.1| PREDICTED: anaphase-promoting c...   114   8e-24   Maylandia zebra
gi|16975123|pdb|1JHJ|A Chain A, Crystal Structure Of The Apc10DO...   114   8e-24   Homo sapiens [man]
gi|432918759|ref|XP_004079652.1| PREDICTED: anaphase-promoting c...   114   8e-24   Oryzias latipes [Japanese rice fish]
gi|47209318|emb|CAF92702.1| unnamed protein product [Tetraodon n...   114   8e-24   Tetraodon nigroviridis
gi|312377680|gb|EFR24453.1| hypothetical protein AND_10959 [Anop...   114   9e-24   
gi|426345599|ref|XP_004040493.1| PREDICTED: anaphase-promoting c...   114   9e-24   Gorilla gorilla gorilla [lowland gorilla]
gi|348538028|ref|XP_003456494.1| PREDICTED: anaphase-promoting c...   114   9e-24   Oreochromis niloticus
gi|426345597|ref|XP_004040492.1| PREDICTED: anaphase-promoting c...   114   1e-23   Gorilla gorilla gorilla [lowland gorilla]
gi|156549338|ref|XP_001601344.1| PREDICTED: anaphase-promoting c...   114   1e-23   Nasonia vitripennis
gi|410038760|ref|XP_003950470.1| PREDICTED: anaphase-promoting c...   114   1e-23   
gi|412992797|emb|CCO18777.1| anaphase promoting complex subunit ...   114   1e-23   Bathycoccus prasinos
gi|410930143|ref|XP_003978458.1| PREDICTED: anaphase-promoting c...   114   1e-23   
gi|390608650|ref|NP_001254625.1| anaphase promoting complex subu...   114   1e-23   Danio rerio [leopard danio]
gi|195455839|ref|XP_002074889.1| GK23298 [Drosophila willistoni]...   114   1e-23   Drosophila willistoni
gi|195382745|ref|XP_002050089.1| GJ21948 [Drosophila virilis] >g...   114   1e-23   Drosophila virilis
gi|195123817|ref|XP_002006398.1| GI21024 [Drosophila mojavensis]...   114   1e-23   Drosophila mojavensis
gi|145529011|ref|XP_001450294.1| hypothetical protein [Parameciu...   113   1e-23   Paramecium tetraurelia strain d4-2
gi|122692361|ref|NP_001073826.1| anaphase-promoting complex subu...   113   1e-23   Bos taurus [bovine]
gi|321458778|gb|EFX69840.1| hypothetical protein DAPPUDRAFT_3006...   113   2e-23   Daphnia pulex
gi|145510913|ref|XP_001441384.1| hypothetical protein [Parameciu...   113   2e-23   Paramecium tetraurelia strain d4-2
gi|405959727|gb|EKC25731.1| Anaphase-promoting complex subunit 1...   113   2e-23   Crassostrea gigas
gi|195027301|ref|XP_001986522.1| GH20482 [Drosophila grimshawi] ...   113   2e-23   Drosophila grimshawi
gi|28573741|ref|NP_611223.4| anaphase promoting complex subunit ...   113   2e-23   Drosophila melanogaster
gi|194880742|ref|XP_001974521.1| GG21047 [Drosophila erecta] >gi...   112   2e-23   Drosophila erecta
gi|125807963|ref|XP_001360579.1| GA10993 [Drosophila pseudoobscu...   112   2e-23   Drosophila pseudoobscura pseudoobscura
gi|194755361|ref|XP_001959960.1| GF11781 [Drosophila ananassae] ...   112   3e-23   Drosophila ananassae
gi|391346994|ref|XP_003747750.1| PREDICTED: anaphase-promoting c...   112   3e-23   Metaseiulus occidentalis
gi|348680677|gb|EGZ20493.1| hypothetical protein PHYSODRAFT_2459...   112   3e-23   Phytophthora sojae
gi|145534794|ref|XP_001453141.1| hypothetical protein [Parameciu...   112   3e-23   Paramecium tetraurelia strain d4-2
gi|146184245|ref|XP_001028080.2| anaphase-promoting complex, sub...   112   4e-23   Tetrahymena thermophila SB210
gi|355687635|gb|EHH26219.1| hypothetical protein EGK_16132 [Maca...   112   5e-23   Macaca mulatta [rhesus macaque]
gi|193709423|ref|XP_001952000.1| PREDICTED: anaphase-promoting c...   111   6e-23   Acyrthosiphon pisum
gi|428167359|gb|EKX36320.1| hypothetical protein GUITHDRAFT_1586...   111   7e-23   Guillardia theta CCMP2712
gi|355749598|gb|EHH53997.1| hypothetical protein EGM_14726 [Maca...   111   7e-23   Macaca fascicularis [crab eating macaque]
gi|325181977|emb|CCA16431.1| anaphasepromoting complex subunit 1...   110   9e-23   Albugo laibachii Nc14
gi|403330992|gb|EJY64414.1| Anaphase-promoting complex (APC), su...   110   1e-22   Oxytricha trifallax
gi|513000035|ref|XP_004861555.1| PREDICTED: anaphase-promoting c...   110   1e-22   
gi|449664364|ref|XP_002160509.2| PREDICTED: uncharacterized prot...   110   1e-22   
gi|426251527|ref|XP_004019473.1| PREDICTED: anaphase-promoting c...   109   2e-22   
gi|156376950|ref|XP_001630621.1| predicted protein [Nematostella...   109   2e-22   Nematostella vectensis
gi|470128019|ref|XP_004299953.1| PREDICTED: anaphase-promoting c...   109   3e-22   
gi|388512629|gb|AFK44376.1| unknown [Medicago truncatula]             109   3e-22   Medicago truncatula
gi|119627198|gb|EAX06793.1| hCG1640061 [Homo sapiens]                 109   3e-22   Homo sapiens [man]
gi|508699164|gb|EOX91060.1| Anaphase promoting complex 10 isofor...   109   3e-22   Theobroma cacao [chocolate]
gi|224031763|gb|ACN34957.1| unknown [Zea mays] >gi|413948347|gb|...   109   3e-22   Zea mays [maize]
gi|470102898|ref|XP_004287887.1| PREDICTED: anaphase-promoting c...   108   3e-22   Fragaria vesca subsp. vesca
gi|502153256|ref|XP_004509275.1| PREDICTED: anaphase-promoting c...   108   3e-22   Cicer arietinum [garbanzo]
gi|449446698|ref|XP_004141108.1| PREDICTED: anaphase-promoting c...   108   4e-22   Cucumis sativus [cucumbers]
gi|508699163|gb|EOX91059.1| Anaphase promoting complex 10 isofor...   108   4e-22   Theobroma cacao [chocolate]
gi|508699165|gb|EOX91061.1| Anaphase-promoting complex subunit 1...   108   4e-22   Theobroma cacao [chocolate]
gi|460375457|ref|XP_004233522.1| PREDICTED: anaphase-promoting c...   108   5e-22   
gi|224094807|ref|XP_002310244.1| predicted protein [Populus tric...   108   5e-22   Populus trichocarpa [western balsam poplar]
gi|224134260|ref|XP_002327795.1| predicted protein [Populus tric...   108   5e-22   
gi|462398148|gb|EMJ03816.1| hypothetical protein PRUPE_ppa011884...   108   6e-22   Prunus persica
gi|460375459|ref|XP_004233523.1| PREDICTED: anaphase-promoting c...   108   6e-22   Solanum lycopersicum
gi|242091253|ref|XP_002441459.1| hypothetical protein SORBIDRAFT...   107   8e-22   Sorghum bicolor [broomcorn]
gi|297836562|ref|XP_002886163.1| anaphase-promoting complex, sub...   107   9e-22   Arabidopsis lyrata subsp. lyrata
gi|18398701|ref|NP_565433.1| anaphase-promoting complex subunit ...   107   1e-21   Arabidopsis thaliana [mouse-ear cress]
gi|21592739|gb|AAM64688.1| unknown [Arabidopsis thaliana]             107   1e-21   Arabidopsis thaliana [mouse-ear cress]
gi|482567332|gb|EOA31521.1| hypothetical protein CARUB_v10014711...   107   1e-21   Capsella rubella
gi|302780585|ref|XP_002972067.1| hypothetical protein SELMODRAFT...   107   1e-21   Selaginella moellendorffii
gi|198434262|ref|XP_002131938.1| PREDICTED: anaphase-promoting c...   106   2e-21   Ciona intestinalis [sea vase]
gi|238006074|gb|ACR34072.1| unknown [Zea mays] >gi|413948346|gb|...   106   2e-21   Zea mays [maize]
gi|219884719|gb|ACL52734.1| unknown [Zea mays] >gi|413948345|gb|...   106   2e-21   Zea mays [maize]
gi|499013761|ref|XP_004537616.1| PREDICTED: anaphase-promoting c...   106   3e-21   
gi|145351293|ref|XP_001420017.1| predicted protein [Ostreococcus...   106   3e-21   Ostreococcus lucimarinus CCE9901
gi|449018510|dbj|BAM81912.1| similar to anaphase-promoting compl...   105   3e-21   Cyanidioschyzon merolae strain 10D
gi|308808844|ref|XP_003081732.1| Anaphase-promoting complex, sub...   105   3e-21   Ostreococcus tauri
gi|225430728|ref|XP_002266072.1| PREDICTED: anaphase-promoting c...   105   3e-21   Vitis vinifera
gi|384253180|gb|EIE26655.1| anaphase-promoting complex, subunit ...   105   3e-21   Coccomyxa subellipsoidea C-169
gi|326519366|dbj|BAJ96682.1| predicted protein [Hordeum vulgare ...   105   4e-21   Hordeum vulgare subsp. vulgare [barley]
gi|226528224|ref|NP_001148648.1| anaphase-promoting complex subu...   105   4e-21   Zea mays [maize]
gi|255561114|ref|XP_002521569.1| anaphase-promoting complex, put...   105   4e-21   Ricinus communis
gi|255079740|ref|XP_002503450.1| predicted protein [Micromonas s...   105   5e-21   Micromonas commoda
gi|358249186|ref|NP_001240007.1| uncharacterized protein LOC1008...   105   5e-21   Glycine max [soybeans]
gi|504128801|ref|XP_004577641.1| PREDICTED: anaphase-promoting c...   104   7e-21   Ochotona princeps [southern American pika]
gi|485623105|gb|EOD19341.1| hypothetical protein EMIHUDRAFT_4671...   104   8e-21   Emiliania huxleyi CCMP1516
gi|472584744|gb|EMS22330.1| anaphase promoting complex subunit 1...   104   9e-21   Rhodotorula toruloides NP11
gi|308080974|ref|NP_001183667.1| uncharacterized protein LOC1005...   104   9e-21   Zea mays [maize]
gi|303272633|ref|XP_003055678.1| predicted protein [Micromonas p...   104   1e-20   Micromonas pusilla CCMP1545
gi|357132396|ref|XP_003567816.1| PREDICTED: anaphase-promoting c...   103   1e-20   Brachypodium distachyon [annual false brome]
gi|290991269|ref|XP_002678258.1| anaphase promoting complex subu...   103   1e-20   Naegleria gruberi strain NEG-M
gi|475607033|gb|EMT26572.1| Anaphase-promoting complex subunit 1...   103   2e-20   Aegilops tauschii
gi|224001908|ref|XP_002290626.1| anaphase promoting complex subu...   102   5e-20   Thalassiosira pseudonana CCMP1335
gi|474436420|gb|EMS68205.1| Anaphase-promoting complex subunit 1...   101   6e-20   Triticum urartu
gi|351725793|ref|NP_001236081.1| uncharacterized protein LOC1005...   101   6e-20   Glycine max [soybeans]
gi|323456624|gb|EGB12491.1| hypothetical protein AURANDRAFT_2041...   101   6e-20   Aureococcus anophagefferens
gi|388499086|gb|AFK37609.1| unknown [Lotus japonicus]                 101   7e-20   Lotus japonicus
gi|300681546|emb|CBH32643.1| anaphase-promoting complex subunit,...   101   8e-20   Triticum aestivum [Canadian hard winter wheat]
gi|159471183|ref|XP_001693736.1| anaphase promoting complex subu...   101   8e-20   Chlamydomonas reinhardtii
gi|405975083|gb|EKC39678.1| Anaphase-promoting complex subunit 1...   100   1e-19   Crassostrea gigas
gi|330840131|ref|XP_003292074.1| hypothetical protein DICPUDRAFT...   100   2e-19   Dictyostelium purpureum
gi|307103401|gb|EFN51661.1| hypothetical protein CHLNCDRAFT_1398...   100   2e-19   Chlorella variabilis
gi|302835371|ref|XP_002949247.1| hypothetical protein VOLCADRAFT...   100   2e-19   Volvox carteri f. nagariensis
gi|209878440|ref|XP_002140661.1| anaphase-promoting complex, sub...   100   2e-19   Cryptosporidium muris RN66
gi|126649289|ref|XP_001388316.1| anaphase promoting complex subu...    99   4e-19   Cryptosporidium parvum Iowa II
gi|470319387|gb|EMR11006.1| hypothetical protein PNEG_00607 [Pne...    99   5e-19   Pneumocystis murina B123
gi|115465645|ref|NP_001056422.1| Os05g0579800 [Oryza sativa Japo...    98   7e-19   
gi|470505659|ref|XP_004348598.1| anaphase promoting complex subu...    98   8e-19   Acanthamoeba castellanii str. Neff
gi|51854317|gb|AAU10698.1| putative anaphase promoting complex s...    98   9e-19   Oryza sativa Japonica Group [Japonica rice]
gi|340058112|emb|CCC52466.1| putative anaphase promoting complex...    98   9e-19   Trypanosoma vivax Y486
gi|512861091|ref|XP_004889798.1| PREDICTED: anaphase-promoting c...    97   1e-18   
gi|170099535|ref|XP_001880986.1| predicted protein [Laccaria bic...    97   1e-18   Laccaria bicolor S238N-H82
gi|195999362|ref|XP_002109549.1| hypothetical protein TRIADDRAFT...    97   1e-18   Trichoplax adhaerens
gi|296417930|ref|XP_002838600.1| hypothetical protein [Tuber mel...    97   1e-18   Tuber melanosporum Mel28
gi|430813297|emb|CCJ29329.1| unnamed protein product [Pneumocyst...    97   1e-18   Pneumocystis jirovecii
gi|125553459|gb|EAY99168.1| hypothetical protein OsI_21127 [Oryz...    97   1e-18   Oryza sativa Indica Group [Indian rice]
gi|5091606|gb|AAD39595.1|AC007858_9 10A19I.10 [Oryza sativa Japo...    97   1e-18   Oryza sativa Japonica Group [Japonica rice]
gi|466009820|ref|XP_004269997.1| PREDICTED: anaphase-promoting c...    96   4e-18   
gi|440631730|gb|ELR01649.1| hypothetical protein GMDG_00025 [Geo...    95   5e-18   Pseudogymnoascus destructans 20631-21
gi|66827201|ref|XP_646955.1| anaphase promoting complex subunit ...    94   9e-18   Dictyostelium discoideum AX4
gi|358060516|dbj|GAA93921.1| hypothetical protein E5Q_00567 [Mix...    94   1e-17   Mixia osmundae IAM 14324
gi|353229474|emb|CCD75645.1| putative tbc1 domain family member ...    94   1e-17   Schistosoma mansoni
gi|342185082|emb|CCC94564.1| putative anaphase promoting complex...    94   1e-17   Trypanosoma congolense IL3000
gi|407407786|gb|EKF31460.1| anaphase promoting complex subunit 1...    94   1e-17   Trypanosoma cruzi marinkellei
gi|256081509|ref|XP_002577012.1| tbc1 domain family member [Schi...    94   1e-17   
gi|406866491|gb|EKD19531.1| anaphase promoting complex subunit 1...    93   2e-17   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|403417991|emb|CCM04691.1| predicted protein [Fibroporia radic...    93   2e-17   Fibroporia radiculosa
gi|254571777|ref|XP_002492998.1| hypothetical protein [Komagatae...    93   2e-17   Komagataella phaffii GS115
gi|71419527|ref|XP_811195.1| anaphase promoting complex, subunit...    93   2e-17   Trypanosoma cruzi strain CL Brener
gi|320584174|gb|EFW98385.1| anaphase-promoting complex processiv...    93   3e-17   
gi|388582841|gb|EIM23144.1| anaphase-promoting complex, subunit ...    92   3e-17   Wallemia mellicola CBS 633.66
gi|407847079|gb|EKG02978.1| anaphase promoting complex subunit 1...    92   3e-17   Trypanosoma cruzi
gi|71407839|ref|XP_806361.1| anaphase promoting complex subunit ...    92   3e-17   Trypanosoma cruzi strain CL Brener
gi|471899193|emb|CCO30486.1| Anaphase-promoting complex subunit ...    92   6e-17   Rhizoctonia solani AG-1 IB
gi|392594858|gb|EIW84182.1| anaphase-promoting complex subunit 1...    92   6e-17   Coniophora puteana RWD-64-598 SS2
gi|465954477|gb|EMP25916.1| Anaphase-promoting complex subunit 1...    92   6e-17   Chelonia mydas [green seaturtle]
gi|326427051|gb|EGD72621.1| hypothetical protein PTSG_04356 [Sal...    91   7e-17   Salpingoeca rosetta
gi|393221190|gb|EJD06675.1| anaphase-promoting complex, subunit ...    91   7e-17   Fomitiporia mediterranea MF3/22
gi|336370694|gb|EGN99034.1| hypothetical protein SERLA73DRAFT_73...    91   8e-17   Serpula lacrymans var. lacrymans S7.3
gi|470237864|ref|XP_004350889.1| anaphase promoting complex subu...    91   1e-16   Dictyostelium fasciculatum
gi|308494404|ref|XP_003109391.1| hypothetical protein CRE_08300 ...    90   2e-16   Caenorhabditis remanei
gi|395735392|ref|XP_002815232.2| PREDICTED: anaphase-promoting c...    90   2e-16   
gi|443896585|dbj|GAC73929.1| copper transporter [Pseudozyma anta...    90   2e-16   Moesziomyces antarcticus T-34
gi|402224635|gb|EJU04697.1| galactose-binding like protein, part...    90   2e-16   Dacryopinax primogenitus
gi|328770902|gb|EGF80943.1| hypothetical protein BATDEDRAFT_1111...    89   3e-16   Batrachochytrium dendrobatidis JAM81
gi|389750025|gb|EIM91196.1| anaphase-promoting complex subunit 1...    89   3e-16   Stereum hirsutum FP-91666 SS1
gi|403158039|ref|XP_003307384.2| hypothetical protein PGTG_00334...    89   3e-16   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|261333814|emb|CBH16809.1| anaphase promoting complex, subunit...    89   3e-16   Trypanosoma brucei gambiense DAL972
gi|71749400|ref|XP_828039.1| anaphase promoting complex subunit ...    89   3e-16   Trypanosoma brucei brucei TREU927
gi|406601603|emb|CCH46768.1| Anaphase-promoting complex subunit ...    89   3e-16   Wickerhamomyces ciferrii
gi|395324050|gb|EJF56498.1| APC10-domain-containing protein [Dic...    89   3e-16   Dichomitus squalens LYAD-421 SS1
gi|512204326|gb|EPE33149.1| Galactose-binding protein [Glarea lo...    89   4e-16   Glarea lozoyensis ATCC 20868
gi|268565105|ref|XP_002639335.1| Hypothetical protein CBG03913 [...    89   4e-16   Caenorhabditis briggsae
gi|242214745|ref|XP_002473193.1| predicted protein [Postia place...    89   4e-16   Postia placenta Mad-698-R
gi|345563773|gb|EGX46758.1| hypothetical protein AOL_s00097g506 ...    89   5e-16   Arthrobotrys oligospora ATCC 24927
gi|281200809|gb|EFA75026.1| anaphase promoting complex subunit 1...    89   5e-16   Polysphondylium pallidum PN500
gi|323508231|emb|CBQ68102.1| related to anaphase promoting compl...    89   5e-16   Sporisorium reilianum SRZ2
gi|341890478|gb|EGT46413.1| hypothetical protein CAEBREN_06735 [...    89   5e-16   Caenorhabditis brenneri
gi|409078210|gb|EKM78573.1| hypothetical protein AGABI1DRAFT_100...    88   6e-16   Agaricus bisporus var. burnettii JB137-S8
gi|58269076|ref|XP_571694.1| hypothetical protein [Cryptococcus ...    88   6e-16   Cryptococcus neoformans var. neoformans JEC21
gi|134113060|ref|XP_774806.1| hypothetical protein CNBF2360 [Cry...    88   6e-16   Cryptococcus neoformans var. neoformans B-3501A
gi|409048425|gb|EKM57903.1| hypothetical protein PHACADRAFT_1589...    88   7e-16   Phanerochaete carnosa HHB-10118-sp
gi|426199202|gb|EKV49127.1| hypothetical protein AGABI2DRAFT_116...    88   7e-16   Agaricus bisporus var. bisporus H97
gi|299749485|ref|XP_001836141.2| anaphase-promoting complex [Cop...    88   7e-16   Coprinopsis cinerea okayama7#130
gi|321260060|ref|XP_003194750.1| hypothetical protein CGB_F3450W...    88   1e-15   Cryptococcus gattii WM276
gi|241673384|ref|XP_002399965.1| anaphase-promoting complex, sub...    87   1e-15   Ixodes scapularis [blacklegged tick]
gi|302684263|ref|XP_003031812.1| hypothetical protein SCHCODRAFT...    87   1e-15   Schizophyllum commune H4-8
gi|313230985|emb|CBY18983.1| unnamed protein product [Oikopleura...    87   1e-15   Oikopleura dioica
gi|501310677|dbj|GAC99435.1| potential anaphase-promoting comple...    87   1e-15   Pseudozyma hubeiensis SY62
gi|390595528|gb|EIN04933.1| anaphase-promoting complex subunit 1...    87   1e-15   Punctularia strigosozonata HHB-11173 SS5
gi|328854174|gb|EGG03308.1| hypothetical protein MELLADRAFT_2906...    87   1e-15   Melampsora larici-populina 98AG31
gi|353236924|emb|CCA68909.1| related to anaphase promoting compl...    87   1e-15   Serendipita indica DSM 11827
gi|219125124|ref|XP_002182838.1| predicted protein [Phaeodactylu...    87   2e-15   Phaeodactylum tricornutum CCAP 1055/1
gi|388855275|emb|CCF51169.1| related to anaphase promoting compl...    87   2e-15   Ustilago hordei
gi|71995011|ref|NP_001021777.1| Protein Y48G1C.12 [Caenorhabditi...    87   2e-15   Caenorhabditis elegans [roundworm]
gi|402585479|gb|EJW79419.1| hypothetical protein WUBG_09670 [Wuc...    87   2e-15   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|392572960|gb|EIW66103.1| hypothetical protein TREMEDRAFT_7033...    86   2e-15   Tremella mesenterica DSM 1558
gi|71004322|ref|XP_756827.1| hypothetical protein UM00680.1 [Ust...    86   2e-15   
gi|312065554|ref|XP_003135847.1| anaphase promoting complex subu...    86   3e-15   Loa loa
gi|452986531|gb|EME86287.1| hypothetical protein MYCFIDRAFT_2341...    86   3e-15   Cercospora fijiensis CIRAD86
gi|19112595|ref|NP_595803.1| anaphase-promoting complex subunit ...    86   4e-15   Schizosaccharomyces pombe 972h-
gi|393246511|gb|EJD54020.1| anaphase-promoting complex, subunit ...    86   5e-15   Auricularia subglabra TFB-10046 SS5
gi|392564646|gb|EIW57824.1| anaphase-promoting complex subunit 1...    85   5e-15   Trametes versicolor FP-101664 SS1
gi|452845284|gb|EME47217.1| hypothetical protein DOTSEDRAFT_1456...    85   6e-15   Dothistroma septosporum NZE10
gi|358377857|gb|EHK15540.1| hypothetical protein TRIVIDRAFT_2326...    85   6e-15   Trichoderma virens Gv29-8
gi|170594453|ref|XP_001901978.1| Anaphase promoting complex subu...    85   7e-15   Brugia malayi [agent of lymphatic filariasis]
gi|471574616|gb|EMR72421.1| putative anaphase-promoting complex ...    85   7e-15   Eutypa lata UCREL1
gi|453087085|gb|EMF15126.1| galactose-binding like protein [Myco...    85   8e-15   Sphaerulina musiva SO2202
gi|380479957|emb|CCF42709.1| anaphase-promoting complex subunit ...    84   9e-15   Colletotrichum higginsianum
gi|398408289|ref|XP_003855610.1| hypothetical protein MYCGRDRAFT...    84   9e-15   Zymoseptoria tritici IPO323
gi|238580811|ref|XP_002389407.1| hypothetical protein MPER_11466...    84   1e-14   
gi|260940176|ref|XP_002614388.1| hypothetical protein CLUG_05874...    84   1e-14   Clavispora lusitaniae ATCC 42720
gi|164658686|ref|XP_001730468.1| hypothetical protein MGL_2264 [...    84   2e-14   Malassezia globosa CBS 7966
gi|50552486|ref|XP_503653.1| YALI0E07117p [Yarrowia lipolytica] ...    84   2e-14   Yarrowia lipolytica CLIB122
gi|511011748|gb|EPB92953.1| hypothetical protein HMPREF1544_0002...    84   2e-14   Mucor circinelloides f. circinelloides 1006PhL
gi|477536047|gb|ENH87532.1| anaphase promoting complex subunit 1...    83   2e-14   Colletotrichum orbiculare MAFF 240422
gi|401414618|ref|XP_003871806.1| anaphase promoting complex, sub...    83   2e-14   Leishmania mexicana MHOM/GT/2001/U1103
gi|213407856|ref|XP_002174699.1| anaphase-promoting complex subu...    83   3e-14   Schizosaccharomyces japonicus yFS275
gi|429863828|gb|ELA38235.1| anaphase promoting complex subunit 1...    83   3e-14   Colletotrichum gloeosporioides Nara gc5
gi|344304948|gb|EGW35180.1| hypothetical protein SPAPADRAFT_1461...    83   3e-14   Spathaspora passalidarum NRRL Y-27907
gi|302899183|ref|XP_003047998.1| hypothetical protein NECHADRAFT...    83   3e-14   Nectria haematococca mpVI 77-13-4
gi|302412997|ref|XP_003004331.1| anaphase-promoting complex subu...    83   3e-14   Verticillium alfalfae VaMs.102
gi|76363679|ref|XP_888563.1| anaphase promoting complex, subunit...    82   4e-14   Leishmania major strain Friedlin
gi|358391944|gb|EHK41348.1| hypothetical protein TRIATDRAFT_2280...    82   4e-14   Trichoderma atroviride IMI 206040
gi|340518344|gb|EGR48585.1| predicted protein [Trichoderma reese...    82   4e-14   Trichoderma reesei QM6a
gi|320592894|gb|EFX05303.1| anaphase promoting complex subunit 1...    82   4e-14   Grosmannia clavigera kw1407
gi|512190635|gb|EPE06398.1| anaphase-promoting complex subunit 1...    82   5e-14   Ophiostoma piceae UAMH 11346
gi|154296826|ref|XP_001548842.1| hypothetical protein BC1G_12502...    82   5e-14   Botrytis cinerea B05.10
gi|472238448|gb|EMR83315.1| putative anaphase-promoting complex ...    82   5e-14   Botrytis cinerea BcDW1
gi|156043912|ref|XP_001588512.1| hypothetical protein SS1G_10059...    82   6e-14   Sclerotinia sclerotiorum 1980 UF-70
gi|327293243|ref|XP_003231318.1| hypothetical protein TERG_08103...    82   6e-14   Trichophyton rubrum CBS 118892
gi|296820442|ref|XP_002849941.1| anaphase-promoting complex subu...    82   6e-14   Arthroderma otae CBS 113480
gi|326471718|gb|EGD95727.1| hypothetical protein TESG_03196 [Tri...    82   7e-14   Trichophyton tonsurans CBS 112818
gi|310795688|gb|EFQ31149.1| anaphase-promoting complex [Glomerel...    81   7e-14   Colletotrichum graminicola M1.001
gi|302499174|ref|XP_003011583.1| anaphase promoting complex subu...    81   7e-14   Arthroderma benhamiae CBS 112371
gi|302654059|ref|XP_003018842.1| anaphase promoting complex subu...    81   7e-14   Trichophyton verrucosum HKI 0517
gi|146076228|ref|XP_001462876.1| anaphase promoting complex, sub...    81   9e-14   Leishmania infantum JPCM5
gi|339253962|ref|XP_003372204.1| anaphase-promoting complex, sub...    81   1e-13   Trichinella spiralis
gi|221483945|gb|EEE22249.1| anaphase-promoting complex, putative...    81   1e-13   
gi|346972477|gb|EGY15929.1| anaphase-promoting complex subunit 1...    81   1e-13   Verticillium dahliae VdLs.17
gi|221505228|gb|EEE30882.1| anaphase-promoting complex, putative...    81   1e-13   
gi|237836657|ref|XP_002367626.1| anaphase-promoting complex subu...    80   1e-13   Toxoplasma gondii ME49
gi|322709787|gb|EFZ01362.1| putative anaphase promoting complex ...    80   1e-13   Metarhizium robertsii ARSEF 23
gi|315043592|ref|XP_003171172.1| anaphase-promoting complex subu...    80   1e-13   Microsporum gypseum CBS 118893
gi|449296228|gb|EMC92248.1| hypothetical protein BAUCODRAFT_5240...    80   1e-13   Baudoinia panamericana UAMH 10762
gi|341883002|gb|EGT38937.1| hypothetical protein CAEBREN_21832 [...    80   2e-13   Caenorhabditis brenneri
gi|322698580|gb|EFY90349.1| putative anaphase promoting complex ...    80   2e-13   Metarhizium acridum CQMa 102
gi|67517270|ref|XP_658515.1| hypothetical protein AN0911.2 [Aspe...    80   2e-13   Aspergillus nidulans FGSC A4
gi|330915265|ref|XP_003296962.1| hypothetical protein PTT_07216 ...    80   2e-13   Pyrenophora teres f. teres 0-1
gi|342875512|gb|EGU77256.1| hypothetical protein FOXB_12216 [Fus...    80   2e-13   
gi|477520783|gb|ENH72908.1| Anaphase-promoting complex subunit 1...    80   2e-13   
gi|401405893|ref|XP_003882396.1| anaphase-promoting complex subu...    80   2e-13   
gi|119186119|ref|XP_001243666.1| hypothetical protein CIMG_03107...    80   2e-13   
gi|258578305|ref|XP_002543334.1| conserved hypothetical protein ...    80   2e-13   
gi|425770610|gb|EKV09078.1| Anaphase promoting complex subunit 1...    79   3e-13   
gi|451845258|gb|EMD58571.1| hypothetical protein COCSADRAFT_7301...    79   3e-13   
gi|154331824|ref|XP_001561729.1| anaphase promoting complex, sub...    79   3e-13   
gi|46138601|ref|XP_390991.1| hypothetical protein FG10815.1 [Fus...    79   3e-13   
gi|149247908|ref|XP_001528341.1| conserved hypothetical protein ...    79   3e-13   
gi|121700833|ref|XP_001268681.1| anaphase promoting complex subu...    79   3e-13   
gi|392870373|gb|EAS32170.2| hypothetical protein CIMG_03107 [Coc...    79   4e-13   
gi|408391631|gb|EKJ71003.1| hypothetical protein FPSE_08862 [Fus...    79   4e-13   
gi|189208658|ref|XP_001940662.1| anaphase-promoting complex subu...    79   4e-13   
gi|303318012|ref|XP_003069008.1| Anaphase-promoting complex, sub...    79   4e-13   
gi|396488824|ref|XP_003842952.1| hypothetical protein LEMA_P0871...    79   5e-13   
gi|465794490|emb|CCU99278.1| unnamed protein product [Malassezia...    79   5e-13   
gi|115397607|ref|XP_001214395.1| conserved hypothetical protein ...    79   5e-13   
gi|346318881|gb|EGX88483.1| anaphase promoting complex subunit 1...    79   6e-13   
gi|475676174|gb|EMT73208.1| Anaphase-promoting complex subunit 1...    78   6e-13   
gi|477584545|gb|ENI01637.1| hypothetical protein COCC4DRAFT_6442...    78   7e-13   
gi|512873670|ref|XP_004893233.1| PREDICTED: anaphase-promoting c...    78   7e-13   
gi|375493591|ref|NP_001243641.1| anaphase-promoting complex subu...    78   7e-13   
gi|441619203|ref|XP_004088557.1| PREDICTED: anaphase-promoting c...    78   7e-13   
gi|358370204|dbj|GAA86816.1| anaphase promoting complex subunit ...    78   7e-13   
gi|116200263|ref|XP_001225943.1| hypothetical protein CHGG_08287...    78   7e-13   
gi|507686388|ref|XP_004640765.1| PREDICTED: anaphase-promoting c...    78   8e-13   
gi|488529581|ref|XP_004456574.1| PREDICTED: anaphase-promoting c...    78   8e-13   
gi|336273512|ref|XP_003351510.1| DOC1 protein [Sordaria macrospo...    78   8e-13   
gi|350638777|gb|EHA27133.1| hypothetical protein ASPNIDRAFT_3543...    78   9e-13   
gi|126137712|ref|XP_001385379.1| hypothetical protein PICST_2247...    78   9e-13   
gi|145231096|ref|XP_001389812.1| anaphase promoting complex subu...    78   9e-13   
gi|242773862|ref|XP_002478325.1| phosphatidylserine decarboxylas...    77   1e-12   
gi|367053960|ref|XP_003657358.1| hypothetical protein THITE_2070...    77   1e-12   
gi|452002193|gb|EMD94651.1| hypothetical protein COCHEDRAFT_1075...    77   1e-12   
gi|70996376|ref|XP_752943.1| anaphase promoting complex subunit ...    77   1e-12   
gi|336468027|gb|EGO56190.1| hypothetical protein NEUTE1DRAFT_447...    77   1e-12   
gi|169767246|ref|XP_001818094.1| anaphase promoting complex subu...    77   1e-12   
gi|167524537|ref|XP_001746604.1| hypothetical protein [Monosiga ...    77   1e-12   
gi|378728396|gb|EHY54855.1| anaphase-promoting complex component...    77   1e-12   
gi|482808543|gb|EOA85476.1| hypothetical protein SETTUDRAFT_1550...    77   1e-12   
gi|212531751|ref|XP_002146032.1| anaphase promoting complex subu...    77   1e-12   
gi|240274525|gb|EER38041.1| anaphase-promoting complex subunit [...    77   1e-12   
gi|169599260|ref|XP_001793053.1| hypothetical protein SNOG_02449...    77   1e-12   
gi|119494715|ref|XP_001264173.1| anaphase promoting complex subu...    77   2e-12   
gi|367013850|ref|XP_003681425.1| hypothetical protein TDEL_0D063...    77   2e-12   
gi|124805930|ref|XP_001350578.1| anaphase promoting complex subu...    76   3e-12   
gi|389629068|ref|XP_003712187.1| anaphase-promoting complex subu...    76   3e-12   
gi|402078302|gb|EJT73567.1| anaphase-promoting complex subunit 1...    76   3e-12   
gi|400600133|gb|EJP67824.1| anaphase-promoting complex subunit 1...    76   3e-12   
gi|255717591|ref|XP_002555076.1| KLTH0G00836p [Lachancea thermot...    76   3e-12   
gi|478270088|gb|ENN83455.1| hypothetical protein YQE_00187, part...    76   4e-12   
gi|12718366|emb|CAC28560.1| related to anaphase promoting comple...    76   4e-12   
gi|226295171|gb|EEH50591.1| conserved hypothetical protein [Para...    76   4e-12   
gi|225677672|gb|EEH15956.1| anaphase-promoting complex subunit 1...    76   4e-12   
gi|295664092|ref|XP_002792598.1| conserved hypothetical protein ...    75   4e-12   
gi|171683830|ref|XP_001906857.1| hypothetical protein [Podospora...    75   4e-12   
gi|164423406|ref|XP_963592.2| hypothetical protein NCU08731 [Neu...    75   5e-12   
gi|255941728|ref|XP_002561633.1| Pc16g13340 [Penicillium chrysog...    75   5e-12   
gi|367007228|ref|XP_003688344.1| hypothetical protein TPHA_0N012...    75   6e-12   
gi|239612712|gb|EEQ89699.1| anaphase promoting complex subunit 1...    75   7e-12   
gi|327351785|gb|EGE80642.1| anaphase promoting complex subunit 1...    75   7e-12   
gi|70949173|ref|XP_744022.1| hypothetical protein [Plasmodium ch...    75   7e-12   
gi|261191414|ref|XP_002622115.1| anaphase promoting complex subu...    75   7e-12   
gi|146418868|ref|XP_001485399.1| hypothetical protein PGUG_03128...    74   1e-11   
gi|399172200|emb|CCE26885.1| related to anaphase promoting compl...    74   1e-11   
gi|190346852|gb|EDK39030.2| hypothetical protein PGUG_03128 [Mey...    74   1e-11   
gi|341039056|gb|EGS24048.1| anaphase promoting complex subunit 1...    74   1e-11   
gi|325090863|gb|EGC44173.1| anaphase-promoting complex subunit 1...    74   1e-11   
gi|367034518|ref|XP_003666541.1| hypothetical protein MYCTH_2311...    74   1e-11   
gi|225561420|gb|EEH09700.1| anaphase-promoting complex subunit [...    74   1e-11   
gi|68075889|ref|XP_679864.1| hypothetical protein [Plasmodium be...    73   2e-11   
gi|501751974|emb|CCG83969.1| protein of unknown function [Taphri...    73   2e-11   
gi|254583211|ref|XP_002499337.1| ZYRO0E09416p [Zygosaccharomyces...    72   4e-11   
gi|344228546|gb|EGV60432.1| hypothetical protein CANTEDRAFT_1276...    72   4e-11   
gi|441624590|ref|XP_004089004.1| PREDICTED: anaphase-promoting c...    72   4e-11   
gi|82541677|ref|XP_725062.1| hypothetical protein [Plasmodium yo...    72   6e-11   
gi|221061363|ref|XP_002262251.1| hypothetical protein, conserved...    72   7e-11   


