BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10401_c0_seq2-m.159 complete 122-784(-) 221 (-)
         (220 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|432918759|ref|XP_004079652.1| PREDICTED: anaphase-promoting c...   179   3e-43   Oryzias latipes [Japanese rice fish]
gi|47209318|emb|CAF92702.1| unnamed protein product [Tetraodon n...   179   4e-43   Tetraodon nigroviridis
gi|170049407|ref|XP_001855904.1| anaphase-promoting complex subu...   179   5e-43   Culex quinquefasciatus
gi|348538028|ref|XP_003456494.1| PREDICTED: anaphase-promoting c...   179   5e-43   Oreochromis niloticus
gi|472584744|gb|EMS22330.1| anaphase promoting complex subunit 1...   178   7e-43   Rhodotorula toruloides NP11
gi|157117126|ref|XP_001652947.1| anaphase-promoting complex [Aed...   177   2e-42   Aedes aegypti
gi|291239008|ref|XP_002739417.1| PREDICTED: anaphase promoting c...   177   2e-42   Saccoglossus kowalevskii
gi|410930143|ref|XP_003978458.1| PREDICTED: anaphase-promoting c...   176   4e-42   
gi|156376950|ref|XP_001630621.1| predicted protein [Nematostella...   176   4e-42   Nematostella vectensis
gi|62858451|ref|NP_001016392.1| anaphase promoting complex subun...   176   4e-42   Xenopus tropicalis [western clawed frog]
gi|168015724|ref|XP_001760400.1| predicted protein [Physcomitrel...   176   4e-42   Physcomitrella patens
gi|148234881|ref|NP_001089057.1| uncharacterized protein LOC5950...   176   5e-42   Xenopus laevis [clawed frog]
gi|507686390|ref|XP_004640766.1| PREDICTED: anaphase-promoting c...   175   6e-42   Octodon degus
gi|147899801|ref|NP_001089271.1| anaphase promoting complex subu...   175   7e-42   Xenopus laevis [clawed frog]
gi|224049376|ref|XP_002188840.1| PREDICTED: anaphase-promoting c...   175   7e-42   
gi|390608650|ref|NP_001254625.1| anaphase promoting complex subu...   175   8e-42   Danio rerio [leopard danio]
gi|126331333|ref|XP_001367156.1| PREDICTED: anaphase-promoting c...   174   1e-41   Monodelphis domestica
gi|326918378|ref|XP_003205466.1| PREDICTED: anaphase-promoting c...   174   1e-41   Meleagris gallopavo [common turkey]
gi|56605928|ref|NP_001008467.1| anaphase-promoting complex subun...   174   1e-41   Gallus gallus [bantam]
gi|297293455|ref|XP_001094665.2| PREDICTED: anaphase-promoting c...   174   1e-41   
gi|149635632|ref|XP_001514225.1| PREDICTED: anaphase-promoting c...   174   1e-41   Ornithorhynchus anatinus [duck-billed platypus]
gi|119625457|gb|EAX05052.1| anaphase promoting complex subunit 1...   174   1e-41   Homo sapiens [man]
gi|512934663|ref|XP_004907714.1| PREDICTED: anaphase-promoting c...   174   1e-41   
gi|332820473|ref|XP_001141102.2| PREDICTED: anaphase-promoting c...   174   2e-41   
gi|507705099|ref|XP_004645503.1| PREDICTED: anaphase-promoting c...   174   2e-41   Octodon degus
gi|402870559|ref|XP_003899281.1| PREDICTED: anaphase-promoting c...   174   2e-41   
gi|348582258|ref|XP_003476893.1| PREDICTED: anaphase-promoting c...   174   2e-41   Cavia porcellus [guinea pig]
gi|332217333|ref|XP_003257814.1| PREDICTED: anaphase-promoting c...   174   2e-41   Nomascus leucogenys [White-cheeked Gibbon]
gi|332217335|ref|XP_003257815.1| PREDICTED: anaphase-promoting c...   174   2e-41   Nomascus leucogenys [White-cheeked Gibbon]
gi|35900980|ref|NP_081180.1| anaphase-promoting complex subunit ...   174   2e-41   Mus musculus [mouse]
gi|375493585|ref|NP_001243638.1| anaphase-promoting complex subu...   174   2e-41   Homo sapiens [man]
gi|150170706|ref|NP_055700.2| anaphase-promoting complex subunit...   173   2e-41   Homo sapiens [man]
gi|291401170|ref|XP_002716972.1| PREDICTED: anaphase promoting c...   173   2e-41   
gi|327273880|ref|XP_003221707.1| PREDICTED: anaphase-promoting c...   173   2e-41   Anolis carolinensis [Carolina anole]
gi|4836700|gb|AAD30527.1| anaphase promoting complex subunit 10 ...   173   2e-41   Homo sapiens [man]
gi|72013135|ref|XP_783681.1| PREDICTED: anaphase-promoting compl...   173   3e-41   
gi|505792795|ref|XP_004606254.1| PREDICTED: anaphase-promoting c...   173   3e-41   Sorex araneus [Eurasian shrew]
gi|122692361|ref|NP_001073826.1| anaphase-promoting complex subu...   172   4e-41   Bos taurus [bovine]
gi|507671085|ref|XP_004708754.1| PREDICTED: anaphase-promoting c...   172   5e-41   Echinops telfairi [lesser hedgehog tenrec]
gi|114051628|ref|NP_001040166.1| anaphase promoting complex subu...   172   6e-41   Bombyx mori [silk moth]
gi|357619554|gb|EHJ72080.1| anaphase promoting complex subunit 1...   172   7e-41   Danaus plexippus [American monarch]
gi|295444976|ref|NP_001171398.1| anaphase promoting complex subu...   172   8e-41   Sus scrofa [pigs]
gi|5262509|emb|CAB45705.1| hypothetical protein [Homo sapiens] >...   171   1e-40   Homo sapiens [man]
gi|380023096|ref|XP_003695365.1| PREDICTED: anaphase-promoting c...   171   2e-40   Apis florea [dwarf honeybee]
gi|66531676|ref|XP_396738.2| PREDICTED: anaphase-promoting compl...   170   2e-40   Apis mellifera [European honey bee]
gi|91081555|ref|XP_975078.1| PREDICTED: similar to anaphase prom...   169   3e-40   
gi|332375763|gb|AEE63022.1| unknown [Dendroctonus ponderosae]         169   4e-40   Dendroctonus ponderosae
gi|384253180|gb|EIE26655.1| anaphase-promoting complex, subunit ...   169   4e-40   Coccomyxa subellipsoidea C-169
gi|443684651|gb|ELT88523.1| hypothetical protein CAPTEDRAFT_1623...   169   4e-40   Capitella teleta
gi|355687635|gb|EHH26219.1| hypothetical protein EGK_16132 [Maca...   169   4e-40   Macaca mulatta [rhesus macaque]
gi|499050789|ref|XP_004575911.1| PREDICTED: anaphase-promoting c...   169   5e-40   Maylandia zebra
gi|513000035|ref|XP_004861555.1| PREDICTED: anaphase-promoting c...   169   5e-40   
gi|355749598|gb|EHH53997.1| hypothetical protein EGM_14726 [Maca...   169   6e-40   Macaca fascicularis [crab eating macaque]
gi|426251527|ref|XP_004019473.1| PREDICTED: anaphase-promoting c...   168   7e-40   
gi|312377680|gb|EFR24453.1| hypothetical protein AND_10959 [Anop...   168   7e-40   
gi|158300919|ref|XP_320716.4| AGAP011799-PA [Anopheles gambiae s...   168   8e-40   Anopheles gambiae str. PEST
gi|462398148|gb|EMJ03816.1| hypothetical protein PRUPE_ppa011884...   167   1e-39   Prunus persica
gi|470128019|ref|XP_004299953.1| PREDICTED: anaphase-promoting c...   167   1e-39   
gi|307195501|gb|EFN77387.1| Anaphase-promoting complex subunit 1...   167   1e-39   Harpegnathos saltator
gi|470102898|ref|XP_004287887.1| PREDICTED: anaphase-promoting c...   167   1e-39   Fragaria vesca subsp. vesca
gi|508699163|gb|EOX91059.1| Anaphase promoting complex 10 isofor...   167   2e-39   Theobroma cacao [chocolate]
gi|383859168|ref|XP_003705068.1| PREDICTED: anaphase-promoting c...   167   2e-39   Megachile rotundata
gi|16975123|pdb|1JHJ|A Chain A, Crystal Structure Of The Apc10DO...   167   2e-39   Homo sapiens [man]
gi|428167359|gb|EKX36320.1| hypothetical protein GUITHDRAFT_1586...   167   2e-39   Guillardia theta CCMP2712
gi|193606239|ref|XP_001950033.1| PREDICTED: anaphase-promoting c...   167   2e-39   Acyrthosiphon pisum
gi|195455839|ref|XP_002074889.1| GK23298 [Drosophila willistoni]...   166   3e-39   Drosophila willistoni
gi|307191142|gb|EFN74840.1| Anaphase-promoting complex subunit 1...   166   3e-39   Camponotus floridanus
gi|156549338|ref|XP_001601344.1| PREDICTED: anaphase-promoting c...   166   3e-39   Nasonia vitripennis
gi|332016291|gb|EGI57204.1| Anaphase-promoting complex subunit 1...   166   3e-39   Acromyrmex echinatior
gi|340729497|ref|XP_003403037.1| PREDICTED: anaphase-promoting c...   166   3e-39   Bombus terrestris [large earth bumblebee]
gi|322799261|gb|EFZ20652.1| hypothetical protein SINV_01375 [Sol...   166   3e-39   Solenopsis invicta [imported red fire ant]
gi|449664364|ref|XP_002160509.2| PREDICTED: uncharacterized prot...   166   4e-39   
gi|260806773|ref|XP_002598258.1| hypothetical protein BRAFLDRAFT...   165   6e-39   Branchiostoma floridae
gi|21592739|gb|AAM64688.1| unknown [Arabidopsis thaliana]             165   7e-39   Arabidopsis thaliana [mouse-ear cress]
gi|302780585|ref|XP_002972067.1| hypothetical protein SELMODRAFT...   165   9e-39   Selaginella moellendorffii
gi|198434262|ref|XP_002131938.1| PREDICTED: anaphase-promoting c...   165   1e-38   Ciona intestinalis [sea vase]
gi|298711511|emb|CBJ26599.1| Putative subunit of the Anaphase Pr...   164   1e-38   Ectocarpus siliculosus
gi|301096061|ref|XP_002897129.1| anaphase-promoting complex subu...   164   1e-38   Phytophthora infestans T30-4
gi|195123817|ref|XP_002006398.1| GI21024 [Drosophila mojavensis]...   164   2e-38   Drosophila mojavensis
gi|18398701|ref|NP_565433.1| anaphase-promoting complex subunit ...   164   2e-38   Arabidopsis thaliana [mouse-ear cress]
gi|194880742|ref|XP_001974521.1| GG21047 [Drosophila erecta] >gi...   164   2e-38   Drosophila erecta
gi|195382745|ref|XP_002050089.1| GJ21948 [Drosophila virilis] >g...   164   2e-38   Drosophila virilis
gi|499013761|ref|XP_004537616.1| PREDICTED: anaphase-promoting c...   164   2e-38   
gi|508699164|gb|EOX91060.1| Anaphase promoting complex 10 isofor...   164   2e-38   Theobroma cacao [chocolate]
gi|125807963|ref|XP_001360579.1| GA10993 [Drosophila pseudoobscu...   164   2e-38   Drosophila pseudoobscura pseudoobscura
gi|224134260|ref|XP_002327795.1| predicted protein [Populus tric...   164   2e-38   
gi|297836562|ref|XP_002886163.1| anaphase-promoting complex, sub...   163   2e-38   Arabidopsis lyrata subsp. lyrata
gi|28573741|ref|NP_611223.4| anaphase promoting complex subunit ...   163   2e-38   Drosophila melanogaster
gi|308808844|ref|XP_003081732.1| Anaphase-promoting complex, sub...   163   2e-38   Ostreococcus tauri
gi|194755361|ref|XP_001959960.1| GF11781 [Drosophila ananassae] ...   163   2e-38   Drosophila ananassae
gi|224094807|ref|XP_002310244.1| predicted protein [Populus tric...   163   2e-38   Populus trichocarpa [western balsam poplar]
gi|219884719|gb|ACL52734.1| unknown [Zea mays] >gi|413948345|gb|...   163   2e-38   Zea mays [maize]
gi|242091253|ref|XP_002441459.1| hypothetical protein SORBIDRAFT...   163   3e-38   Sorghum bicolor [broomcorn]
gi|145351293|ref|XP_001420017.1| predicted protein [Ostreococcus...   163   3e-38   Ostreococcus lucimarinus CCE9901
gi|388512629|gb|AFK44376.1| unknown [Medicago truncatula]             162   4e-38   Medicago truncatula
gi|255079740|ref|XP_002503450.1| predicted protein [Micromonas s...   162   4e-38   Micromonas commoda
gi|482567332|gb|EOA31521.1| hypothetical protein CARUB_v10014711...   162   5e-38   Capsella rubella
gi|478253336|gb|ENN73697.1| hypothetical protein YQE_09694, part...   162   5e-38   Dendroctonus ponderosae
gi|391346994|ref|XP_003747750.1| PREDICTED: anaphase-promoting c...   162   6e-38   Metaseiulus occidentalis
gi|255561114|ref|XP_002521569.1| anaphase-promoting complex, put...   162   6e-38   Ricinus communis
gi|506968775|gb|AGM32731.1| APC10 subunit of the anaphase-promot...   162   7e-38   Coptotermes formosanus
gi|348680677|gb|EGZ20493.1| hypothetical protein PHYSODRAFT_2459...   162   7e-38   Phytophthora sojae
gi|449446698|ref|XP_004141108.1| PREDICTED: anaphase-promoting c...   161   9e-38   Cucumis sativus [cucumbers]
gi|403330992|gb|EJY64414.1| Anaphase-promoting complex (APC), su...   161   1e-37   Oxytricha trifallax
gi|195027301|ref|XP_001986522.1| GH20482 [Drosophila grimshawi] ...   161   1e-37   Drosophila grimshawi
gi|470319387|gb|EMR11006.1| hypothetical protein PNEG_00607 [Pne...   161   1e-37   Pneumocystis murina B123
gi|242006722|ref|XP_002424196.1| anaphase-promoting complex subu...   160   1e-37   Pediculus humanus corporis [human body lice]
gi|226528224|ref|NP_001148648.1| anaphase-promoting complex subu...   160   2e-37   Zea mays [maize]
gi|430813297|emb|CCJ29329.1| unnamed protein product [Pneumocyst...   160   2e-37   Pneumocystis jirovecii
gi|502153256|ref|XP_004509275.1| PREDICTED: anaphase-promoting c...   160   2e-37   Cicer arietinum [garbanzo]
gi|326519366|dbj|BAJ96682.1| predicted protein [Hordeum vulgare ...   160   2e-37   Hordeum vulgare subsp. vulgare [barley]
gi|460375459|ref|XP_004233523.1| PREDICTED: anaphase-promoting c...   160   3e-37   Solanum lycopersicum
gi|159471183|ref|XP_001693736.1| anaphase promoting complex subu...   159   3e-37   Chlamydomonas reinhardtii
gi|504128801|ref|XP_004577641.1| PREDICTED: anaphase-promoting c...   159   4e-37   Ochotona princeps [southern American pika]
gi|308080974|ref|NP_001183667.1| uncharacterized protein LOC1005...   159   4e-37   Zea mays [maize]
gi|358249186|ref|NP_001240007.1| uncharacterized protein LOC1008...   159   4e-37   Glycine max [soybeans]
gi|307103401|gb|EFN51661.1| hypothetical protein CHLNCDRAFT_1398...   159   6e-37   Chlorella variabilis
gi|357132396|ref|XP_003567816.1| PREDICTED: anaphase-promoting c...   159   7e-37   Brachypodium distachyon [annual false brome]
gi|460375457|ref|XP_004233522.1| PREDICTED: anaphase-promoting c...   158   9e-37   
gi|405959727|gb|EKC25731.1| Anaphase-promoting complex subunit 1...   158   1e-36   Crassostrea gigas
gi|224001908|ref|XP_002290626.1| anaphase promoting complex subu...   157   1e-36   Thalassiosira pseudonana CCMP1335
gi|290991269|ref|XP_002678258.1| anaphase promoting complex subu...   157   1e-36   Naegleria gruberi strain NEG-M
gi|412992797|emb|CCO18777.1| anaphase promoting complex subunit ...   157   2e-36   Bathycoccus prasinos
gi|474436420|gb|EMS68205.1| Anaphase-promoting complex subunit 1...   157   2e-36   Triticum urartu
gi|330840131|ref|XP_003292074.1| hypothetical protein DICPUDRAFT...   157   2e-36   Dictyostelium purpureum
gi|193709423|ref|XP_001952000.1| PREDICTED: anaphase-promoting c...   157   2e-36   Acyrthosiphon pisum
gi|470505659|ref|XP_004348598.1| anaphase promoting complex subu...   157   2e-36   Acanthamoeba castellanii str. Neff
gi|170099535|ref|XP_001880986.1| predicted protein [Laccaria bic...   156   4e-36   Laccaria bicolor S238N-H82
gi|225430728|ref|XP_002266072.1| PREDICTED: anaphase-promoting c...   156   4e-36   Vitis vinifera
gi|351725793|ref|NP_001236081.1| uncharacterized protein LOC1005...   155   4e-36   Glycine max [soybeans]
gi|325181977|emb|CCA16431.1| anaphasepromoting complex subunit 1...   155   5e-36   Albugo laibachii Nc14
gi|388499086|gb|AFK37609.1| unknown [Lotus japonicus]                 155   5e-36   Lotus japonicus
gi|145529011|ref|XP_001450294.1| hypothetical protein [Parameciu...   155   8e-36   Paramecium tetraurelia strain d4-2
gi|321458778|gb|EFX69840.1| hypothetical protein DAPPUDRAFT_3006...   154   1e-35   Daphnia pulex
gi|145534794|ref|XP_001453141.1| hypothetical protein [Parameciu...   153   3e-35   Paramecium tetraurelia strain d4-2
gi|145510913|ref|XP_001441384.1| hypothetical protein [Parameciu...   153   3e-35   Paramecium tetraurelia strain d4-2
gi|302835371|ref|XP_002949247.1| hypothetical protein VOLCADRAFT...   153   4e-35   Volvox carteri f. nagariensis
gi|466009820|ref|XP_004269997.1| PREDICTED: anaphase-promoting c...   152   8e-35   
gi|115465645|ref|NP_001056422.1| Os05g0579800 [Oryza sativa Japo...   151   9e-35   
gi|323456624|gb|EGB12491.1| hypothetical protein AURANDRAFT_2041...   151   1e-34   Aureococcus anophagefferens
gi|485623105|gb|EOD19341.1| hypothetical protein EMIHUDRAFT_4671...   151   1e-34   Emiliania huxleyi CCMP1516
gi|51854317|gb|AAU10698.1| putative anaphase promoting complex s...   151   1e-34   Oryza sativa Japonica Group [Japonica rice]
gi|303272633|ref|XP_003055678.1| predicted protein [Micromonas p...   151   1e-34   Micromonas pusilla CCMP1545
gi|336370694|gb|EGN99034.1| hypothetical protein SERLA73DRAFT_73...   150   2e-34   Serpula lacrymans var. lacrymans S7.3
gi|5091606|gb|AAD39595.1|AC007858_9 10A19I.10 [Oryza sativa Japo...   150   2e-34   Oryza sativa Japonica Group [Japonica rice]
gi|393221190|gb|EJD06675.1| anaphase-promoting complex, subunit ...   150   2e-34   Fomitiporia mediterranea MF3/22
gi|300681546|emb|CBH32643.1| anaphase-promoting complex subunit,...   149   5e-34   Triticum aestivum [Canadian hard winter wheat]
gi|395735392|ref|XP_002815232.2| PREDICTED: anaphase-promoting c...   149   6e-34   
gi|146184245|ref|XP_001028080.2| anaphase-promoting complex, sub...   148   1e-33   Tetrahymena thermophila SB210
gi|512861091|ref|XP_004889798.1| PREDICTED: anaphase-promoting c...   147   1e-33   
gi|403417991|emb|CCM04691.1| predicted protein [Fibroporia radic...   147   2e-33   Fibroporia radiculosa
gi|119627198|gb|EAX06793.1| hCG1640061 [Homo sapiens]                 147   2e-33   Homo sapiens [man]
gi|392594858|gb|EIW84182.1| anaphase-promoting complex subunit 1...   145   5e-33   Coniophora puteana RWD-64-598 SS2
gi|296417930|ref|XP_002838600.1| hypothetical protein [Tuber mel...   145   6e-33   Tuber melanosporum Mel28
gi|388582841|gb|EIM23144.1| anaphase-promoting complex, subunit ...   145   9e-33   Wallemia mellicola CBS 633.66
gi|353236924|emb|CCA68909.1| related to anaphase promoting compl...   145   9e-33   Serendipita indica DSM 11827
gi|409048425|gb|EKM57903.1| hypothetical protein PHACADRAFT_1589...   145   9e-33   Phanerochaete carnosa HHB-10118-sp
gi|281200809|gb|EFA75026.1| anaphase promoting complex subunit 1...   145   9e-33   Polysphondylium pallidum PN500
gi|393246511|gb|EJD54020.1| anaphase-promoting complex, subunit ...   144   1e-32   Auricularia subglabra TFB-10046 SS5
gi|66827201|ref|XP_646955.1| anaphase promoting complex subunit ...   144   2e-32   Dictyostelium discoideum AX4
gi|389750025|gb|EIM91196.1| anaphase-promoting complex subunit 1...   143   2e-32   Stereum hirsutum FP-91666 SS1
gi|470237864|ref|XP_004350889.1| anaphase promoting complex subu...   142   5e-32   Dictyostelium fasciculatum
gi|195999362|ref|XP_002109549.1| hypothetical protein TRIADDRAFT...   142   7e-32   Trichoplax adhaerens
gi|390595528|gb|EIN04933.1| anaphase-promoting complex subunit 1...   141   1e-31   Punctularia strigosozonata HHB-11173 SS5
gi|402224635|gb|EJU04697.1| galactose-binding like protein, part...   141   1e-31   Dacryopinax primogenitus
gi|358060516|dbj|GAA93921.1| hypothetical protein E5Q_00567 [Mix...   140   2e-31   Mixia osmundae IAM 14324
gi|209878440|ref|XP_002140661.1| anaphase-promoting complex, sub...   140   2e-31   Cryptosporidium muris RN66
gi|256081509|ref|XP_002577012.1| tbc1 domain family member [Schi...   139   6e-31   
gi|409078210|gb|EKM78573.1| hypothetical protein AGABI1DRAFT_100...   139   6e-31   Agaricus bisporus var. burnettii JB137-S8
gi|426199202|gb|EKV49127.1| hypothetical protein AGABI2DRAFT_116...   139   6e-31   Agaricus bisporus var. bisporus H97
gi|353229474|emb|CCD75645.1| putative tbc1 domain family member ...   139   7e-31   Schistosoma mansoni
gi|125553459|gb|EAY99168.1| hypothetical protein OsI_21127 [Oryz...   138   9e-31   Oryza sativa Indica Group [Indian rice]
gi|392564646|gb|EIW57824.1| anaphase-promoting complex subunit 1...   138   1e-30   Trametes versicolor FP-101664 SS1
gi|395324050|gb|EJF56498.1| APC10-domain-containing protein [Dic...   137   3e-30   Dichomitus squalens LYAD-421 SS1
gi|19112595|ref|NP_595803.1| anaphase-promoting complex subunit ...   135   9e-30   Schizosaccharomyces pombe 972h-
gi|242214745|ref|XP_002473193.1| predicted protein [Postia place...   135   1e-29   Postia placenta Mad-698-R
gi|328770902|gb|EGF80943.1| hypothetical protein BATDEDRAFT_1111...   134   2e-29   Batrachochytrium dendrobatidis JAM81
gi|328854174|gb|EGG03308.1| hypothetical protein MELLADRAFT_2906...   134   2e-29   Melampsora larici-populina 98AG31
gi|320584174|gb|EFW98385.1| anaphase-promoting complex processiv...   133   3e-29   
gi|254571777|ref|XP_002492998.1| hypothetical protein [Komagatae...   133   3e-29   Komagataella phaffii GS115
gi|213407856|ref|XP_002174699.1| anaphase-promoting complex subu...   133   4e-29   Schizosaccharomyces japonicus yFS275
gi|299749485|ref|XP_001836141.2| anaphase-promoting complex [Cop...   132   5e-29   Coprinopsis cinerea okayama7#130
gi|321260060|ref|XP_003194750.1| hypothetical protein CGB_F3450W...   132   6e-29   Cryptococcus gattii WM276
gi|58269076|ref|XP_571694.1| hypothetical protein [Cryptococcus ...   132   7e-29   Cryptococcus neoformans var. neoformans JEC21
gi|134113060|ref|XP_774806.1| hypothetical protein CNBF2360 [Cry...   132   8e-29   Cryptococcus neoformans var. neoformans B-3501A
gi|406866491|gb|EKD19531.1| anaphase promoting complex subunit 1...   131   2e-28   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|440631730|gb|ELR01649.1| hypothetical protein GMDG_00025 [Geo...   130   2e-28   Pseudogymnoascus destructans 20631-21
gi|238006074|gb|ACR34072.1| unknown [Zea mays] >gi|413948346|gb|...   129   4e-28   Zea mays [maize]
gi|508699165|gb|EOX91061.1| Anaphase-promoting complex subunit 1...   129   6e-28   Theobroma cacao [chocolate]
gi|403158039|ref|XP_003307384.2| hypothetical protein PGTG_00334...   129   7e-28   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|345563773|gb|EGX46758.1| hypothetical protein AOL_s00097g506 ...   128   8e-28   Arthrobotrys oligospora ATCC 24927
gi|50552486|ref|XP_503653.1| YALI0E07117p [Yarrowia lipolytica] ...   128   1e-27   Yarrowia lipolytica CLIB122
gi|512204326|gb|EPE33149.1| Galactose-binding protein [Glarea lo...   127   2e-27   Glarea lozoyensis ATCC 20868
gi|302684263|ref|XP_003031812.1| hypothetical protein SCHCODRAFT...   126   5e-27   Schizophyllum commune H4-8
gi|241570589|ref|XP_002402817.1| anaphase-promoting complex, sub...   126   5e-27   Ixodes scapularis [blacklegged tick]