>gi|170049407|ref|XP_001855904.1| anaphase-promoting complex subunit 10 [Culex quinquefasciatus]
 gi|167871257|gb|EDS34640.1| anaphase-promoting complex subunit 10 [Culex quinquefasciatus]
          Length = 185

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 75/103 (72%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + G      SE +   +RE+GS A+WSLSS K G GV++LRD++  TYWQSDG LPHL
Sbjct: 2   SVKTGANLCPTSEERSGNVREVGSQAVWSLSSCKPGFGVEQLRDNSMETYWQSDGQLPHL 61

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           VNIQFP+K  V QI ++ +YK DESYTP++I+IR GTH  DLQ
Sbjct: 62  VNIQFPRKTTVSQIFIYSDYKLDESYTPSRISIRCGTHFNDLQ 104



>gi|157117126|ref|XP_001652947.1| anaphase-promoting complex [Aedes aegypti]
 gi|108876148|gb|EAT40373.1| AAEL007871-PA [Aedes aegypti]
          Length = 185

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 75/103 (72%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + G      +E +   +RE+GS A+WSLSS K G GV++LRD++  TYWQSDG LPHL
Sbjct: 2   SVKTGANVCPTTEERSGSVREVGSQAVWSLSSCKPGFGVEQLRDNSMETYWQSDGQLPHL 61

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           VNIQFP+K  V QI ++ +YK DESYTP++I+IR GTH  DLQ
Sbjct: 62  VNIQFPRKTTVSQIYIYSDYKLDESYTPSRISIRCGTHFNDLQ 104



>gi|168015724|ref|XP_001760400.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162688414|gb|EDQ74791.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 185

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/86 (63%), Positives = 70/86 (81%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E REIG  A W++SS K GNGV+ LRD+N LTYWQSDG+ PHLVNIQFP+KV + Q++L+
Sbjct: 20  EKREIGKLAAWTVSSNKPGNGVEMLRDNNLLTYWQSDGSQPHLVNIQFPKKVRLQQVALF 79

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
           +++K DESYTPNKI+IRAG    DL+
Sbjct: 80  VDFKVDESYTPNKISIRAGNSFHDLR 105



>gi|114051628|ref|NP_001040166.1| anaphase promoting complex subunit 10 [Bombyx mori]
 gi|87248261|gb|ABD36183.1| anaphase promoting complex subunit 10 [Bombyx mori]
          Length = 182

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G G+D+LRDD   TYWQSDG LPHLVNIQF +K  V  I ++ 
Sbjct: 17  VREVGNHAIWSLSSCKPGFGIDQLRDDCMETYWQSDGQLPHLVNIQFQKKTMVSHIYIYT 76

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IRAGTH  DLQ
Sbjct: 77  DYKLDESYTPSRISIRAGTHFNDLQ 101



>gi|158300919|ref|XP_320716.4| AGAP011799-PA [Anopheles gambiae str. PEST]
 gi|157013391|gb|EAA00431.4| AGAP011799-PA [Anopheles gambiae str. PEST]
          Length = 185

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 54/85 (63%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G  A+WSLSS K G GVD+LRD++  TYWQSDG LPHLVNIQF +K  V QI ++ 
Sbjct: 20  VREVGGQAVWSLSSCKPGFGVDQLRDNSMETYWQSDGQLPHLVNIQFHRKTTVSQIYIYS 79

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR GTH  DLQ
Sbjct: 80  DYKLDESYTPSRISIRCGTHFNDLQ 104



>gi|357619554|gb|EHJ72080.1| anaphase promoting complex subunit 10 [Danaus plexippus]
          Length = 181

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G G+D+LRDD   TYWQSDG LPHLVNIQF +K  V  I ++ 
Sbjct: 16  VREVGNHAIWSLSSCKPGFGIDQLRDDCMDTYWQSDGQLPHLVNIQFQRKTMVSHIYIYT 75

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IRAGTH  DLQ
Sbjct: 76  DYKLDESYTPSRISIRAGTHFNDLQ 100



>gi|66531676|ref|XP_396738.2| PREDICTED: anaphase-promoting complex subunit 10-like [Apis
           mellifera]
          Length = 186

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + GE   I+ E     +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHL
Sbjct: 2   SNKTGEIDPIQKELAGR-VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHL 60

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           VNIQF +K  +  I ++ +YK DESYTP++I+IRAGT+  DLQ
Sbjct: 61  VNIQFKRKTTICDICIYTDYKLDESYTPSRISIRAGTNFNDLQ 103



>gi|193606239|ref|XP_001950033.1| PREDICTED: anaphase-promoting complex subunit 10-like
           [Acyrthosiphon pisum]
          Length = 188

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/85 (63%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+GS AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  V  I +++
Sbjct: 26  VREVGSQAIWSLSSCKPGFGVDQLRDDCMETYWQSDGQLPHLVNIQFRRKTVVRDICIYI 85

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +Y+ DESYTP +I++RAGT+  DLQ
Sbjct: 86  DYRLDESYTPGRISVRAGTNFNDLQ 110



>gi|298711511|emb|CBJ26599.1| Putative subunit of the Anaphase Promoting Complex [Ectocarpus
           siliculosus]
          Length = 210

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/97 (58%), Positives = 71/97 (73%)

Query: 35  ERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQF 94
           E K   SE  +   REIG  A+WSLSS K GNGVD+LRDD+  TYWQSDG  PHL+NIQF
Sbjct: 16  EAKTEASELDYVTRREIGREAVWSLSSAKPGNGVDQLRDDSTDTYWQSDGGQPHLINIQF 75

Query: 95  PQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDL 131
            +K+ VV+I+  L++ SDESYTP K++IRAG+   DL
Sbjct: 76  HKKMTVVEIAFHLDFSSDESYTPKKLSIRAGSSFHDL 112



>gi|478253336|gb|ENN73697.1| hypothetical protein YQE_09694, partial [Dendroctonus ponderosae]
          Length = 644

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G  AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 20  VREVGCQAIWSLSSCKPGFGVDQLRDDRADTYWQSDGQLPHLVNIQFQRKTTISDIYIYT 79

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR GTH  D+Q
Sbjct: 80  DYKLDESYTPSRISIRVGTHFNDIQ 104



>gi|507686390|ref|XP_004640766.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Octodon degus]
          Length = 185

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/85 (63%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           NYKSDESYTP+KI++R G +  +LQ
Sbjct: 82  NYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|380023096|ref|XP_003695365.1| PREDICTED: anaphase-promoting complex subunit 10-like [Apis florea]
          Length = 186

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + GE   I+ E     +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHL
Sbjct: 2   SNKTGEIDPIQEELAGR-VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHL 60

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           VNIQF +K  +  I ++ +YK DESYTP++I+IRAGT+  DLQ
Sbjct: 61  VNIQFKRKTTIRDICIYTDYKLDESYTPSRISIRAGTNFNDLQ 103



>gi|72013135|ref|XP_783681.1| PREDICTED: anaphase-promoting complex subunit 10-like
           [Strongylocentrotus purpuratus]
          Length = 182

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (73%)

Query: 37  KIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQ 96
           KI   +     LREIGS A+WSLSS K G GVD+LRD++  TYWQSDG  PHLVNIQF +
Sbjct: 7   KIDDVDLTTTGLREIGSQAVWSLSSCKPGFGVDQLRDNSTDTYWQSDGIQPHLVNIQFRR 66

Query: 97  KVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           K  V  ++L+ ++KSDESYTPNKI++RAG +  DLQ
Sbjct: 67  KTTVHSVALYADFKSDESYTPNKISVRAGNNFHDLQ 102



>gi|291239008|ref|XP_002739417.1| PREDICTED: anaphase promoting complex subunit 10-like [Saccoglossus
           kowalevskii]
          Length = 179

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 53/86 (61%), Positives = 68/86 (79%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++REIGS A+WSLSS K G GVD+LRD +  TYWQSDGT PHLVNIQF +K  + ++ ++
Sbjct: 15  KIREIGSQAVWSLSSCKPGFGVDQLRDGSLETYWQSDGTQPHLVNIQFRRKTTLNRLCIY 74

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
            +YK+DESYTPNKI++R G H  DLQ
Sbjct: 75  ADYKADESYTPNKISVRIGNHFHDLQ 100



>gi|307195501|gb|EFN77387.1| Anaphase-promoting complex subunit 10 [Harpegnathos saltator]
          Length = 189

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNYAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTPN+I+IRAGT+  DLQ
Sbjct: 82  DYKLDESYTPNRISIRAGTNFNDLQ 106



>gi|332375763|gb|AEE63022.1| unknown [Dendroctonus ponderosae]
          Length = 185

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/94 (59%), Positives = 71/94 (75%), Gaps = 1/94 (1%)

Query: 39  IKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKV 98
           IK+E ++  +RE+G  AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K 
Sbjct: 12  IKNE-RNGSVREVGCQAIWSLSSCKPGFGVDQLRDDRADTYWQSDGQLPHLVNIQFQRKT 70

Query: 99  NVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
            +  I ++ +YK DESYTP++I+IR GTH  D+Q
Sbjct: 71  TISDIYIYTDYKLDESYTPSRISIRVGTHFNDIQ 104



>gi|506968775|gb|AGM32731.1| APC10 subunit of the anaphase-promoting complex (APC) [Coptotermes
           formosanus]
          Length = 186

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/91 (62%), Positives = 70/91 (76%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVV 101
           E +  ++RE+GS AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  V 
Sbjct: 15  EERAGKVREVGSQAIWSLSSCKPGFGVDQLRDDCTDTYWQSDGQLPHLVNIQFRRKTTVH 74

Query: 102 QISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
            I ++ +YK DESYTP++I+IRAGT+  DLQ
Sbjct: 75  DIFIFTDYKLDESYTPSRISIRAGTNFNDLQ 105



>gi|332016291|gb|EGI57204.1| Anaphase-promoting complex subunit 10 [Acromyrmex echinatior]
          Length = 189

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNYAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTPN+I+IRAGT+  DLQ
Sbjct: 82  DYKLDESYTPNRISIRAGTNFNDLQ 106



>gi|322799261|gb|EFZ20652.1| hypothetical protein SINV_01375 [Solenopsis invicta]
          Length = 189

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNYAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTPN+I+IRAGT+  DLQ
Sbjct: 82  DYKLDESYTPNRISIRAGTNFNDLQ 106



>gi|307191142|gb|EFN74840.1| Anaphase-promoting complex subunit 10 [Camponotus floridanus]
          Length = 189

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNYAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTPN+I+IRAGT+  DLQ
Sbjct: 82  DYKLDESYTPNRISIRAGTNFNDLQ 106



>gi|443684651|gb|ELT88523.1| hypothetical protein CAPTEDRAFT_162347 [Capitella teleta]
          Length = 185

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (77%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           +LRE+G  A+WSLSS K G GVD+LRD +  TYWQSDG  PHLVNIQF +K+ +  I ++
Sbjct: 21  KLREVGGQAVWSLSSCKAGFGVDQLRDGSLDTYWQSDGPQPHLVNIQFRRKMTIQDICIY 80

Query: 107 LNYKSDESYTPNKITIRAGTHNGDL 131
            +YK+DESYTPN+I+IRAG H  DL
Sbjct: 81  ADYKADESYTPNRISIRAGNHFNDL 105



>gi|297293455|ref|XP_001094665.2| PREDICTED: anaphase-promoting complex subunit 10 isoform 4 [Macaca
           mulatta]
          Length = 223

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 60  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 119

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 120 DYKSDESYTPSKISVRVGNNFHNLQ 144



>gi|119625457|gb|EAX05052.1| anaphase promoting complex subunit 10, isoform CRA_b [Homo sapiens]
          Length = 223

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 60  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 119

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 120 DYKSDESYTPSKISVRVGNNFHNLQ 144



>gi|383859168|ref|XP_003705068.1| PREDICTED: anaphase-promoting complex subunit 10-like [Megachile
           rotundata]
          Length = 189

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/85 (63%), Positives = 68/85 (80%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K+ +  I ++ 
Sbjct: 22  VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKITIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IRAGT+  DLQ
Sbjct: 82  DYKLDESYTPSRISIRAGTNFNDLQ 106



>gi|260806773|ref|XP_002598258.1| hypothetical protein BRAFLDRAFT_119142 [Branchiostoma floridae]
 gi|229283530|gb|EEN54270.1| hypothetical protein BRAFLDRAFT_119142 [Branchiostoma floridae]
          Length = 181

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/86 (62%), Positives = 66/86 (76%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++REIG  A+WS+SS K G GVD+LRD +  TYWQSDG  PHLVNIQF +K  V  + L+
Sbjct: 19  KVREIGDLAVWSVSSCKPGFGVDQLRDGSLDTYWQSDGPQPHLVNIQFRKKTAVKSLCLY 78

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
            +YKSDESYTPN+I+IR GTH  DLQ
Sbjct: 79  ADYKSDESYTPNRISIRTGTHFHDLQ 104



>gi|242006722|ref|XP_002424196.1| anaphase-promoting complex subunit, putative [Pediculus humanus
           corporis]
 gi|212507537|gb|EEB11458.1| anaphase-promoting complex subunit, putative [Pediculus humanus
           corporis]
          Length = 187

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 71/92 (77%)

Query: 41  SEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           +E +  ++RE+GS AIWSLSS K   GVD+LRD+   TYWQSDG LPHLVNIQF +K  V
Sbjct: 15  TEERAGKVREVGSHAIWSLSSCKPSFGVDQLRDNCMETYWQSDGQLPHLVNIQFRKKTTV 74

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
             I ++++YK DESYTP++I++RAGT+  DLQ
Sbjct: 75  QDICIYIDYKLDESYTPSRISVRAGTNFTDLQ 106



>gi|512934663|ref|XP_004907714.1| PREDICTED: anaphase-promoting complex subunit 10 [Heterocephalus
           glaber]
 gi|513015250|ref|XP_004868965.1| PREDICTED: anaphase-promoting complex subunit 10 [Heterocephalus
           glaber]
          Length = 196

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 33  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 92

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 93  DYKSDESYTPSKISVRVGNNFHNLQ 117



>gi|332217333|ref|XP_003257814.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2
           [Nomascus leucogenys]
          Length = 196

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 33  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 92

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 93  DYKSDESYTPSKISVRVGNNFHNLQ 117



>gi|35900980|ref|NP_081180.1| anaphase-promoting complex subunit 10 [Mus musculus]
 gi|157823281|ref|NP_001101915.1| anaphase-promoting complex subunit 10 [Rattus norvegicus]
 gi|354477204|ref|XP_003500812.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cricetulus
           griseus]
 gi|34395503|sp|Q8K2H6.1|APC10_MOUSE RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|21618682|gb|AAH31460.1| Anaphase promoting complex subunit 10 [Mus musculus]
 gi|26334441|dbj|BAC30921.1| unnamed protein product [Mus musculus]
 gi|148678930|gb|EDL10877.1| anaphase promoting complex subunit 10, isoform CRA_a [Mus musculus]
 gi|149037945|gb|EDL92305.1| anaphase promoting complex subunit 10 (predicted) [Rattus
           norvegicus]
 gi|197245971|gb|AAI68746.1| Anaphase promoting complex subunit 10 [Rattus norvegicus]
 gi|344244110|gb|EGW00214.1| Anaphase-promoting complex subunit 10 [Cricetulus griseus]
          Length = 185

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|507705099|ref|XP_004645503.1| PREDICTED: anaphase-promoting complex subunit 10 [Octodon degus]
          Length = 196

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 33  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 92

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 93  DYKSDESYTPSKISVRVGNNFHNLQ 117



>gi|291401170|ref|XP_002716972.1| PREDICTED: anaphase promoting complex subunit 10 [Oryctolagus
           cuniculus]
          Length = 194

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 31  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 90

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 91  DYKSDESYTPSKISVRVGNNFHNLQ 115



>gi|301096061|ref|XP_002897129.1| anaphase-promoting complex subunit 10 [Phytophthora infestans
           T30-4]
 gi|262107448|gb|EEY65500.1| anaphase-promoting complex subunit 10 [Phytophthora infestans
           T30-4]
          Length = 178

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 52/84 (61%), Positives = 67/84 (79%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           RE+G  A+WSLSS K GNGVD+LRDDN  TYWQSDG  PHL+NIQF +K+ + +++L+L+
Sbjct: 12  REVGDDAMWSLSSAKPGNGVDQLRDDNMDTYWQSDGVQPHLINIQFARKMVIKEVALYLD 71

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           YK DESYTP KI IR+G+   DL+
Sbjct: 72  YKLDESYTPKKIAIRSGSTVHDLK 95



>gi|224049376|ref|XP_002188840.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1
           [Taeniopygia guttata]
 gi|449499904|ref|XP_004175396.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2
           [Taeniopygia guttata]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|148678931|gb|EDL10878.1| anaphase promoting complex subunit 10, isoform CRA_b [Mus musculus]
          Length = 111

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|56605928|ref|NP_001008467.1| anaphase-promoting complex subunit 10 [Gallus gallus]
 gi|53130520|emb|CAG31589.1| hypothetical protein RCJMB04_8g15 [Gallus gallus]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|149635632|ref|XP_001514225.1| PREDICTED: anaphase-promoting complex subunit 10-like
           [Ornithorhynchus anatinus]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|147899801|ref|NP_001089271.1| anaphase promoting complex subunit 10 [Xenopus laevis]
 gi|58702062|gb|AAH90191.1| MGC85037 protein [Xenopus laevis]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKALCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|62858451|ref|NP_001016392.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
 gi|89273769|emb|CAJ82095.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
 gi|169642211|gb|AAI60495.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
 gi|213624324|gb|AAI70941.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
 gi|213627011|gb|AAI70586.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKALCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|295444976|ref|NP_001171398.1| anaphase promoting complex subunit 10 protein [Sus scrofa]
 gi|293633213|gb|ADE60007.1| anaphase promoting complex subunit 10 protein [Sus scrofa]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|326918378|ref|XP_003205466.1| PREDICTED: anaphase-promoting complex subunit 10-like [Meleagris
           gallopavo]
 gi|449271299|gb|EMC81759.1| Anaphase-promoting complex subunit 10 [Columba livia]
 gi|483519027|gb|EOB04971.1| Anaphase-promoting complex subunit 10, partial [Anas platyrhynchos]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|505792795|ref|XP_004606254.1| PREDICTED: anaphase-promoting complex subunit 10 [Sorex araneus]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|4836700|gb|AAD30527.1| anaphase promoting complex subunit 10 [Homo sapiens]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|150170706|ref|NP_055700.2| anaphase-promoting complex subunit 10 isoform 1 [Homo sapiens]
 gi|375493577|ref|NP_001243635.1| anaphase-promoting complex subunit 10 isoform 1 [Homo sapiens]
 gi|375493580|ref|NP_001243636.1| anaphase-promoting complex subunit 10 isoform 1 [Homo sapiens]
 gi|375493583|ref|NP_001243637.1| anaphase-promoting complex subunit 10 isoform 1 [Homo sapiens]
 gi|57096819|ref|XP_532678.1| PREDICTED: anaphase-promoting complex subunit 10 [Canis lupus
           familiaris]
 gi|149698187|ref|XP_001502007.1| PREDICTED: anaphase-promoting complex subunit 10-like [Equus
           caballus]
 gi|301761716|ref|XP_002916280.1| PREDICTED: anaphase-promoting complex subunit 10-like [Ailuropoda
           melanoleuca]
 gi|332217331|ref|XP_003257813.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1
           [Nomascus leucogenys]
 gi|332217337|ref|XP_003257816.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 4
           [Nomascus leucogenys]
 gi|332820471|ref|XP_003310583.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Pan
           troglodytes]
 gi|332820475|ref|XP_003310584.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 3 [Pan
           troglodytes]
 gi|344291652|ref|XP_003417548.1| PREDICTED: anaphase-promoting complex subunit 10-like [Loxodonta
           africana]
 gi|390460386|ref|XP_002745363.2| PREDICTED: anaphase-promoting complex subunit 10 [Callithrix
           jacchus]
 gi|395834503|ref|XP_003790240.1| PREDICTED: anaphase-promoting complex subunit 10 [Otolemur
           garnettii]
 gi|397489753|ref|XP_003815883.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Pan
           paniscus]
 gi|397489755|ref|XP_003815884.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Pan
           paniscus]
 gi|397489759|ref|XP_003815886.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 4 [Pan
           paniscus]
 gi|397489761|ref|XP_003815887.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 5 [Pan
           paniscus]
 gi|402870555|ref|XP_003899279.1| PREDICTED: anaphase-promoting complex subunit 10 [Papio anubis]
 gi|402870557|ref|XP_003899280.1| PREDICTED: anaphase-promoting complex subunit 10 [Papio anubis]
 gi|403272412|ref|XP_003928059.1| PREDICTED: anaphase-promoting complex subunit 10 [Saimiri
           boliviensis boliviensis]
 gi|403272414|ref|XP_003928060.1| PREDICTED: anaphase-promoting complex subunit 10 [Saimiri
           boliviensis boliviensis]
 gi|410038750|ref|XP_003950466.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
 gi|410038755|ref|XP_003950468.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
 gi|410956799|ref|XP_003985025.1| PREDICTED: anaphase-promoting complex subunit 10 [Felis catus]
 gi|426246995|ref|XP_004017272.1| PREDICTED: anaphase-promoting complex subunit 10 [Ovis aries]
 gi|426345585|ref|XP_004040486.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Gorilla
           gorilla gorilla]
 gi|426345589|ref|XP_004040488.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 3 [Gorilla
           gorilla gorilla]
 gi|426345591|ref|XP_004040489.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 4 [Gorilla
           gorilla gorilla]
 gi|465972469|ref|XP_004263651.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Orcinus
           orca]
 gi|465972474|ref|XP_004263652.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Orcinus
           orca]
 gi|470614106|ref|XP_004316567.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1
           [Tursiops truncatus]
 gi|470614108|ref|XP_004316568.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2
           [Tursiops truncatus]
 gi|471382251|ref|XP_004378911.1| PREDICTED: anaphase-promoting complex subunit 10 [Trichechus
           manatus latirostris]
 gi|472384915|ref|XP_004411824.1| PREDICTED: anaphase-promoting complex subunit 10 [Odobenus rosmarus
           divergens]
 gi|478493164|ref|XP_004420937.1| PREDICTED: anaphase-promoting complex subunit 10 [Ceratotherium
           simum simum]
 gi|488529577|ref|XP_004456572.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Dasypus
           novemcinctus]
 gi|488529579|ref|XP_004456573.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Dasypus
           novemcinctus]
 gi|504151718|ref|XP_004588194.1| PREDICTED: anaphase-promoting complex subunit 10 [Ochotona
           princeps]
 gi|507543845|ref|XP_004655906.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X1
           [Jaculus jaculus]
 gi|507955687|ref|XP_004685358.1| PREDICTED: anaphase-promoting complex subunit 10 [Condylura
           cristata]
 gi|511876110|ref|XP_004758050.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X1
           [Mustela putorius furo]
 gi|511876112|ref|XP_004758051.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X2
           [Mustela putorius furo]
 gi|511968440|ref|XP_004802301.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X1
           [Mustela putorius furo]
 gi|511968442|ref|XP_004802302.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X2
           [Mustela putorius furo]
 gi|34395509|sp|Q9UM13.1|APC10_HUMAN RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|6463666|dbj|BAA86953.1| APC10 [Homo sapiens]
 gi|13528834|gb|AAH05217.1| ANAPC10 protein [Homo sapiens]
 gi|83026423|gb|ABB96248.1| anaphase promoting complex subunit 10 [Homo sapiens]
 gi|119625455|gb|EAX05050.1| anaphase promoting complex subunit 10, isoform CRA_a [Homo sapiens]
 gi|119625456|gb|EAX05051.1| anaphase promoting complex subunit 10, isoform CRA_a [Homo sapiens]
 gi|281354080|gb|EFB29664.1| hypothetical protein PANDA_004341 [Ailuropoda melanoleuca]
 gi|296478783|tpg|DAA20898.1| TPA: anaphase-promoting complex subunit 10 [Bos taurus]
 gi|306921421|dbj|BAJ17790.1| anaphase promoting complex subunit 10 [synthetic construct]
 gi|325464375|gb|ADZ15958.1| anaphase promoting complex subunit 10 [synthetic construct]
 gi|351714538|gb|EHB17457.1| Anaphase-promoting complex subunit 10 [Heterocephalus glaber]
 gi|432114070|gb|ELK36117.1| Anaphase-promoting complex subunit 10 [Myotis davidii]
 gi|440894891|gb|ELR47215.1| Anaphase-promoting complex subunit 10 [Bos grunniens mutus]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|90085633|dbj|BAE91557.1| unnamed protein product [Macaca fascicularis]
          Length = 119

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|327273880|ref|XP_003221707.1| PREDICTED: anaphase-promoting complex subunit 10-like [Anolis
           carolinensis]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|126331333|ref|XP_001367156.1| PREDICTED: anaphase-promoting complex subunit 10-like [Monodelphis
           domestica]
 gi|395542601|ref|XP_003773215.1| PREDICTED: anaphase-promoting complex subunit 10 [Sarcophilus
           harrisii]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|340729497|ref|XP_003403037.1| PREDICTED: anaphase-promoting complex subunit 10-like [Bombus
           terrestris]
 gi|350411580|ref|XP_003489394.1| PREDICTED: anaphase-promoting complex subunit 10-like [Bombus
           impatiens]
          Length = 189

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 58/99 (58%), Positives = 72/99 (72%), Gaps = 1/99 (1%)

Query: 34  GERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQ 93
           GE   I+ E     +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQ
Sbjct: 9   GEIDPIQEELAGR-VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQ 67

Query: 94  FPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           F +K  +  I ++ +YK DESYTP++I+IRAGT+  DLQ
Sbjct: 68  FKRKTTIRDICIYTDYKLDESYTPSRISIRAGTNFNDLQ 106



>gi|91081555|ref|XP_975078.1| PREDICTED: similar to anaphase promoting complex subunit 10
           [Tribolium castaneum]
 gi|270005121|gb|EFA01569.1| hypothetical protein TcasGA2_TC007130 [Tribolium castaneum]
          Length = 185

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (77%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+GS AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVN+QF +K  +  I ++ 
Sbjct: 20  VREVGSQAIWSLSSCKPGFGVDQLRDDRDDTYWQSDGQLPHLVNVQFQRKTTISDIYIYT 79

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR G+H  DLQ
Sbjct: 80  DYKLDESYTPSRISIRVGSHFNDLQ 104



>gi|375493585|ref|NP_001243638.1| anaphase-promoting complex subunit 10 isoform 2 [Homo sapiens]
 gi|397489757|ref|XP_003815885.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 3 [Pan
           paniscus]
 gi|410038752|ref|XP_003950467.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
 gi|426345587|ref|XP_004040487.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Gorilla
           gorilla gorilla]
          Length = 196

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 33  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 92

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 93  DYKSDESYTPSKISVRVGNNFHNLQ 117



>gi|332820473|ref|XP_001141102.2| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Pan
           troglodytes]
 gi|426345593|ref|XP_004040490.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 5 [Gorilla
           gorilla gorilla]
          Length = 219

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 56  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 115

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 116 DYKSDESYTPSKISVRVGNNFHNLQ 140



>gi|5262509|emb|CAB45705.1| hypothetical protein [Homo sapiens]
 gi|190689587|gb|ACE86568.1| anaphase promoting complex subunit 10 protein [synthetic construct]
 gi|190690951|gb|ACE87250.1| anaphase promoting complex subunit 10 protein [synthetic construct]
          Length = 185

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|507671085|ref|XP_004708754.1| PREDICTED: anaphase-promoting complex subunit 10 [Echinops
           telfairi]
          Length = 185

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|410038764|ref|XP_003950472.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
 gi|426345601|ref|XP_004040494.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 9 [Gorilla
           gorilla gorilla]
 gi|441619206|ref|XP_004088558.1| PREDICTED: anaphase-promoting complex subunit 10 [Nomascus
           leucogenys]
          Length = 110

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|402870559|ref|XP_003899281.1| PREDICTED: anaphase-promoting complex subunit 10 [Papio anubis]
          Length = 219

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 56  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 115

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 116 DYKSDESYTPSKISVRVGNNFHNLQ 140



>gi|348582258|ref|XP_003476893.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cavia
           porcellus]
          Length = 185

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|148234881|ref|NP_001089057.1| uncharacterized protein LOC595046 [Xenopus laevis]
 gi|57870661|gb|AAH89086.1| LOC595046 protein [Xenopus laevis]
          Length = 185

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKALCVYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|375493587|ref|NP_001243639.1| anaphase-promoting complex subunit 10 isoform 3 [Homo sapiens]
 gi|375493589|ref|NP_001243640.1| anaphase-promoting complex subunit 10 isoform 3 [Homo sapiens]
          Length = 114