gi|308494404|ref|XP_003109391.1| hypothetical protein CRE_08300 ...   125   5e-27   Caenorhabditis remanei
gi|268565105|ref|XP_002639335.1| Hypothetical protein CBG03913 [...   125   5e-27   Caenorhabditis briggsae
gi|406601603|emb|CCH46768.1| Anaphase-promoting complex subunit ...   125   6e-27   Wickerhamomyces ciferrii
gi|380479957|emb|CCF42709.1| anaphase-promoting complex subunit ...   125   6e-27   Colletotrichum higginsianum
gi|326427051|gb|EGD72621.1| hypothetical protein PTSG_04356 [Sal...   125   8e-27   Salpingoeca rosetta
gi|312065554|ref|XP_003135847.1| anaphase promoting complex subu...   124   2e-26   Loa loa
gi|320592894|gb|EFX05303.1| anaphase promoting complex subunit 1...   124   2e-26   Grosmannia clavigera kw1407
gi|512190635|gb|EPE06398.1| anaphase-promoting complex subunit 1...   123   4e-26   Ophiostoma piceae UAMH 11346
gi|167524537|ref|XP_001746604.1| hypothetical protein [Monosiga ...   122   5e-26   Monosiga brevicollis MX1
gi|170594453|ref|XP_001901978.1| Anaphase promoting complex subu...   122   5e-26   Brugia malayi [agent of lymphatic filariasis]
gi|241673384|ref|XP_002399965.1| anaphase-promoting complex, sub...   122   7e-26   Ixodes scapularis [blacklegged tick]
gi|511011748|gb|EPB92953.1| hypothetical protein HMPREF1544_0002...   122   8e-26   Mucor circinelloides f. circinelloides 1006PhL
gi|398408289|ref|XP_003855610.1| hypothetical protein MYCGRDRAFT...   121   1e-25   Zymoseptoria tritici IPO323
gi|310795688|gb|EFQ31149.1| anaphase-promoting complex [Glomerel...   121   1e-25   Colletotrichum graminicola M1.001
gi|302412997|ref|XP_003004331.1| anaphase-promoting complex subu...   121   1e-25   Verticillium alfalfae VaMs.102
gi|477536047|gb|ENH87532.1| anaphase promoting complex subunit 1...   121   1e-25   Colletotrichum orbiculare MAFF 240422
gi|260940176|ref|XP_002614388.1| hypothetical protein CLUG_05874...   121   2e-25   Clavispora lusitaniae ATCC 42720
gi|71995011|ref|NP_001021777.1| Protein Y48G1C.12 [Caenorhabditi...   121   2e-25   Caenorhabditis elegans [roundworm]
gi|429863828|gb|ELA38235.1| anaphase promoting complex subunit 1...   120   2e-25   Colletotrichum gloeosporioides Nara gc5
gi|452845284|gb|EME47217.1| hypothetical protein DOTSEDRAFT_1456...   120   2e-25   Dothistroma septosporum NZE10
gi|452986531|gb|EME86287.1| hypothetical protein MYCFIDRAFT_2341...   120   2e-25   Cercospora fijiensis CIRAD86
gi|341890478|gb|EGT46413.1| hypothetical protein CAEBREN_06735 [...   120   2e-25   Caenorhabditis brenneri
gi|392572960|gb|EIW66103.1| hypothetical protein TREMEDRAFT_7033...   120   2e-25   Tremella mesenterica DSM 1558
gi|400600133|gb|EJP67824.1| anaphase-promoting complex subunit 1...   120   3e-25   Beauveria bassiana ARSEF 2860
gi|148678931|gb|EDL10878.1| anaphase promoting complex subunit 1...   120   3e-25   Mus musculus [mouse]
gi|90085633|dbj|BAE91557.1| unnamed protein product [Macaca fasc...   120   3e-25   Macaca fascicularis [crab eating macaque]
gi|346972477|gb|EGY15929.1| anaphase-promoting complex subunit 1...   119   4e-25   Verticillium dahliae VdLs.17
gi|410038762|ref|XP_003950471.1| PREDICTED: anaphase-promoting c...   119   4e-25   
gi|426345599|ref|XP_004040493.1| PREDICTED: anaphase-promoting c...   119   5e-25   Gorilla gorilla gorilla [lowland gorilla]
gi|346318881|gb|EGX88483.1| anaphase promoting complex subunit 1...   119   5e-25   Cordyceps militaris CM01
gi|302899183|ref|XP_003047998.1| hypothetical protein NECHADRAFT...   119   6e-25   Nectria haematococca mpVI 77-13-4
gi|219125124|ref|XP_002182838.1| predicted protein [Phaeodactylu...   119   6e-25   Phaeodactylum tricornutum CCAP 1055/1
gi|358377857|gb|EHK15540.1| hypothetical protein TRIVIDRAFT_2326...   119   7e-25   Trichoderma virens Gv29-8
gi|471574616|gb|EMR72421.1| putative anaphase-promoting complex ...   118   9e-25   Eutypa lata UCREL1
gi|322698580|gb|EFY90349.1| putative anaphase promoting complex ...   118   1e-24   Metarhizium acridum CQMa 102
gi|322709787|gb|EFZ01362.1| putative anaphase promoting complex ...   118   1e-24   Metarhizium robertsii ARSEF 23
gi|375493587|ref|NP_001243639.1| anaphase-promoting complex subu...   118   1e-24   Homo sapiens [man]
gi|342185082|emb|CCC94564.1| putative anaphase promoting complex...   117   1e-24   Trypanosoma congolense IL3000
gi|410038764|ref|XP_003950472.1| PREDICTED: anaphase-promoting c...   117   1e-24   
gi|426345597|ref|XP_004040492.1| PREDICTED: anaphase-promoting c...   117   2e-24   Gorilla gorilla gorilla [lowland gorilla]
gi|336273512|ref|XP_003351510.1| DOC1 protein [Sordaria macrospo...   117   2e-24   Sordaria macrospora k-hell
gi|410038760|ref|XP_003950470.1| PREDICTED: anaphase-promoting c...   117   2e-24   
gi|344304948|gb|EGW35180.1| hypothetical protein SPAPADRAFT_1461...   117   2e-24   Spathaspora passalidarum NRRL Y-27907
gi|358391944|gb|EHK41348.1| hypothetical protein TRIATDRAFT_2280...   117   2e-24   Trichoderma atroviride IMI 206040
gi|156043912|ref|XP_001588512.1| hypothetical protein SS1G_10059...   117   3e-24   Sclerotinia sclerotiorum 1980 UF-70
gi|126649289|ref|XP_001388316.1| anaphase promoting complex subu...   117   3e-24   Cryptosporidium parvum Iowa II
gi|472238448|gb|EMR83315.1| putative anaphase-promoting complex ...   116   3e-24   Botrytis cinerea BcDW1
gi|449018510|dbj|BAM81912.1| similar to anaphase-promoting compl...   116   3e-24   Cyanidioschyzon merolae strain 10D
gi|154296826|ref|XP_001548842.1| hypothetical protein BC1G_12502...   116   4e-24   Botrytis cinerea B05.10
gi|402585479|gb|EJW79419.1| hypothetical protein WUBG_09670 [Wuc...   116   4e-24   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|336468027|gb|EGO56190.1| hypothetical protein NEUTE1DRAFT_447...   116   5e-24   Neurospora tetrasperma FGSC 2508
gi|465794490|emb|CCU99278.1| unnamed protein product [Malassezia...   116   5e-24   Malassezia sympodialis ATCC 42132
gi|12718366|emb|CAC28560.1| related to anaphase promoting comple...   115   6e-24   Neurospora crassa
gi|238878786|gb|EEQ42424.1| conserved hypothetical protein [Cand...   115   6e-24   Candida albicans WO-1
gi|68476752|ref|XP_717521.1| potential anaphase-promoting comple...   115   6e-24   Candida albicans SC5314
gi|164423406|ref|XP_963592.2| hypothetical protein NCU08731 [Neu...   115   6e-24   
gi|443896585|dbj|GAC73929.1| copper transporter [Pseudozyma anta...   115   7e-24   Moesziomyces antarcticus T-34
gi|116200263|ref|XP_001225943.1| hypothetical protein CHGG_08287...   115   8e-24   Chaetomium globosum CBS 148.51
gi|149247908|ref|XP_001528341.1| conserved hypothetical protein ...   115   1e-23   Lodderomyces elongisporus NRRL YB-4239
gi|451845258|gb|EMD58571.1| hypothetical protein COCSADRAFT_7301...   115   1e-23   Bipolaris sorokiniana ND90Pr
gi|340518344|gb|EGR48585.1| predicted protein [Trichoderma reese...   114   1e-23   Trichoderma reesei QM6a
gi|408391631|gb|EKJ71003.1| hypothetical protein FPSE_08862 [Fus...   114   1e-23   Fusarium pseudograminearum CS3096
gi|459366172|gb|EMG45611.1| Anaphase promoting complex subunit, ...   114   1e-23   Candida maltosa Xu316
gi|46138601|ref|XP_390991.1| hypothetical protein FG10815.1 [Fus...   114   2e-23   
gi|340058112|emb|CCC52466.1| putative anaphase promoting complex...   114   2e-23   Trypanosoma vivax Y486
gi|475676174|gb|EMT73208.1| Anaphase-promoting complex subunit 1...   114   2e-23   Fusarium oxysporum f. sp. cubense race 4
gi|367053960|ref|XP_003657358.1| hypothetical protein THITE_2070...   114   2e-23   Thielavia terrestris NRRL 8126
gi|342875512|gb|EGU77256.1| hypothetical protein FOXB_12216 [Fus...   113   3e-23   Fusarium oxysporum Fo5176
gi|453087085|gb|EMF15126.1| galactose-binding like protein [Myco...   113   3e-23   Sphaerulina musiva SO2202
gi|477520783|gb|ENH72908.1| Anaphase-promoting complex subunit 1...   113   4e-23   Fusarium oxysporum f. sp. cubense race 1
gi|339253962|ref|XP_003372204.1| anaphase-promoting complex, sub...   113   4e-23   Trichinella spiralis
gi|344228546|gb|EGV60432.1| hypothetical protein CANTEDRAFT_1276...   112   5e-23   Candida tenuis ATCC 10573
gi|68476603|ref|XP_717594.1| potential anaphase-promoting comple...   112   5e-23   Candida albicans SC5314
gi|501751974|emb|CCG83969.1| protein of unknown function [Taphri...   112   5e-23   Taphrina deformans PYCC 5710
gi|313230985|emb|CBY18983.1| unnamed protein product [Oikopleura...   112   6e-23   Oikopleura dioica
gi|323508231|emb|CBQ68102.1| related to anaphase promoting compl...   112   8e-23   Sporisorium reilianum SRZ2
gi|407407786|gb|EKF31460.1| anaphase promoting complex subunit 1...   112   8e-23   Trypanosoma cruzi marinkellei
gi|171683830|ref|XP_001906857.1| hypothetical protein [Podospora...   112   9e-23   Podospora anserina S mat+
gi|126137712|ref|XP_001385379.1| hypothetical protein PICST_2247...   111   1e-22   Scheffersomyces stipitis CBS 6054
gi|341039056|gb|EGS24048.1| anaphase promoting complex subunit 1...   111   1e-22   Chaetomium thermophilum var. thermophilum DSM 1495
gi|449296228|gb|EMC92248.1| hypothetical protein BAUCODRAFT_5240...   111   1e-22   Baudoinia panamericana UAMH 10762
gi|388855275|emb|CCF51169.1| related to anaphase promoting compl...   111   1e-22   Ustilago hordei
gi|399172200|emb|CCE26885.1| related to anaphase promoting compl...   110   2e-22   Claviceps purpurea 20.1
gi|389629068|ref|XP_003712187.1| anaphase-promoting complex subu...   110   3e-22   Magnaporthe oryzae 70-15
gi|164658686|ref|XP_001730468.1| hypothetical protein MGL_2264 [...   110   3e-22   
gi|255729524|ref|XP_002549687.1| hypothetical protein CTRG_03984...   110   3e-22   
gi|71419527|ref|XP_811195.1| anaphase promoting complex, subunit...   110   3e-22   
gi|71407839|ref|XP_806361.1| anaphase promoting complex subunit ...   109   4e-22   
gi|261333814|emb|CBH16809.1| anaphase promoting complex, subunit...   109   4e-22   
gi|367034518|ref|XP_003666541.1| hypothetical protein MYCTH_2311...   109   6e-22   
gi|354546462|emb|CCE43192.1| hypothetical protein CPAR2_208370 [...   108   7e-22   
gi|71749400|ref|XP_828039.1| anaphase promoting complex subunit ...   108   8e-22   
gi|501310677|dbj|GAC99435.1| potential anaphase-promoting comple...   108   1e-21   
gi|444319899|ref|XP_004180606.1| hypothetical protein TBLA_0E002...   108   1e-21   
gi|407847079|gb|EKG02978.1| anaphase promoting complex subunit 1...   108   1e-21   
gi|402078302|gb|EJT73567.1| anaphase-promoting complex subunit 1...   107   2e-21   
gi|241949329|ref|XP_002417387.1| anaphase promoting complex subu...   107   2e-21   
gi|327293243|ref|XP_003231318.1| hypothetical protein TERG_08103...   107   2e-21   
gi|146418868|ref|XP_001485399.1| hypothetical protein PGUG_03128...   107   2e-21   
gi|190346852|gb|EDK39030.2| hypothetical protein PGUG_03128 [Mey...   107   2e-21   
gi|224031763|gb|ACN34957.1| unknown [Zea mays] >gi|413948347|gb|...   107   2e-21   
gi|12837763|dbj|BAB23942.1| unnamed protein product [Mus musculus]    107   2e-21   
gi|448511700|ref|XP_003866591.1| hypothetical protein CORT_0A076...   107   2e-21   
gi|296820442|ref|XP_002849941.1| anaphase-promoting complex subu...   106   4e-21   
gi|471899193|emb|CCO30486.1| Anaphase-promoting complex subunit ...   105   8e-21   
gi|367013850|ref|XP_003681425.1| hypothetical protein TDEL_0D063...   105   1e-20   
gi|50302205|ref|XP_451036.1| hypothetical protein [Kluyveromyces...   105   1e-20   
gi|169767246|ref|XP_001818094.1| anaphase promoting complex subu...   104   1e-20   
gi|254583211|ref|XP_002499337.1| ZYRO0E09416p [Zygosaccharomyces...   103   3e-20   
gi|119625458|gb|EAX05053.1| anaphase promoting complex subunit 1...   103   4e-20   
gi|475607033|gb|EMT26572.1| Anaphase-promoting complex subunit 1...   102   5e-20   
gi|68075889|ref|XP_679864.1| hypothetical protein [Plasmodium be...   101   1e-19   
gi|294886855|ref|XP_002771887.1| anaphase-promoting complex, put...   101   1e-19   
gi|470324363|ref|XP_004349843.1| predicted protein [Capsaspora o...   101   1e-19   
gi|212531751|ref|XP_002146032.1| anaphase promoting complex subu...   101   1e-19   
gi|261191414|ref|XP_002622115.1| anaphase promoting complex subu...   100   2e-19   
gi|45198790|ref|NP_985819.1| AFR272Wp [Ashbya gossypii ATCC 1089...   100   4e-19   
gi|513033434|gb|AGO13406.1| AaceriAFR272Wp [Saccharomycetaceae s...   100   4e-19   
gi|405975083|gb|EKC39678.1| Anaphase-promoting complex subunit 1...   100   4e-19   
gi|255717591|ref|XP_002555076.1| KLTH0G00836p [Lachancea thermot...   100   4e-19   
gi|82541677|ref|XP_725062.1| hypothetical protein [Plasmodium yo...    99   7e-19   
gi|397616024|gb|EJK63782.1| hypothetical protein THAOC_15542 [Th...    99   8e-19   
gi|294659147|ref|XP_002770905.1| DEHA2F26400p [Debaryomyces hans...    99   8e-19   
gi|221483945|gb|EEE22249.1| anaphase-promoting complex, putative...    99   9e-19   
gi|221505228|gb|EEE30882.1| anaphase-promoting complex, putative...    99   1e-18   
gi|67478522|ref|XP_654652.1| hypothetical protein [Entamoeba his...    99   1e-18   
gi|448080247|ref|XP_004194578.1| Piso0_005079 [Millerozyma farin...    98   1e-18   
gi|448084729|ref|XP_004195677.1| Piso0_005079 [Millerozyma farin...    98   1e-18   
gi|237836657|ref|XP_002367626.1| anaphase-promoting complex subu...    98   1e-18   
gi|452002193|gb|EMD94651.1| hypothetical protein COCHEDRAFT_1075...    98   1e-18   
gi|363749811|ref|XP_003645123.1| hypothetical protein Ecym_2591 ...    97   2e-18   
gi|124805930|ref|XP_001350578.1| anaphase promoting complex subu...    97   2e-18   
gi|115397607|ref|XP_001214395.1| conserved hypothetical protein ...    97   3e-18   
gi|407041255|gb|EKE40620.1| Anaphase-promoting complex, subunit ...    97   4e-18   
gi|67517270|ref|XP_658515.1| hypothetical protein AN0911.2 [Aspe...    96   4e-18   
gi|465954477|gb|EMP25916.1| Anaphase-promoting complex subunit 1...    96   5e-18   
gi|255941728|ref|XP_002561633.1| Pc16g13340 [Penicillium chrysog...    96   6e-18   
gi|367007228|ref|XP_003688344.1| hypothetical protein TPHA_0N012...    96   6e-18   
gi|70996376|ref|XP_752943.1| anaphase promoting complex subunit ...    96   7e-18   
gi|494825054|gb|EON62272.1| hypothetical protein W97_01493 [Coni...    96   8e-18   
gi|326471718|gb|EGD95727.1| hypothetical protein TESG_03196 [Tri...    96   8e-18   
gi|302499174|ref|XP_003011583.1| anaphase promoting complex subu...    96   8e-18   
gi|238580811|ref|XP_002389407.1| hypothetical protein MPER_11466...    96   9e-18   
gi|121700833|ref|XP_001268681.1| anaphase promoting complex subu...    96   9e-18   
gi|221061363|ref|XP_002262251.1| hypothetical protein, conserved...    96   9e-18   
gi|119494715|ref|XP_001264173.1| anaphase promoting complex subu...    96   9e-18   
gi|378728396|gb|EHY54855.1| anaphase-promoting complex component...    95   1e-17   
gi|358370204|dbj|GAA86816.1| anaphase promoting complex subunit ...    95   1e-17   
gi|145231096|ref|XP_001389812.1| anaphase promoting complex subu...    95   1e-17   
gi|350638777|gb|EHA27133.1| hypothetical protein ASPNIDRAFT_3543...    95   1e-17   
gi|302654059|ref|XP_003018842.1| anaphase promoting complex subu...    95   1e-17   
gi|315043592|ref|XP_003171172.1| anaphase-promoting complex subu...    95   2e-17   
gi|365760869|gb|EHN02556.1| Doc1p [Saccharomyces cerevisiae x Sa...    94   2e-17   
gi|20149881|pdb|1GQP|A Chain A, Apc10DOC1 SUBUNIT OF S. CEREVISI...    94   2e-17   
gi|323337731|gb|EGA78975.1| Doc1p [Saccharomyces cerevisiae Vin13]     94   2e-17   
gi|793873|emb|CAA89016.1| HRC283 [Saccharomyces cerevisiae] >gi|...    94   2e-17   
gi|1945308|emb|CAA96958.1| unnamed protein product [Saccharomyce...    94   2e-17   
gi|366993389|ref|XP_003676459.1| hypothetical protein NCAS_0E002...    94   2e-17   
gi|349577997|dbj|GAA23163.1| K7_Doc1p [Saccharomyces cerevisiae ...    94   2e-17   
gi|37362650|ref|NP_011274.2| anaphase promoting complex subunit ...    94   2e-17   
gi|258578305|ref|XP_002543334.1| conserved hypothetical protein ...    94   3e-17   
gi|401405893|ref|XP_003882396.1| anaphase-promoting complex subu...    94   3e-17   
gi|425770610|gb|EKV09078.1| Anaphase promoting complex subunit 1...    93   4e-17   
gi|71004322|ref|XP_756827.1| hypothetical protein UM00680.1 [Ust...    93   4e-17   
gi|392870373|gb|EAS32170.2| hypothetical protein CIMG_03107 [Coc...    93   5e-17   
gi|303318012|ref|XP_003069008.1| Anaphase-promoting complex, sub...    93   5e-17   
gi|401625868|gb|EJS43855.1| doc1p [Saccharomyces arboricola H-6]       93   5e-17   
gi|300122501|emb|CBK23071.2| unnamed protein product [Blastocyst...    92   6e-17   
gi|156103159|ref|XP_001617272.1| hypothetical protein [Plasmodiu...    92   1e-16   
gi|339254000|ref|XP_003372223.1| anaphase-promoting complex subu...    91   1e-16   
gi|239612712|gb|EEQ89699.1| anaphase promoting complex subunit 1...    91   2e-16   
gi|405121292|gb|AFR96061.1| hypothetical protein CNAG_05743 [Cry...    91   2e-16   
gi|156839094|ref|XP_001643242.1| hypothetical protein Kpol_460p1...    91   2e-16   
gi|50289411|ref|XP_447137.1| hypothetical protein [Candida glabr...    91   2e-16   
gi|327351785|gb|EGE80642.1| anaphase promoting complex subunit 1...    91   2e-16   
gi|225561420|gb|EEH09700.1| anaphase-promoting complex subunit [...    91   3e-16   
gi|295664092|ref|XP_002792598.1| conserved hypothetical protein ...    91   3e-16   
gi|325090863|gb|EGC44173.1| anaphase-promoting complex subunit 1...    90   3e-16   
gi|226295171|gb|EEH50591.1| conserved hypothetical protein [Para...    90   3e-16   
gi|225677672|gb|EEH15956.1| anaphase-promoting complex subunit 1...    90   3e-16   
gi|240274525|gb|EER38041.1| anaphase-promoting complex subunit [...    90   3e-16   
gi|396488824|ref|XP_003842952.1| hypothetical protein LEMA_P0871...    90   3e-16   
gi|242773862|ref|XP_002478325.1| phosphatidylserine decarboxylas...    90   4e-16   
gi|410083815|ref|XP_003959485.1| hypothetical protein KAFR_0J028...    89   6e-16   
gi|294887587|ref|XP_002772180.1| anaphase-promoting complex, put...    89   9e-16   
gi|396081415|gb|AFN83032.1| anaphase-promoting complex subunit 1...    88   1e-15   
gi|403217322|emb|CCK71816.1| hypothetical protein KNAG_0I00250 [...    88   1e-15   
gi|330915265|ref|XP_003296962.1| hypothetical protein PTT_07216 ...    88   1e-15   
gi|482808543|gb|EOA85476.1| hypothetical protein SETTUDRAFT_1550...    88   2e-15   
gi|452820714|gb|EME27753.1| anaphase-promoting complex subunit 1...    87   2e-15   
gi|189208658|ref|XP_001940662.1| anaphase-promoting complex subu...    87   4e-15   
gi|477584545|gb|ENI01637.1| hypothetical protein COCC4DRAFT_6442...    86   5e-15   
gi|401414618|ref|XP_003871806.1| anaphase promoting complex, sub...    86   7e-15   
gi|154413207|ref|XP_001579634.1| hypothetical protein [Trichomon...    86   9e-15   
gi|76363679|ref|XP_888563.1| anaphase promoting complex, subunit...    85   1e-14   
gi|401826409|ref|XP_003887298.1| anaphase-promoting complex subu...    84   2e-14   
gi|19173638|ref|NP_597441.1| hypothetical protein ECU05_0980 [En...    84   2e-14   
gi|154331824|ref|XP_001561729.1| anaphase promoting complex, sub...    84   3e-14   
gi|169599260|ref|XP_001793053.1| hypothetical protein SNOG_02449...    84   3e-14   
gi|146076228|ref|XP_001462876.1| anaphase promoting complex, sub...    84   4e-14   
gi|303389353|ref|XP_003072909.1| anaphase-promoting complex subu...    83   5e-14   
gi|320036838|gb|EFW18776.1| conserved hypothetical protein [Cocc...    82   8e-14   
gi|402465731|gb|EJW01408.1| hypothetical protein EDEG_00455 [Edh...    81   2e-13   
gi|119186119|ref|XP_001243666.1| hypothetical protein CIMG_03107...    81   2e-13   
gi|341883002|gb|EGT38937.1| hypothetical protein CAEBREN_21832 [...    80   4e-13   
gi|471206199|ref|XP_004259852.1| anaphase-promoting complex subu...    80   4e-13   
gi|505760144|gb|EOR04218.1| Anaphase-promoting complex subunit 1...    80   4e-13   
gi|429965927|gb|ELA47924.1| hypothetical protein VCUG_00644 [Vav...    79   6e-13   
gi|407919192|gb|EKG12446.1| hypothetical protein MPH_10402 [Macr...    79   7e-13   
gi|392920346|ref|NP_001256220.1| Protein APC-10, isoform a [Caen...    79   7e-13   
gi|392920340|ref|NP_001256217.1| Protein APC-10, isoform b [Caen...    79   7e-13   
gi|488529581|ref|XP_004456574.1| PREDICTED: anaphase-promoting c...    78   2e-12   
gi|375493591|ref|NP_001243641.1| anaphase-promoting complex subu...    78   2e-12   
gi|512873670|ref|XP_004893233.1| PREDICTED: anaphase-promoting c...    78   2e-12   
gi|507686388|ref|XP_004640765.1| PREDICTED: anaphase-promoting c...    78   2e-12   
gi|441619203|ref|XP_004088557.1| PREDICTED: anaphase-promoting c...    78   2e-12   
gi|300706770|ref|XP_002995625.1| hypothetical protein NCER_10142...    78   2e-12   
gi|70949173|ref|XP_744022.1| hypothetical protein [Plasmodium ch...    78   2e-12   
gi|326485169|gb|EGE09179.1| anaphase promoting complex subunit A...    78   2e-12   
gi|308478556|ref|XP_003101489.1| CRE-APC-10 protein [Caenorhabdi...    77   4e-12   
gi|268558242|ref|XP_002637111.1| C. briggsae CBR-APC-10 protein ...    77   4e-12   
gi|478270088|gb|ENN83455.1| hypothetical protein YQE_00187, part...    75   1e-11   
gi|375073735|gb|AFA34423.1| anaphase promoting complex subunit 1...    75   2e-11   
gi|387593412|gb|EIJ88436.1| hypothetical protein NEQG_01126 [Nem...    74   3e-11   
gi|471223504|ref|XP_004030529.1| hypothetical protein IMG5_15907...    73   5e-11   
gi|457877379|ref|XP_004224958.1| anaphase promoting complex subu...    72   7e-11   


>gi|432918759|ref|XP_004079652.1| PREDICTED: anaphase-promoting complex subunit 10-like [Oryzias
           latipes]
          Length = 186

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (69%), Gaps = 10/174 (5%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +E+ EP  W+ I L    +  +T+ P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLEMVEPSGWIHISL----LNQRTNEPISTFM 137

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   TV+F M+ TIR
Sbjct: 138 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTTVDFMMYRTIR 186



>gi|47209318|emb|CAF92702.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 186

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 120/174 (68%), Gaps = 10/174 (5%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +E+ EP  W+ I L       +T+ P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLEMVEPSGWIHISLMNQ----RTNEPISTFM 137

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   TV+F M+ TIR
Sbjct: 138 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTTVDFMMYRTIR 186



>gi|170049407|ref|XP_001855904.1| anaphase-promoting complex subunit 10 [Culex quinquefasciatus]
 gi|167871257|gb|EDS34640.1| anaphase-promoting complex subunit 10 [Culex quinquefasciatus]
          Length = 185

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 125/195 (64%), Gaps = 15/195 (7%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + G      SE +   +RE+GS A+WSLSS K G GV++LRD++  TYWQSDG LPHL
Sbjct: 2   SVKTGANLCPTSEERSGNVREVGSQAVWSLSSCKPGFGVEQLRDNSMETYWQSDGQLPHL 61

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQ 149
           VNIQFP+K  V QI ++ +YK DESYTP++I+IR GTH  DLQ++  V+L EP  WV I 
Sbjct: 62  VNIQFPRKTTVSQIFIYSDYKLDESYTPSRISIRCGTHFNDLQEVEVVDLCEPSGWVCIP 121

Query: 150 LSGDEILSKTSR--PVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFY--EDYSDDD 205
           +       K  R  P+   + QIA+ +NHQNG+DTH+RQI+V +P     Y  E Y    
Sbjct: 122 I-------KEVRDIPMRTFMIQIAVISNHQNGRDTHMRQIRVHSPTEGTTYPLEQYG--- 171

Query: 206 IPFKTVEFAMHETIR 220
            PF T+EF    TIR
Sbjct: 172 -PFSTIEFQQFRTIR 185



>gi|348538028|ref|XP_003456494.1| PREDICTED: anaphase-promoting complex subunit 10-like [Oreochromis
           niloticus]
 gi|499050791|ref|XP_004575912.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Maylandia zebra]
          Length = 186

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (69%), Gaps = 10/174 (5%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +E+ EP  W+ I L    +  +T+ P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLEMVEPSGWIHISL----MNPRTNEPISTFM 137

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   TV+F M+ TIR
Sbjct: 138 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTTVDFMMYRTIR 186



>gi|472584744|gb|EMS22330.1| anaphase promoting complex subunit 10 [Rhodosporidium toruloides
           NP11]
          Length = 182

 Score =  178 bits (452), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 127/185 (68%), Gaps = 9/185 (4%)

Query: 41  SEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           +E   +ELR+IGS A W++SS K G GV+ +RD +  T WQS+G  PHL+NIQFP+K ++
Sbjct: 2   AEPSADELRDIGSLAHWAVSSAKPGYGVEHVRDADPATLWQSEGAQPHLINIQFPKKQSI 61

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQL-----SGDEI 155
            Q+ ++ +   D+SYTP+KI+IRAGTH+GDL ++R VEL  P  W   +L     +GD  
Sbjct: 62  TQVWIFADINQDDSYTPHKISIRAGTHHGDLHEVRWVELANPRGWQAFKLGGTSKTGDTG 121

Query: 156 LSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAM 215
            ++   P+ AHL QIAI +NH NGKDTH+R +++FAP++     +  DD +PF+TV F  
Sbjct: 122 PAEGEEPIRAHLVQIAILSNHMNGKDTHVRGVRIFAPRV----LELDDDLVPFRTVAFTQ 177

Query: 216 HETIR 220
           HETIR
Sbjct: 178 HETIR 182



>gi|157117126|ref|XP_001652947.1| anaphase-promoting complex [Aedes aegypti]
 gi|108876148|gb|EAT40373.1| AAEL007871-PA [Aedes aegypti]
          Length = 185

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 125/195 (64%), Gaps = 15/195 (7%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + G      +E +   +RE+GS A+WSLSS K G GV++LRD++  TYWQSDG LPHL
Sbjct: 2   SVKTGANVCPTTEERSGSVREVGSQAVWSLSSCKPGFGVEQLRDNSMETYWQSDGQLPHL 61

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQ 149
           VNIQFP+K  V QI ++ +YK DESYTP++I+IR GTH  DLQ++  V+L EP  WV I 
Sbjct: 62  VNIQFPRKTTVSQIYIYSDYKLDESYTPSRISIRCGTHFNDLQEVEVVDLCEPSGWVCIP 121

Query: 150 LSGDEILSKTSR--PVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFY--EDYSDDD 205
           +       K  R  P+   + QIA+ +NHQNG+DTH+RQI+V +P     Y  E +    
Sbjct: 122 I-------KEVRDIPMRTFMIQIAVISNHQNGRDTHMRQIRVHSPTEGTTYPLEQFG--- 171

Query: 206 IPFKTVEFAMHETIR 220
            PF T+EF    TIR
Sbjct: 172 -PFSTIEFQQFRTIR 185



>gi|291239008|ref|XP_002739417.1| PREDICTED: anaphase promoting complex subunit 10-like [Saccoglossus
           kowalevskii]
          Length = 179

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/175 (49%), Positives = 122/175 (69%), Gaps = 11/175 (6%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++REIGS A+WSLSS K G GVD+LRD +  TYWQSDGT PHLVNIQF +K  + ++ ++
Sbjct: 15  KIREIGSQAVWSLSSCKPGFGVDQLRDGSLETYWQSDGTQPHLVNIQFRRKTTLNRLCIY 74

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
            +YK+DESYTPNKI++R G H  DLQ++  +EL EP  WV + L       ++ +P+   
Sbjct: 75  ADYKADESYTPNKISVRIGNHFHDLQEIEVLELTEPSGWVIVPLQ-----DRSGKPLRTF 129

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
           + QIA+ +NHQNG+DTH+RQIKV++P      ++ S   +P F  VE AM+ T+R
Sbjct: 130 MIQIAVLSNHQNGRDTHMRQIKVYSP-----VQENSIGKLPTFSNVELAMYSTVR 179



>gi|410930143|ref|XP_003978458.1| PREDICTED: anaphase-promoting complex subunit 10-like [Takifugu
           rubripes]
          Length = 182

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 88/174 (50%), Positives = 119/174 (68%), Gaps = 14/174 (8%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +E+ EP  W+ I L         ++P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLEMVEPSGWIHISL--------INQPISTFM 133

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   TV+F M+ TIR
Sbjct: 134 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTTVDFMMYRTIR 182



>gi|156376950|ref|XP_001630621.1| predicted protein [Nematostella vectensis]
 gi|156217645|gb|EDO38558.1| predicted protein [Nematostella vectensis]
          Length = 182

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 121/176 (68%), Gaps = 14/176 (7%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           +LREIG  A WSLSS K G G+++LRD N  TYWQSDG  PHL+NIQF +K  + +IS++
Sbjct: 19  KLREIGDQAAWSLSSCKPGFGIEQLRDGNLETYWQSDGPQPHLINIQFKRKTAIQKISIY 78

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS-GDEILSKTSRPVGA 165
            +YK+DESYTP+KI++RAG    DL  +  ++LDEP  W+ + L+ GD       RP+  
Sbjct: 79  ADYKADESYTPSKISVRAGNSFHDLHQIELIQLDEPTGWLTVSLNEGD-------RPIRT 131

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
           ++ Q+A+ ANHQNG+DTH+RQIK+FAP       D  + D+P F +V+ AM+  +R
Sbjct: 132 YMLQVAVLANHQNGRDTHMRQIKIFAPLC-----DAVNPDMPTFTSVDCAMYSCVR 182



>gi|62858451|ref|NP_001016392.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
 gi|89273769|emb|CAJ82095.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
 gi|169642211|gb|AAI60495.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
 gi|213624324|gb|AAI70941.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
 gi|213627011|gb|AAI70586.1| anaphase promoting complex subunit 10 [Xenopus (Silurana)
           tropicalis]
          Length = 185

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 118/174 (67%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKALCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+         +P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDAH-----KKPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKVF P      E+ S    P   T++F MH  IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVFTP-----VEESSIGRFPRCTTIDFMMHRFIR 185



>gi|168015724|ref|XP_001760400.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162688414|gb|EDQ74791.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 185

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 121/174 (69%), Gaps = 8/174 (4%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E REIG  A W++SS K GNGV+ LRD+N LTYWQSDG+ PHLVNIQFP+KV + Q++L+
Sbjct: 20  EKREIGKLAAWTVSSNKPGNGVEMLRDNNLLTYWQSDGSQPHLVNIQFPKKVRLQQVALF 79

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           +++K DESYTPNKI+IRAG    DL++++ ++L EP+ WV+I L  ++    +   + A 
Sbjct: 80  VDFKVDESYTPNKISIRAGNSFHDLREIKVIDLMEPMGWVNISLCKND----SKDFLRAF 135

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
             Q+A+ +NHQNG+DTHIRQIK++ P+              F T+EF+   TIR
Sbjct: 136 FVQLAVLSNHQNGRDTHIRQIKIYGPRQTAVI----GQPFEFTTIEFSSRSTIR 185



>gi|148234881|ref|NP_001089057.1| uncharacterized protein LOC595046 [Xenopus laevis]
 gi|57870661|gb|AAH89086.1| LOC595046 protein [Xenopus laevis]
          Length = 185

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 118/174 (67%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKALCVYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+         +P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDAH-----KKPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKVF P      E+ S    P   T++F MH  IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVFTP-----VEESSIGRFPRCTTIDFMMHRFIR 185



>gi|507686390|ref|XP_004640766.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Octodon degus]
          Length = 185

 Score =  175 bits (444), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           NYKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  NYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|147899801|ref|NP_001089271.1| anaphase promoting complex subunit 10 [Xenopus laevis]
 gi|58702062|gb|AAH90191.1| MGC85037 protein [Xenopus laevis]
          Length = 185

 Score =  175 bits (444), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 118/174 (67%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKALCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+         +P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWLHVPLTDAH-----KKPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKVF P      E+ S    P   T++F MH  IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVFTP-----VEESSIGRFPRCTTIDFMMHRFIR 185



>gi|224049376|ref|XP_002188840.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1
           [Taeniopygia guttata]
 gi|449499904|ref|XP_004175396.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2
           [Taeniopygia guttata]
          Length = 185

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 88/174 (50%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+         +P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDTH-----KKPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   TV+F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTTVDFMMYRSIR 185



>gi|390608650|ref|NP_001254625.1| anaphase promoting complex subunit 10 [Danio rerio]
 gi|390608652|ref|NP_001254626.1| anaphase promoting complex subunit 10 [Danio rerio]
          Length = 185

 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP++I++R G +  +LQ++R +E+ EP  W+ I L     L   + P+   +
Sbjct: 82  DYKSDESYTPSRISVRVGNNFHNLQEIRQLEMVEPSGWIHIPL-----LDLVNNPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   TV+F M+ TIR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKYPRCTTVDFMMYRTIR 185



>gi|126331333|ref|XP_001367156.1| PREDICTED: anaphase-promoting complex subunit 10-like [Monodelphis
           domestica]
 gi|395542601|ref|XP_003773215.1| PREDICTED: anaphase-promoting complex subunit 10 [Sarcophilus
           harrisii]
          Length = 185

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+         +P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDSH-----KKPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|326918378|ref|XP_003205466.1| PREDICTED: anaphase-promoting complex subunit 10-like [Meleagris
           gallopavo]
 gi|449271299|gb|EMC81759.1| Anaphase-promoting complex subunit 10 [Columba livia]
 gi|483519027|gb|EOB04971.1| Anaphase-promoting complex subunit 10, partial [Anas platyrhynchos]
          Length = 185