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|410038762|ref|XP_003950471.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
          Length = 126

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|332217335|ref|XP_003257815.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 3
           [Nomascus leucogenys]
          Length = 219

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 56  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 115

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 116 DYKSDESYTPSKISVRVGNNFHNLQ 140



>gi|499050789|ref|XP_004575911.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X1
           [Maylandia zebra]
          Length = 202

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|16975123|pdb|1JHJ|A Chain A, Crystal Structure Of The Apc10DOC1 SUBUNIT OF THE HUMAN
           Anaphase-Promoting Complex
          Length = 171

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 21  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 80

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 81  DYKSDESYTPSKISVRVGNNFHNLQ 105



>gi|432918759|ref|XP_004079652.1| PREDICTED: anaphase-promoting complex subunit 10-like [Oryzias
           latipes]
          Length = 186

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|47209318|emb|CAF92702.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 186

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|312377680|gb|EFR24453.1| hypothetical protein AND_10959 [Anopheles darlingi]
          Length = 185

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (70%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + G      SE +   +RE+G  A+WSLSS K G GVD+LRD++  TYWQSDG LPHL
Sbjct: 2   SVKTGANVCPLSEERSGSVREVGEHAVWSLSSCKPGFGVDQLRDNSTETYWQSDGQLPHL 61

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           V+IQF Q  +V QI ++ +YK DESYTP++I+IR GTH  DLQ
Sbjct: 62  VSIQFHQMTSVSQIYIYSDYKLDESYTPSRISIRRGTHFNDLQ 104



>gi|426345599|ref|XP_004040493.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 8 [Gorilla
           gorilla gorilla]
          Length = 126

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|348538028|ref|XP_003456494.1| PREDICTED: anaphase-promoting complex subunit 10-like [Oreochromis
           niloticus]
 gi|499050791|ref|XP_004575912.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Maylandia zebra]
          Length = 186

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|426345597|ref|XP_004040492.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 7 [Gorilla
           gorilla gorilla]
          Length = 142

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|156549338|ref|XP_001601344.1| PREDICTED: anaphase-promoting complex subunit 10-like [Nasonia
           vitripennis]
          Length = 189

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/85 (63%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFRRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IRAGT+  DLQ
Sbjct: 82  DYKLDESYTPSRISIRAGTNFNDLQ 106



>gi|410038760|ref|XP_003950470.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
          Length = 142

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|412992797|emb|CCO18777.1| anaphase promoting complex subunit 10 [Bathycoccus prasinos]
          Length = 397

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/85 (58%), Positives = 63/85 (74%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIG  A+WS++S K GNGV+ LRD N  TYWQSDG  PH +N QF +K NV ++S++ 
Sbjct: 203 VREIGDEAVWSVTSSKPGNGVELLRDGNLKTYWQSDGAQPHFINCQFQKKTNVCEVSIYT 262

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           NYK DESYTP+KI IRAG    DL+
Sbjct: 263 NYKQDESYTPSKIVIRAGNSYRDLK 287



>gi|410930143|ref|XP_003978458.1| PREDICTED: anaphase-promoting complex subunit 10-like [Takifugu
           rubripes]
          Length = 182

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|390608650|ref|NP_001254625.1| anaphase promoting complex subunit 10 [Danio rerio]
 gi|390608652|ref|NP_001254626.1| anaphase promoting complex subunit 10 [Danio rerio]
          Length = 185

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP++I++R G +  +LQ
Sbjct: 82  DYKSDESYTPSRISVRVGNNFHNLQ 106



>gi|195455839|ref|XP_002074889.1| GK23298 [Drosophila willistoni]
 gi|194170974|gb|EDW85875.1| GK23298 [Drosophila willistoni]
          Length = 197

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 72/92 (78%)

Query: 41  SEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           SE +   +RE+GS A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+
Sbjct: 25  SEERLGGVREVGSQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNI 84

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
            QI ++ +YK DESYTP++I+IR+GT+  DLQ
Sbjct: 85  SQIYIYTDYKLDESYTPSRISIRSGTNFNDLQ 116



>gi|195382745|ref|XP_002050089.1| GJ21948 [Drosophila virilis]
 gi|194144886|gb|EDW61282.1| GJ21948 [Drosophila virilis]
          Length = 197

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+GS A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGSQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR+GT+  DLQ
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQ 114



>gi|195123817|ref|XP_002006398.1| GI21024 [Drosophila mojavensis]
 gi|193911466|gb|EDW10333.1| GI21024 [Drosophila mojavensis]
          Length = 197

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+GS A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGSQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR+GT+  DLQ
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQ 114



>gi|145529011|ref|XP_001450294.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124417905|emb|CAK82897.1| unnamed protein product [Paramecium tetraurelia]
          Length = 197

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/84 (59%), Positives = 68/84 (80%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           +EIG  AIW+LSS K GNGVD+LRDDN  T+WQSDGT PH + IQF +K+ V +++L+L+
Sbjct: 29  KEIGDQAIWTLSSAKTGNGVDQLRDDNLNTFWQSDGTQPHYITIQFLKKMRVQEVALYLD 88

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           +K DESYTPNK++IR GT+  D++
Sbjct: 89  FKQDESYTPNKLSIRTGTNIQDMK 112



>gi|122692361|ref|NP_001073826.1| anaphase-promoting complex subunit 10 [Bos taurus]
 gi|122138186|sp|Q2YDH1.1|APC10_BOVIN RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|82571514|gb|AAI10225.1| Anaphase promoting complex subunit 10 [Bos taurus]
          Length = 185

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVN+QF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNLQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQ 106



>gi|321458778|gb|EFX69840.1| hypothetical protein DAPPUDRAFT_300659 [Daphnia pulex]
          Length = 192

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/93 (56%), Positives = 69/93 (74%)

Query: 40  KSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVN 99
           K E K   + E+G  A+WSLSS K G G+D+LRDD+  TYWQSDG LPHLVNIQF +K  
Sbjct: 17  KKEEKEGSILEVGDQAVWSLSSCKAGFGIDQLRDDSTDTYWQSDGQLPHLVNIQFRKKTT 76

Query: 100 VVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           +  I ++ +YK+DESYTP++I++RAGT   DLQ
Sbjct: 77  IQNIWIFADYKADESYTPSRISVRAGTGFSDLQ 109



>gi|145510913|ref|XP_001441384.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124408634|emb|CAK73987.1| unnamed protein product [Paramecium tetraurelia]
          Length = 197

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/88 (56%), Positives = 72/88 (81%)

Query: 45  HEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQIS 104
           +++ +EIG  AIW+LSS K GNGVD+LRDDN  T+WQSDGT PH + IQF +K+ V +++
Sbjct: 25  NQQRKEIGDQAIWTLSSAKTGNGVDQLRDDNLNTFWQSDGTQPHNITIQFLKKMRVQEVA 84

Query: 105 LWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           ++L++K DESYTPNK++IRAGT+  D++
Sbjct: 85  VYLDFKQDESYTPNKLSIRAGTNIQDMK 112



>gi|405959727|gb|EKC25731.1| Anaphase-promoting complex subunit 10 [Crassostrea gigas]
          Length = 185

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/97 (55%), Positives = 71/97 (73%), Gaps = 1/97 (1%)

Query: 35  ERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQF 94
           E  I+K E +   LRE+G+ A+WSLSS K G GVD+L D+   TYWQSDG  PHLVNIQF
Sbjct: 10  EIDILKEE-REGRLREVGNQAVWSLSSCKPGFGVDQLLDNTVDTYWQSDGPQPHLVNIQF 68

Query: 95  PQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDL 131
            +K  +  + ++ +YK+DESYTPN+I++RAGTH  DL
Sbjct: 69  RRKTTIHDVCIYTDYKADESYTPNRISLRAGTHFNDL 105



>gi|195027301|ref|XP_001986522.1| GH20482 [Drosophila grimshawi]
 gi|193902522|gb|EDW01389.1| GH20482 [Drosophila grimshawi]
          Length = 197

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR+GT+  DLQ
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQ 114



>gi|28573741|ref|NP_611223.4| anaphase promoting complex subunit 10 [Drosophila melanogaster]
 gi|195335261|ref|XP_002034293.1| GM19974 [Drosophila sechellia]
 gi|195584242|ref|XP_002081923.1| GD25470 [Drosophila simulans]
 gi|34395510|sp|Q9V831.2|APC10_DROME RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|21406644|gb|AAL48829.2| RE25242p [Drosophila melanogaster]
 gi|28380763|gb|AAF57848.2| anaphase promoting complex subunit 10 [Drosophila melanogaster]
 gi|194126263|gb|EDW48306.1| GM19974 [Drosophila sechellia]
 gi|194193932|gb|EDX07508.1| GD25470 [Drosophila simulans]
 gi|220948260|gb|ACL86673.1| CG11419-PA [synthetic construct]
 gi|220957430|gb|ACL91258.1| CG11419-PA [synthetic construct]
          Length = 195

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR+GT+  DLQ
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQ 114



>gi|194880742|ref|XP_001974521.1| GG21047 [Drosophila erecta]
 gi|195487878|ref|XP_002092079.1| GE13990 [Drosophila yakuba]
 gi|190657708|gb|EDV54921.1| GG21047 [Drosophila erecta]
 gi|194178180|gb|EDW91791.1| GE13990 [Drosophila yakuba]
          Length = 195

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR+GT+  DLQ
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQ 114



>gi|125807963|ref|XP_001360579.1| GA10993 [Drosophila pseudoobscura pseudoobscura]
 gi|195150391|ref|XP_002016138.1| GL10659 [Drosophila persimilis]
 gi|54635751|gb|EAL25154.1| GA10993 [Drosophila pseudoobscura pseudoobscura]
 gi|194109985|gb|EDW32028.1| GL10659 [Drosophila persimilis]
          Length = 195

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR+GT+  DLQ
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQ 114



>gi|194755361|ref|XP_001959960.1| GF11781 [Drosophila ananassae]
 gi|190621258|gb|EDV36782.1| GF11781 [Drosophila ananassae]
          Length = 195

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I+IR+GT+  DLQ
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQ 114



>gi|391346994|ref|XP_003747750.1| PREDICTED: anaphase-promoting complex subunit 10-like [Metaseiulus
           occidentalis]
          Length = 209

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 68/91 (74%), Gaps = 1/91 (1%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVV 101
           EFK E  RE+G  A+WSLSS K G GVD+LRD+N  TYWQSDG  PHLVNIQF  K  V 
Sbjct: 39  EFKGEH-REVGDQAVWSLSSCKPGFGVDQLRDNNTETYWQSDGPQPHLVNIQFRHKTLVD 97

Query: 102 QISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
            ++++ ++K DESYTPN+I++R G+H  DLQ
Sbjct: 98  SVAIYTDFKLDESYTPNRISVRVGSHFHDLQ 128



>gi|348680677|gb|EGZ20493.1| hypothetical protein PHYSODRAFT_245966 [Phytophthora sojae]
          Length = 175

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (77%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G  A+WSLSS K GNGVD+LRD+N  TYWQSDG  PHL+NIQF +K  V +++L L
Sbjct: 10  MREVGDDAVWSLSSAKPGNGVDQLRDNNMDTYWQSDGVQPHLINIQFSRKTAVKEVALHL 69

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP KI IR+G+   DL+
Sbjct: 70  DYKLDESYTPKKIAIRSGSTVHDLK 94



>gi|145534794|ref|XP_001453141.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124420841|emb|CAK85744.1| unnamed protein product [Paramecium tetraurelia]
          Length = 195

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 50/84 (59%), Positives = 68/84 (80%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           +EIG  AIW+LSS K GNGVD+LRDDN  T+WQSDGT PH + IQF +K+ V +I+++L+
Sbjct: 29  KEIGDQAIWTLSSAKTGNGVDQLRDDNMNTFWQSDGTQPHYLTIQFLKKMRVQEIAIYLD 88

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           +K DESYTPNK++IR GT+  D++
Sbjct: 89  FKQDESYTPNKLSIRTGTNIQDMK 112



>gi|146184245|ref|XP_001028080.2| anaphase-promoting complex, subunit 10 [Tetrahymena thermophila]
 gi|146143314|gb|EAS07838.2| anaphase-promoting complex, subunit 10 [Tetrahymena thermophila
           SB210]
          Length = 189

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 50/84 (59%), Positives = 70/84 (83%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG  A+W+LSS K GNGVD+LRD +  T+WQSDG  PHL+NIQF +K+ V +++++L+
Sbjct: 21  REIGDDAVWTLSSAKPGNGVDQLRDGDEKTFWQSDGNQPHLINIQFLKKMRVQEVAMYLD 80

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           +K+DESYTP+KI+IRAGT+  DL+
Sbjct: 81  FKTDESYTPSKISIRAGTNLQDLK 104



>gi|355687635|gb|EHH26219.1| hypothetical protein EGK_16132 [Macaca mulatta]
          Length = 185

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (77%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI+ + G +  +LQ
Sbjct: 82  DYKSDESYTPSKISAKVGNNFHNLQ 106



>gi|193709423|ref|XP_001952000.1| PREDICTED: anaphase-promoting complex subunit 10-like
           [Acyrthosiphon pisum]
          Length = 188

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 67/85 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+GS AIWS+SS K G GV++LRDDN  TYWQS G LPHLVNIQF +K  V  + +++
Sbjct: 26  VREVGSLAIWSVSSCKSGFGVNQLRDDNIETYWQSCGQLPHLVNIQFRRKTIVSDVYIYV 85

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           N++ DESYTPN I+IRAGT+  DLQ
Sbjct: 86  NHRLDESYTPNIISIRAGTNFNDLQ 110



>gi|428167359|gb|EKX36320.1| hypothetical protein GUITHDRAFT_158685 [Guillardia theta CCMP2712]
          Length = 165

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 50/81 (61%), Positives = 67/81 (82%)

Query: 52  GSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKS 111
           G  A+W+LS+ K GNGV++LRD+N  TYWQSDG  PHLVNIQF +KV++ +I+++ ++K 
Sbjct: 11  GGDAVWTLSTAKPGNGVEQLRDNNTDTYWQSDGPQPHLVNIQFHKKVSIKEIAMYCDFKL 70

Query: 112 DESYTPNKITIRAGTHNGDLQ 132
           DESYTP+KI+IRAGTH  DLQ
Sbjct: 71  DESYTPSKISIRAGTHFHDLQ 91



>gi|355749598|gb|EHH53997.1| hypothetical protein EGM_14726 [Macaca fascicularis]
          Length = 185

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (77%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI+ + G +  +LQ
Sbjct: 82  DYKSDESYTPSKISAKIGNNFHNLQ 106



>gi|325181977|emb|CCA16431.1| anaphasepromoting complex subunit 10 putative [Albugo laibachii
           Nc14]
          Length = 200

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 51/84 (60%), Positives = 65/84 (77%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVV 101
           EF+  E REIG+ A WSLSS K GNG+D+LRDD   T+WQSDGT PH +NI+F +K  + 
Sbjct: 8   EFECAEGREIGNEAFWSLSSAKPGNGIDQLRDDTIDTFWQSDGTQPHCINIEFNKKTLIQ 67

Query: 102 QISLWLNYKSDESYTPNKITIRAG 125
           +I+L+L YK DESYTP KI+IR+G
Sbjct: 68  EIALYLYYKLDESYTPKKISIRSG 91



>gi|403330992|gb|EJY64414.1| Anaphase-promoting complex (APC), subunit 10 [Oxytricha trifallax]
 gi|403331386|gb|EJY64638.1| Anaphase-promoting complex (APC), subunit 10 [Oxytricha trifallax]
          Length = 207

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/84 (60%), Positives = 67/84 (79%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG  A+W+LSS K GNGV+++RDD   T+WQSDGT PH VNIQF +K+ V +ISL+L+
Sbjct: 37  REIGDLAVWTLSSAKPGNGVEQIRDDQVSTFWQSDGTQPHYVNIQFLKKMRVQEISLYLD 96

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           +K+DESYTP+KI+IR G    +LQ
Sbjct: 97  FKTDESYTPSKISIRVGNSFYELQ 120



>gi|513000035|ref|XP_004861555.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X1
           [Heterocephalus glaber]
          Length = 185

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (77%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTIVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKS ESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSHESYTPSKISVRVGNNFHNLQ 106



>gi|449664364|ref|XP_002160509.2| PREDICTED: uncharacterized protein LOC100201345 [Hydra
            magnipapillata]
          Length = 1462

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 67/90 (74%)

Query: 45   HEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQIS 104
             +++REIG +A+WSLSS K G GV +LRD+   TY+QSDG  PHL+NIQFP K  V  +S
Sbjct: 1294 QDQVREIGENAVWSLSSCKPGFGVSELRDNKLTTYFQSDGPQPHLINIQFPWKQAVRFVS 1353

Query: 105  LWLNYKSDESYTPNKITIRAGTHNGDLQVK 134
            ++ +YKSDESYTPN+I+IR G    DL+ K
Sbjct: 1354 IYTDYKSDESYTPNRISIRVGNDKHDLKQK 1383



>gi|426251527|ref|XP_004019473.1| PREDICTED: anaphase-promoting complex subunit 10-like [Ovis aries]
          Length = 185

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 66/85 (77%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A WSL S K G GV++LRDDN  TYWQSDG+ PHLVNIQF +K  V  + +++
Sbjct: 22  VREIGSQAAWSLLSCKPGFGVNQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKALCIYV 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++R G +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRVGNNYHNLQ 106



>gi|156376950|ref|XP_001630621.1| predicted protein [Nematostella vectensis]
 gi|156217645|gb|EDO38558.1| predicted protein [Nematostella vectensis]
          Length = 182

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/85 (58%), Positives = 65/85 (76%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           +LREIG  A WSLSS K G G+++LRD N  TYWQSDG  PHL+NIQF +K  + +IS++
Sbjct: 19  KLREIGDQAAWSLSSCKPGFGIEQLRDGNLETYWQSDGPQPHLINIQFKRKTAIQKISIY 78

Query: 107 LNYKSDESYTPNKITIRAGTHNGDL 131
            +YK+DESYTP+KI++RAG    DL
Sbjct: 79  ADYKADESYTPSKISVRAGNSFHDL 103



>gi|470128019|ref|XP_004299953.1| PREDICTED: anaphase-promoting complex subunit 10-like [Fragaria
           vesca subsp. vesca]
          Length = 191

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 62/80 (77%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           + LRE G +A WS+SSWK GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 24  DNLRETGKNATWSVSSWKSGNGVSYLRDDNLDTYWQSDGAQPHLVNIQFQKKVKLQLVVL 83

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI IRAG
Sbjct: 84  YVDFKLDESYTPSKILIRAG 103



>gi|388512629|gb|AFK44376.1| unknown [Medicago truncatula]
          Length = 196

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 62/80 (77%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           E+LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PH VNIQF +KV +  + L
Sbjct: 29  EDLRELGKKAAWSVSSCKTGNGVSSLRDDNLETYWQSDGAQPHFVNIQFQKKVRLQLVVL 88

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 89  YVDFKLDESYTPSKISIRAG 108



>gi|119627198|gb|EAX06793.1| hCG1640061 [Homo sapiens]
          Length = 157

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (77%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLYIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI+ + G +  +LQ
Sbjct: 82  DYKSDESYTPSKISAKVGNNFHNLQ 106



>gi|508699164|gb|EOX91060.1| Anaphase promoting complex 10 isoform 2 [Theobroma cacao]
          Length = 173

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 62/80 (77%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKTGNGVSSLRDDNLETYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI IRAG
Sbjct: 85  YVDFKLDESYTPSKICIRAG 104



>gi|224031763|gb|ACN34957.1| unknown [Zea mays]
 gi|413948347|gb|AFW80996.1| hypothetical protein ZEAMMB73_722151 [Zea mays]
          Length = 148

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/88 (56%), Positives = 67/88 (76%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 35  DMREMAKTAAWSVSSCKAGNGVAALRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 94

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQVK 134
           +++K DESYTP+KI+IRAG    +L+V+
Sbjct: 95  VDFKLDESYTPSKISIRAGDGFHNLKVR 122



>gi|470102898|ref|XP_004287887.1| PREDICTED: anaphase-promoting complex subunit 10-like [Fragaria
           vesca subsp. vesca]
          Length = 191

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 64/80 (80%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SSWK GNGV  LRDDN  TYWQSDG  PH VNIQF +KV +  + L
Sbjct: 24  DDLREMGKNAAWSVSSWKSGNGVSYLRDDNLDTYWQSDGAQPHSVNIQFQKKVKLQLVVL 83

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 84  YVDFKLDESYTPSKISIRAG 103



>gi|502153256|ref|XP_004509275.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X1
           [Cicer arietinum]
 gi|502153259|ref|XP_004509276.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Cicer arietinum]
 gi|502153261|ref|XP_004509277.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X3
           [Cicer arietinum]
          Length = 196

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 62/80 (77%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +ELRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PH VNIQF +KV +  + L
Sbjct: 29  DELRELGKKAAWSVSSCKPGNGVSSLRDDNLETYWQSDGAQPHFVNIQFQKKVRLQLVVL 88

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 89  YVDFKLDESYTPSKISIRAG 108



>gi|449446698|ref|XP_004141108.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cucumis
           sativus]
 gi|449489479|ref|XP_004158324.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cucumis
           sativus]
          Length = 192

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKPGNGVSALRDDNLETYWQSDGVQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 85  YVDFKLDESYTPSKISIRAG 104



>gi|508699163|gb|EOX91059.1| Anaphase promoting complex 10 isoform 1 [Theobroma cacao]
          Length = 192

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 62/80 (77%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKTGNGVSSLRDDNLETYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI IRAG
Sbjct: 85  YVDFKLDESYTPSKICIRAG 104



>gi|508699165|gb|EOX91061.1| Anaphase-promoting complex subunit 10 isoform 3 [Theobroma cacao]
          Length = 157

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 62/80 (77%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKTGNGVSSLRDDNLETYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI IRAG
Sbjct: 85  YVDFKLDESYTPSKICIRAG 104



>gi|460375457|ref|XP_004233522.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform 1
           [Solanum lycopersicum]
          Length = 195

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS+K GNGV  LRDDN  TYWQSDG  PHLVN+QF +KV +  + L
Sbjct: 24  DDLREMGKKAAWSVSSYKPGNGVLSLRDDNLETYWQSDGAQPHLVNVQFQKKVKLQLVVL 83

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP KI+IRAG
Sbjct: 84  YVDFKLDESYTPGKISIRAG 103



>gi|224094807|ref|XP_002310244.1| predicted protein [Populus trichocarpa]
 gi|222853147|gb|EEE90694.1| predicted protein [Populus trichocarpa]
          Length = 192

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKPGNGVSSLRDDNLDTYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 85  YVDFKLDESYTPSKISIRAG 104



>gi|224134260|ref|XP_002327795.1| predicted protein [Populus trichocarpa]
 gi|222836880|gb|EEE75273.1| predicted protein [Populus trichocarpa]
          Length = 192

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKPGNGVSSLRDDNLDTYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 85  YVDFKLDESYTPSKISIRAG 104



>gi|462398148|gb|EMJ03816.1| hypothetical protein PRUPE_ppa011884mg [Prunus persica]
          Length = 192

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 62/80 (77%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKAGNGVSSLRDDNLDTYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP KI+IRAG
Sbjct: 85  YVDFKLDESYTPCKISIRAG 104



>gi|460375459|ref|XP_004233523.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform 2
           [Solanum lycopersicum]
          Length = 191

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS+K GNGV  LRDDN  TYWQSDG  PHLVN+QF +KV +  + L
Sbjct: 24  DDLREMGKKAAWSVSSYKPGNGVLSLRDDNLETYWQSDGAQPHLVNVQFQKKVKLQLVVL 83

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP KI+IRAG
Sbjct: 84  YVDFKLDESYTPGKISIRAG 103



>gi|242091253|ref|XP_002441459.1| hypothetical protein SORBIDRAFT_09g027240 [Sorghum bicolor]
 gi|241946744|gb|EES19889.1| hypothetical protein SORBIDRAFT_09g027240 [Sorghum bicolor]
          Length = 201

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 63/79 (79%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  ++L+
Sbjct: 35  DMREMAKTAAWSVSSCKAGNGVAALRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVALY 94

Query: 107 LNYKSDESYTPNKITIRAG 125
           +++K DESYTP+KI+IRAG
Sbjct: 95  VDFKLDESYTPSKISIRAG 113



>gi|297836562|ref|XP_002886163.1| anaphase-promoting complex, subunit 10 family [Arabidopsis lyrata
           subsp. lyrata]
 gi|297332003|gb|EFH62422.1| anaphase-promoting complex, subunit 10 family [Arabidopsis lyrata
           subsp. lyrata]
          Length = 192

 Score =  107 bits (267), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SS K GNGV  LRDDN  TYWQSDG  PHL+NIQF +KV +  + L
Sbjct: 25  DDLREMGKNAAWSVSSCKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 85  YVDFKLDESYTPSKISIRAG 104



>gi|18398701|ref|NP_565433.1| anaphase-promoting complex subunit 10 [Arabidopsis thaliana]
 gi|34395513|sp|Q9ZPW2.2|APC10_ARATH RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|20197809|gb|AAD15507.2| expressed protein [Arabidopsis thaliana]
 gi|90567996|gb|ABD94068.1| At2g18290 [Arabidopsis thaliana]
 gi|110738941|dbj|BAF01391.1| hypothetical protein [Arabidopsis thaliana]
 gi|330251657|gb|AEC06751.1| anaphase-promoting complex subunit 10 [Arabidopsis thaliana]
          Length = 192

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SS K GNGV  LRDDN  TYWQSDG  PHL+NIQF +KV +  + L
Sbjct: 25  DDLREMGKNAAWSVSSCKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 85  YVDFKLDESYTPSKISIRAG 104



>gi|21592739|gb|AAM64688.1| unknown [Arabidopsis thaliana]
          Length = 192

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SS K GNGV  LRDDN  TYWQSDG  PHL+NIQF +KV +  + L
Sbjct: 25  DDLREMGKNAAWSVSSCKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 85  YVDFKLDESYTPSKISIRAG 104



>gi|482567332|gb|EOA31521.1| hypothetical protein CARUB_v10014711mg [Capsella rubella]
          Length = 192

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SS K GNGV  LRDDN  TYWQSDG  PHL+NIQF +KV +  + L
Sbjct: 25  DDLREMGKNAAWSVSSCKPGNGVGTLRDDNIETYWQSDGLQPHLINIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 85  YVDFKLDESYTPSKISIRAG 104



>gi|302780585|ref|XP_002972067.1| hypothetical protein SELMODRAFT_96868 [Selaginella moellendorffii]
 gi|302781674|ref|XP_002972611.1| hypothetical protein SELMODRAFT_96982 [Selaginella moellendorffii]
 gi|300160078|gb|EFJ26697.1| hypothetical protein SELMODRAFT_96982 [Selaginella moellendorffii]
 gi|300160366|gb|EFJ26984.1| hypothetical protein SELMODRAFT_96868 [Selaginella moellendorffii]
          Length = 174

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 65/86 (75%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E REIG  A+WS+SS K GNGVD LRD +  TYWQSDG  PHLVNIQF +KV +  ++++
Sbjct: 9   ERREIGKLAVWSVSSAKPGNGVDLLRDASLETYWQSDGAQPHLVNIQFQKKVRLQLLAIY 68

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
           +++K DESYTPNKI++R G    DL+
Sbjct: 69  VDFKLDESYTPNKISVRTGNSFYDLR 94



>gi|198434262|ref|XP_002131938.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform 1
           [Ciona intestinalis]
          Length = 202

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 66/93 (70%)

Query: 39  IKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKV 98
           I+   + E LREIG  A+WS+SS K G GV+ LRD++  TYWQSDGT PH+VN+QF QK 
Sbjct: 22  IRELLEKESLREIGHQAVWSVSSCKQGYGVNSLRDNSLETYWQSDGTQPHMVNVQFKQKT 81

Query: 99  NVVQISLWLNYKSDESYTPNKITIRAGTHNGDL 131
            +  + ++ +YK+DESYTP+++++  G    DL
Sbjct: 82  TIHSVGVYTDYKADESYTPSRLSVSVGNDFNDL 114



>gi|238006074|gb|ACR34072.1| unknown [Zea mays]
 gi|413948346|gb|AFW80995.1| hypothetical protein ZEAMMB73_722151 [Zea mays]
          Length = 147

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 62/79 (78%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 35  DMREMAKTAAWSVSSCKAGNGVAALRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 94

Query: 107 LNYKSDESYTPNKITIRAG 125
           +++K DESYTP+KI+IRAG
Sbjct: 95  VDFKLDESYTPSKISIRAG 113



>gi|219884719|gb|ACL52734.1| unknown [Zea mays]
 gi|413948345|gb|AFW80994.1| anaphase-promoting complex subunit 10 [Zea mays]
          Length = 201

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 62/79 (78%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 35  DMREMAKTAAWSVSSCKAGNGVAALRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 94

Query: 107 LNYKSDESYTPNKITIRAG 125
           +++K DESYTP+KI+IRAG
Sbjct: 95  VDFKLDESYTPSKISIRAG 113



>gi|499013761|ref|XP_004537616.1| PREDICTED: anaphase-promoting complex subunit 10-like, partial
           [Ceratitis capitata]
          Length = 168

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 66/85 (77%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIG+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVN+QF +K  +  + L+ 
Sbjct: 23  VREIGNQAVWSLSSCKPGFGVERLRDNIIDTYWQSDGQLPHLVNVQFHRKTRISAVYLYA 82

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DESYTP++I++R G++  DLQ
Sbjct: 83  DYKLDESYTPSRISLRTGSNFNDLQ 107



>gi|145351293|ref|XP_001420017.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144580250|gb|ABO98310.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 280

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 60/83 (72%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           E+G  A+WS++S K GNGV+ LRDD+  T+WQSDG  PH+VN QF  K  + +I+LW  Y
Sbjct: 1   EVGHLAVWSVASAKPGNGVELLRDDDLATFWQSDGAQPHVVNAQFQHKAELCEIALWCEY 60

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
           K DESYTP+ I+IRAG    DL+
Sbjct: 61  KMDESYTPSLISIRAGASCHDLR 83



>gi|449018510|dbj|BAM81912.1| similar to anaphase-promoting complex subunit 10 [Cyanidioschyzon
           merolae strain 10D]
          Length = 391

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 67/93 (72%)

Query: 40  KSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVN 99
           KSE + E LRE+G  A+WS+SS K GNG++ +RD N  T++Q+DG  PH ++IQF QK  
Sbjct: 127 KSETQLEALRELGDEAVWSVSSAKQGNGIELMRDGNVQTFFQTDGAQPHKISIQFRQKTK 186

Query: 100 VVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           V QI ++LNY+ DESYTPN+I +  GT   DL+
Sbjct: 187 VSQIRMFLNYQLDESYTPNRIGVWTGTDFHDLR 219



>gi|308808844|ref|XP_003081732.1| Anaphase-promoting complex, subunit 10 (IC) [Ostreococcus tauri]
 gi|55978032|gb|AAV68616.1| anaphase promoting complex subunit 10 [Ostreococcus tauri]
 gi|116060198|emb|CAL56257.1| Anaphase-promoting complex, subunit 10 (IC) [Ostreococcus tauri]
          Length = 319

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A+WS++S K GNGV+ LRDD+  T+WQSDG  PH+VN QF  KV + ++++W  Y
Sbjct: 15  KIGGLAVWSVASAKPGNGVEMLRDDDLGTFWQSDGAQPHVVNAQFQHKVEICELAMWCEY 74

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
           K DESYTP+ I+IRAG    DL+
Sbjct: 75  KMDESYTPSVISIRAGASCHDLR 97



>gi|225430728|ref|XP_002266072.1| PREDICTED: anaphase-promoting complex subunit 10 [Vitis vinifera]
 gi|297735140|emb|CBI17502.3| unnamed protein product [Vitis vinifera]
          Length = 192

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (77%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           E+LRE+   A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 25  EDLREMAKKAAWSVSSCKAGNGVLLLRDDNLDTYWQSDGAQPHLVNIQFLKKVKLQLVVI 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 85  YVDFKLDESYTPSKISIRAG 104



>gi|384253180|gb|EIE26655.1| anaphase-promoting complex, subunit 10 [Coccomyxa subellipsoidea
           C-169]
          Length = 173

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/84 (59%), Positives = 66/84 (78%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG  A+W+++S K GNGV+ LRD    TYWQSDG+ PHLVNIQF +KV + ++++ L+
Sbjct: 8   REIGKLAVWTVTSAKPGNGVELLRDGREDTYWQSDGSQPHLVNIQFQKKVRLQELAINLD 67

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           YK DESYTPNKI++RAGT   DL+
Sbjct: 68  YKLDESYTPNKISVRAGTSVHDLK 91



>gi|326519366|dbj|BAJ96682.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 204

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 63/79 (79%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDD+  TYWQSDG  PHLVNIQF +KV +  ++L+
Sbjct: 38  DMREMAKTAAWSVSSCKPGNGVASLRDDSLDTYWQSDGAQPHLVNIQFQKKVQLQLVALY 97

Query: 107 LNYKSDESYTPNKITIRAG 125
           +++K DESYTP+KI+IRAG
Sbjct: 98  VDFKLDESYTPSKISIRAG 116



>gi|226528224|ref|NP_001148648.1| anaphase-promoting complex subunit 10 [Zea mays]
 gi|195621090|gb|ACG32375.1| anaphase-promoting complex subunit 10 [Zea mays]
          Length = 201

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/84 (59%), Positives = 64/84 (76%), Gaps = 2/84 (2%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 35  DMREMAKTAAWSVSSCKAGNGVAALRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 94

Query: 107 LNYKSDESYTPNKITIRA--GTHN 128
           +++K DESYTP+KI+IRA  G HN
Sbjct: 95  VDFKLDESYTPSKISIRAEDGFHN 118



>gi|255561114|ref|XP_002521569.1| anaphase-promoting complex, putative [Ricinus communis]
 gi|223539247|gb|EEF40840.1| anaphase-promoting complex, putative [Ricinus communis]
          Length = 192

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  ++WQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKPGNGVSSLRDDNLDSFWQSDGAQPHLVNIQFQKKVKLQLVLL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 85  YVDFKLDESYTPSKISIRAG 104



>gi|255079740|ref|XP_002503450.1| predicted protein [Micromonas sp. RCC299]
 gi|226518717|gb|ACO64708.1| predicted protein [Micromonas sp. RCC299]
          Length = 198

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 67/89 (75%)

Query: 44  KHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQI 103
           +  ++ EIG  A+WS++S K GNGV+ LRD++  TYWQSDG  PHLVN+QF +KV V ++
Sbjct: 19  RRGDVSEIGKLAVWSVTSAKPGNGVELLRDNSLDTYWQSDGAQPHLVNVQFQKKVRVREL 78

Query: 104 SLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
            ++ +Y+ DESYTPNKI++RAG    DL+
Sbjct: 79  CIYADYRLDESYTPNKISVRAGNSFHDLR 107



>gi|358249186|ref|NP_001240007.1| uncharacterized protein LOC100806981 [Glycine max]
 gi|255633646|gb|ACU17182.1| unknown [Glycine max]
          Length = 192

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (77%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++L E+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  I L
Sbjct: 25  DDLTEMGKKAAWSVSSCKPGNGVSSLRDDNLETYWQSDGGQPHLVNIQFQKKVRLQLIVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+K++IRAG
Sbjct: 85  YVDFKLDESYTPSKVSIRAG 104



>gi|504128801|ref|XP_004577641.1| PREDICTED: anaphase-promoting complex subunit 10-like [Ochotona
           princeps]
          Length = 185

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 49/85 (57%), Positives = 64/85 (75%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           ++EIGS A+WS SS K G GVD+L DDN  TYWQS G+ PH VNIQF +K  V  + ++ 
Sbjct: 22  VQEIGSQAVWSFSSCKPGFGVDQLGDDNLETYWQSAGSQPHSVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YKSDESYTP+KI++RAG +  +LQ
Sbjct: 82  DYKSDESYTPSKISVRAGNNFHNLQ 106



>gi|485623105|gb|EOD19341.1| hypothetical protein EMIHUDRAFT_46713, partial [Emiliania huxleyi
           CCMP1516]
          Length = 161

 Score =  104 bits (259), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 64/83 (77%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           EIG  A+WSLS+ K GNGV++LRDD+  TYWQSDG  PHLVNIQF +K+ +  I ++ ++
Sbjct: 1   EIGDLAVWSLSTAKPGNGVEQLRDDDVNTYWQSDGPQPHLVNIQFHRKMVIHHIRVYTDF 60

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
           K DESYTP KI+IR+GT   DLQ
Sbjct: 61  KLDESYTPAKISIRSGTTFHDLQ 83



>gi|472584744|gb|EMS22330.1| anaphase promoting complex subunit 10 [Rhodosporidium toruloides
           NP11]
          Length = 182

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 69/92 (75%)

Query: 41  SEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           +E   +ELR+IGS A W++SS K G GV+ +RD +  T WQS+G  PHL+NIQFP+K ++
Sbjct: 2   AEPSADELRDIGSLAHWAVSSAKPGYGVEHVRDADPATLWQSEGAQPHLINIQFPKKQSI 61

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
            Q+ ++ +   D+SYTP+KI+IRAGTH+GDL 
Sbjct: 62  TQVWIFADINQDDSYTPHKISIRAGTHHGDLH 93



>gi|308080974|ref|NP_001183667.1| uncharacterized protein LOC100502261 [Zea mays]
 gi|238013766|gb|ACR37918.1| unknown [Zea mays]
 gi|413946331|gb|AFW78980.1| hypothetical protein ZEAMMB73_444017 [Zea mays]
          Length = 198

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+   A WS+SS+K GNGV  LRDDN   YWQSDG  PHLVNI+F +KV +  ++L+
Sbjct: 32  DMREVAKRAAWSVSSFKDGNGVAALRDDNLDAYWQSDGAEPHLVNIRFQKKVQLQLVALY 91

Query: 107 LNYKSDESYTPNKITIRAG 125
           +++K DESYTP+KI+IRAG
Sbjct: 92  VDFKLDESYTPSKISIRAG 110



>gi|303272633|ref|XP_003055678.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226463652|gb|EEH60930.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 216

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/83 (57%), Positives = 62/83 (74%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           EIG  A+WS++S K GNGV+ LRDD   TYWQSDG  PHLVN+QF +KV + +++L+  Y
Sbjct: 32  EIGKLAVWSVTSAKPGNGVELLRDDCLDTYWQSDGAQPHLVNVQFQKKVRLRELALYAKY 91

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             DESYTP+KI+IRAG    DL+
Sbjct: 92  ALDESYTPSKISIRAGNSFHDLR 114



>gi|357132396|ref|XP_003567816.1| PREDICTED: anaphase-promoting complex subunit 10-like [Brachypodium
           distachyon]
          Length = 205

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 62/79 (78%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDD+  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 39  DMREMAKTAAWSVSSCKPGNGVASLRDDSLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 98

Query: 107 LNYKSDESYTPNKITIRAG 125
           +++K DESYTP+KI+IRAG
Sbjct: 99  VDFKLDESYTPSKISIRAG 117



>gi|290991269|ref|XP_002678258.1| anaphase promoting complex subunit 10 [Naegleria gruberi]
 gi|284091869|gb|EFC45514.1| anaphase promoting complex subunit 10 [Naegleria gruberi]
          Length = 274

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 1/88 (1%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L EIG  A+WS+S+ K GNGV++LRDDN  TYWQSDG  PH +NIQF + + + +++++L
Sbjct: 93  LIEIGKYAVWSVSTAKQGNGVEELRDDNLETYWQSDGPQPHTINIQFHKVLTIQEVAIYL 152

Query: 108 NYKSDESYTPNKITIRAGTHNGDL-QVK 134
           +YK DESYTP  I+I+ G++  DL Q+K
Sbjct: 153 DYKKDESYTPQVISIKCGSNFHDLIQIK 180



>gi|475607033|gb|EMT26572.1| Anaphase-promoting complex subunit 10 [Aegilops tauschii]
          Length = 162

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (75%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A+WS+SS K GNGV  LRD +  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 38  DMREMAKTAVWSVSSSKPGNGVASLRDHSLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 97

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQV 133
           +++K DESYTP+KI+IRAG    +L+V
Sbjct: 98  VDFKLDESYTPSKISIRAGDGLHNLKV 124



>gi|224001908|ref|XP_002290626.1| anaphase promoting complex subunit 10 [Thalassiosira pseudonana
           CCMP1335]
 gi|220974048|gb|EED92378.1| anaphase promoting complex subunit 10, partial [Thalassiosira
           pseudonana CCMP1335]
          Length = 153

 Score =  102 bits (253), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 60/79 (75%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIG SA WSLS+ K GNGVD+LRD +  TYWQSDG  PH +NIQFP++  V  I+L++
Sbjct: 2   VREIGKSAQWSLSTAKPGNGVDQLRDSSLDTYWQSDGLQPHYINIQFPRRQTVSAIALYM 61

Query: 108 NYKSDESYTPNKITIRAGT 126
           ++  DESYTP K+ +R GT
Sbjct: 62  DFNLDESYTPKKMKVRVGT 80



>gi|474436420|gb|EMS68205.1| Anaphase-promoting complex subunit 10 [Triticum urartu]
          Length = 199

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 61/79 (77%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDD+  TYWQS G  PHLVNIQF +KV +  + L+
Sbjct: 29  DMREMAKTAAWSVSSCKPGNGVASLRDDSLDTYWQSAGAQPHLVNIQFQKKVQLQLVVLY 88

Query: 107 LNYKSDESYTPNKITIRAG 125
           +++K DESYTP+KI+IRAG
Sbjct: 89  VDFKLDESYTPSKISIRAG 107



>gi|351725793|ref|NP_001236081.1| uncharacterized protein LOC100526925 [Glycine max]
 gi|255631165|gb|ACU15948.1| unknown [Glycine max]
          Length = 192

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++L E+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQ  +KV +  I L
Sbjct: 25  DDLTEMGKKAAWSVSSCKPGNGVSSLRDDNLETYWQSDGGQPHLVNIQSQKKVRLQLIVL 84

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+K++IRAG
Sbjct: 85  YVDFKLDESYTPSKVSIRAG 104



>gi|323456624|gb|EGB12491.1| hypothetical protein AURANDRAFT_20412 [Aureococcus anophagefferens]
          Length = 194

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 66/91 (72%), Gaps = 8/91 (8%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLR--------DDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           REIG  A+WSLS+ K GNGV+++R        D+N  TYWQSDG  PHL+NIQF +K+++
Sbjct: 21  REIGDEAVWSLSTAKPGNGVEQIRAAPGGKRRDENTETYWQSDGGQPHLINIQFHKKMSI 80

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDL 131
            +++ +L+Y  DESYTP K++IRAGT   DL
Sbjct: 81  SEMAFYLDYGLDESYTPKKMSIRAGTTFHDL 111



>gi|388499086|gb|AFK37609.1| unknown [Lotus japonicus]
          Length = 197

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 60/80 (75%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +EL E+G  A WS+SS K GN V  LRD N  T+WQSDG  PHLVNIQF +KV +  + L
Sbjct: 30  DELTELGKKAAWSVSSCKPGNSVSSLRDQNLETFWQSDGAQPHLVNIQFQKKVRLQLVVL 89

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI+IRAG
Sbjct: 90  YVDFKLDESYTPSKISIRAG 109



>gi|300681546|emb|CBH32643.1| anaphase-promoting complex subunit, putative,expressed [Triticum
           aestivum]
          Length = 184

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 61/79 (77%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  +RDD+  TYWQSD   PHLVNIQF +KV +  + L+
Sbjct: 40  DMREMAKTAAWSVSSCKPGNGVASIRDDSLDTYWQSDDAQPHLVNIQFQKKVQLHLVVLY 99

Query: 107 LNYKSDESYTPNKITIRAG 125
           +++K DESYTPNKI+IRAG
Sbjct: 100 VDFKLDESYTPNKISIRAG 118



>gi|159471183|ref|XP_001693736.1| anaphase promoting complex subunit 10 [Chlamydomonas reinhardtii]
 gi|158283239|gb|EDP08990.1| anaphase promoting complex subunit 10 [Chlamydomonas reinhardtii]
          Length = 178

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 66/84 (78%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           RE+G  A+WS++S K GNGV+ LRD +  T+WQSDG  PHL+N+QF +KV ++++ ++++
Sbjct: 14  REVGHLAVWSVTSAKAGNGVEMLRDGSTETFWQSDGLQPHLINVQFQRKVPLLELQMYVD 73