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+         +P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDTH-----KKPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|56605928|ref|NP_001008467.1| anaphase-promoting complex subunit 10 [Gallus gallus]
 gi|53130520|emb|CAG31589.1| hypothetical protein RCJMB04_8g15 [Gallus gallus]
          Length = 185

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+         +P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEVRQLELVEPSGWIHVPLTDTH-----KKPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|297293455|ref|XP_001094665.2| PREDICTED: anaphase-promoting complex subunit 10 isoform 4 [Macaca
           mulatta]
          Length = 223

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 60  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 119

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 120 DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 174

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 175 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 223



>gi|149635632|ref|XP_001514225.1| PREDICTED: anaphase-promoting complex subunit 10-like
           [Ornithorhynchus anatinus]
          Length = 185

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+         +P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDAH-----KKPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|119625457|gb|EAX05052.1| anaphase promoting complex subunit 10, isoform CRA_b [Homo sapiens]
          Length = 223

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 60  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 119

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 120 DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 174

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 175 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 223



>gi|512934663|ref|XP_004907714.1| PREDICTED: anaphase-promoting complex subunit 10 [Heterocephalus
           glaber]
 gi|513015250|ref|XP_004868965.1| PREDICTED: anaphase-promoting complex subunit 10 [Heterocephalus
           glaber]
          Length = 196

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 33  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 92

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 93  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 147

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 148 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 196



>gi|332820473|ref|XP_001141102.2| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Pan
           troglodytes]
 gi|426345593|ref|XP_004040490.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 5 [Gorilla
           gorilla gorilla]
          Length = 219

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 56  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 115

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 116 DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 170

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 171 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 219



>gi|507705099|ref|XP_004645503.1| PREDICTED: anaphase-promoting complex subunit 10 [Octodon degus]
          Length = 196

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 33  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 92

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 93  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 147

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 148 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 196



>gi|402870559|ref|XP_003899281.1| PREDICTED: anaphase-promoting complex subunit 10 [Papio anubis]
          Length = 219

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 56  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 115

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 116 DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 170

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 171 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 219



>gi|348582258|ref|XP_003476893.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cavia
           porcellus]
          Length = 185

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFTMYRSIR 185



>gi|332217333|ref|XP_003257814.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2
           [Nomascus leucogenys]
          Length = 196

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 33  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 92

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 93  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 147

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 148 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 196



>gi|332217335|ref|XP_003257815.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 3
           [Nomascus leucogenys]
          Length = 219

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 56  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 115

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 116 DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 170

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 171 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 219



>gi|35900980|ref|NP_081180.1| anaphase-promoting complex subunit 10 [Mus musculus]
 gi|157823281|ref|NP_001101915.1| anaphase-promoting complex subunit 10 [Rattus norvegicus]
 gi|354477204|ref|XP_003500812.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cricetulus
           griseus]
 gi|34395503|sp|Q8K2H6.1|APC10_MOUSE RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|21618682|gb|AAH31460.1| Anaphase promoting complex subunit 10 [Mus musculus]
 gi|26334441|dbj|BAC30921.1| unnamed protein product [Mus musculus]
 gi|148678930|gb|EDL10877.1| anaphase promoting complex subunit 10, isoform CRA_a [Mus musculus]
 gi|149037945|gb|EDL92305.1| anaphase promoting complex subunit 10 (predicted) [Rattus
           norvegicus]
 gi|197245971|gb|AAI68746.1| Anaphase promoting complex subunit 10 [Rattus norvegicus]
 gi|344244110|gb|EGW00214.1| Anaphase-promoting complex subunit 10 [Cricetulus griseus]
          Length = 185

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|375493585|ref|NP_001243638.1| anaphase-promoting complex subunit 10 isoform 2 [Homo sapiens]
 gi|397489757|ref|XP_003815885.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 3 [Pan
           paniscus]
 gi|410038752|ref|XP_003950467.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
 gi|426345587|ref|XP_004040487.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Gorilla
           gorilla gorilla]
          Length = 196

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 33  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 92

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 93  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 147

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 148 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 196



>gi|150170706|ref|NP_055700.2| anaphase-promoting complex subunit 10 isoform 1 [Homo sapiens]
 gi|375493577|ref|NP_001243635.1| anaphase-promoting complex subunit 10 isoform 1 [Homo sapiens]
 gi|375493580|ref|NP_001243636.1| anaphase-promoting complex subunit 10 isoform 1 [Homo sapiens]
 gi|375493583|ref|NP_001243637.1| anaphase-promoting complex subunit 10 isoform 1 [Homo sapiens]
 gi|57096819|ref|XP_532678.1| PREDICTED: anaphase-promoting complex subunit 10 [Canis lupus
           familiaris]
 gi|149698187|ref|XP_001502007.1| PREDICTED: anaphase-promoting complex subunit 10-like [Equus
           caballus]
 gi|301761716|ref|XP_002916280.1| PREDICTED: anaphase-promoting complex subunit 10-like [Ailuropoda
           melanoleuca]
 gi|332217331|ref|XP_003257813.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1
           [Nomascus leucogenys]
 gi|332217337|ref|XP_003257816.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 4
           [Nomascus leucogenys]
 gi|332820471|ref|XP_003310583.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Pan
           troglodytes]
 gi|332820475|ref|XP_003310584.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 3 [Pan
           troglodytes]
 gi|344291652|ref|XP_003417548.1| PREDICTED: anaphase-promoting complex subunit 10-like [Loxodonta
           africana]
 gi|390460386|ref|XP_002745363.2| PREDICTED: anaphase-promoting complex subunit 10 [Callithrix
           jacchus]
 gi|395834503|ref|XP_003790240.1| PREDICTED: anaphase-promoting complex subunit 10 [Otolemur
           garnettii]
 gi|397489753|ref|XP_003815883.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Pan
           paniscus]
 gi|397489755|ref|XP_003815884.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Pan
           paniscus]
 gi|397489759|ref|XP_003815886.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 4 [Pan
           paniscus]
 gi|397489761|ref|XP_003815887.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 5 [Pan
           paniscus]
 gi|402870555|ref|XP_003899279.1| PREDICTED: anaphase-promoting complex subunit 10 [Papio anubis]
 gi|402870557|ref|XP_003899280.1| PREDICTED: anaphase-promoting complex subunit 10 [Papio anubis]
 gi|403272412|ref|XP_003928059.1| PREDICTED: anaphase-promoting complex subunit 10 [Saimiri
           boliviensis boliviensis]
 gi|403272414|ref|XP_003928060.1| PREDICTED: anaphase-promoting complex subunit 10 [Saimiri
           boliviensis boliviensis]
 gi|410038750|ref|XP_003950466.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
 gi|410038755|ref|XP_003950468.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
 gi|410956799|ref|XP_003985025.1| PREDICTED: anaphase-promoting complex subunit 10 [Felis catus]
 gi|426246995|ref|XP_004017272.1| PREDICTED: anaphase-promoting complex subunit 10 [Ovis aries]
 gi|426345585|ref|XP_004040486.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Gorilla
           gorilla gorilla]
 gi|426345589|ref|XP_004040488.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 3 [Gorilla
           gorilla gorilla]
 gi|426345591|ref|XP_004040489.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 4 [Gorilla
           gorilla gorilla]
 gi|465972469|ref|XP_004263651.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Orcinus
           orca]
 gi|465972474|ref|XP_004263652.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Orcinus
           orca]
 gi|470614106|ref|XP_004316567.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1
           [Tursiops truncatus]
 gi|470614108|ref|XP_004316568.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2
           [Tursiops truncatus]
 gi|471382251|ref|XP_004378911.1| PREDICTED: anaphase-promoting complex subunit 10 [Trichechus
           manatus latirostris]
 gi|472384915|ref|XP_004411824.1| PREDICTED: anaphase-promoting complex subunit 10 [Odobenus rosmarus
           divergens]
 gi|478493164|ref|XP_004420937.1| PREDICTED: anaphase-promoting complex subunit 10 [Ceratotherium
           simum simum]
 gi|488529577|ref|XP_004456572.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 1 [Dasypus
           novemcinctus]
 gi|488529579|ref|XP_004456573.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 2 [Dasypus
           novemcinctus]
 gi|504151718|ref|XP_004588194.1| PREDICTED: anaphase-promoting complex subunit 10 [Ochotona
           princeps]
 gi|507543845|ref|XP_004655906.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X1
           [Jaculus jaculus]
 gi|507955687|ref|XP_004685358.1| PREDICTED: anaphase-promoting complex subunit 10 [Condylura
           cristata]
 gi|511876110|ref|XP_004758050.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X1
           [Mustela putorius furo]
 gi|511876112|ref|XP_004758051.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X2
           [Mustela putorius furo]
 gi|511968440|ref|XP_004802301.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X1
           [Mustela putorius furo]
 gi|511968442|ref|XP_004802302.1| PREDICTED: anaphase-promoting complex subunit 10 isoform X2
           [Mustela putorius furo]
 gi|34395509|sp|Q9UM13.1|APC10_HUMAN RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|6463666|dbj|BAA86953.1| APC10 [Homo sapiens]
 gi|13528834|gb|AAH05217.1| ANAPC10 protein [Homo sapiens]
 gi|83026423|gb|ABB96248.1| anaphase promoting complex subunit 10 [Homo sapiens]
 gi|119625455|gb|EAX05050.1| anaphase promoting complex subunit 10, isoform CRA_a [Homo sapiens]
 gi|119625456|gb|EAX05051.1| anaphase promoting complex subunit 10, isoform CRA_a [Homo sapiens]
 gi|281354080|gb|EFB29664.1| hypothetical protein PANDA_004341 [Ailuropoda melanoleuca]
 gi|296478783|tpg|DAA20898.1| TPA: anaphase-promoting complex subunit 10 [Bos taurus]
 gi|306921421|dbj|BAJ17790.1| anaphase promoting complex subunit 10 [synthetic construct]
 gi|325464375|gb|ADZ15958.1| anaphase promoting complex subunit 10 [synthetic construct]
 gi|351714538|gb|EHB17457.1| Anaphase-promoting complex subunit 10 [Heterocephalus glaber]
 gi|432114070|gb|ELK36117.1| Anaphase-promoting complex subunit 10 [Myotis davidii]
 gi|440894891|gb|ELR47215.1| Anaphase-promoting complex subunit 10 [Bos grunniens mutus]
          Length = 185

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|291401170|ref|XP_002716972.1| PREDICTED: anaphase promoting complex subunit 10 [Oryctolagus
           cuniculus]
          Length = 194

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 31  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 90

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 91  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 145

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 146 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGRFPRCTTIDFMMYRSIR 194



>gi|327273880|ref|XP_003221707.1| PREDICTED: anaphase-promoting complex subunit 10-like [Anolis
           carolinensis]
          Length = 185

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+         +P+   +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDTH-----KKPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRGTTIDFMMYRSIR 185



>gi|4836700|gb|AAD30527.1| anaphase promoting complex subunit 10 [Homo sapiens]
          Length = 185

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|72013135|ref|XP_783681.1| PREDICTED: anaphase-promoting complex subunit 10-like
           [Strongylocentrotus purpuratus]
          Length = 182

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 124/185 (67%), Gaps = 10/185 (5%)

Query: 37  KIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQ 96
           KI   +     LREIGS A+WSLSS K G GVD+LRD++  TYWQSDG  PHLVNIQF +
Sbjct: 7   KIDDVDLTTTGLREIGSQAVWSLSSCKPGFGVDQLRDNSTDTYWQSDGIQPHLVNIQFRR 66

Query: 97  KVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEIL 156
           K  V  ++L+ ++KSDESYTPNKI++RAG +  DLQ++  +EL EP  W+ I+L+  +  
Sbjct: 67  KTTVHSVALYADFKSDESYTPNKISVRAGNNFHDLQEVELLELGEPSGWISIRLADSD-- 124

Query: 157 SKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAM 215
               +P+   + QIA  +NHQNG+DTH+RQI+V+AP          ++ +P F  V+ +M
Sbjct: 125 ---GKPIRTFMIQIAALSNHQNGRDTHMRQIRVYAP----MQNTTRNNRLPSFSGVDCSM 177

Query: 216 HETIR 220
           + TIR
Sbjct: 178 YSTIR 182



>gi|505792795|ref|XP_004606254.1| PREDICTED: anaphase-promoting complex subunit 10 [Sorex araneus]
          Length = 185

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGRFPRCTTIDFMMYRSIR 185



>gi|122692361|ref|NP_001073826.1| anaphase-promoting complex subunit 10 [Bos taurus]
 gi|122138186|sp|Q2YDH1.1|APC10_BOVIN RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|82571514|gb|AAI10225.1| Anaphase promoting complex subunit 10 [Bos taurus]
          Length = 185

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVN+QF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNLQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|507671085|ref|XP_004708754.1| PREDICTED: anaphase-promoting complex subunit 10 [Echinops
           telfairi]
          Length = 185

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (67%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L     +    +P    +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPL-----IDNHKKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|114051628|ref|NP_001040166.1| anaphase promoting complex subunit 10 [Bombyx mori]
 gi|87248261|gb|ABD36183.1| anaphase promoting complex subunit 10 [Bombyx mori]
          Length = 182

 Score =  172 bits (435), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 117/173 (67%), Gaps = 7/173 (4%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G G+D+LRDD   TYWQSDG LPHLVNIQF +K  V  I ++ 
Sbjct: 17  VREVGNHAIWSLSSCKPGFGIDQLRDDCMETYWQSDGQLPHLVNIQFQKKTMVSHIYIYT 76

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IRAGTH  DLQ++  +EL EP  W  I      I     RP+  ++
Sbjct: 77  DYKLDESYTPSRISIRAGTHFNDLQEIEVIELIEPSGWEMI-----PIKDIHDRPIRTYM 131

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQIKV +P  P  ++     +  F TV+F  + TIR
Sbjct: 132 IQIAVLSNHQNGRDTHMRQIKVHSPCEPTSFDINKFRN--FSTVQFQQYATIR 182



>gi|357619554|gb|EHJ72080.1| anaphase promoting complex subunit 10 [Danaus plexippus]
          Length = 181

 Score =  172 bits (435), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 88/173 (50%), Positives = 117/173 (67%), Gaps = 7/173 (4%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G G+D+LRDD   TYWQSDG LPHLVNIQF +K  V  I ++ 
Sbjct: 16  VREVGNHAIWSLSSCKPGFGIDQLRDDCMDTYWQSDGQLPHLVNIQFQRKTMVSHIYIYT 75

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IRAGTH  DLQ++  +EL EP  W  I      I     RP+  ++
Sbjct: 76  DYKLDESYTPSRISIRAGTHFNDLQEIEVIELIEPSGWEMI-----PIKDIHERPIRTYM 130

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQIK+ +P  P  ++   +    F TV+F  + TIR
Sbjct: 131 IQIAVLSNHQNGRDTHMRQIKIHSPCEPTSFD--MNKFRTFSTVQFQQYATIR 181



>gi|295444976|ref|NP_001171398.1| anaphase promoting complex subunit 10 protein [Sus scrofa]
 gi|293633213|gb|ADE60007.1| anaphase promoting complex subunit 10 protein [Sus scrofa]
          Length = 185

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ A+HQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLASHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|5262509|emb|CAB45705.1| hypothetical protein [Homo sapiens]
 gi|190689587|gb|ACE86568.1| anaphase promoting complex subunit 10 protein [synthetic construct]
 gi|190690951|gb|ACE87250.1| anaphase promoting complex subunit 10 protein [synthetic construct]
          Length = 185

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P  + +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRSFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANH NG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHLNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|380023096|ref|XP_003695365.1| PREDICTED: anaphase-promoting complex subunit 10-like [Apis florea]
          Length = 186

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 123/191 (64%), Gaps = 6/191 (3%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + GE   I+ E     +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHL
Sbjct: 2   SNKTGEIDPIQEELAGR-VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHL 60

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQ 149
           VNIQF +K  +  I ++ +YK DESYTP++I+IRAGT+  DLQ++  ++L+EP  WV I 
Sbjct: 61  VNIQFKRKTTIRDICIYTDYKLDESYTPSRISIRAGTNFNDLQEIEVMDLNEPSGWVII- 119

Query: 150 LSGDEILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFK 209
                I     RP+   + QIA+ +NHQNG+DTH+RQIKV++P   +     S     F 
Sbjct: 120 ----PIKDINDRPIRTFMIQIAVISNHQNGRDTHMRQIKVYSPTQDILGPPASYIAGQFL 175

Query: 210 TVEFAMHETIR 220
           T EF  + T+R
Sbjct: 176 TNEFLRYATVR 186



>gi|66531676|ref|XP_396738.2| PREDICTED: anaphase-promoting complex subunit 10-like [Apis
           mellifera]
          Length = 186

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/191 (47%), Positives = 122/191 (63%), Gaps = 6/191 (3%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + GE   I+ E     +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHL
Sbjct: 2   SNKTGEIDPIQKELAGR-VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHL 60

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQ 149
           VNIQF +K  +  I ++ +YK DESYTP++I+IRAGT+  DLQ++  ++L+EP  WV I 
Sbjct: 61  VNIQFKRKTTICDICIYTDYKLDESYTPSRISIRAGTNFNDLQEIEVMDLNEPSGWVII- 119

Query: 150 LSGDEILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFK 209
                I     RP+   + QIA+ +NHQNG+DTH+RQI V++P   +     S     F 
Sbjct: 120 ----PIKDINDRPIRTFMIQIAVISNHQNGRDTHMRQINVYSPTQDILGPPASYIAGQFL 175

Query: 210 TVEFAMHETIR 220
           T EF  + T+R
Sbjct: 176 TNEFLRYATVR 186



>gi|91081555|ref|XP_975078.1| PREDICTED: similar to anaphase promoting complex subunit 10
           [Tribolium castaneum]
 gi|270005121|gb|EFA01569.1| hypothetical protein TcasGA2_TC007130 [Tribolium castaneum]
          Length = 185

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 122/185 (65%), Gaps = 14/185 (7%)

Query: 39  IKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKV 98
           IK+E +   +RE+GS AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVN+QF +K 
Sbjct: 12  IKNE-RSGNVREVGSQAIWSLSSCKPGFGVDQLRDDRDDTYWQSDGQLPHLVNVQFQRKT 70

Query: 99  NVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSK 158
            +  I ++ +YK DESYTP++I+IR G+H  DLQ++  V L EP  WV I      I   
Sbjct: 71  TISDIYIYTDYKLDESYTPSRISIRVGSHFNDLQEIEVVMLTEPSGWVHI-----PIKDI 125

Query: 159 TSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYS---DDDIPFKTVEFAM 215
             +P+   + QIA+ +NHQNG+DTH+RQIK+++P      E+     D+ + F TVEF  
Sbjct: 126 RDKPIRVFMIQIAVTSNHQNGRDTHMRQIKIYSP-----IENQGIAIDNFLNFSTVEFQQ 180

Query: 216 HETIR 220
           + TIR
Sbjct: 181 YATIR 185



>gi|332375763|gb|AEE63022.1| unknown [Dendroctonus ponderosae]
          Length = 185

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 88/184 (47%), Positives = 120/184 (65%), Gaps = 12/184 (6%)

Query: 39  IKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKV 98
           IK+E ++  +RE+G  AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K 
Sbjct: 12  IKNE-RNGSVREVGCQAIWSLSSCKPGFGVDQLRDDRADTYWQSDGQLPHLVNIQFQRKT 70

Query: 99  NVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSK 158
            +  I ++ +YK DESYTP++I+IR GTH  D+Q++  + L EP  WV +      I   
Sbjct: 71  TISDIYIYTDYKLDESYTPSRISIRVGTHFNDIQEIEVIPLIEPAGWVHV-----SIRDL 125

Query: 159 TSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAP--KLPLFYEDYSDDDIPFKTVEFAMH 216
             +P+   + Q+A+ +NHQNG+DTH+RQIK+ +P     + +E +      F TVEF  H
Sbjct: 126 RDKPIRVFMIQLAVTSNHQNGRDTHMRQIKIHSPIEHSGVGFEQFGR----FSTVEFQQH 181

Query: 217 ETIR 220
            TIR
Sbjct: 182 ATIR 185



>gi|384253180|gb|EIE26655.1| anaphase-promoting complex, subunit 10 [Coccomyxa subellipsoidea
           C-169]
          Length = 173

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 87/172 (50%), Positives = 119/172 (69%), Gaps = 6/172 (3%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG  A+W+++S K GNGV+ LRD    TYWQSDG+ PHLVNIQF +KV + ++++ L+
Sbjct: 8   REIGKLAVWTVTSAKPGNGVELLRDGREDTYWQSDGSQPHLVNIQFQKKVRLQELAINLD 67

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLF 168
           YK DESYTPNKI++RAGT   DL+++R VEL+EP+ WV + L        +S  + A+  
Sbjct: 68  YKLDESYTPNKISVRAGTSVHDLKEIRVVELNEPIGWVKVPLQP----PYSSDNLKAYCM 123

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           Q+AI +NHQNG+DTH+RQIKVF P+  +        +I F TVE +   TIR
Sbjct: 124 QLAILSNHQNGRDTHVRQIKVFGPRHDVLQP--LGQEIGFTTVELSQFATIR 173



>gi|443684651|gb|ELT88523.1| hypothetical protein CAPTEDRAFT_162347 [Capitella teleta]
          Length = 185

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 116/178 (65%), Gaps = 11/178 (6%)

Query: 44  KHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQI 103
           +  +LRE+G  A+WSLSS K G GVD+LRD +  TYWQSDG  PHLVNIQF +K+ +  I
Sbjct: 18  REGKLREVGGQAVWSLSSCKAGFGVDQLRDGSLDTYWQSDGPQPHLVNIQFRRKMTIQDI 77