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           YK DESYTP+++++RAG    DL+
Sbjct: 74  YKLDESYTPSRVSVRAGHTYQDLK 97



>gi|405975083|gb|EKC39678.1| Anaphase-promoting complex subunit 10 [Crassostrea gigas]
          Length = 125

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 63/89 (70%), Gaps = 1/89 (1%)

Query: 35  ERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQF 94
           E  I+K E +   LRE+G+ A+WSLSS K G GVD+L D+   TYWQSDG  PHLVNIQF
Sbjct: 10  EIDILKEE-REGRLREVGNQAVWSLSSCKPGFGVDQLLDNTVDTYWQSDGPQPHLVNIQF 68

Query: 95  PQKVNVVQISLWLNYKSDESYTPNKITIR 123
            +K  +  + ++ +YK+DESYTPN+  IR
Sbjct: 69  RRKTTIHDVCIYTDYKADESYTPNRPCIR 97



>gi|330840131|ref|XP_003292074.1| hypothetical protein DICPUDRAFT_39988 [Dictyostelium purpureum]
 gi|325077709|gb|EGC31404.1| hypothetical protein DICPUDRAFT_39988 [Dictyostelium purpureum]
          Length = 190

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 60/83 (72%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           EIG  A WS+SS K G+GV++LRD+N  TYWQSD   PH + IQFP+K  +  I L+ NY
Sbjct: 28  EIGKLASWSVSSAKPGSGVEQLRDNNAETYWQSDAQQPHNITIQFPKKCFIENILLYCNY 87

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
           K DESYTP KI+I+AGT   DLQ
Sbjct: 88  KLDESYTPQKISIKAGTLLHDLQ 110



>gi|307103401|gb|EFN51661.1| hypothetical protein CHLNCDRAFT_139870 [Chlorella variabilis]
          Length = 180

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 66/96 (68%)

Query: 37  KIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQ 96
           K++ +       REIG  A+WS++S K GNGV+ LRD    TYWQSDG  PHLVN+QF +
Sbjct: 2   KLVTTLQPDTNFREIGRLAVWSVTSAKPGNGVELLRDGRDDTYWQSDGAQPHLVNVQFQK 61

Query: 97  KVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           KV + +++++ +YK DESYTP KI+IR G    D++
Sbjct: 62  KVYLSEVAIFTDYKLDESYTPTKISIRVGNTFSDVR 97



>gi|302835371|ref|XP_002949247.1| hypothetical protein VOLCADRAFT_80519 [Volvox carteri f.
           nagariensis]
 gi|300265549|gb|EFJ49740.1| hypothetical protein VOLCADRAFT_80519 [Volvox carteri f.
           nagariensis]
          Length = 181

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 66/84 (78%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           RE+G  A+WS++S K GNGV+ LRD N  T+WQSDG  PHL+NIQF +K+ ++++ ++++
Sbjct: 17  REVGHLAVWSVTSAKPGNGVEMLRDGNAETFWQSDGLQPHLINIQFQRKMPLLELHMYVD 76

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           YK DESYTP+++++RAG    DL+
Sbjct: 77  YKLDESYTPSRVSVRAGHTYQDLK 100



>gi|209878440|ref|XP_002140661.1| anaphase-promoting complex, subunit 10 family protein
           [Cryptosporidium muris RN66]
 gi|209556267|gb|EEA06312.1| anaphase-promoting complex, subunit 10 family protein
           [Cryptosporidium muris RN66]
          Length = 227

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 59/85 (69%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L EIG  A W+LSS K GNGV++LRD+N  T+WQSDG  PH + ++FP K  V  I L+L
Sbjct: 36  LIEIGDFASWTLSSAKPGNGVNQLRDNNSSTFWQSDGQSPHTITLRFPSKTKVSMIDLYL 95

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
            YK DESYTP  I+IRAG    DL+
Sbjct: 96  AYKIDESYTPQIISIRAGNQESDLE 120



>gi|126649289|ref|XP_001388316.1| anaphase promoting complex subunit 10 [Cryptosporidium parvum Iowa
           II]
 gi|126117410|gb|EAZ51510.1| anaphase promoting complex subunit 10, putative [Cryptosporidium
           parvum Iowa II]
          Length = 132

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L EIG  A WSLSS K GNG+ +LRD+N  T+WQSDG  PH + ++FP+K  V  I L+L
Sbjct: 16  LIEIGDLASWSLSSAKPGNGIQQLRDNNSSTFWQSDGQSPHTITLRFPKKTKVSVIDLYL 75

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
            YK DESYTP  I+IR+G    DL+
Sbjct: 76  AYKIDESYTPQIISIRSGNQESDLE 100



>gi|470319387|gb|EMR11006.1| hypothetical protein PNEG_00607 [Pneumocystis murina B123]
          Length = 198

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 63/84 (75%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG+ A W++SS K G GV++LR+DN  T+WQSDG  PH +NI F +KV++  +S +  
Sbjct: 34  REIGNLATWTVSSSKPGFGVEQLRNDNVDTFWQSDGPQPHYINIHFIKKVSIKLLSFYTQ 93

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           Y+ DESYTP+KI++RAGT   DLQ
Sbjct: 94  YRQDESYTPSKISVRAGTGFHDLQ 117



>gi|115465645|ref|NP_001056422.1| Os05g0579800 [Oryza sativa Japonica Group]
 gi|113579973|dbj|BAF18336.1| Os05g0579800, partial [Oryza sativa Japonica Group]
          Length = 205

 Score = 98.2 bits (243), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 38  DDMREMAKTAAWSVSSCKPGNGVASLRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVV 97

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI++RAG
Sbjct: 98  YVDFKLDESYTPSKISVRAG 117



>gi|470505659|ref|XP_004348598.1| anaphase promoting complex subunit 10-like family protein, putative
           [Acanthamoeba castellanii str. Neff]
 gi|440801115|gb|ELR22140.1| anaphase promoting complex subunit 10-like family protein, putative
           [Acanthamoeba castellanii str. Neff]
          Length = 463

 Score = 97.8 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 44/85 (51%), Positives = 62/85 (72%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L E+G  A WSLSS K G G+++LRDDN  TYWQSDG  PH +++Q+ ++V + Q+SL+L
Sbjct: 6   LVEVGREACWSLSSAKPGFGIEQLRDDNLDTYWQSDGPQPHTISVQWHRRVCIEQVSLYL 65

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           ++  DESYTP  ++IR GT   DL+
Sbjct: 66  SFAHDESYTPCHMSIRVGTTFHDLR 90



>gi|51854317|gb|AAU10698.1| putative anaphase promoting complex subunit 10 [Oryza sativa
           Japonica Group]
 gi|215693935|dbj|BAG89134.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 201

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 34  DDMREMAKTAAWSVSSCKPGNGVASLRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVV 93

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI++RAG
Sbjct: 94  YVDFKLDESYTPSKISVRAG 113



>gi|340058112|emb|CCC52466.1| putative anaphase promoting complex, subunit 10-like protein
           [Trypanosoma vivax Y486]
          Length = 230

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 62/89 (69%)

Query: 43  FKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQ 102
           F+ +E       A+WS+SS KHGNGV  L D +  TYWQSDG +PH+++I F +   V  
Sbjct: 38  FEKQEALVALRDAVWSVSSAKHGNGVTCLLDRSHDTYWQSDGVVPHIISIDFSRLTPVAA 97

Query: 103 ISLWLNYKSDESYTPNKITIRAGTHNGDL 131
           ++L+L+YK D+SYTP K  ++AGTH+GD+
Sbjct: 98  VALYLDYKEDKSYTPRKTRVQAGTHSGDM 126



>gi|512861091|ref|XP_004889798.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Heterocephalus glaber]
 gi|512972212|ref|XP_004848220.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Heterocephalus glaber]
 gi|351703329|gb|EHB06248.1| Anaphase-promoting complex subunit 10 [Heterocephalus glaber]
          Length = 185

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/85 (51%), Positives = 63/85 (74%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS +   GVD+L+DDN  TYWQS+ + PHL+NIQF +K     + ++ 
Sbjct: 22  VREIGSQAVWSLSSCESVFGVDQLQDDNLETYWQSESSQPHLLNIQFRRKTTAKTLCIYS 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +YK DE+YTP+KI++R G +  +LQ
Sbjct: 82  DYKPDENYTPSKISVRVGNNFHNLQ 106



>gi|170099535|ref|XP_001880986.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164644511|gb|EDR08761.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 186

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 61/83 (73%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +I S A WS+SS+K G GV+ LRD +  T+W SDG  PH + I+FP+KV + +IS++LN+
Sbjct: 18  DISSRAKWSVSSFKFGFGVECLRDGDPDTFWHSDGPQPHFITIEFPRKVAIQKISIYLNF 77

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
            SD+SYTP+ + IRAGT   DLQ
Sbjct: 78  SSDDSYTPSTLAIRAGTGPSDLQ 100



>gi|195999362|ref|XP_002109549.1| hypothetical protein TRIADDRAFT_21690 [Trichoplax adhaerens]
 gi|190587673|gb|EDV27715.1| hypothetical protein TRIADDRAFT_21690 [Trichoplax adhaerens]
          Length = 175

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 63/84 (75%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           RE+G+ A+WS+SS K G G+ +L D+++ TYWQSDG+ PHL+NIQF +K  +  + ++ +
Sbjct: 20  REVGNEAVWSVSSCKPGLGIHQLLDNSYETYWQSDGSQPHLINIQFFKKTYISCLKIYTD 79

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           +K DESYTP +I++R G H+ DL 
Sbjct: 80  FKLDESYTPKEISVRVGLHDHDLH 103



>gi|296417930|ref|XP_002838600.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634550|emb|CAZ82791.1| unnamed protein product [Tuber melanosporum]
          Length = 231

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 66/87 (75%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           E L+EIG+ A W++SS K GNGV++LRD+N   +WQSDG  PH +NI F ++V V +I +
Sbjct: 62  EGLKEIGNLACWTVSSAKPGNGVEQLRDENTNLFWQSDGPQPHTINIHFAKRVFVRKIRM 121

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQ 132
           +L++++DESYTP +++I +GT   DLQ
Sbjct: 122 YLDFENDESYTPTRMSILSGTGYHDLQ 148



>gi|430813297|emb|CCJ29329.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 198

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 63/84 (75%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG+ A W++SS K G GV++LR+D+  T+WQSDG  PH +NI F +KV++  +S +  
Sbjct: 34  REIGNLATWTVSSSKPGFGVEQLRNDSIDTFWQSDGPQPHYINIHFIKKVSIKLLSFYTQ 93

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
           Y+ DESYTP+KI++RAGT   DLQ
Sbjct: 94  YRQDESYTPSKISVRAGTGFHDLQ 117



>gi|125553459|gb|EAY99168.1| hypothetical protein OsI_21127 [Oryza sativa Indica Group]
 gi|222632683|gb|EEE64815.1| hypothetical protein OsJ_19671 [Oryza sativa Japonica Group]
          Length = 223

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 34  DDMREMAKTAAWSVSSCKPGNGVASLRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVV 93

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI++RAG
Sbjct: 94  YVDFKLDESYTPSKISVRAG 113



>gi|5091606|gb|AAD39595.1|AC007858_9 10A19I.10 [Oryza sativa Japonica Group]
          Length = 239

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 63/80 (78%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 34  DDMREMAKTAAWSVSSCKPGNGVASLRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVV 93

Query: 106 WLNYKSDESYTPNKITIRAG 125
           ++++K DESYTP+KI++RAG
Sbjct: 94  YVDFKLDESYTPSKISVRAG 113



>gi|466009820|ref|XP_004269997.1| PREDICTED: anaphase-promoting complex subunit 10-like [Orcinus
           orca]
          Length = 248

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%)

Query: 56  IWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDESY 115
           I +LSS K G  VD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ +YKSDESY
Sbjct: 93  ICALSSCKPGFEVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESY 152

Query: 116 TPNKITIRAGTHNGDLQ 132
           TP+KI++R G +  +LQ
Sbjct: 153 TPSKISVRVGNNFHNLQ 169



>gi|440631730|gb|ELR01649.1| hypothetical protein GMDG_00025 [Geomyces destructans 20631-21]
          Length = 320

 Score = 95.1 bits (235), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 66/93 (70%)

Query: 39  IKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKV 98
           + S F    L+EIG+ A W++S+ K G+GV+ LRDD+   YWQSDG  PH +NI F + V
Sbjct: 122 VDSVFDPTGLKEIGNLASWTVSTCKPGSGVEALRDDDTSLYWQSDGPQPHHLNIHFSRLV 181

Query: 99  NVVQISLWLNYKSDESYTPNKITIRAGTHNGDL 131
           +++ I ++L++++DESYTP +IT+ AGT   DL
Sbjct: 182 SILSIRIFLDFEADESYTPTRITLLAGTGYHDL 214



>gi|66827201|ref|XP_646955.1| anaphase promoting complex subunit 10 [Dictyostelium discoideum
           AX4]
 gi|74859038|sp|Q55ER5.1|APC10_DICDI RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10
 gi|60475149|gb|EAL73085.1| anaphase promoting complex subunit 10 [Dictyostelium discoideum
           AX4]
          Length = 188

 Score = 94.4 bits (233), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 59/83 (71%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           EIG  A WS+SS K G+GV++LRD+N  T+WQSD   PH + IQFP+K  +  + +  +Y
Sbjct: 27  EIGKHASWSVSSAKPGSGVEQLRDNNLDTFWQSDAQQPHHITIQFPKKCYIENLLIHCDY 86

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
           K DESYTP KI+I+AGT   DLQ
Sbjct: 87  KLDESYTPCKISIKAGTILHDLQ 109



>gi|358060516|dbj|GAA93921.1| hypothetical protein E5Q_00567 [Mixia osmundae IAM 14324]
          Length = 190

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 67/91 (73%), Gaps = 2/91 (2%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVV 101
           + +H+  R++G  A WS+SS K G GV +L D +  T WQS+G  PHL+NIQF +++ + 
Sbjct: 28  DLRHK--RDVGRFAQWSVSSAKPGYGVQQLLDPSVETLWQSEGPQPHLINIQFRRRMPIT 85

Query: 102 QISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           Q+SL+++  +D+SYTP++I IRAG+ +GDLQ
Sbjct: 86  QVSLFVDVNTDDSYTPHRIAIRAGSFSGDLQ 116



>gi|353229474|emb|CCD75645.1| putative tbc1 domain family member [Schistosoma mansoni]
          Length = 355

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 62/85 (72%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++R++   A+WSLSS K G+G+D+L  ++  T+WQSDG  PH VNIQFP+K+ + ++ L+
Sbjct: 21  KVRDVCDHAVWSLSSCKPGHGIDQLLSESTDTFWQSDGPQPHCVNIQFPRKMILSKLCLY 80

Query: 107 LNYKSDESYTPNKITIRAGTHNGDL 131
            +YK DESYTP+++ IR G    DL
Sbjct: 81  TDYKVDESYTPSRLAIRVGNTIHDL 105



>gi|342185082|emb|CCC94564.1| putative anaphase promoting complex, subunit 10-like protein
           [Trypanosoma congolense IL3000]
          Length = 231

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 58/77 (75%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           A+WS+SS KHGNGV  L D +  T+WQSDG +PH+++I F +  +V  ++++L++  D S
Sbjct: 50  AVWSVSSAKHGNGVMCLLDGSHDTFWQSDGVVPHVISIDFARLTSVAVVAIYLDFAEDNS 109

Query: 115 YTPNKITIRAGTHNGDL 131
           YTP K+ ++AGTHNGD+
Sbjct: 110 YTPRKMRVQAGTHNGDM 126



>gi|407407786|gb|EKF31460.1| anaphase promoting complex subunit 10, putative [Trypanosoma cruzi
           marinkellei]
          Length = 256

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 59/77 (76%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           A+W++SS KHGNGV  L D +  T+WQSDG LPH+++I + +   V  ++L+L+++ DES
Sbjct: 48  AVWTVSSAKHGNGVTCLLDGSHSTFWQSDGVLPHVISIDYARLTPVSVVALYLDFQQDES 107

Query: 115 YTPNKITIRAGTHNGDL 131
           YTP KI +++GTH+GD+
Sbjct: 108 YTPRKIRVQSGTHSGDM 124



>gi|256081509|ref|XP_002577012.1| tbc1 domain family member [Schistosoma mansoni]
          Length = 533

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 62/85 (72%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++R++   A+WSLSS K G+G+D+L  ++  T+WQSDG  PH VNIQFP+K+ + ++ L+
Sbjct: 21  KVRDVCDHAVWSLSSCKPGHGIDQLLSESTDTFWQSDGPQPHCVNIQFPRKMILSKLCLY 80

Query: 107 LNYKSDESYTPNKITIRAGTHNGDL 131
            +YK DESYTP+++ IR G    DL
Sbjct: 81  TDYKVDESYTPSRLAIRVGNTIHDL 105



>gi|406866491|gb|EKD19531.1| anaphase promoting complex subunit 10 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 417

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 62/84 (73%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           LREIG+ A W++SS K G GVD LRDD+   +WQSDG  PH +NI F + V+++ I ++L
Sbjct: 226 LREIGNLASWTVSSCKPGCGVDALRDDDTGLFWQSDGPQPHHLNIHFSRLVSILSIRIFL 285

Query: 108 NYKSDESYTPNKITIRAGTHNGDL 131
           ++++DESYTP +IT+ AGT   DL
Sbjct: 286 DFEADESYTPTRITLLAGTAYHDL 309



>gi|403417991|emb|CCM04691.1| predicted protein [Fibroporia radiculosa]
          Length = 231

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L +IG  A WS+SS+K G G + LRD +  T+W SDG  PH + I+FP+KV + ++ L L
Sbjct: 60  LPDIGYLAKWSVSSFKFGFGPECLRDSDPETFWHSDGPQPHFITIEFPRKVAIQKLCLCL 119

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +Y+ D+SYTP  I +RAGT   DLQ
Sbjct: 120 SYQMDDSYTPATIAVRAGTGPSDLQ 144



>gi|254571777|ref|XP_002492998.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238032796|emb|CAY70819.1| hypothetical protein PAS_chr3_1218 [Komagataella pastoris GS115]
          Length = 192

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 63/89 (70%)

Query: 43  FKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQ 102
           F  + L EI S A WS+SS+KH NG+ +LR+DN  TYWQSDG LPH + + F +KV+V +
Sbjct: 16  FTKKGLVEISSLAWWSVSSYKHNNGLKELREDNPDTYWQSDGNLPHSLKLHFSKKVSVER 75

Query: 103 ISLWLNYKSDESYTPNKITIRAGTHNGDL 131
           ISL+ NY+ DESY+P  I++ +G    DL
Sbjct: 76  ISLFTNYQLDESYSPQVISVYSGNGEHDL 104



>gi|71419527|ref|XP_811195.1| anaphase promoting complex, subunit 10-like protein [Trypanosoma
           cruzi strain CL Brener]
 gi|70875831|gb|EAN89344.1| anaphase promoting complex, subunit 10-like protein [Trypanosoma
           cruzi]
          Length = 256

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 59/77 (76%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           AIW++SS KHGNGV  L D +  T+WQSDG LPH+++I + +   V  ++L+L+++ DES
Sbjct: 48  AIWTVSSAKHGNGVTCLLDGSHSTFWQSDGVLPHVISIDYARLTPVSVVALYLDFQQDES 107

Query: 115 YTPNKITIRAGTHNGDL 131
           YTP +I +++GTH+GD+
Sbjct: 108 YTPRRIRVQSGTHSGDM 124



>gi|320584174|gb|EFW98385.1| anaphase-promoting complex processivity factor Apc10, putative
           [Ogataea parapolymorpha DL-1]
          Length = 402

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 61/89 (68%)

Query: 43  FKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQ 102
            +H  L +IG+ A W +S++K G G+ +LR+D+  +YWQSDG  PH + I F ++V V +
Sbjct: 55  LEHLGLIDIGNLAAWGVSTYKQGYGIKELREDSPFSYWQSDGQQPHFITIHFTKRVTVQR 114

Query: 103 ISLWLNYKSDESYTPNKITIRAGTHNGDL 131
           +S + NY+ DESYTP+KI + AG+   DL
Sbjct: 115 LSFYFNYQLDESYTPSKILVLAGSGEHDL 143



>gi|388582841|gb|EIM23144.1| anaphase-promoting complex, subunit 10 [Wallemia sebi CBS 633.66]
          Length = 186

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 61/82 (74%)

Query: 51  IGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYK 110
           + S A WS+SS+K GN +D L D N  T WQSDG  PHL+ +QF ++V++ Q+S++L++ 
Sbjct: 6   LSSIAQWSVSSYKEGNVLDCLMDTNPDTVWQSDGPQPHLITLQFTRRVSINQVSMYLDHT 65

Query: 111 SDESYTPNKITIRAGTHNGDLQ 132
            D+SYTP  I+IRAGT+ GDLQ
Sbjct: 66  LDDSYTPKTISIRAGTYLGDLQ 87



>gi|407847079|gb|EKG02978.1| anaphase promoting complex subunit 10, putative [Trypanosoma cruzi]
          Length = 256

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 59/77 (76%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           A+W++SS KHGNGV  L D +  T+WQSDG LPH+++I + +   V  ++L+L+++ DES
Sbjct: 48  AVWTVSSAKHGNGVTCLLDGSHSTFWQSDGVLPHVISIDYARLTPVSVVALYLDFQQDES 107

Query: 115 YTPNKITIRAGTHNGDL 131
           YTP +I +++GTH+GD+
Sbjct: 108 YTPRRIRVQSGTHSGDM 124



>gi|71407839|ref|XP_806361.1| anaphase promoting complex subunit 10 [Trypanosoma cruzi strain CL
           Brener]
 gi|70870085|gb|EAN84510.1| anaphase promoting complex subunit 10, putative [Trypanosoma cruzi]
          Length = 256

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 59/77 (76%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           A+W++SS KHGNGV  L D +  T+WQSDG LPH+++I + +   V  ++L+L+++ DES
Sbjct: 48  AVWTVSSAKHGNGVTCLLDGSHSTFWQSDGVLPHVISIDYARLTPVSVVALYLDFQQDES 107