Query: 104 SLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPV 163
            ++ +YK+DESYTPN+I+IRAG H  DL ++  VEL EP  WV I L          +P+
Sbjct: 78  CIYADYKADESYTPNRISIRAGNHFNDLSEIEQVELSEPSGWVAIALK-----DLHGKPI 132

Query: 164 GAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
              + QIA+ +NHQNG+DTH+RQIK+ +P      +D S    P F TV+ + +  IR
Sbjct: 133 RTFMIQIAVLSNHQNGRDTHMRQIKIHSP-----VQDVSVAKRPNFTTVQMSQYSCIR 185



>gi|355687635|gb|EHH26219.1| hypothetical protein EGK_16132 [Macaca mulatta]
          Length = 185

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 118/174 (67%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI+ + G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISAKVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ A+HQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLASHQNGRDTHVRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|499050789|ref|XP_004575911.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X1
           [Maylandia zebra]
          Length = 202

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 120/190 (63%), Gaps = 26/190 (13%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF ++  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRRTTVKMLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRT----------------VELDEPLRWVDIQLS 151
           +YKSDESYTP+KI++R G +  +LQ++R                 +E+ EP  W+ I L 
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRVSKSLRPSSSSSSPLQQLEMVEPSGWIHISLM 141

Query: 152 GDEILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKT 210
                 +T+ P+   + QIA+ ANHQNG+DTH+RQIKV+ P      E+ S    P   T
Sbjct: 142 N----PRTNEPISTFMIQIAVLANHQNGRDTHMRQIKVYTP-----VEESSIGKFPRCTT 192

Query: 211 VEFAMHETIR 220
           V+F M+ TIR
Sbjct: 193 VDFMMYRTIR 202



>gi|513000035|ref|XP_004861555.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X1
           [Heterocephalus glaber]
          Length = 185

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 118/174 (67%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTIVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKS ESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSHESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYHSIR 185



>gi|355749598|gb|EHH53997.1| hypothetical protein EGM_14726 [Macaca fascicularis]
          Length = 185

 Score =  169 bits (427), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 118/174 (67%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI+ + G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISAKIGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ A+HQNG+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLASHQNGRDTHVRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|426251527|ref|XP_004019473.1| PREDICTED: anaphase-promoting complex subunit 10-like [Ovis aries]
          Length = 185

 Score =  168 bits (426), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 119/174 (68%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A WSL S K G GV++LRDDN  TYWQSDG+ PHLVNIQF +K  V  + +++
Sbjct: 22  VREIGSQAAWSLLSCKPGFGVNQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKALCIYV 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP+ W+ + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISVRVGNNYHNLQEIRQLELVEPIGWIHVPLTNNH-----RKPTSTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQNG+DTH+ QIK++ P      E+ S   +P   TV+F ++ +IR
Sbjct: 137 IQIAVLANHQNGRDTHMGQIKIYTP-----VEESSIGKLPRCTTVDFMIYRSIR 185



>gi|312377680|gb|EFR24453.1| hypothetical protein AND_10959 [Anopheles darlingi]
          Length = 185

 Score =  168 bits (426), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 121/191 (63%), Gaps = 7/191 (3%)

Query: 30  SQRRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHL 89
           S + G      SE +   +RE+G  A+WSLSS K G GVD+LRD++  TYWQSDG LPHL
Sbjct: 2   SVKTGANVCPLSEERSGSVREVGEHAVWSLSSCKPGFGVDQLRDNSTETYWQSDGQLPHL 61

Query: 90  VNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQ 149
           V+IQF Q  +V QI ++ +YK DESYTP++I+IR GTH  DLQ++  V+L EP  WV I 
Sbjct: 62  VSIQFHQMTSVSQIYIYSDYKLDESYTPSRISIRRGTHFNDLQEIDVVDLCEPSGWVCIP 121

Query: 150 LSGDEILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFK 209
           + G      T   +   + QIA+ +NHQNG+DTH+RQI++ +P     Y    +    F 
Sbjct: 122 IKGG-----TDSYLCTFMIQIAVISNHQNGRDTHMRQIRIHSPTAETHYP--LEQHGTFS 174

Query: 210 TVEFAMHETIR 220
           T+EF  + TIR
Sbjct: 175 TIEFQQYRTIR 185



>gi|158300919|ref|XP_320716.4| AGAP011799-PA [Anopheles gambiae str. PEST]
 gi|157013391|gb|EAA00431.4| AGAP011799-PA [Anopheles gambiae str. PEST]
          Length = 185

 Score =  168 bits (426), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 122/185 (65%), Gaps = 17/185 (9%)

Query: 41  SEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           +E +   +RE+G  A+WSLSS K G GVD+LRD++  TYWQSDG LPHLVNIQF +K  V
Sbjct: 13  TEERSGTVREVGGQAVWSLSSCKPGFGVDQLRDNSMETYWQSDGQLPHLVNIQFHRKTTV 72

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSG-DEILSKT 159
            QI ++ +YK DESYTP++I+IR GTH  DLQ++  V+L EP  WV I +   +E+L  T
Sbjct: 73  SQIYIYSDYKLDESYTPSRISIRCGTHFNDLQEVEVVDLCEPSGWVCIPIKEYEEMLMCT 132

Query: 160 SRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAP----KLPLFYEDYSDDDIPFKTVEFAM 215
                  + QIA+ +NHQNG+DTH+RQI++ +P    + PL +         F T+EF+ 
Sbjct: 133 ------FMIQIAVISNHQNGRDTHMRQIRIHSPTEGSQYPLEHHG------KFSTIEFSQ 180

Query: 216 HETIR 220
             TIR
Sbjct: 181 FRTIR 185



>gi|462398148|gb|EMJ03816.1| hypothetical protein PRUPE_ppa011884mg [Prunus persica]
          Length = 192

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 120/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKAGNGVSSLRDDNLDTYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP KI+IRAG    +L+D++TVELD+P  WV I LSG++        V  
Sbjct: 85  YVDFKLDESYTPCKISIRAGDGFHNLKDIKTVELDKPTGWVHISLSGND---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QI++ +NH NG+DTH+RQIKV+ P+  P+ ++ +      F + EF  + ++R
Sbjct: 142 FMLQISVLSNHLNGRDTHVRQIKVYGPRPNPIPHQPFQ-----FTSREFITYSSVR 192



>gi|470128019|ref|XP_004299953.1| PREDICTED: anaphase-promoting complex subunit 10-like [Fragaria
           vesca subsp. vesca]
          Length = 191

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 121/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           + LRE G +A WS+SSWK GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 24  DNLRETGKNATWSVSSWKSGNGVSYLRDDNLDTYWQSDGAQPHLVNIQFQKKVKLQLVVL 83

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI IRAG    +L+D++TVEL +P  W+ I LSG++        V  
Sbjct: 84  YVDFKLDESYTPSKILIRAGDGFHNLKDIKTVELYKPRGWIYISLSGNDARETF---VNT 140

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QI++ +NH NG+DTH+RQIK++ P+L P+ ++ +      F + EF+ + +IR
Sbjct: 141 FMLQISVLSNHLNGRDTHVRQIKLYGPRLNPIPHQPFQ-----FTSREFSTYASIR 191



>gi|307195501|gb|EFN77387.1| Anaphase-promoting complex subunit 10 [Harpegnathos saltator]
          Length = 189

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/173 (50%), Positives = 115/173 (66%), Gaps = 5/173 (2%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNYAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTPN+I+IRAGT+  DLQ++  ++L+EP  WV I      I +   RP+   +
Sbjct: 82  DYKLDESYTPNRISIRAGTNFNDLQEVEVMDLNEPSGWVVI-----PIKNINDRPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQIKV +P   +           F T EF  + TIR
Sbjct: 137 IQIAVISNHQNGRDTHMRQIKVHSPAQDILGPPAPYIPGQFLTNEFLRYATIR 189



>gi|470102898|ref|XP_004287887.1| PREDICTED: anaphase-promoting complex subunit 10-like [Fragaria
           vesca subsp. vesca]
          Length = 191

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 122/176 (69%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SSWK GNGV  LRDDN  TYWQSDG  PH VNIQF +KV +  + L
Sbjct: 24  DDLREMGKNAAWSVSSWKSGNGVSYLRDDNLDTYWQSDGAQPHSVNIQFQKKVKLQLVVL 83

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L+D++TVELD+P  W+ I LSG++        V  
Sbjct: 84  YVDFKLDESYTPSKISIRAGDGFHNLKDIKTVELDKPRGWIHISLSGNDARETF---VNT 140

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QI++ +NH NG+DTH+RQIK++ P+  P+ ++ +      F + EF  + +IR
Sbjct: 141 FMLQISVLSNHLNGRDTHVRQIKLYGPRPNPIPHQPFQ-----FTSREFITYASIR 191



>gi|508699163|gb|EOX91059.1| Anaphase promoting complex 10 isoform 1 [Theobroma cacao]
          Length = 192

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 120/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKTGNGVSSLRDDNLETYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI IRAG    +L++++TVEL +P  WV + LSG++        V  
Sbjct: 85  YVDFKLDESYTPSKICIRAGDGFHNLKEIKTVELVKPTGWVYLSLSGND---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIKV+ P+L P+ ++ +      F + EF  + T+R
Sbjct: 142 FMLQIAVLSNHLNGRDTHVRQIKVYGPRLNPIPHQPFQ-----FTSREFITYSTVR 192



>gi|383859168|ref|XP_003705068.1| PREDICTED: anaphase-promoting complex subunit 10-like [Megachile
           rotundata]
          Length = 189

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 116/173 (67%), Gaps = 5/173 (2%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K+ +  I ++ 
Sbjct: 22  VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKITIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IRAGT+  DLQ++  ++L+EP  WV I      I     RP+   +
Sbjct: 82  DYKLDESYTPSRISIRAGTNFNDLQEVEVMDLNEPSGWVII-----PIKDINDRPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQIKV +P   +     S     F T EF  + T+R
Sbjct: 137 IQIAVISNHQNGRDTHMRQIKVHSPTQDILGPPASYIPGQFLTNEFLRYATVR 189



>gi|16975123|pdb|1JHJ|A Chain A, Crystal Structure Of The Apc10DOC1 SUBUNIT OF THE HUMAN
           Anaphase-Promoting Complex
          Length = 171

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/145 (53%), Positives = 106/145 (73%), Gaps = 5/145 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 21  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 80

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++R G +  +LQ++R +EL EP  W+ + L+ +       +P    +
Sbjct: 81  DYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFM 135

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP 192
            QIA+ ANHQNG+DTH+RQIK++ P
Sbjct: 136 IQIAVLANHQNGRDTHMRQIKIYTP 160



>gi|428167359|gb|EKX36320.1| hypothetical protein GUITHDRAFT_158685 [Guillardia theta CCMP2712]
          Length = 165

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 117/169 (69%), Gaps = 14/169 (8%)

Query: 52  GSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKS 111
           G  A+W+LS+ K GNGV++LRD+N  TYWQSDG  PHLVNIQF +KV++ +I+++ ++K 
Sbjct: 11  GGDAVWTLSTAKPGNGVEQLRDNNTDTYWQSDGPQPHLVNIQFHKKVSIKEIAMYCDFKL 70

Query: 112 DESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQIA 171
           DESYTP+KI+IRAGTH  DLQD++ + L+EP  W+ + ++           + A + QIA
Sbjct: 71  DESYTPSKISIRAGTHFHDLQDVKEINLEEPCGWLTVAMNS----------LRAFMIQIA 120

Query: 172 IKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           + ANH+NG+D+HIRQIK++ P+L    E        F T EF+ + +IR
Sbjct: 121 VLANHENGRDSHIRQIKIYGPRL----EGLEVGSSSFSTPEFSSYSSIR 165



>gi|193606239|ref|XP_001950033.1| PREDICTED: anaphase-promoting complex subunit 10-like
           [Acyrthosiphon pisum]
          Length = 188

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/145 (55%), Positives = 104/145 (71%), Gaps = 5/145 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+GS AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  V  I +++
Sbjct: 26  VREVGSQAIWSLSSCKPGFGVDQLRDDCMETYWQSDGQLPHLVNIQFRRKTVVRDICIYI 85

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y+ DESYTP +I++RAGT+  DLQ++  VEL+EP  WV I       L     P+  ++
Sbjct: 86  DYRLDESYTPGRISVRAGTNFNDLQEVEVVELNEPYGWVRIMTKDINDL-----PLKTYM 140

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP 192
            QIA+  NHQNG+DTH+RQIKV +P
Sbjct: 141 LQIAVITNHQNGRDTHMRQIKVHSP 165



>gi|195455839|ref|XP_002074889.1| GK23298 [Drosophila willistoni]
 gi|194170974|gb|EDW85875.1| GK23298 [Drosophila willistoni]
          Length = 197

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 122/186 (65%), Gaps = 19/186 (10%)

Query: 41  SEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           SE +   +RE+GS A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+
Sbjct: 25  SEERLGGVREVGSQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNI 84

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTS 160
            QI ++ +YK DESYTP++I+IR+GT+  DLQ+L+ ++L EP  WV I +    + S   
Sbjct: 85  SQIYIYTDYKLDESYTPSRISIRSGTNFNDLQELQVIDLSEPTGWVQIPIKDGNVKS--- 141

Query: 161 RPVGAHLFQIAIKANHQNGKDTHIRQIKVFAP------KLPLFYEDYSDDDIPFKTVEFA 214
             +   + QIA+ +NHQNG+DTH+RQI++ AP       L LF +        F TV+F 
Sbjct: 142 --IRTFMLQIAVISNHQNGRDTHMRQIRIHAPVEGKHYPLELFGK--------FSTVDFQ 191

Query: 215 MHETIR 220
              TIR
Sbjct: 192 KFATIR 197



>gi|307191142|gb|EFN74840.1| Anaphase-promoting complex subunit 10 [Camponotus floridanus]
          Length = 189

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 86/173 (49%), Positives = 115/173 (66%), Gaps = 5/173 (2%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNYAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTPN+I+IRAGT+  DLQ++  ++L+EP  W+ I      I +   RP+   +
Sbjct: 82  DYKLDESYTPNRISIRAGTNFNDLQEVEVMDLNEPSGWIVI-----PIKNINDRPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQIK+ +P   +           F T EF  + TIR
Sbjct: 137 IQIAVISNHQNGRDTHMRQIKIHSPAQDILGPPAPYIPGQFLTNEFLRYATIR 189



>gi|156549338|ref|XP_001601344.1| PREDICTED: anaphase-promoting complex subunit 10-like [Nasonia
           vitripennis]
          Length = 189

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (65%), Gaps = 5/173 (2%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFRRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IRAGT+  DLQ++  ++L EP  WV I +  D       RP+   +
Sbjct: 82  DYKLDESYTPSRISIRAGTNFNDLQEVEVMDLSEPSGWVVIPIRDD-----NDRPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQIKV +P   +           F T EF  + TIR
Sbjct: 137 IQIAVISNHQNGRDTHMRQIKVHSPAEDILGPHSQLVPGRFLTNEFQRYATIR 189



>gi|332016291|gb|EGI57204.1| Anaphase-promoting complex subunit 10 [Acromyrmex echinatior]
          Length = 189

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 86/173 (49%), Positives = 115/173 (66%), Gaps = 5/173 (2%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNYAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTPN+I+IRAGT+  DLQ++  ++L+EP  W+ I      I +   RP+   +
Sbjct: 82  DYKLDESYTPNRISIRAGTNFNDLQEVEVMDLNEPSGWIVI-----PIKNINDRPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQIK+ +P   +           F T EF  + TIR
Sbjct: 137 IQIAVISNHQNGRDTHMRQIKIHSPAQDILGPPAPYIPGQFLTNEFLRYATIR 189



>gi|340729497|ref|XP_003403037.1| PREDICTED: anaphase-promoting complex subunit 10-like [Bombus
           terrestris]
 gi|350411580|ref|XP_003489394.1| PREDICTED: anaphase-promoting complex subunit 10-like [Bombus
           impatiens]
          Length = 189

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 120/187 (64%), Gaps = 6/187 (3%)

Query: 34  GERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQ 93
           GE   I+ E     +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQ
Sbjct: 9   GEIDPIQEELAGR-VREVGNHAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQ 67

Query: 94  FPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGD 153
           F +K  +  I ++ +YK DESYTP++I+IRAGT+  DLQ++  ++L+EP  WV I     
Sbjct: 68  FKRKTTIRDICIYTDYKLDESYTPSRISIRAGTNFNDLQEIEVMDLNEPSGWVII----- 122

Query: 154 EILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEF 213
            I     RP+   + QIA+ +NHQNG+DTH+RQIKV++P   +           F T EF
Sbjct: 123 PIKDINDRPIRTFMIQIAVISNHQNGRDTHMRQIKVYSPTQDVLGPPAPYIAGHFLTNEF 182

Query: 214 AMHETIR 220
             + T+R
Sbjct: 183 LRYATVR 189



>gi|322799261|gb|EFZ20652.1| hypothetical protein SINV_01375 [Solenopsis invicta]
          Length = 189

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 86/173 (49%), Positives = 115/173 (66%), Gaps = 5/173 (2%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  +  I ++ 
Sbjct: 22  VREVGNYAIWSLSSCKPGFGVDQLRDDITETYWQSDGQLPHLVNIQFKRKTTIRDICIYT 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTPN+I+IRAGT+  DLQ++  ++L+EP  W+ I      I +   RP+   +
Sbjct: 82  DYKLDESYTPNRISIRAGTNFNDLQEVEVMDLNEPSGWIVI-----PIKNINDRPIRTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQIK+ +P   +           F T EF  + TIR
Sbjct: 137 IQIAVISNHQNGRDTHMRQIKIHSPAQDILGPPAPYIPGQFLTNEFLRYATIR 189



>gi|449664364|ref|XP_002160509.2| PREDICTED: uncharacterized protein LOC100201345 [Hydra
            magnipapillata]
          Length = 1462

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/150 (52%), Positives = 106/150 (70%), Gaps = 6/150 (4%)

Query: 45   HEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQIS 104
             +++REIG +A+WSLSS K G GV +LRD+   TY+QSDG  PHL+NIQFP K  V  +S
Sbjct: 1294 QDQVREIGENAVWSLSSCKPGFGVSELRDNKLTTYFQSDGPQPHLINIQFPWKQAVRFVS 1353

Query: 105  LWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG 164
            ++ +YKSDESYTPN+I+IR G    DL+    +ELDEP  W++++L  +    KT     
Sbjct: 1354 IYTDYKSDESYTPNRISIRVGNDKHDLKQKELLELDEPCGWINVELDNNGNTLKT----- 1408

Query: 165  AHLFQIAIKANHQNGKDTHIRQIKVFAPKL 194
              + QIA+  NHQNG+DTH+RQIKVFAPK+
Sbjct: 1409 -FMIQIAVLGNHQNGRDTHLRQIKVFAPKV 1437



>gi|260806773|ref|XP_002598258.1| hypothetical protein BRAFLDRAFT_119142 [Branchiostoma floridae]
 gi|229283530|gb|EEN54270.1| hypothetical protein BRAFLDRAFT_119142 [Branchiostoma floridae]
          Length = 181

 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 5/146 (3%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++REIG  A+WS+SS K G GVD+LRD +  TYWQSDG  PHLVNIQF +K  V  + L+
Sbjct: 19  KVREIGDLAVWSVSSCKPGFGVDQLRDGSLDTYWQSDGPQPHLVNIQFRKKTAVKSLCLY 78

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
            +YKSDESYTPN+I+IR GTH  DLQ++  VEL EP  WV I      I  K+ +P    
Sbjct: 79  ADYKSDESYTPNRISIRTGTHFHDLQEVEQVELSEPTGWVII-----PIQDKSLQPQRTF 133

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAP 192
           + QIA+ +NHQNG+DTH+RQIK+ AP
Sbjct: 134 MIQIAVLSNHQNGRDTHMRQIKIHAP 159



>gi|21592739|gb|AAM64688.1| unknown [Arabidopsis thaliana]
          Length = 192

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 121/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SS K GNGV  LRDDN  TYWQSDG  PHL+NIQF +KV +  + L
Sbjct: 25  DDLREMGKNAAWSVSSCKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L+D+++VEL +P  WV + LSG +        V  
Sbjct: 85  YVDFKLDESYTPSKISIRAGDGFHNLKDIKSVELVKPTGWVCLSLSGTD---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIAI +NH NG+DTHIRQIKV+ P+  P+ ++ +      F ++EF  + T+R
Sbjct: 142 FMLQIAILSNHLNGRDTHIRQIKVYGPRPNPIPHQPFQ-----FTSMEFLTYSTLR 192



>gi|302780585|ref|XP_002972067.1| hypothetical protein SELMODRAFT_96868 [Selaginella moellendorffii]
 gi|302781674|ref|XP_002972611.1| hypothetical protein SELMODRAFT_96982 [Selaginella moellendorffii]
 gi|300160078|gb|EFJ26697.1| hypothetical protein SELMODRAFT_96982 [Selaginella moellendorffii]
 gi|300160366|gb|EFJ26984.1| hypothetical protein SELMODRAFT_96868 [Selaginella moellendorffii]
          Length = 174

 Score =  165 bits (417), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 116/174 (66%), Gaps = 8/174 (4%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E REIG  A+WS+SS K GNGVD LRD +  TYWQSDG  PHLVNIQF +KV +  ++++
Sbjct: 9   ERREIGKLAVWSVSSAKPGNGVDLLRDASLETYWQSDGAQPHLVNIQFQKKVRLQLLAIY 68