Query: 115 YTPNKITIRAGTHNGDL 131
           YTP +I +++GTH+GD+
Sbjct: 108 YTPRRIRVQSGTHSGDM 124



>gi|471899193|emb|CCO30486.1| Anaphase-promoting complex subunit 10 Short=APC10 [Rhizoctonia
           solani AG-1 IB]
          Length = 122

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 60/86 (69%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           +L +IG  A WS+SS+K+G  VD LRDD+  T+WQSDG  PH + +QF +KV V +I++ 
Sbjct: 8   KLPDIGHLATWSVSSYKYGFNVDCLRDDDPETFWQSDGPQPHFITLQFHKKVAVQKIAIL 67

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
           L +  D+SYTP ++ IRAG    DLQ
Sbjct: 68  LKFDQDDSYTPVRLAIRAGMSLNDLQ 93



>gi|392594858|gb|EIW84182.1| anaphase-promoting complex subunit 10 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 198

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + LRD +  T+W SDG  PH + I+FP+KV + +IS++L++
Sbjct: 20  DIGRLARWSVSSYKFGFGAECLRDGDPETFWHSDGPQPHFITIEFPRKVAIQKISIYLSW 79

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP+ I +RAGT   DLQ
Sbjct: 80  PQDDSYTPSTIAVRAGTGPSDLQ 102



>gi|465954477|gb|EMP25916.1| Anaphase-promoting complex subunit 10 [Chelonia mydas]
          Length = 116

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (77%)

Query: 65  GNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRA 124
           G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ +YKSDESYTP+KI++R 
Sbjct: 39  GFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRV 98

Query: 125 GTHNGDLQ 132
           G +  +LQ
Sbjct: 99  GNNFHNLQ 106



>gi|326427051|gb|EGD72621.1| hypothetical protein PTSG_04356 [Salpingoeca sp. ATCC 50818]
          Length = 198

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           R+IG S +W+LSS K G G+ +LRD +   YWQSDG  PHLV I+F Q+  +   S++++
Sbjct: 34  RDIGDSGVWTLSSCKAGFGIQQLRDPSTTIYWQSDGPQPHLVTIEFLQRTALASFSIYVD 93

Query: 109 YKSDESYTPNKITIRAGTHNGDLQ 132
              DESYTP  +++R G+H+ DL+
Sbjct: 94  STLDESYTPKTLSVRVGSHHHDLR 117



>gi|393221190|gb|EJD06675.1| anaphase-promoting complex, subunit 10 [Fomitiporia mediterranea
           MF3/22]
          Length = 219

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (69%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + LRD +  T+W SDG  PH V IQFP+K  V +ISL L++
Sbjct: 51  DIGHLAKWSVSSYKFGFGPECLRDGDPDTFWHSDGAQPHSVFIQFPRKTAVQKISLHLSF 110

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP+ I +RAGT  GDLQ
Sbjct: 111 PLDDSYTPSTICLRAGTSLGDLQ 133



>gi|336370694|gb|EGN99034.1| hypothetical protein SERLA73DRAFT_73609 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336383460|gb|EGO24609.1| hypothetical protein SERLADRAFT_438236 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 210

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + LRD +  T+W SDG  PH + I+FP+KV + +IS++L++
Sbjct: 42  DIGRLAKWSVSSYKFGFGTECLRDGDPDTFWHSDGPQPHFITIEFPRKVAIQKISIYLSW 101

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP+ + IRAGT   DLQ
Sbjct: 102 PQDDSYTPSTLAIRAGTGPSDLQ 124



>gi|470237864|ref|XP_004350889.1| anaphase promoting complex subunit 10 [Dictyostelium fasciculatum]
 gi|328865795|gb|EGG14181.1| anaphase promoting complex subunit 10 [Dictyostelium fasciculatum]
          Length = 194

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 62/87 (71%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++L +IG  A W LSS K G GVD+LRD++  T+WQSD   PH ++IQF ++  +  I L
Sbjct: 30  QDLVDIGEHATWLLSSAKPGFGVDQLRDESLSTFWQSDAPQPHTISIQFNKRYEIENILL 89

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQ 132
           + ++K DESYTP+KI+I+AGT   DL+
Sbjct: 90  YTDHKLDESYTPSKISIKAGTTFHDLE 116



>gi|308494404|ref|XP_003109391.1| hypothetical protein CRE_08300 [Caenorhabditis remanei]
 gi|308246804|gb|EFO90756.1| hypothetical protein CRE_08300 [Caenorhabditis remanei]
          Length = 216

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 62/88 (70%)

Query: 44  KHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQI 103
           K + L +I S AIW LSS K+G GVD+L  D+   YWQSDG  PH ++++F +K +V  +
Sbjct: 26  KDQPLLDISSQAIWCLSSCKNGYGVDELMSDSVEKYWQSDGPQPHTIHLEFQKKTDVAMM 85

Query: 104 SLWLNYKSDESYTPNKITIRAGTHNGDL 131
             +L++K+DESYTP+KI ++ G+ + D+
Sbjct: 86  MFYLDFKNDESYTPSKIQVKMGSSHQDI 113



>gi|395735392|ref|XP_002815232.2| PREDICTED: anaphase-promoting complex subunit 10 [Pongo abelii]
          Length = 182

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (77%)

Query: 65  GNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRA 124
           G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ +YKSDESYTP+KI++R 
Sbjct: 36  GFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRV 95

Query: 125 GTHNGDLQ 132
           G +  +LQ
Sbjct: 96  GNNFHNLQ 103



>gi|443896585|dbj|GAC73929.1| copper transporter [Pseudozyma antarctica T-34]
          Length = 301

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 70/104 (67%), Gaps = 3/104 (2%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSS--AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLP 87
           S+++  R+I   + +  ++ ++GS+    W+LSS+K G+GV +LR  +    WQSDG  P
Sbjct: 20  SRKKRPRRIYDVDDRSTKV-DVGSTPGTSWTLSSYKPGSGVAELRSADLTKLWQSDGNQP 78

Query: 88  HLVNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDL 131
           HLVNIQF ++  V  +S++L+ K D+SYTP KI I+AGT+  DL
Sbjct: 79  HLVNIQFARRTCVTHVSIFLDVKQDDSYTPTKIAIKAGTNYHDL 122



>gi|402224635|gb|EJU04697.1| galactose-binding like protein, partial [Dacryopinax sp. DJM-731
           SS1]
          Length = 163

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (71%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           A WS+SS K+G GV+ L DD+  T+WQSDG  PH + + FP++V V +ISL L+   DES
Sbjct: 1   ASWSVSSSKYGFGVECLYDDDPSTFWQSDGPQPHFITLYFPRQVKVQKISLHLDALQDES 60

Query: 115 YTPNKITIRAGTHNGDLQ 132
           YTPNK+ +RAGT   DLQ
Sbjct: 61  YTPNKLCVRAGTTVHDLQ 78



>gi|328770902|gb|EGF80943.1| hypothetical protein BATDEDRAFT_11110 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 186

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 57/85 (67%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           EL++I S A WSLSS K   GVD+L D N  TYWQSDG  PH +N+ F +   + Q+S++
Sbjct: 36  ELKDISSLAKWSLSSNKEAFGVDRLHDGNLDTYWQSDGPQPHYINMYFHKCWAIAQVSVY 95

Query: 107 LNYKSDESYTPNKITIRAGTHNGDL 131
           L++K DESYTP +I +R G    DL
Sbjct: 96  LDFKQDESYTPRQIALRVGNRVQDL 120



>gi|389750025|gb|EIM91196.1| anaphase-promoting complex subunit 10 [Stereum hirsutum FP-91666
           SS1]
          Length = 204

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 60/83 (72%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + L+D++  T+W SDG  PH V I+FP+K+ V +ISL+L++
Sbjct: 36  DIGHLAKWSVSSFKFGFGPECLQDNDPDTFWHSDGPQPHFVTIEFPRKMAVQKISLFLSF 95

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP  ++IRAGT   DLQ
Sbjct: 96  PLDDSYTPAALSIRAGTTASDLQ 118



>gi|403158039|ref|XP_003307384.2| hypothetical protein PGTG_00334 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375163653|gb|EFP74378.2| hypothetical protein PGTG_00334 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 204

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 58/84 (69%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++G   +WS+SS K G GV+ LRDD+  T WQS+G  PH + I+FP+K  V QIS++++ 
Sbjct: 25  DLGDLGLWSVSSAKPGFGVENLRDDSVHTLWQSEGPQPHFIRIEFPKKTIVTQISIFVDV 84

Query: 110 KSDESYTPNKITIRAGTHNGDLQV 133
             D+SYTP K++I  GT   DLQV
Sbjct: 85  TLDDSYTPCKLSISLGTFKQDLQV 108



>gi|261333814|emb|CBH16809.1| anaphase promoting complex, subunit 10-like protein, putative
           [Trypanosoma brucei gambiense DAL972]
          Length = 235

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 55/77 (71%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           A+WS+SS KHGNGV  L D +  T+WQSDG +PH+++I F     V  ++L+L+   D S
Sbjct: 50  AVWSVSSAKHGNGVMCLLDGSHNTFWQSDGVVPHVISIDFALLKPVAAVALYLDCAEDNS 109

Query: 115 YTPNKITIRAGTHNGDL 131
           YTP ++ ++AGTHNGD+
Sbjct: 110 YTPRRMRVQAGTHNGDM 126



>gi|71749400|ref|XP_828039.1| anaphase promoting complex subunit 10-like protein [Trypanosoma
           brucei]
 gi|70833423|gb|EAN78927.1| anaphase promoting complex, subunit 10-like protein [Trypanosoma
           brucei brucei strain 927/4 GUTat10.1]
          Length = 235

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 55/77 (71%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           A+WS+SS KHGNGV  L D +  T+WQSDG +PH+++I F     V  ++L+L+   D S
Sbjct: 50  AVWSVSSAKHGNGVMCLLDGSHNTFWQSDGVVPHVISIDFALLKPVAAVALYLDCAEDNS 109

Query: 115 YTPNKITIRAGTHNGDL 131
           YTP ++ ++AGTHNGD+
Sbjct: 110 YTPRRMRVQAGTHNGDM 126



>gi|406601603|emb|CCH46768.1| Anaphase-promoting complex subunit 10 [Wickerhamomyces ciferrii]
          Length = 230

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 60/84 (71%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L ++GS A W+ SS K  N V KLRD++  TYWQSDG  PH ++I F +KV++ +IS+++
Sbjct: 63  LVDVGSLASWTASSEKQDNEVMKLRDESPDTYWQSDGVQPHYIDIHFAKKVSISKISIYI 122

Query: 108 NYKSDESYTPNKITIRAGTHNGDL 131
           +Y  DESYTP+KIT+ AG    DL
Sbjct: 123 DYALDESYTPSKITVLAGNGFHDL 146



>gi|395324050|gb|EJF56498.1| APC10-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 227

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 59/83 (71%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + L D++  T+W SDG  PH + ++FP+KV++ ++S++L++
Sbjct: 58  DIGHLAKWSVSSFKFGFGAECLTDEDPDTFWHSDGPQPHFITVEFPRKVSIQKLSMYLSF 117

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP  I +RAGT   DLQ
Sbjct: 118 PMDDSYTPATIAVRAGTGPVDLQ 140



>gi|512204326|gb|EPE33149.1| Galactose-binding protein [Glarea lozoyensis ATCC 20868]
          Length = 348

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 60/84 (71%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EIG+ A W++SS K G GV+ LRDD+   +WQSDG  PH +NI F + V+++ I ++L
Sbjct: 145 LKEIGNLASWTVSSSKPGCGVEALRDDDTSLFWQSDGPQPHHLNIHFSRLVSILSIRIFL 204

Query: 108 NYKSDESYTPNKITIRAGTHNGDL 131
           ++ +DESYTP +I + AGT   DL
Sbjct: 205 DFAADESYTPTRIVLLAGTGYHDL 228



>gi|268565105|ref|XP_002639335.1| Hypothetical protein CBG03913 [Caenorhabditis briggsae]
          Length = 220

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 63/90 (70%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVV 101
           E +   L +I + AIW++SS K+G G+D+L  DN   YWQSDG  PH ++++F +K +V 
Sbjct: 29  EPRDSPLLDISNQAIWTVSSCKNGYGIDELMSDNVEKYWQSDGPQPHTIHLEFQKKTDVA 88

Query: 102 QISLWLNYKSDESYTPNKITIRAGTHNGDL 131
            +  +L+YK+DESYTP+KI I+ G+ + D+
Sbjct: 89  FMMFYLDYKNDESYTPSKIQIKLGSSHQDI 118



>gi|242214745|ref|XP_002473193.1| predicted protein [Postia placenta Mad-698-R]
 gi|220727695|gb|EED81606.1| predicted protein [Postia placenta Mad-698-R]
          Length = 149

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + LRDD   T+W SDG  PH + ++FP+KV V ++S+ L +
Sbjct: 6   DIGHLAKWSVSSYKFGFGPECLRDDEPDTFWHSDGPQPHFITLEFPRKVAVQKLSVCLCF 65

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP  I +RAGT   DLQ
Sbjct: 66  PLDDSYTPATIAVRAGTGPSDLQ 88



>gi|345563773|gb|EGX46758.1| hypothetical protein AOL_s00097g506 [Arthrobotrys oligospora ATCC
           24927]
          Length = 404

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 44/85 (51%), Positives = 59/85 (69%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EIG  A W++S+ K G GV +LR ++   +WQSDG  PHL+NI F ++V V +I ++L
Sbjct: 154 LKEIGHLASWTVSTSKPGCGVAELRSEDTNLFWQSDGPQPHLINIHFAKRVFVKRIRVFL 213

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +Y  DESYTP KI I AGT   DLQ
Sbjct: 214 DYGQDESYTPTKIAIYAGTGYHDLQ 238



>gi|281200809|gb|EFA75026.1| anaphase promoting complex subunit 10 [Polysphondylium pallidum
           PN500]
          Length = 225

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 60/85 (70%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L +IG +A W+LSS K G G+++L D+N  TYWQSD   PH +NIQF ++  +  + L+ 
Sbjct: 61  LVDIGKNATWTLSSAKPGFGIEQLLDENLSTYWQSDAPQPHTINIQFNRRYEIESLLLYT 120

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           ++K DESYTP+KI+I+ G+   DL+
Sbjct: 121 DFKEDESYTPSKISIKIGSTFHDLE 145



>gi|323508231|emb|CBQ68102.1| related to anaphase promoting complex subunit 10 [Sporisorium
           reilianum SRZ2]
          Length = 303

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 62/86 (72%), Gaps = 2/86 (2%)

Query: 50  EIGSS--AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           ++GS+    W+LSS+K G+GV +LR  +    WQSDG+ PHL+NIQF ++  V  +S++L
Sbjct: 40  DVGSAPGTSWTLSSYKPGSGVGELRSADLSKLWQSDGSQPHLINIQFARRTCVTHLSIFL 99

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQV 133
           + K D+SYTP KI+++AGT+  DL +
Sbjct: 100 DVKQDDSYTPTKISVKAGTNYHDLTL 125



>gi|341890478|gb|EGT46413.1| hypothetical protein CAEBREN_06735 [Caenorhabditis brenneri]
          Length = 216

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%)

Query: 44  KHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQI 103
           K   L +I S A+W+LSS K+G GVD+L  DN   YWQSDG  PH + ++F +K +V  +
Sbjct: 26  KDRPLLDISSQAVWALSSCKNGYGVDELLSDNVEKYWQSDGPQPHTILLEFQKKTDVAMM 85

Query: 104 SLWLNYKSDESYTPNKITIRAGTHNGDL 131
             + ++K+DESYTP+KI I+ G+ + D+
Sbjct: 86  MFYFDFKNDESYTPSKIQIKMGSSHQDI 113



>gi|409078210|gb|EKM78573.1| hypothetical protein AGABI1DRAFT_100625 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 196

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 57/83 (68%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++ S   WS+SS+K G G + LRD +  T+W SDG  PH + I+FP+KV + +IS++L+Y
Sbjct: 28  DVSSQGKWSVSSYKFGFGAECLRDGDPDTFWHSDGPQPHYITIEFPRKVAIQKISIFLSY 87

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP  + +RAGT   DLQ
Sbjct: 88  PQDDSYTPTTLAVRAGTGLSDLQ 110



>gi|58269076|ref|XP_571694.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57227929|gb|AAW44387.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 190

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 59/86 (68%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E  E+   A WS+SS K+G GVD LRD N  T+WQS+G  PH +++ FP+KV +  I++ 
Sbjct: 26  ERPELSHLAQWSVSSHKYGFGVDNLRDGNDSTFWQSEGAQPHTIDLAFPRKVMISAIAVH 85

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
           +++  D+SYTP+KI IR GT   DLQ
Sbjct: 86  MSHPRDDSYTPSKIGIRCGTGVHDLQ 111



>gi|134113060|ref|XP_774806.1| hypothetical protein CNBF2360 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257452|gb|EAL20159.1| hypothetical protein CNBF2360 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 190

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 59/86 (68%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E  E+   A WS+SS K+G GVD LRD N  T+WQS+G  PH +++ FP+KV +  I++ 
Sbjct: 26  ERPELSHLAQWSVSSHKYGFGVDNLRDGNDSTFWQSEGAQPHTIDLAFPRKVMISAIAVH 85

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
           +++  D+SYTP+KI IR GT   DLQ
Sbjct: 86  MSHPRDDSYTPSKIGIRCGTGVHDLQ 111



>gi|409048425|gb|EKM57903.1| hypothetical protein PHACADRAFT_158961 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 187

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (68%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + L+D +  T+W SDG  PH + I+FP+KV V ++S++L +
Sbjct: 21  DIGQMAKWSVSSFKFGFGPECLQDGDPETFWHSDGPQPHFITIEFPRKVAVQKLSIYLCF 80

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP  I +RAGT   DLQ
Sbjct: 81  PLDDSYTPATIAVRAGTGPLDLQ 103



>gi|426199202|gb|EKV49127.1| hypothetical protein AGABI2DRAFT_116179 [Agaricus bisporus var.
           bisporus H97]
          Length = 197

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 57/83 (68%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++ S   WS+SS+K G G + LRD +  T+W SDG  PH + ++FP+KV + +IS++L+Y
Sbjct: 29  DVSSQGKWSVSSYKFGFGAECLRDGDPDTFWHSDGPQPHYITVEFPRKVAIQKISIFLSY 88

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP  + +RAGT   DLQ
Sbjct: 89  PQDDSYTPTTLAVRAGTGLSDLQ 111



>gi|299749485|ref|XP_001836141.2| anaphase-promoting complex [Coprinopsis cinerea okayama7#130]
 gi|298408461|gb|EAU85650.2| anaphase-promoting complex [Coprinopsis cinerea okayama7#130]
          Length = 194

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 56/83 (67%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +I   A WS+SS+K G GV+ LRD +  T+W SDG  PH + ++FP KV + +IS+ L +
Sbjct: 36  DISDRAKWSVSSYKFGFGVECLRDGDPDTFWHSDGPQPHFITLEFPCKVAIQKISILLRF 95

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP+ + IRAGT   DLQ
Sbjct: 96  PLDDSYTPSTLAIRAGTGPSDLQ 118



>gi|321260060|ref|XP_003194750.1| hypothetical protein CGB_F3450W [Cryptococcus gattii WM276]
 gi|317461222|gb|ADV22963.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 185

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 59/86 (68%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E  E+   A WS+SS K+G GVD LRD N  T+WQS+G  PH +++ FP+KV +  I++ 
Sbjct: 26  ERPELSHLAQWSVSSHKYGFGVDNLRDGNDGTFWQSEGAQPHTIDLAFPRKVMISAIAVH 85

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
           +++  D+SYTP+KI IR GT   DLQ
Sbjct: 86  MSHPRDDSYTPSKIGIRCGTGVHDLQ 111



>gi|241673384|ref|XP_002399965.1| anaphase-promoting complex, subunit, putative [Ixodes scapularis]
 gi|215504164|gb|EEC13658.1| anaphase-promoting complex, subunit, putative [Ixodes scapularis]
          Length = 183

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 63/88 (71%)

Query: 45  HEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQIS 104
           H  +RE+GS A+WS+SS + G+GV +LRD +  T+WQSDG LPH +++QF +++++  + 
Sbjct: 14  HGRVREVGSQAVWSVSSGRRGHGVSQLRDGDLDTFWQSDGELPHRIDVQFGRRLSIQAVL 73

Query: 105 LWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           + + +  DE++TPN +++ AG    D++
Sbjct: 74  INVCHDLDENFTPNVVSVSAGNDPHDMR 101



>gi|302684263|ref|XP_003031812.1| hypothetical protein SCHCODRAFT_37734 [Schizophyllum commune H4-8]
 gi|300105505|gb|EFI96909.1| hypothetical protein SCHCODRAFT_37734, partial [Schizophyllum
           commune H4-8]
          Length = 145

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (68%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +I   A WS+SS+K G G + L D +  T+W SDG  PH ++I+FP+KV + ++SL+L++
Sbjct: 2   DISDKAKWSVSSFKFGFGAECLTDGDPDTFWHSDGPQPHFISIEFPKKVAIQKLSLFLSF 61

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP  I IRAGT   DLQ
Sbjct: 62  NEDDSYTPATIEIRAGTGANDLQ 84



>gi|313230985|emb|CBY18983.1| unnamed protein product [Oikopleura dioica]
          Length = 174

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 59/95 (62%)

Query: 37  KIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQ 96
           +++   +    L +IG+ AIWS+SS K    +  LRD+N  TYWQSDG  PH +  QF  
Sbjct: 4   QLLLKNYTQGNLPDIGNDAIWSVSSCKREFPISNLRDNNIDTYWQSDGNQPHTITCQFRS 63

Query: 97  KVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDL 131
           +  VV I L+ + KSDESYTP+ ITI+AG    DL
Sbjct: 64  RQQVVGILLYADSKSDESYTPSHITIKAGNDFNDL 98



>gi|501310677|dbj|GAC99435.1| potential anaphase-promoting complex processivity factor
           [Pseudozyma hubeiensis SY62]
          Length = 316

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 60/86 (69%), Gaps = 2/86 (2%)

Query: 50  EIGSS--AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           ++GSS    W+LSS+K G+GV +LR  +    WQSDG  PHL+NIQF ++  V  +S++L
Sbjct: 41  DVGSSPGTHWTLSSYKPGSGVSELRSADLTKLWQSDGNQPHLINIQFARRTCVTHLSIFL 100