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           +++K DESYTPNKI++R G    DL++++ VEL EP+ WV + L      + +   + A 
Sbjct: 69  VDFKLDESYTPNKISVRTGNSFYDLREIKMVELAEPVGWVKVSLCP----TDSKEYLRAF 124

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           L Q+A+ +NHQNG+DTHIRQIK++ P+              F T++F+M  ++R
Sbjct: 125 LVQLAVLSNHQNGRDTHIRQIKIYGPR----QNAVIGHPFCFNTIDFSMRSSVR 174



>gi|198434262|ref|XP_002131938.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform 1
           [Ciona intestinalis]
          Length = 202

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/188 (45%), Positives = 120/188 (63%), Gaps = 13/188 (6%)

Query: 39  IKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKV 98
           I+   + E LREIG  A+WS+SS K G GV+ LRD++  TYWQSDGT PH+VN+QF QK 
Sbjct: 22  IRELLEKESLREIGHQAVWSVSSCKQGYGVNSLRDNSLETYWQSDGTQPHMVNVQFKQKT 81

Query: 99  NVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS---GDEI 155
            +  + ++ +YK+DESYTP+++++  G    DL ++  VE++EP  WV I+L    GD  
Sbjct: 82  TIHSVGVYTDYKADESYTPSRLSVSVGNDFNDLSEVEQVEVNEPSGWVWIKLPNQVGD-- 139

Query: 156 LSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDY--SDDDIP-FKTVE 212
                +P+   + QI++  NHQNG+DTH+RQIKVFA        DY  S   +P F +VE
Sbjct: 140 -----KPIRTFMAQISVLQNHQNGRDTHMRQIKVFASTKDTTSIDYMISGCRLPMFSSVE 194

Query: 213 FAMHETIR 220
            AM  TIR
Sbjct: 195 AAMFSTIR 202



>gi|298711511|emb|CBJ26599.1| Putative subunit of the Anaphase Promoting Complex [Ectocarpus
           siliculosus]
          Length = 210

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 118/197 (59%), Gaps = 13/197 (6%)

Query: 35  ERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQF 94
           E K   SE  +   REIG  A+WSLSS K GNGVD+LRDD+  TYWQSDG  PHL+NIQF
Sbjct: 16  EAKTEASELDYVTRREIGREAVWSLSSAKPGNGVDQLRDDSTDTYWQSDGGQPHLINIQF 75

Query: 95  PQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQL---- 150
            +K+ VV+I+  L++ SDESYTP K++IRAG+   DL ++   EL EP+ WV + L    
Sbjct: 76  HKKMTVVEIAFHLDFSSDESYTPKKLSIRAGSSFHDLVEVTVKELHEPVGWVRVPLFAPG 135

Query: 151 ------SGDEILSKTSRPV-GAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSD 203
                    +       PV  AH  QI + A HQNG+DTHIRQ+KVF P+L     D S 
Sbjct: 136 GGGAAAIAADAAGGAEGPVLRAHFVQICVVAMHQNGRDTHIRQVKVFGPRLASVQHDPS- 194

Query: 204 DDIPFKTVEFAMHETIR 220
             + F + EF     IR
Sbjct: 195 -LLEFISPEFETFACIR 210



>gi|301096061|ref|XP_002897129.1| anaphase-promoting complex subunit 10 [Phytophthora infestans
           T30-4]
 gi|262107448|gb|EEY65500.1| anaphase-promoting complex subunit 10 [Phytophthora infestans
           T30-4]
          Length = 178

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 114/173 (65%), Gaps = 7/173 (4%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           RE+G  A+WSLSS K GNGVD+LRDDN  TYWQSDG  PHL+NIQF +K+ + +++L+L+
Sbjct: 12  REVGDDAMWSLSSAKPGNGVDQLRDDNMDTYWQSDGVQPHLINIQFARKMVIKEVALYLD 71

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLF 168
           YK DESYTP KI IR+G+   DL+++    + EP  W+ I L  DE+  +   P+     
Sbjct: 72  YKLDESYTPKKIAIRSGSTVHDLKEIHVQHIAEPSGWISIPLHADEVSEQA--PLRTFFL 129

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTV-EFAMHETIR 220
           Q+ + A HQNG+DTHIRQ+K++AP+      +  D  IP  T  +FA    IR
Sbjct: 130 QVVVLAMHQNGRDTHIRQVKIYAPR----ETNVLDWTIPEATTPQFAAFSCIR 178



>gi|195123817|ref|XP_002006398.1| GI21024 [Drosophila mojavensis]
 gi|193911466|gb|EDW10333.1| GI21024 [Drosophila mojavensis]
          Length = 197

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 119/181 (65%), Gaps = 21/181 (11%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+GS A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGSQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IR+GT+  DLQ+L+ ++L EP  WV I +    + S     +   +
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQELQVIDLTEPNGWVQIPIKDGNVKS-----LRTFM 144

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP--------KLPLFYEDYSDDDIPFKTVEFAMHETI 219
            QIA+ +NHQNG+DTH+RQI+V AP         L LF +        F TV+F    TI
Sbjct: 145 LQIAVISNHQNGRDTHMRQIRVHAPCGGESKHYPLELFGK--------FGTVDFQKFATI 196

Query: 220 R 220
           R
Sbjct: 197 R 197



>gi|18398701|ref|NP_565433.1| anaphase-promoting complex subunit 10 [Arabidopsis thaliana]
 gi|34395513|sp|Q9ZPW2.2|APC10_ARATH RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|20197809|gb|AAD15507.2| expressed protein [Arabidopsis thaliana]
 gi|90567996|gb|ABD94068.1| At2g18290 [Arabidopsis thaliana]
 gi|110738941|dbj|BAF01391.1| hypothetical protein [Arabidopsis thaliana]
 gi|330251657|gb|AEC06751.1| anaphase-promoting complex subunit 10 [Arabidopsis thaliana]
          Length = 192

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 121/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SS K GNGV  LRDDN  TYWQSDG  PHL+NIQF +KV +  + L
Sbjct: 25  DDLREMGKNAAWSVSSCKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L+++++VEL +P  WV + LSG +        V  
Sbjct: 85  YVDFKLDESYTPSKISIRAGDGFHNLKEIKSVELVKPTGWVCLSLSGTD---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIAI +NH NG+DTHIRQIKV+ P+  P+ ++ +      F ++EF  + T+R
Sbjct: 142 FMLQIAILSNHLNGRDTHIRQIKVYGPRPNPIPHQPFQ-----FTSMEFLTYSTLR 192



>gi|194880742|ref|XP_001974521.1| GG21047 [Drosophila erecta]
 gi|195487878|ref|XP_002092079.1| GE13990 [Drosophila yakuba]
 gi|190657708|gb|EDV54921.1| GG21047 [Drosophila erecta]
 gi|194178180|gb|EDW91791.1| GE13990 [Drosophila yakuba]
          Length = 195

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 119/179 (66%), Gaps = 19/179 (10%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IR+GT+  DLQ+L+ ++L EP  WV I +    + S     +   +
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQELQVMDLTEPTGWVQIPIKDGNVKS-----IRTFM 144

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP------KLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQI++ AP       L LF +        F TV+F    TIR
Sbjct: 145 LQIAVISNHQNGRDTHMRQIRIHAPVEGKHYPLELFGK--------FGTVDFQKFATIR 195



>gi|195382745|ref|XP_002050089.1| GJ21948 [Drosophila virilis]
 gi|194144886|gb|EDW61282.1| GJ21948 [Drosophila virilis]
          Length = 197

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 119/181 (65%), Gaps = 21/181 (11%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+GS A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGSQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IR+GT+  DLQ+L+ ++L EP  WV I +    + S     +   +
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQELQVIDLTEPNGWVQIPIKDGNVKS-----LRTFM 144

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP--------KLPLFYEDYSDDDIPFKTVEFAMHETI 219
            QIA+ +NHQNG+DTH+RQI+V AP         L LF +        F TV+F    TI
Sbjct: 145 LQIAVISNHQNGRDTHMRQIRVHAPCGGEGKHYPLELFGK--------FGTVDFQKFATI 196

Query: 220 R 220
           R
Sbjct: 197 R 197



>gi|499013761|ref|XP_004537616.1| PREDICTED: anaphase-promoting complex subunit 10-like, partial
           [Ceratitis capitata]
          Length = 168

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 106/145 (73%), Gaps = 5/145 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIG+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVN+QF +K  +  + L+ 
Sbjct: 23  VREIGNQAVWSLSSCKPGFGVERLRDNIIDTYWQSDGQLPHLVNVQFHRKTRISAVYLYA 82

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I++R G++  DLQ+L+  EL EP  W  IQ+      S  SRPV  ++
Sbjct: 83  DYKLDESYTPSRISLRTGSNFNDLQELQNQELFEPTGWTAIQVE-----SGKSRPVRIYM 137

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP 192
            QIAI ANHQNG+DTH+RQI++ AP
Sbjct: 138 LQIAIVANHQNGRDTHLRQIRIHAP 162



>gi|508699164|gb|EOX91060.1| Anaphase promoting complex 10 isoform 2 [Theobroma cacao]
          Length = 173

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 108/151 (71%), Gaps = 3/151 (1%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKTGNGVSSLRDDNLETYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI IRAG    +L++++TVEL +P  WV + LSG++        V  
Sbjct: 85  YVDFKLDESYTPSKICIRAGDGFHNLKEIKTVELVKPTGWVYLSLSGND---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKLPL 196
            + QIA+ +NH NG+DTH+RQIKV+ P+L +
Sbjct: 142 FMLQIAVLSNHLNGRDTHVRQIKVYGPRLCI 172



>gi|125807963|ref|XP_001360579.1| GA10993 [Drosophila pseudoobscura pseudoobscura]
 gi|195150391|ref|XP_002016138.1| GL10659 [Drosophila persimilis]
 gi|54635751|gb|EAL25154.1| GA10993 [Drosophila pseudoobscura pseudoobscura]
 gi|194109985|gb|EDW32028.1| GL10659 [Drosophila persimilis]
          Length = 195

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 118/175 (67%), Gaps = 11/175 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IR+GT+  DLQ+L+ ++L EP  WV + +    + S     +   +
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQELQVLDLTEPTGWVQVPIKDGNVKS-----IRTFM 144

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFY--EDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQI++ AP     Y  E +      F TV+F    TIR
Sbjct: 145 LQIAVISNHQNGRDTHMRQIRIHAPVEGKLYALEPFGK----FGTVDFQKFATIR 195



>gi|224134260|ref|XP_002327795.1| predicted protein [Populus trichocarpa]
 gi|222836880|gb|EEE75273.1| predicted protein [Populus trichocarpa]
          Length = 192

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 120/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKPGNGVSSLRDDNLDTYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L++++T+EL +P  WV + LSG++        V  
Sbjct: 85  YVDFKLDESYTPSKISIRAGDGFHNLKEIKTMELVKPTGWVYLSLSGND---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIKV+ P+  P  ++ +      F + EF M+ ++R
Sbjct: 142 FMLQIAVLSNHLNGRDTHVRQIKVYGPRPNPFPHQPFQ-----FTSREFIMYSSVR 192



>gi|297836562|ref|XP_002886163.1| anaphase-promoting complex, subunit 10 family [Arabidopsis lyrata
           subsp. lyrata]
 gi|297332003|gb|EFH62422.1| anaphase-promoting complex, subunit 10 family [Arabidopsis lyrata
           subsp. lyrata]
          Length = 192

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 121/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SS K GNGV  LRDDN  TYWQSDG  PHL+NIQF +KV +  + L
Sbjct: 25  DDLREMGKNAAWSVSSCKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L+++++VEL +P  WV + LSG +        V  
Sbjct: 85  YVDFKLDESYTPSKISIRAGDGFHNLKEIKSVELVKPTGWVCLSLSGTD---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIAI +NH NG+DTHIRQIKV+ P+  P+ ++ +      F ++EF  + T+R
Sbjct: 142 FMLQIAILSNHLNGRDTHIRQIKVYGPRPNPIPHQPFQ-----FTSMEFLTYSTLR 192



>gi|28573741|ref|NP_611223.4| anaphase promoting complex subunit 10 [Drosophila melanogaster]
 gi|195335261|ref|XP_002034293.1| GM19974 [Drosophila sechellia]
 gi|195584242|ref|XP_002081923.1| GD25470 [Drosophila simulans]
 gi|34395510|sp|Q9V831.2|APC10_DROME RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10;
           AltName: Full=Cyclosome subunit 10
 gi|21406644|gb|AAL48829.2| RE25242p [Drosophila melanogaster]
 gi|28380763|gb|AAF57848.2| anaphase promoting complex subunit 10 [Drosophila melanogaster]
 gi|194126263|gb|EDW48306.1| GM19974 [Drosophila sechellia]
 gi|194193932|gb|EDX07508.1| GD25470 [Drosophila simulans]
 gi|220948260|gb|ACL86673.1| CG11419-PA [synthetic construct]
 gi|220957430|gb|ACL91258.1| CG11419-PA [synthetic construct]
          Length = 195

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 119/179 (66%), Gaps = 19/179 (10%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IR+GT+  DLQ+L+ ++L EP  WV I +    + S     +   +
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQELQVMDLTEPTGWVQIPIKDGNVKS-----IRTFM 144

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP------KLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQI++ AP       L LF +        F TV+F    TIR
Sbjct: 145 LQIAVISNHQNGRDTHMRQIRIHAPVEGKHYPLELFGK--------FGTVDFQKFATIR 195



>gi|308808844|ref|XP_003081732.1| Anaphase-promoting complex, subunit 10 (IC) [Ostreococcus tauri]
 gi|55978032|gb|AAV68616.1| anaphase promoting complex subunit 10 [Ostreococcus tauri]
 gi|116060198|emb|CAL56257.1| Anaphase-promoting complex, subunit 10 (IC) [Ostreococcus tauri]
          Length = 319

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (71%), Gaps = 4/144 (2%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A+WS++S K GNGV+ LRDD+  T+WQSDG  PH+VN QF  KV + ++++W  Y
Sbjct: 15  KIGGLAVWSVASAKPGNGVEMLRDDDLGTFWQSDGAQPHVVNAQFQHKVEICELAMWCEY 74

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQ 169
           K DESYTP+ I+IRAG    DL+++R VEL+ P  WV ++L G +  S     + A+  Q
Sbjct: 75  KMDESYTPSVISIRAGASCHDLREVRCVELENPNGWVRVRLRGPDDASY----LRAYFVQ 130

Query: 170 IAIKANHQNGKDTHIRQIKVFAPK 193
           IAI ANHQNG+DTH+RQIK+F P+
Sbjct: 131 IAILANHQNGRDTHVRQIKIFGPR 154



>gi|194755361|ref|XP_001959960.1| GF11781 [Drosophila ananassae]
 gi|190621258|gb|EDV36782.1| GF11781 [Drosophila ananassae]
          Length = 195

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 119/179 (66%), Gaps = 19/179 (10%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IR+GT+  DLQ+L+ ++L EP  WV I +    + S     +   +
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQELQVMDLTEPTGWVQIPIKDGNVKS-----IRTFM 144

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP------KLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+ +NHQNG+DTH+RQI++ AP       L LF +        F TV+F    TIR
Sbjct: 145 LQIAVISNHQNGRDTHMRQIRIHAPVEGKHYPLELFGK--------FGTVDFQKFATIR 195



>gi|224094807|ref|XP_002310244.1| predicted protein [Populus trichocarpa]
 gi|222853147|gb|EEE90694.1| predicted protein [Populus trichocarpa]
          Length = 192

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 120/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKPGNGVSSLRDDNLDTYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L++++T+EL +P  WV + LSG++        V  
Sbjct: 85  YVDFKLDESYTPSKISIRAGDGFHNLKEIKTMELVKPTGWVYLSLSGND---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIKV+ P+L P  ++ +      F + EF  + ++R
Sbjct: 142 FMLQIAVLSNHLNGRDTHVRQIKVYGPQLNPFPHQPFQ-----FTSREFITYSSVR 192



>gi|219884719|gb|ACL52734.1| unknown [Zea mays]
 gi|413948345|gb|AFW80994.1| anaphase-promoting complex subunit 10 [Zea mays]
          Length = 201

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 119/175 (68%), Gaps = 9/175 (5%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 35  DMREMAKTAAWSVSSCKAGNGVAALRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 94

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           +++K DESYTP+KI+IRAG    +L+++RTVEL +P+ WV I LSG   +      +   
Sbjct: 95  VDFKLDESYTPSKISIRAGDGFHNLKEIRTVELAKPVGWVHISLSG---IDPRETFIHTF 151

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
           + QIA+ +NH NG+DTH+RQIK++ P+  P+ ++ +      F + EF  + TIR
Sbjct: 152 MLQIAVLSNHLNGRDTHVRQIKIYGPRPNPVPHQPFH-----FTSREFITYSTIR 201



>gi|242091253|ref|XP_002441459.1| hypothetical protein SORBIDRAFT_09g027240 [Sorghum bicolor]
 gi|241946744|gb|EES19889.1| hypothetical protein SORBIDRAFT_09g027240 [Sorghum bicolor]
          Length = 201

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 120/177 (67%), Gaps = 13/177 (7%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  ++L+
Sbjct: 35  DMREMAKTAAWSVSSCKAGNGVAALRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVALY 94

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           +++K DESYTP+KI+IRAG    +L++++TVEL +P+ WV I LSG +      R    H
Sbjct: 95  VDFKLDESYTPSKISIRAGDGFHNLKEIKTVELAKPVGWVHISLSGAD-----PRETFIH 149

Query: 167 LF--QIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            F  QIA+ +NH NG+DTH+RQIK++ P+  P+  + +      F + EF  + TIR
Sbjct: 150 TFMLQIAVLSNHLNGRDTHVRQIKIYGPRPNPVPAQPFH-----FTSREFITYSTIR 201



>gi|145351293|ref|XP_001420017.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144580250|gb|ABO98310.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 280

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (71%), Gaps = 4/144 (2%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           E+G  A+WS++S K GNGV+ LRDD+  T+WQSDG  PH+VN QF  K  + +I+LW  Y
Sbjct: 1   EVGHLAVWSVASAKPGNGVELLRDDDLATFWQSDGAQPHVVNAQFQHKAELCEIALWCEY 60

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQ 169
           K DESYTP+ I+IRAG    DL+++R VEL++P  WV ++L G +     S  + A+  Q
Sbjct: 61  KMDESYTPSLISIRAGASCHDLREVRLVELEQPNGWVRVRLRGVD----DSSYLRAYFIQ 116

Query: 170 IAIKANHQNGKDTHIRQIKVFAPK 193
           IA+ ANHQNG+DTH+RQIK+F P+
Sbjct: 117 IAVLANHQNGRDTHVRQIKIFGPR 140



>gi|388512629|gb|AFK44376.1| unknown [Medicago truncatula]
          Length = 196

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 116/176 (65%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           E+LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PH VNIQF +KV +  + L
Sbjct: 29  EDLRELGKKAAWSVSSCKTGNGVSSLRDDNLETYWQSDGAQPHFVNIQFQKKVRLQLVVL 88

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L++++ VEL +P  W+ + LSG   L      V  
Sbjct: 89  YVDFKLDESYTPSKISIRAGDGFHNLKEIKAVELVKPTGWLYLSLSG---LDPRETFVNT 145

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIKV+ P+  P+  + +      F + EF  + TIR
Sbjct: 146 FMLQIAVLSNHLNGRDTHVRQIKVYGPRPNPIPQQPFQ-----FTSTEFITYSTIR 196



>gi|255079740|ref|XP_002503450.1| predicted protein [Micromonas sp. RCC299]
 gi|226518717|gb|ACO64708.1| predicted protein [Micromonas sp. RCC299]
          Length = 198

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 117/182 (64%), Gaps = 7/182 (3%)

Query: 44  KHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQI 103
           +  ++ EIG  A+WS++S K GNGV+ LRD++  TYWQSDG  PHLVN+QF +KV V ++
Sbjct: 19  RRGDVSEIGKLAVWSVTSAKPGNGVELLRDNSLDTYWQSDGAQPHLVNVQFQKKVRVREL 78

Query: 104 SLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDE-----ILSK 158
            ++ +Y+ DESYTPNKI++RAG    DL++++TV+LDEP  W  + L  DE     +   
Sbjct: 79  CIYADYRLDESYTPNKISVRAGNSFHDLREIKTVDLDEPSGWTRVSLVKDENEPGALNGG 138

Query: 159 TSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHET 218
               +  +  QIA+ +NHQNG+DTH+RQ+K++ P+     E      + F T E+    T
Sbjct: 139 DGECLRTYFLQIAVLSNHQNGRDTHVRQVKIYGPRTSP--EAMIGQGMQFTTPEYGQFAT 196

Query: 219 IR 220
           +R
Sbjct: 197 VR 198



>gi|482567332|gb|EOA31521.1| hypothetical protein CARUB_v10014711mg [Capsella rubella]
          Length = 192

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 120/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G +A WS+SS K GNGV  LRDDN  TYWQSDG  PHL+NIQF +KV +  + L
Sbjct: 25  DDLREMGKNAAWSVSSCKPGNGVGTLRDDNIETYWQSDGLQPHLINIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L+++++VEL +P  WV + LSG +        V  
Sbjct: 85  YVDFKLDESYTPSKISIRAGDGFHNLKEIKSVELVKPTGWVCLSLSGTD---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIAI +NH NG+DTHIRQIKV+ P+  P+  + +      F ++EF  + T+R
Sbjct: 142 FMLQIAILSNHLNGRDTHIRQIKVYGPRPNPIPRQPFQ-----FTSMEFLTYSTLR 192



>gi|478253336|gb|ENN73697.1| hypothetical protein YQE_09694, partial [Dendroctonus ponderosae]
          Length = 644

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 78/154 (50%), Positives = 107/154 (69%), Gaps = 6/154 (3%)