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQV 133
           + K D+SYTP +I ++AGT+  DL +
Sbjct: 101 DVKQDDSYTPTRIAVKAGTNYHDLTL 126



>gi|390595528|gb|EIN04933.1| anaphase-promoting complex subunit 10 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 221

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 60/83 (72%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K+G G + L D++  T+W SDG  PH + ++FP+K+ + ++S++L++
Sbjct: 46  DIGRYAKWSVSSFKYGFGAECLIDNDPDTFWHSDGPQPHFITVEFPRKMAIQKLSIYLSF 105

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP+ + IRAGT   DLQ
Sbjct: 106 PLDDSYTPSTLAIRAGTGPSDLQ 128



>gi|328854174|gb|EGG03308.1| hypothetical protein MELLADRAFT_29060 [Melampsora larici-populina
           98AG31]
          Length = 130

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 58/83 (69%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++G  A+WS+SS K G GV +LRDD+  T WQS+G  PH + I+FP+K  V +IS++++ 
Sbjct: 1   DLGDRAVWSVSSAKPGFGVAQLRDDSIHTLWQSEGPQPHFIRIEFPKKTAVSRISIFVDV 60

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP +++I  G+   DLQ
Sbjct: 61  SMDDSYTPCRLSIAVGSFKQDLQ 83



>gi|353236924|emb|CCA68909.1| related to anaphase promoting complex subunit 10 [Piriformospora
           indica DSM 11827]
          Length = 189

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 60/83 (72%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG+ A WS+SSWK+G G++ LRD+N  T+W S+G  PH + ++FP++V V +I + L+ 
Sbjct: 20  DIGNLARWSVSSWKYGFGLECLRDNNPDTFWHSEGNQPHSITLEFPKRVAVQKIIVHLDQ 79

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
           K D+SYTP  I IRAGT   DLQ
Sbjct: 80  KKDDSYTPEIIGIRAGTSLRDLQ 102



>gi|219125124|ref|XP_002182838.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405632|gb|EEC45574.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 148

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (67%), Gaps = 2/84 (2%)

Query: 50  EIGSSAI-WSLSSWKHGNGVDKLRDDNFLTYWQSDGTL-PHLVNIQFPQKVNVVQISLWL 107
           EIG  A+ W LSS K GNGV+++RD +  TYWQSDGT  PH + + F ++V +  + L+L
Sbjct: 1   EIGREALCWQLSSAKPGNGVEQIRDKSVTTYWQSDGTAQPHWIQVHFGRRVAISHVCLYL 60

Query: 108 NYKSDESYTPNKITIRAGTHNGDL 131
           ++  DESYTP +ITI AG    DL
Sbjct: 61  DFSLDESYTPKRITIEAGMTTQDL 84



>gi|388855275|emb|CCF51169.1| related to anaphase promoting complex subunit 10 [Ustilago hordei]
          Length = 309

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 55/77 (71%)

Query: 57  WSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDESYT 116
           W+LSS+K G+GV +LR  +    WQSDG  PHL+NIQF ++  V  +S++L+ K D+SYT
Sbjct: 52  WTLSSYKPGSGVPELRSPDLTKLWQSDGNQPHLINIQFSRRTCVTHLSIYLDVKQDDSYT 111

Query: 117 PNKITIRAGTHNGDLQV 133
           P ++ ++AGT+  DL +
Sbjct: 112 PTRVAVKAGTNYHDLTM 128



>gi|71995011|ref|NP_001021777.1| Protein Y48G1C.12 [Caenorhabditis elegans]
 gi|373220040|emb|CCD71733.1| Protein Y48G1C.12 [Caenorhabditis elegans]
          Length = 216

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 60/88 (68%)

Query: 44  KHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQI 103
           K   L +I S AIW+LSS K G G+D+L  D+   YWQSDG  PH + ++F +K +V  +
Sbjct: 26  KDTPLLDISSQAIWALSSCKSGFGIDELLSDSVEKYWQSDGPQPHTILLEFQKKTDVAMM 85

Query: 104 SLWLNYKSDESYTPNKITIRAGTHNGDL 131
             +L++K+DESYTP+KI ++ G+ + D+
Sbjct: 86  MFYLDFKNDESYTPSKIQVKMGSSHQDI 113



>gi|402585479|gb|EJW79419.1| hypothetical protein WUBG_09670 [Wuchereria bancrofti]
          Length = 177

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 47  ELREIGSSAIWSLSSWK-HGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++R+I + A W+LSS K  G G+ +L DD+   YWQSDG  PH V I+F +K N+  + L
Sbjct: 34  DVRDISNQAFWTLSSCKTDGFGIQQLLDDDLEQYWQSDGPQPHTVTIEFSKKTNISYLLL 93

Query: 106 WLNYKSDESYTPNKITIRAGT 126
           +L+YK+DESYTP+K+ +R G+
Sbjct: 94  YLDYKTDESYTPSKVVVRLGS 114



>gi|392572960|gb|EIW66103.1| hypothetical protein TREMEDRAFT_70338 [Tremella mesenterica DSM
           1558]
          Length = 174

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           E+G  A WS+SS K+G GV+ L+D N  T+WQS+G  PH +++ FP++V +  I+L  ++
Sbjct: 25  ELGHLATWSVSSHKYGFGVENLQDGNENTFWQSEGPQPHTIDLAFPKRVFISSIALHTSH 84

Query: 110 KSDESYTPNKITIRAGTHNGDLQ 132
             D+SYTP+K++IRAGT   DLQ
Sbjct: 85  PRDDSYTPSKLSIRAGTGLHDLQ 107



>gi|71004322|ref|XP_756827.1| hypothetical protein UM00680.1 [Ustilago maydis 521]
 gi|46095629|gb|EAK80862.1| hypothetical protein UM00680.1 [Ustilago maydis 521]
          Length = 224

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 60/86 (69%), Gaps = 2/86 (2%)

Query: 50  EIGSS--AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           ++GSS    W+LSS+K G+GV +LR  +    WQSDG  PHL++IQF ++  V  +S++L
Sbjct: 40  DVGSSPGTQWTLSSYKPGSGVAELRSSDLTKLWQSDGNQPHLISIQFSRRTCVTHLSIYL 99

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQV 133
           + K D+SYTP KI ++AGT+  DL +
Sbjct: 100 DVKQDDSYTPTKIAVKAGTNYHDLTM 125



>gi|312065554|ref|XP_003135847.1| anaphase promoting complex subunit 10 [Loa loa]
 gi|307768997|gb|EFO28231.1| anaphase promoting complex subunit 10 [Loa loa]
          Length = 213

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 60/86 (69%), Gaps = 1/86 (1%)

Query: 47  ELREIGSSAIWSLSSWK-HGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++R+I + A W+LSS K  G G+ +L DD+   YWQSDG  PH V I+F +K N+  + L
Sbjct: 34  DVRDISNQAFWTLSSCKTDGFGIQQLLDDDLEQYWQSDGPQPHTVTIEFNKKTNISYLLL 93

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDL 131
           +L+YK+DESYTP+K+ +R G+   D+
Sbjct: 94  YLDYKTDESYTPSKVVVRLGSSVLDV 119



>gi|452986531|gb|EME86287.1| hypothetical protein MYCFIDRAFT_23413, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 158

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI S A W++S+ K GNGV  LR  +  T+WQSDG  PHL++I F + V++V + ++L
Sbjct: 2   LKEISSLASWTVSTAKPGNGVAALRSPDTTTFWQSDGPQPHLLSIHFFKLVSIVHMRIYL 61

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           ++ SDESYTP KI   AG    D+Q
Sbjct: 62  DFISDESYTPTKIQFLAGMGVHDIQ 86



>gi|19112595|ref|NP_595803.1| anaphase-promoting complex subunit Apc10 [Schizosaccharomyces pombe
           972h-]
 gi|26390994|sp|O42971.1|APC10_SCHPO RecName: Full=Anaphase-promoting complex subunit 10; AltName:
           Full=20S cyclosome/APC complex protein apc10
 gi|2842526|emb|CAA16839.1| anaphase-promoting complex subunit Apc10 [Schizosaccharomyces
           pombe]
 gi|3402334|dbj|BAA32157.1| Apc10 (anaphase promoting complex) [Schizosaccharomyces pombe]
          Length = 189

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           E   +IG+ A W+ SS K G  +  +RDDN  TYWQSDG+ PH ++I+F ++V++  +S+
Sbjct: 21  EGFVDIGNLAQWTCSSEKSGFPIRLVRDDNIDTYWQSDGSQPHTIHIKFVKRVSIKYVSM 80

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQV 133
           +L Y  DESYTP+ + I AGT   DL++
Sbjct: 81  YLQYTLDESYTPSTLRISAGTGFQDLEI 108



>gi|393246511|gb|EJD54020.1| anaphase-promoting complex, subunit 10 [Auricularia delicata
           TFB-10046 SS5]
          Length = 202

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 57/86 (66%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E  +IG    WS+SS+K G G + LRDD+  T+W SDG  PH V + F ++V + +I+L+
Sbjct: 31  EHPDIGDLGTWSVSSFKFGFGTECLRDDDPGTFWHSDGPQPHHVTVHFARRVAIQKIALY 90

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
           + ++ D+SYTP  + +RAGT   DLQ
Sbjct: 91  IAFQQDDSYTPQALLLRAGTSLNDLQ 116



>gi|392564646|gb|EIW57824.1| anaphase-promoting complex subunit 10 [Trametes versicolor
           FP-101664 SS1]
          Length = 225

 Score = 85.1 bits (209), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 57/86 (66%), Gaps = 3/86 (3%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQS---DGTLPHLVNIQFPQKVNVVQISLW 106
           +IG  A WS+SS+K G G + L DD+  T+W S   DG  PH V I+FP+KV V ++S+ 
Sbjct: 53  DIGGLAKWSVSSFKFGFGPECLTDDDPETFWHSSSSDGPQPHFVTIEFPRKVAVQKLSIH 112

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQ 132
           L+Y  D+SYTP  I +RAGT   D+Q
Sbjct: 113 LSYPLDDSYTPANICVRAGTGPVDIQ 138



>gi|452845284|gb|EME47217.1| hypothetical protein DOTSEDRAFT_145664 [Dothistroma septosporum
           NZE10]
          Length = 282

 Score = 85.1 bits (209), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%)

Query: 41  SEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           + F    L+EI S A W++S+ K GNGV  LR  +   +WQSDG  PHL++I F + V++
Sbjct: 64  TPFPPPGLKEISSLASWTVSTAKPGNGVAALRSPDTSHFWQSDGPQPHLLSIHFFKLVSI 123

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           V I ++L++ +DESYTP K+   AG    D+Q
Sbjct: 124 VHIRIYLDFAADESYTPTKVQFLAGMGIHDIQ 155



>gi|358377857|gb|EHK15540.1| hypothetical protein TRIVIDRAFT_232648 [Trichoderma virens Gv29-8]
          Length = 404

 Score = 85.1 bits (209), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 56/84 (66%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV++LR D+  +YWQSDG  PH + I F ++V +  I  ++
Sbjct: 194 LKEISNLGKFTVSSHKPGNGVEQLRSDDLTSYWQSDGPQPHKLTIYFVKRVGIRDIRFYV 253

Query: 108 NYKSDESYTPNKITIRAGTHNGDL 131
           NY  DESYTP KI  ++GT   +L
Sbjct: 254 NYNEDESYTPTKIIFKSGTSENNL 277



>gi|170594453|ref|XP_001901978.1| Anaphase promoting complex subunit 10 [Brugia malayi]
 gi|158590922|gb|EDP29537.1| Anaphase promoting complex subunit 10, putative [Brugia malayi]
          Length = 213

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 60/86 (69%), Gaps = 1/86 (1%)

Query: 47  ELREIGSSAIWSLSSWK-HGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++R+I + A W+LSS K  G G+ +L D++   YWQSDG  PH V I+F +K N+  + L
Sbjct: 34  DVRDISNQAFWTLSSCKTDGFGIQQLLDEDLEQYWQSDGPQPHTVTIEFSRKTNISYLLL 93

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDL 131
           +L+YK+DESYTP+K+ +R G+   D+
Sbjct: 94  YLDYKTDESYTPSKVVVRLGSSVLDV 119



>gi|471574616|gb|EMR72421.1| putative anaphase-promoting complex subunit 10 protein [Eutypa lata
           UCREL1]
          Length = 289

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (71%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI + A +++SS+K G GV +LRDD+   +WQSDG  PH +NI F ++V +  + L+L
Sbjct: 71  LKEISNLASFTVSSYKPGCGVKELRDDDVNQFWQSDGPQPHRLNIHFIKRVEIRALRLYL 130

Query: 108 NYKSDESYTPNKITIRAG 125
           +Y+ DESYTP KI I AG
Sbjct: 131 DYELDESYTPTKIQITAG 148



>gi|453087085|gb|EMF15126.1| galactose-binding like protein [Mycosphaerella populorum SO2202]
          Length = 325

 Score = 84.7 bits (208), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 57/84 (67%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI S A W++S+ K GNGV  LR  +   +WQSDG  PHL++I F + V++V++ ++L
Sbjct: 99  LKEISSLASWTVSTAKPGNGVLALRSADVAQFWQSDGPQPHLLSIHFFKLVSIVRMRIYL 158

Query: 108 NYKSDESYTPNKITIRAGTHNGDL 131
           +Y SDESYTP KI   AG    DL
Sbjct: 159 DYLSDESYTPTKIQFLAGMGVHDL 182



>gi|380479957|emb|CCF42709.1| anaphase-promoting complex subunit 10 [Colletotrichum higginsianum]
          Length = 342

 Score = 84.3 bits (207), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (67%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV++LRDD+  TYWQSDG  PH + + F ++V +  I  ++
Sbjct: 145 LKEISNLGKFTVSSHKQGNGVEQLRDDSLKTYWQSDGPQPHKLTVYFIKRVGIRDIRFFV 204

Query: 108 NYKSDESYTPNKITIRAGTHNGDL 131
           +Y  DESYTP KI  ++GT   +L
Sbjct: 205 DYSEDESYTPTKIIFKSGTSENNL 228



>gi|398408289|ref|XP_003855610.1| hypothetical protein MYCGRDRAFT_28674, partial [Zymoseptoria
           tritici IPO323]
 gi|339475494|gb|EGP90586.1| hypothetical protein MYCGRDRAFT_28674 [Zymoseptoria tritici IPO323]
          Length = 137

 Score = 84.3 bits (207), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI S A W++S+ K GNGV  LR  +   +WQSDG  PHL++I F + V++V + ++L
Sbjct: 2   LKEISSLASWTVSTAKPGNGVAALRSPDTSMFWQSDGPQPHLLSIHFFKLVSIVHMRIFL 61

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQ 132
           +++SDESYTP KI   AG    D+Q
Sbjct: 62  DFQSDESYTPTKIQFLAGMGVHDIQ 86



>gi|238580811|ref|XP_002389407.1| hypothetical protein MPER_11466 [Moniliophthora perniciosa FA553]
 gi|215451641|gb|EEB90337.1| hypothetical protein MPER_11466 [Moniliophthora perniciosa FA553]
          Length = 122

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 55/82 (67%)

Query: 51  IGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYK 110
           I S   WS+SS+K G G + L D    T+W SDG  PH + I+FP+KV + ++S++L++ 
Sbjct: 21  ISSQGKWSVSSYKFGFGAECLLDGEPDTFWHSDGPQPHFITIEFPRKVAIQKLSIYLSHP 80

Query: 111 SDESYTPNKITIRAGTHNGDLQ 132
            D+SYTP+ + IRAGT   DLQ
Sbjct: 81  QDDSYTPSTLAIRAGTGPSDLQ 102



>gi|260940176|ref|XP_002614388.1| hypothetical protein CLUG_05874 [Clavispora lusitaniae ATCC 42720]
 gi|238852282|gb|EEQ41746.1| hypothetical protein CLUG_05874 [Clavispora lusitaniae ATCC 42720]
          Length = 322

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 57/94 (60%), Gaps = 17/94 (18%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTL-----------------PHLVNIQFPQK 97
           A W LSS K G G+D+LRDD   TYWQSDG+                  PH V +QF +K
Sbjct: 78  ATWKLSSCKQGYGLDQLRDDTPSTYWQSDGSTENTIEQQANAENAQLNHPHTVTLQFSKK 137

Query: 98  VNVVQISLWLNYKSDESYTPNKITIRAGTHNGDL 131
           V++ +IS++ NY+ DESYTP++I I AG  N DL
Sbjct: 138 VSLERISIFTNYQLDESYTPSRIKIMAGNSNWDL 171



>gi|164658686|ref|XP_001730468.1| hypothetical protein MGL_2264 [Malassezia globosa CBS 7966]
 gi|159104364|gb|EDP43254.1| hypothetical protein MGL_2264 [Malassezia globosa CBS 7966]
          Length = 231

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (66%)

Query: 57  WSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDESYT 116
           W LSS K  +G+ +L  D+  T WQSDG  PHLV I FP++  V  +S++L+   D+SYT
Sbjct: 27  WMLSSAKARHGIAQLTSDDLDTLWQSDGIQPHLVTIHFPRRTPVTHLSIYLDCCRDDSYT 86

Query: 117 PNKITIRAGTHNGDL 131
           P KI ++AGTH  DL
Sbjct: 87  PTKILVKAGTHPYDL 101



>gi|50552486|ref|XP_503653.1| YALI0E07117p [Yarrowia lipolytica]
 gi|49649522|emb|CAG79235.1| YALI0E07117p [Yarrowia lipolytica CLIB122]
          Length = 184

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 59/82 (71%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++GS A WS+SS K G GV+ LR D+   +WQSDG  PH ++I F ++V++ ++S++ +Y
Sbjct: 21  DLGSLAHWSVSSHKTGCGVEALRSDDHQLFWQSDGPQPHHLDIHFSKRVSIERVSIYTDY 80

Query: 110 KSDESYTPNKITIRAGTHNGDL 131
           + DESYTP+KI I AG+   DL
Sbjct: 81  ELDESYTPSKIKILAGSGYHDL 102



>gi|511011748|gb|EPB92953.1| hypothetical protein HMPREF1544_00027 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 284

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (65%), Gaps = 4/88 (4%)

Query: 49  REIGS-SAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLP---HLVNIQFPQKVNVVQIS 104
           REIG   AIWS+SS++   G DKLRD+N LTYWQSD   P   H +++ F Q   + Q+S
Sbjct: 112 REIGEHEAIWSVSSFRPHWGPDKLRDNNALTYWQSDCPNPQLNHTIDLSFHQATLIRQVS 171

Query: 105 LWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           ++++Y  DESYTP  I +R GT   DLQ
Sbjct: 172 VFIDYFQDESYTPKTIMVRGGTTYRDLQ 199



>gi|477536047|gb|ENH87532.1| anaphase promoting complex subunit 10 [Colletotrichum orbiculare
           MAFF 240422]
          Length = 366

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 55/79 (69%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGVD+LR+D+  TYWQSDG  PH + + F ++V +  I  ++
Sbjct: 163 LKEISNLGKFTVSSHKQGNGVDQLRNDSLKTYWQSDGPQPHKLTVYFIKRVGIRDIRFYV 222

Query: 108 NYKSDESYTPNKITIRAGT 126
           ++  DESYTP KI  ++GT
Sbjct: 223 DFNEDESYTPTKIVFKSGT 241



>gi|401414618|ref|XP_003871806.1| anaphase promoting complex, subunit 10-like protein [Leishmania
           mexicana MHOM/GT/2001/U1103]
 gi|322488026|emb|CBZ23271.1| anaphase promoting complex, subunit 10-like protein [Leishmania
           mexicana MHOM/GT/2001/U1103]
          Length = 330

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 57/85 (67%), Gaps = 3/85 (3%)

Query: 50  EIGSSA--IWSLSSWKHGNGVDKL-RDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++G S   +W++SS KHGNGV  L R  +   +WQSDG LPH++ IQ  Q   V  ++++
Sbjct: 53  DVGCSGNTVWTVSSAKHGNGVRHLMRHHDLNNFWQSDGVLPHVIRIQLGQLTPVEAMAVY 112

Query: 107 LNYKSDESYTPNKITIRAGTHNGDL 131
           +N   D+SY+P  I ++AGTHNGD+
Sbjct: 113 VNSAVDQSYSPRVIRVKAGTHNGDM 137



>gi|213407856|ref|XP_002174699.1| anaphase-promoting complex subunit 10 [Schizosaccharomyces
           japonicus yFS275]
 gi|212002746|gb|EEB08406.1| anaphase-promoting complex subunit 10 [Schizosaccharomyces
           japonicus yFS275]
          Length = 178

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%)

Query: 38  IIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQK 97
           I + E K   L ++G+ A WS S+ K G  +  +RDD+  TYWQSDG+ PH++  +F ++
Sbjct: 3   ITEHEKKIHGLVDVGNLAQWSASTEKTGFPISNVRDDDINTYWQSDGSQPHVLYAKFIKR 62

Query: 98  VNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQ 132
           V +  +S++L Y  DESYTP+KI I AGT   DLQ
Sbjct: 63  VEIKYLSIYLMYSLDESYTPSKIRIAAGTGLHDLQ 97



>gi|429863828|gb|ELA38235.1| anaphase promoting complex subunit 10 [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 260

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (66%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGVD+LR D+  +YWQSDG  PH + + F ++V +  I  ++
Sbjct: 59  LKEISNLGKFTVSSHKQGNGVDQLRHDSLKSYWQSDGPQPHKLTVYFIKRVGIRDIRFYV 118

Query: 108 NYKSDESYTPNKITIRAGTHNGDL 131
           +Y  DESYTP KI  ++GT   +L
Sbjct: 119 DYNEDESYTPTKIIFKSGTSENNL 142



>gi|344304948|gb|EGW35180.1| hypothetical protein SPAPADRAFT_146140 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 332

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 62/93 (66%), Gaps = 5/93 (5%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGT-----LPHLVNIQFPQ 96
           E +  +L ++   A W LSS+K G G+ +LRDD+  TYWQSDG+     L H + IQF +
Sbjct: 90  ELESLQLFDLSPLANWKLSSYKPGFGLVQLRDDSPDTYWQSDGSNQGNNLQHSITIQFSK 149

Query: 97  KVNVVQISLWLNYKSDESYTPNKITIRAGTHNG 129
           KV + +IS++ NY  DESYTP+KI I AG+ +G
Sbjct: 150 KVALERISIFTNYSLDESYTPSKIKIMAGSCDG 182