Query: 39  IKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKV 98
           IK+E ++  +RE+G  AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K 
Sbjct: 12  IKNE-RNGSVREVGCQAIWSLSSCKPGFGVDQLRDDRADTYWQSDGQLPHLVNIQFQRKT 70

Query: 99  NVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSK 158
            +  I ++ +YK DESYTP++I+IR GTH  D+Q++  + L EP  WV +      I   
Sbjct: 71  TISDIYIYTDYKLDESYTPSRISIRVGTHFNDIQEIEVIPLIEPAGWVHVS-----IRDL 125

Query: 159 TSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
             +P+   + Q+A+ +NHQNG+DTH+RQIK+ +P
Sbjct: 126 RDKPIRVFMIQLAVTSNHQNGRDTHMRQIKIHSP 159



>gi|391346994|ref|XP_003747750.1| PREDICTED: anaphase-promoting complex subunit 10-like [Metaseiulus
           occidentalis]
          Length = 209

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 80/151 (52%), Positives = 107/151 (70%), Gaps = 7/151 (4%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVV 101
           EFK E  RE+G  A+WSLSS K G GVD+LRD+N  TYWQSDG  PHLVNIQF  K  V 
Sbjct: 39  EFKGEH-REVGDQAVWSLSSCKPGFGVDQLRDNNTETYWQSDGPQPHLVNIQFRHKTLVD 97

Query: 102 QISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSR 161
            ++++ ++K DESYTPN+I++R G+H  DLQ+L  +EL EP  WV I ++ ++      +
Sbjct: 98  SVAIYTDFKLDESYTPNRISVRVGSHFHDLQELDVIELTEPSGWVTIPINHNK------Q 151

Query: 162 PVGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
           P+     QIAI +NHQNG+DTH+RQIK+ +P
Sbjct: 152 PIKTFFIQIAILSNHQNGRDTHLRQIKIHSP 182



>gi|255561114|ref|XP_002521569.1| anaphase-promoting complex, putative [Ricinus communis]
 gi|223539247|gb|EEF40840.1| anaphase-promoting complex, putative [Ricinus communis]
          Length = 192

 Score =  162 bits (409), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 121/176 (68%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  ++WQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKPGNGVSSLRDDNLDSFWQSDGAQPHLVNIQFQKKVKLQLVLL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L++++TVEL +P  WV + LSG++        V  
Sbjct: 85  YVDFKLDESYTPSKISIRAGDGFHNLKEIKTVELVKPTGWVYLSLSGND---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIKV+ P+L P+ ++ +      F + EF  + ++R
Sbjct: 142 FMLQIAVLSNHLNGRDTHVRQIKVYGPRLNPIPHQPFQ-----FTSREFITYSSVR 192



>gi|506968775|gb|AGM32731.1| APC10 subunit of the anaphase-promoting complex (APC) [Coptotermes
           formosanus]
          Length = 186

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 81/151 (53%), Positives = 108/151 (71%), Gaps = 5/151 (3%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVV 101
           E +  ++RE+GS AIWSLSS K G GVD+LRDD   TYWQSDG LPHLVNIQF +K  V 
Sbjct: 15  EERAGKVREVGSQAIWSLSSCKPGFGVDQLRDDCTDTYWQSDGQLPHLVNIQFRRKTTVH 74

Query: 102 QISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSR 161
            I ++ +YK DESYTP++I+IRAGT+  DLQ++  ++L+EP  WV I      I     +
Sbjct: 75  DIFIFTDYKLDESYTPSRISIRAGTNFNDLQEVEVIDLNEPTGWVLI-----PIKDIHEK 129

Query: 162 PVGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
           P+   + QIA+ +NHQNG+DTH+RQIK+ +P
Sbjct: 130 PIRTFMIQIAVISNHQNGRDTHMRQIKIHSP 160



>gi|348680677|gb|EGZ20493.1| hypothetical protein PHYSODRAFT_245966 [Phytophthora sojae]
          Length = 175

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 112/174 (64%), Gaps = 9/174 (5%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G  A+WSLSS K GNGVD+LRD+N  TYWQSDG  PHL+NIQF +K  V +++L L
Sbjct: 10  MREVGDDAVWSLSSAKPGNGVDQLRDNNMDTYWQSDGVQPHLINIQFSRKTAVKEVALHL 69

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP KI IR+G+   DL+++    + EP  W+ I L  DE       P+    
Sbjct: 70  DYKLDESYTPKKIAIRSGSTVHDLKEIHVQHIAEPSGWISIPLHSDE----EQVPLRTFF 125

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTV-EFAMHETIR 220
            QI I A HQNG+DTHIRQ+K++AP+      +  D  IP  T  +FA +  IR
Sbjct: 126 LQIVILAMHQNGRDTHIRQVKIYAPR----EANVLDWTIPEATTPQFAAYSCIR 175



>gi|449446698|ref|XP_004141108.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cucumis
           sativus]
 gi|449489479|ref|XP_004158324.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cucumis
           sativus]
          Length = 192

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 119/176 (67%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKPGNGVSALRDDNLETYWQSDGVQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L++++TVEL +P  WV + LSG++        V  
Sbjct: 85  YVDFKLDESYTPSKISIRAGDGFHNLKEIKTVELVKPTGWVYLLLSGND---PKDTFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIK++ P+  P+ ++ +      F + EF  +  IR
Sbjct: 142 FMLQIAVLSNHLNGRDTHVRQIKIYGPRPNPIPHQPFQ-----FTSREFITYSIIR 192



>gi|403330992|gb|EJY64414.1| Anaphase-promoting complex (APC), subunit 10 [Oxytricha trifallax]
 gi|403331386|gb|EJY64638.1| Anaphase-promoting complex (APC), subunit 10 [Oxytricha trifallax]
          Length = 207

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 116/175 (66%), Gaps = 7/175 (4%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG  A+W+LSS K GNGV+++RDD   T+WQSDGT PH VNIQF +K+ V +ISL+L+
Sbjct: 37  REIGDLAVWTLSSAKPGNGVEQIRDDQVSTFWQSDGTQPHYVNIQFLKKMRVQEISLYLD 96

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLF 168
           +K+DESYTP+KI+IR G    +LQ+++ +E +EP+ W   QL       +  +P    +F
Sbjct: 97  FKTDESYTPSKISIRVGNSFYELQEVKLIEFEEPIGWFTFQLHEKGTNGQILKPYIKTMF 156

Query: 169 -QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDI--PFKTVEFAMHETIR 220
            QIAI  N  +G+DTHIRQIK+FAP+     + Y + D+   F T E     TIR
Sbjct: 157 VQIAILQNQHSGRDTHIRQIKIFAPR----EKQYHNRDMHPNFLTTEMTQFSTIR 207



>gi|195027301|ref|XP_001986522.1| GH20482 [Drosophila grimshawi]
 gi|193902522|gb|EDW01389.1| GH20482 [Drosophila grimshawi]
          Length = 197

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 119/181 (65%), Gaps = 21/181 (11%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+G+ A+WSLSS K G GV++LRD+   TYWQSDG LPHLVNIQF ++ N+ QI ++ 
Sbjct: 30  VREVGAQAVWSLSSCKPGFGVERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYT 89

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DESYTP++I+IR+GT+  DLQ+L+ ++L EP  WV I +    + S     +   +
Sbjct: 90  DYKLDESYTPSRISIRSGTNFNDLQELQVIDLTEPNGWVQIPIKDGNVKS-----LRTFM 144

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP--------KLPLFYEDYSDDDIPFKTVEFAMHETI 219
            QIA+ +NHQNG+DTH+RQI+V AP         L LF +        F +V+F    TI
Sbjct: 145 LQIAVISNHQNGRDTHMRQIRVHAPCGGEGKHYPLELFGK--------FGSVDFQKFATI 196

Query: 220 R 220
           R
Sbjct: 197 R 197



>gi|470319387|gb|EMR11006.1| hypothetical protein PNEG_00607 [Pneumocystis murina B123]
          Length = 198

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 118/174 (67%), Gaps = 11/174 (6%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG+ A W++SS K G GV++LR+DN  T+WQSDG  PH +NI F +KV++  +S +  
Sbjct: 34  REIGNLATWTVSSSKPGFGVEQLRNDNVDTFWQSDGPQPHYINIHFIKKVSIKLLSFYTQ 93

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQL--SGDEILSKTSRPVGAH 166
           Y+ DESYTP+KI++RAGT   DLQ++  ++L+EP  WV I L   G + L +T      H
Sbjct: 94  YRQDESYTPSKISVRAGTGFHDLQEVIALDLNEPSGWVHISLGDCGKDGLLRT------H 147

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           L Q+ ++ANHQNGKDTHIR +KVFAP++   Y     D +P+ ++ F+ H  IR
Sbjct: 148 LLQLCVQANHQNGKDTHIRLVKVFAPRI---YAADETDILPYTSIIFSKHLKIR 198



>gi|242006722|ref|XP_002424196.1| anaphase-promoting complex subunit, putative [Pediculus humanus
           corporis]
 gi|212507537|gb|EEB11458.1| anaphase-promoting complex subunit, putative [Pediculus humanus
           corporis]
          Length = 187

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 120/181 (66%), Gaps = 9/181 (4%)

Query: 41  SEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           +E +  ++RE+GS AIWSLSS K   GVD+LRD+   TYWQSDG LPHLVNIQF +K  V
Sbjct: 15  TEERAGKVREVGSHAIWSLSSCKPSFGVDQLRDNCMETYWQSDGQLPHLVNIQFRKKTTV 74

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTS 160
             I ++++YK DESYTP++I++RAGT+  DLQ++  ++L+EP  W  I +          
Sbjct: 75  QDICIYIDYKLDESYTPSRISVRAGTNFTDLQEVEVIDLNEPTGWFLIPVK-----DIND 129

Query: 161 RPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFA-MHETI 219
           +P+   + QIA+ +NHQNG+DTH+RQIK+ +   PL     S +DI   T +F  M  ++
Sbjct: 130 KPIRTFMIQIAVISNHQNGRDTHMRQIKIHS---PLEKRGMSLNDIGDFTTQFCQMFTSV 186

Query: 220 R 220
           R
Sbjct: 187 R 187



>gi|226528224|ref|NP_001148648.1| anaphase-promoting complex subunit 10 [Zea mays]
 gi|195621090|gb|ACG32375.1| anaphase-promoting complex subunit 10 [Zea mays]
          Length = 201

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 120/177 (67%), Gaps = 13/177 (7%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 35  DMREMAKTAAWSVSSCKAGNGVAALRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 94

Query: 107 LNYKSDESYTPNKITIRA--GTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG 164
           +++K DESYTP+KI+IRA  G HN  L+++RTVEL +P+ WV I LSG   +      + 
Sbjct: 95  VDFKLDESYTPSKISIRAEDGFHN--LKEIRTVELAKPVGWVHISLSG---IDPRETFIH 149

Query: 165 AHLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
             + QIA+ +NH NG+DTH+RQIK++ P+  P+ ++ +      F + EF  + TIR
Sbjct: 150 TFMLQIAVLSNHLNGRDTHVRQIKIYGPRPNPVPHQPFH-----FTSREFITYSTIR 201



>gi|430813297|emb|CCJ29329.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 198

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 118/174 (67%), Gaps = 11/174 (6%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG+ A W++SS K G GV++LR+D+  T+WQSDG  PH +NI F +KV++  +S +  
Sbjct: 34  REIGNLATWTVSSSKPGFGVEQLRNDSIDTFWQSDGPQPHYINIHFIKKVSIKLLSFYTQ 93

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQL--SGDEILSKTSRPVGAH 166
           Y+ DESYTP+KI++RAGT   DLQ++  ++L+EP  WV + L   G + L +T      H
Sbjct: 94  YRQDESYTPSKISVRAGTGFHDLQEVIALDLNEPSGWVHVTLGDCGKDGLLRT------H 147

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           L Q+ ++ANHQNGKDTHIR +KVFAP++   Y     D +P+ +V F+ H  +R
Sbjct: 148 LLQLCVQANHQNGKDTHIRLVKVFAPRI---YAADEADILPYTSVAFSKHLKVR 198



>gi|502153256|ref|XP_004509275.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X1
           [Cicer arietinum]
 gi|502153259|ref|XP_004509276.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Cicer arietinum]
 gi|502153261|ref|XP_004509277.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X3
           [Cicer arietinum]
          Length = 196

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 116/176 (65%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +ELRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PH VNIQF +KV +  + L
Sbjct: 29  DELRELGKKAAWSVSSCKPGNGVSSLRDDNLETYWQSDGAQPHFVNIQFQKKVRLQLVVL 88

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L++++ VEL +P  W+ + LSG   +      V  
Sbjct: 89  YVDFKLDESYTPSKISIRAGDGFHNLKEIKAVELVKPTGWLYLSLSG---IDPRDTFVNT 145

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIKV+ P+  P+  + +      F + EF  + TIR
Sbjct: 146 FMLQIAVLSNHLNGRDTHVRQIKVYGPRPNPIPQQPFQ-----FTSEEFITYSTIR 196



>gi|326519366|dbj|BAJ96682.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 204

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 120/177 (67%), Gaps = 13/177 (7%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDD+  TYWQSDG  PHLVNIQF +KV +  ++L+
Sbjct: 38  DMREMAKTAAWSVSSCKPGNGVASLRDDSLDTYWQSDGAQPHLVNIQFQKKVQLQLVALY 97

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           +++K DESYTP+KI+IRAG    +L++++TV+L +P+ WV I LSG +      R    H
Sbjct: 98  VDFKLDESYTPSKISIRAGDGFHNLKEIKTVDLLKPVGWVHISLSGTD-----PRETFVH 152

Query: 167 LF--QIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            F  QIA+ ANH NG+DTH+RQIK++ P+  P+  + +        + EF M+ TIR
Sbjct: 153 TFMLQIAVLANHLNGRDTHVRQIKIYGPRPNPVPRQPFH-----VTSREFIMYSTIR 204



>gi|460375459|ref|XP_004233523.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform 2
           [Solanum lycopersicum]
          Length = 191

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 115/178 (64%), Gaps = 13/178 (7%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS+K GNGV  LRDDN  TYWQSDG  PHLVN+QF +KV +  + L
Sbjct: 24  DDLREMGKKAAWSVSSYKPGNGVLSLRDDNLETYWQSDGAQPHLVNVQFQKKVKLQLVVL 83

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP KI+IRAG    +L++++ VEL +P  W+ I LSG++        V  
Sbjct: 84  YVDFKLDESYTPGKISIRAGDGFHNLKEIKAVELVKPTGWMHISLSGND---PRETFVNT 140

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPK---LPLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QI + +NH NG+DTHIRQIKV+ P+   +PL           F + EF  +  +R
Sbjct: 141 FMLQIGVLSNHLNGRDTHIRQIKVYGPRPNPIPL-------QPFQFTSTEFITYSAVR 191



>gi|159471183|ref|XP_001693736.1| anaphase promoting complex subunit 10 [Chlamydomonas reinhardtii]
 gi|158283239|gb|EDP08990.1| anaphase promoting complex subunit 10 [Chlamydomonas reinhardtii]
          Length = 178

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 71/145 (48%), Positives = 108/145 (74%), Gaps = 3/145 (2%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           RE+G  A+WS++S K GNGV+ LRD +  T+WQSDG  PHL+N+QF +KV ++++ ++++
Sbjct: 14  REVGHLAVWSVTSAKAGNGVEMLRDGSTETFWQSDGLQPHLINVQFQRKVPLLELQMYVD 73

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLF 168
           YK DESYTP+++++RAG    DL+++R +EL+EP  WV I L+ D+       P+ A   
Sbjct: 74  YKLDESYTPSRVSVRAGHTYQDLKEVRVLELEEPSGWVVIPLTADD---APHEPLKAFYL 130

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPK 193
           Q+A+ ANHQNG+DTHIRQ+KVF+ +
Sbjct: 131 QLAVLANHQNGRDTHIRQVKVFSAR 155



>gi|504128801|ref|XP_004577641.1| PREDICTED: anaphase-promoting complex subunit 10-like [Ochotona
           princeps]
          Length = 185

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 115/174 (66%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           ++EIGS A+WS SS K G GVD+L DDN  TYWQS G+ PH VNIQF +K  V  + ++ 
Sbjct: 22  VQEIGSQAVWSFSSCKPGFGVDQLGDDNLETYWQSAGSQPHSVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI++RAG +  +LQ++R +EL +P  W  + L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISVRAGNNFHNLQEIRQLELVDPSGWTHVPLTDNH-----KKPTRMFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIAI ANHQ+G+DTH+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAILANHQDGRDTHMRQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 185



>gi|308080974|ref|NP_001183667.1| uncharacterized protein LOC100502261 [Zea mays]
 gi|238013766|gb|ACR37918.1| unknown [Zea mays]
 gi|413946331|gb|AFW78980.1| hypothetical protein ZEAMMB73_444017 [Zea mays]
          Length = 198

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 120/177 (67%), Gaps = 13/177 (7%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+   A WS+SS+K GNGV  LRDDN   YWQSDG  PHLVNI+F +KV +  ++L+
Sbjct: 32  DMREVAKRAAWSVSSFKDGNGVAALRDDNLDAYWQSDGAEPHLVNIRFQKKVQLQLVALY 91

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           +++K DESYTP+KI+IRAG    +L++++TVEL +P+ WV I LSG +      R    H
Sbjct: 92  VDFKLDESYTPSKISIRAGDGFHNLKEIKTVELAKPVGWVHISLSGAD-----PRETFIH 146

Query: 167 LF--QIAIKANHQNGKDTHIRQIKVFAPK-LPLFYEDYSDDDIPFKTVEFAMHETIR 220
            F  QIA+ +NH NG+DTH+RQIK++ P+  P+ ++ +      F + EF  + TIR
Sbjct: 147 TFMLQIAVLSNHLNGRDTHVRQIKIYGPRPSPVPHQPFH-----FISREFITYSTIR 198



>gi|358249186|ref|NP_001240007.1| uncharacterized protein LOC100806981 [Glycine max]
 gi|255633646|gb|ACU17182.1| unknown [Glycine max]
          Length = 192

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 118/176 (67%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++L E+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  I L
Sbjct: 25  DDLTEMGKKAAWSVSSCKPGNGVSSLRDDNLETYWQSDGGQPHLVNIQFQKKVRLQLIVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+K++IRAG    +L++++TVEL +P  WV + LSG   +      V  
Sbjct: 85  YVDFKLDESYTPSKVSIRAGDGFHNLKEIKTVELVKPTGWVYLSLSG---VDPRDTFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIKV+ P+  P+ ++ +      F + EF  + +IR
Sbjct: 142 FMLQIAVLSNHLNGRDTHVRQIKVYGPRPNPIPHQPFQ-----FTSREFITYSSIR 192



>gi|307103401|gb|EFN51661.1| hypothetical protein CHLNCDRAFT_139870 [Chlorella variabilis]
          Length = 180

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 81/185 (43%), Positives = 120/185 (64%), Gaps = 7/185 (3%)

Query: 37  KIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQ 96
           K++ +       REIG  A+WS++S K GNGV+ LRD    TYWQSDG  PHLVN+QF +
Sbjct: 2   KLVTTLQPDTNFREIGRLAVWSVTSAKPGNGVELLRDGRDDTYWQSDGAQPHLVNVQFQK 61

Query: 97  KVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEIL 156
           KV + +++++ +YK DESYTP KI+IR G    D++++R++EL EP  WV + L  D+  
Sbjct: 62  KVYLSEVAIFTDYKLDESYTPTKISIRVGNTFSDVREVRSIELSEPQGWVVVSLPPDD-- 119

Query: 157 SKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAM 215
            +    +   L QIA+ ANHQNG+DTHIRQ++VF P+  P+    +   ++ F + +FAM
Sbjct: 120 -EPEAYLKGFLLQIAVLANHQNGRDTHIRQVRVFGPRSDPIKALGH---EVSFTSPQFAM 175

Query: 216 HETIR 220
           +   R
Sbjct: 176 YAAAR 180



>gi|357132396|ref|XP_003567816.1| PREDICTED: anaphase-promoting complex subunit 10-like [Brachypodium
           distachyon]
          Length = 205

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 119/177 (67%), Gaps = 13/177 (7%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDD+  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 39  DMREMAKTAAWSVSSCKPGNGVASLRDDSLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 98

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           +++K DESYTP+KI+IRAG    +L++++TV L +P+ WV I LSG +      R    H
Sbjct: 99  VDFKLDESYTPSKISIRAGDGFHNLKEIKTVNLLKPVGWVHISLSGAD-----PRETFIH 153

Query: 167 LF--QIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            F  QIA+ ANH NG+DTHIRQIK++ P+  P+ ++ +      F + E  M+ T+R
Sbjct: 154 TFMLQIAVLANHLNGRDTHIRQIKIYGPRPNPVPHQPFH-----FTSRECIMYSTVR 205



>gi|460375457|ref|XP_004233522.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform 1
           [Solanum lycopersicum]
          Length = 195

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 105/148 (70%), Gaps = 3/148 (2%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS+K GNGV  LRDDN  TYWQSDG  PHLVN+QF +KV +  + L
Sbjct: 24  DDLREMGKKAAWSVSSYKPGNGVLSLRDDNLETYWQSDGAQPHLVNVQFQKKVKLQLVVL 83

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP KI+IRAG    +L++++ VEL +P  W+ I LSG++        V  
Sbjct: 84  YVDFKLDESYTPGKISIRAGDGFHNLKEIKAVELVKPTGWMHISLSGND---PRETFVNT 140

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPK 193
            + QI + +NH NG+DTHIRQIKV+ P+
Sbjct: 141 FMLQIGVLSNHLNGRDTHIRQIKVYGPR 168



>gi|405959727|gb|EKC25731.1| Anaphase-promoting complex subunit 10 [Crassostrea gigas]
          Length = 185

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 109/158 (68%), Gaps = 6/158 (3%)

Query: 35  ERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQF 94
           E  I+K E +   LRE+G+ A+WSLSS K G GVD+L D+   TYWQSDG  PHLVNIQF
Sbjct: 10  EIDILKEE-REGRLREVGNQAVWSLSSCKPGFGVDQLLDNTVDTYWQSDGPQPHLVNIQF 68

Query: 95  PQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDE 154
            +K  +  + ++ +YK+DESYTPN+I++RAGTH  DL ++  +EL EP+ WV + +    
Sbjct: 69  RRKTTIHDVCIYTDYKADESYTPNRISLRAGTHFNDLIEVDQIELSEPVGWVCVPMK--- 125

Query: 155 ILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
                 +P+   + QIA+ +NHQNG+DTH+R+IK+ +P
Sbjct: 126 --DINDKPIRTFMVQIAVLSNHQNGRDTHLRRIKIRSP 161



>gi|224001908|ref|XP_002290626.1| anaphase promoting complex subunit 10 [Thalassiosira pseudonana
           CCMP1335]
 gi|220974048|gb|EED92378.1| anaphase promoting complex subunit 10, partial [Thalassiosira
           pseudonana CCMP1335]
          Length = 153

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 102/146 (69%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIG SA WSLS+ K GNGVD+LRD +  TYWQSDG  PH +NIQFP++  V  I+L++
Sbjct: 2   VREIGKSAQWSLSTAKPGNGVDQLRDSSLDTYWQSDGLQPHYINIQFPRRQTVSAIALYM 61

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           ++  DESYTP K+ +R GT   +L+++R V++ EP+ WV I L    +     +P+  H 
Sbjct: 62  DFNLDESYTPKKMKVRVGTTFHNLEEVRVVDVKEPIGWVTIPLWRKHVPVWKRKPMRTHF 121

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPK 193
            Q+ I + HQNG+DTHIRQ+K+F P+
Sbjct: 122 VQLGITSMHQNGRDTHIRQVKIFGPR 147



>gi|290991269|ref|XP_002678258.1| anaphase promoting complex subunit 10 [Naegleria gruberi]
 gi|284091869|gb|EFC45514.1| anaphase promoting complex subunit 10 [Naegleria gruberi]
          Length = 274

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 123/188 (65%), Gaps = 21/188 (11%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L EIG  A+WS+S+ K GNGV++LRDDN  TYWQSDG  PH +NIQF + + + +++++L
Sbjct: 93  LIEIGKYAVWSVSTAKQGNGVEELRDDNLETYWQSDGPQPHTINIQFHKVLTIQEVAIYL 152

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQL--SGDEILSKTSRPVGA 165
           +YK DESYTP  I+I+ G++  DL  ++T+EL+EP+ +V+I +  S ++ L +  R    
Sbjct: 153 DYKKDESYTPQVISIKCGSNFHDLIQIKTIELEEPVGYVNINMLNSSEKDLLEHCR---C 209

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-------------FKTVE 212
           ++ QI I  NHQNG+DTH+RQ+KV+ P   L   D+S +  P             F T++
Sbjct: 210 NMLQIVISQNHQNGRDTHVRQVKVYGPVEHL---DHSSNINPIDLSLNNSNASNQFDTLQ 266

Query: 213 FAMHETIR 220
           F+M  T+R
Sbjct: 267 FSMFSTLR 274



>gi|412992797|emb|CCO18777.1| anaphase promoting complex subunit 10 [Bathycoccus prasinos]
          Length = 397

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 113/201 (56%), Gaps = 34/201 (16%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIG  A+WS++S K GNGV+ LRD N  TYWQSDG  PH +N QF +K NV ++S++ 
Sbjct: 203 VREIGDEAVWSVTSSKPGNGVELLRDGNLKTYWQSDGAQPHFINCQFQKKTNVCEVSIYT 262

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQL----------------- 150
           NYK DESYTP+KI IRAG    DL+D+ T  L+EP  W  ++                  
Sbjct: 263 NYKQDESYTPSKIVIRAGNSYRDLKDVATKTLNEPHGWQRVRTTRLDKEKLKEIHAQYGS 322

Query: 151 ------SGDEILSKTS--RPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYS 202
                 SG E L K S   P+ A   QI I  NHQNG+DTH+RQ+ V++P          
Sbjct: 323 KKHLKNSGLEYLEKESCEAPIRAFFIQICIVQNHQNGRDTHVRQVHVYSPAATPA----- 377

Query: 203 DDDIP---FKTVEFAMHETIR 220
             D P   F++ E+A +  +R
Sbjct: 378 -SDGPRARFQSSEYARYAVVR 397



>gi|474436420|gb|EMS68205.1| Anaphase-promoting complex subunit 10 [Triticum urartu]
          Length = 199

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 119/177 (67%), Gaps = 13/177 (7%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDD+  TYWQS G  PHLVNIQF +KV +  + L+
Sbjct: 29  DMREMAKTAAWSVSSCKPGNGVASLRDDSLDTYWQSAGAQPHLVNIQFQKKVQLQLVVLY 88

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           +++K DESYTP+KI+IRAG    +L++++TV+L +P+ WV I LSG +      R    H
Sbjct: 89  VDFKLDESYTPSKISIRAGDGFHNLKEIKTVDLLKPVGWVHISLSGTD-----PRETFIH 143

Query: 167 LF--QIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            F  QIA+ ANH NG+DTH+RQIK++ P+  P+ ++ +      F + E  M+ TIR
Sbjct: 144 TFMLQIAVLANHLNGRDTHVRQIKIYGPRPNPVPHQPFH-----FTSRECIMYSTIR 195



>gi|330840131|ref|XP_003292074.1| hypothetical protein DICPUDRAFT_39988 [Dictyostelium purpureum]
 gi|325077709|gb|EGC31404.1| hypothetical protein DICPUDRAFT_39988 [Dictyostelium purpureum]
          Length = 190

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 117/171 (68%), Gaps = 8/171 (4%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           EIG  A WS+SS K G+GV++LRD+N  TYWQSD   PH + IQFP+K  +  I L+ NY
Sbjct: 28  EIGKLASWSVSSAKPGSGVEQLRDNNAETYWQSDAQQPHNITIQFPKKCFIENILLYCNY 87

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQ 169
           K DESYTP KI+I+AGT   DLQ++ T EL+EP+ W++I L     LS    P+ A+L Q
Sbjct: 88  KLDESYTPQKISIKAGTLLHDLQEIITTELEEPIGWINIPLC----LSNGG-PLKANLLQ 142

Query: 170 IAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           I+I +N +NG+DTHIRQIKV+  K+ +  E+++     FK+ E +  ETIR
Sbjct: 143 ISILSNLKNGRDTHIRQIKVYGKKISI--ENFTQYP-KFKSSESSYFETIR 190



>gi|193709423|ref|XP_001952000.1| PREDICTED: anaphase-promoting complex subunit 10-like
           [Acyrthosiphon pisum]
          Length = 188

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/173 (48%), Positives = 115/173 (66%), Gaps = 10/173 (5%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +RE+GS AIWS+SS K G GV++LRDDN  TYWQS G LPHLVNIQF +K  V  + +++
Sbjct: 26  VREVGSLAIWSVSSCKSGFGVNQLRDDNIETYWQSCGQLPHLVNIQFRRKTIVSDVYIYV 85

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           N++ DESYTPN I+IRAGT+  DLQ++  VEL EP  W+ I++     LS     +  +L
Sbjct: 86  NHRLDESYTPNIISIRAGTNFNDLQEVELVELLEPYNWIRIKIKDIRNLS-----LKTYL 140

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QIA+  NHQNG + HIR IK+ +   P+  +D+   +  F TVE   + TI+
Sbjct: 141 LQIAVLKNHQNGNNCHIRLIKIHS---PISTKDFLLGN--FSTVEMRQYTTIK 188



>gi|470505659|ref|XP_004348598.1| anaphase promoting complex subunit 10-like family protein, putative
           [Acanthamoeba castellanii str. Neff]
 gi|440801115|gb|ELR22140.1| anaphase promoting complex subunit 10-like family protein, putative
           [Acanthamoeba castellanii str. Neff]
          Length = 463

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/171 (48%), Positives = 116/171 (67%), Gaps = 13/171 (7%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L E+G  A WSLSS K G G+++LRDDN  TYWQSDG  PH +++Q+ ++V + Q+SL+L
Sbjct: 6   LVEVGREACWSLSSAKPGFGIEQLRDDNLDTYWQSDGPQPHTISVQWHRRVCIEQVSLYL 65

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           ++  DESYTP  ++IR GT   DL+D++TVE++EP  WV I LS DE        V  HL
Sbjct: 66  SFAHDESYTPCHMSIRVGTTFHDLRDIKTVEMEEPNGWVHIPLS-DE-----PGTVFGHL 119

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSD--DDIP-FKTVEFAM 215
            Q+A+ ANHQNG+D+H+RQ+KVF P      +   D  ++IP F T +F+M
Sbjct: 120 IQVAVLANHQNGRDSHVRQVKVFGPS----RQSTGDAVEEIPHFDTSDFSM 166



>gi|170099535|ref|XP_001880986.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164644511|gb|EDR08761.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 186

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 115/179 (64%), Gaps = 18/179 (10%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +I S A WS+SS+K G GV+ LRD +  T+W SDG  PH + I+FP+KV + +IS++LN+
Sbjct: 18  DISSRAKWSVSSFKFGFGVECLRDGDPDTFWHSDGPQPHFITIEFPRKVAIQKISIYLNF 77

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS------GDEILSKTSRPV 163
            SD+SYTP+ + IRAGT   DLQD+R V L++P  W+   +S      GD +      PV
Sbjct: 78  SSDDSYTPSTLAIRAGTGPSDLQDVRVVTLEKPEGWITFDVSSEPNEDGDGL-----NPV 132

Query: 164 GAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP--FKTVEFAMHETIR 220
            A++ QI + ANH +GKDTH+R ++V  P      ED + DD P  F+T  F M+ETIR
Sbjct: 133 YAYVLQIIVAANHMSGKDTHVRGLRVLGP-----IEDRAADDDPFSFRTAAFKMYETIR 186



>gi|225430728|ref|XP_002266072.1| PREDICTED: anaphase-promoting complex subunit 10 [Vitis vinifera]
 gi|297735140|emb|CBI17502.3| unnamed protein product [Vitis vinifera]
          Length = 192

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 104/146 (71%), Gaps = 3/146 (2%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           E+LRE+   A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 25  EDLREMAKKAAWSVSSCKAGNGVLLLRDDNLDTYWQSDGAQPHLVNIQFLKKVKLQLVVI 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L++++TVEL +P  WV I LSG++        V  
Sbjct: 85  YVDFKLDESYTPSKISIRAGDGFHNLKEIKTVELVKPTGWVYISLSGND---PRETFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFA 191
            + QIAI +NH NG+DTH+RQIKV+ 
Sbjct: 142 FMLQIAILSNHLNGRDTHVRQIKVYG 167



>gi|351725793|ref|NP_001236081.1| uncharacterized protein LOC100526925 [Glycine max]
 gi|255631165|gb|ACU15948.1| unknown [Glycine max]
          Length = 192

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 117/176 (66%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++L E+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQ  +KV +  I L
Sbjct: 25  DDLTEMGKKAAWSVSSCKPGNGVSSLRDDNLETYWQSDGGQPHLVNIQSQKKVRLQLIVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+K++IRAG    +L++++TVEL +P  WV + LSG   +      V  
Sbjct: 85  YVDFKLDESYTPSKVSIRAGDGFHNLKEIKTVELVKPTGWVYLSLSG---VDPRDTFVNT 141

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIKV+ P+  P+ ++ +      F + EF  + +IR
Sbjct: 142 FMLQIAVLSNHLNGRDTHVRQIKVYGPRPNPIPHQPFQ-----FTSREFITYSSIR 192



>gi|325181977|emb|CCA16431.1| anaphasepromoting complex subunit 10 putative [Albugo laibachii
           Nc14]
          Length = 200

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 107/169 (63%), Gaps = 17/169 (10%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVV 101
           EF+  E REIG+ A WSLSS K GNG+D+LRDD   T+WQSDGT PH +NI+F +K  + 
Sbjct: 8   EFECAEGREIGNEAFWSLSSAKPGNGIDQLRDDTIDTFWQSDGTQPHCINIEFNKKTLIQ 67

Query: 102 QISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDI------------- 148
           +I+L+L YK DESYTP KI+IR+G    +L ++   EL EP  W+ I             
Sbjct: 68  EIALYLYYKLDESYTPKKISIRSGNTVQELVEIHAKELVEPNGWIRIPLYTIENGEVLCA 127

Query: 149 ----QLSGDEILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPK 193
               QL+    L+   RP+     QIA+ A HQNG+DTHIRQ+K+++P+
Sbjct: 128 KNFGQLADRATLNLQHRPLRTFFIQIAVLAMHQNGRDTHIRQVKIYSPR 176



>gi|388499086|gb|AFK37609.1| unknown [Lotus japonicus]
          Length = 197

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 116/176 (65%), Gaps = 9/176 (5%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +EL E+G  A WS+SS K GN V  LRD N  T+WQSDG  PHLVNIQF +KV +  + L
Sbjct: 30  DELTELGKKAAWSVSSCKPGNSVSSLRDQNLETFWQSDGAQPHLVNIQFQKKVRLQLVVL 89

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI+IRAG    +L+++++VEL +P  W+ + LSG   +      V  
Sbjct: 90  YVDFKLDESYTPSKISIRAGDGFHNLKEIKSVELVKPSGWIYLSLSG---VDPRETFVNT 146

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKL-PLFYEDYSDDDIPFKTVEFAMHETIR 220
            + QIA+ +NH NG+DTH+RQIKV+ P+  P+ ++ Y      F + EF  + TIR
Sbjct: 147 FMLQIAVLSNHLNGRDTHVRQIKVYGPRPNPIPHQPYQ-----FTSREFITYSTIR 197



>gi|145529011|ref|XP_001450294.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124417905|emb|CAK82897.1| unnamed protein product [Paramecium tetraurelia]
          Length = 197

 Score =  155 bits (391), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 116/177 (65%), Gaps = 13/177 (7%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           +EIG  AIW+LSS K GNGVD+LRDDN  T+WQSDGT PH + IQF +K+ V +++L+L+
Sbjct: 29  KEIGDQAIWTLSSAKTGNGVDQLRDDNLNTFWQSDGTQPHYITIQFLKKMRVQEVALYLD 88

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL- 167
           +K DESYTPNK++IR GT+  D+++++ +EL EP  W    L   ++L+   +P  + + 
Sbjct: 89  FKQDESYTPNKLSIRTGTNIQDMKEVQFIELKEPYGWYVFALK-TKLLNGQEKPYVSTIN 147

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPK----LPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QI +  N  +GKDTHIRQ+K+F P+      L + D       FKT E   + +IR
Sbjct: 148 IQIVVLQNQHSGKDTHIRQVKIFGPREKQNQGLSFPD-------FKTPEITQYASIR 197



>gi|321458778|gb|EFX69840.1| hypothetical protein DAPPUDRAFT_300659 [Daphnia pulex]
          Length = 192

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 114/181 (62%), Gaps = 5/181 (2%)

Query: 40  KSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVN 99
           K E K   + E+G  A+WSLSS K G G+D+LRDD+  TYWQSDG LPHLVNIQF +K  
Sbjct: 17  KKEEKEGSILEVGDQAVWSLSSCKAGFGIDQLRDDSTDTYWQSDGQLPHLVNIQFRKKTT 76

Query: 100 VVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKT 159
           +  I ++ +YK+DESYTP++I++RAGT   DLQ++  +EL+EP  W+ I L   +     
Sbjct: 77  IQNIWIFADYKADESYTPSRISVRAGTGFSDLQEVEVIELNEPNGWIAIPLKDAQ----- 131

Query: 160 SRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETI 219
            + +   + Q+A+ +NHQ+G+DTH+R ++V +P            +  F + E  M  T+
Sbjct: 132 DKYIRTFMLQLAVLSNHQSGRDTHLRNVRVHSPVSQSMVAIKPLQNFQFLSREMCMFNTL 191

Query: 220 R 220
           +
Sbjct: 192 K 192



>gi|145534794|ref|XP_001453141.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124420841|emb|CAK85744.1| unnamed protein product [Paramecium tetraurelia]
          Length = 195

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 114/177 (64%), Gaps = 15/177 (8%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           +EIG  AIW+LSS K GNGVD+LRDDN  T+WQSDGT PH + IQF +K+ V +I+++L+
Sbjct: 29  KEIGDQAIWTLSSAKTGNGVDQLRDDNMNTFWQSDGTQPHYLTIQFLKKMRVQEIAIYLD 88

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL- 167
           +K DESYTPNK++IR GT+  D+++++ +EL EP  W  I L    +     RP  + + 
Sbjct: 89  FKQDESYTPNKLSIRTGTNIQDMKEVQFIELKEPYGWYVIALKTKLL---NDRPYVSTIN 145

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPK----LPLFYEDYSDDDIPFKTVEFAMHETIR 220
            QI +  N  +GKDTHIRQ+K+F P+      L + D       FKT E   + +IR
Sbjct: 146 VQIVVLQNQHSGKDTHIRQVKIFGPRENQNQGLSFPD-------FKTPELTQYASIR 195



>gi|145510913|ref|XP_001441384.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124408634|emb|CAK73987.1| unnamed protein product [Paramecium tetraurelia]
          Length = 197

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 109/150 (72%), Gaps = 2/150 (1%)

Query: 45  HEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQIS 104
           +++ +EIG  AIW+LSS K GNGVD+LRDDN  T+WQSDGT PH + IQF +K+ V +++
Sbjct: 25  NQQRKEIGDQAIWTLSSAKTGNGVDQLRDDNLNTFWQSDGTQPHNITIQFLKKMRVQEVA 84

Query: 105 LWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG 164
           ++L++K DESYTPNK++IRAGT+  D++++  +EL EP  W   QL   ++L+   +P  
Sbjct: 85  VYLDFKQDESYTPNKLSIRAGTNIQDMKEVLYIELKEPYGWFVFQLK-TKLLNGQEKPYV 143

Query: 165 AHL-FQIAIKANHQNGKDTHIRQIKVFAPK 193
           + +  Q+ +  N  +GKDTHIRQ+++F P+
Sbjct: 144 STINIQVVVLQNQHSGKDTHIRQVRIFGPR 173



>gi|302835371|ref|XP_002949247.1| hypothetical protein VOLCADRAFT_80519 [Volvox carteri f.
           nagariensis]
 gi|300265549|gb|EFJ49740.1| hypothetical protein VOLCADRAFT_80519 [Volvox carteri f.
           nagariensis]
          Length = 181

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 120/174 (68%), Gaps = 11/174 (6%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           RE+G  A+WS++S K GNGV+ LRD N  T+WQSDG  PHL+NIQF +K+ ++++ ++++
Sbjct: 17  REVGHLAVWSVTSAKPGNGVEMLRDGNAETFWQSDGLQPHLINIQFQRKMPLLELHMYVD 76

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLF 168
           YK DESYTP+++++RAG    DL+++R V+L+EP  WV I L+ +   S    P+ A   
Sbjct: 77  YKLDESYTPSRVSVRAGHTYQDLKEVRVVDLEEPSGWVIIPLTSE---SWPHEPLKAFHL 133

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFK--TVEFAMHETIR 220
           Q+A+ ANHQNG+DTHIRQ+K+++ +        S+  +P    T + +++ T+R
Sbjct: 134 QLAVLANHQNGRDTHIRQVKIWSARTD------SNKTLPCSATTTQMSIYSTVR 181



>gi|466009820|ref|XP_004269997.1| PREDICTED: anaphase-promoting complex subunit 10-like [Orcinus
           orca]
          Length = 248

 Score =  152 bits (383), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 109/166 (65%), Gaps = 11/166 (6%)

Query: 56  IWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDESY 115
           I +LSS K G  VD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ +YKSDESY
Sbjct: 93  ICALSSCKPGFEVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESY 152

Query: 116 TPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQIAIKAN 175
           TP+KI++R G +  +LQ++R +EL +P  W+ + L+ +       +P    + QIA+ AN
Sbjct: 153 TPSKISVRVGNNFHNLQEIRQLELVQPSGWIHVPLTDNH-----KKPTRTFMIQIAVLAN 207

Query: 176 HQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
           HQNG+DTH+RQIK++ P      E+ S    P   T +F M+ +IR
Sbjct: 208 HQNGRDTHMRQIKIYTP-----VEESSIGKFPTCTTTDFMMYRSIR 248



>gi|115465645|ref|NP_001056422.1| Os05g0579800 [Oryza sativa Japonica Group]
 gi|113579973|dbj|BAF18336.1| Os05g0579800, partial [Oryza sativa Japonica Group]
          Length = 205

 Score =  151 bits (382), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 119/182 (65%), Gaps = 21/182 (11%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 38  DDMREMAKTAAWSVSSCKPGNGVASLRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVV 97

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI++RAG    +L++++TVEL +P+ WV I LSG +      R    
Sbjct: 98  YVDFKLDESYTPSKISVRAGDGFHNLKEIKTVELSKPVGWVHISLSGAD-----PRETFI 152

Query: 166 HLF--QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-----FKTVEFAMHET 218
           H F  QI++ +NH NG+DTHIRQIK++ P+          + +P     F + EF  + T
Sbjct: 153 HTFMLQISVLSNHLNGRDTHIRQIKIYGPR---------PNHVPHQPFHFTSREFVTYST 203

Query: 219 IR 220
           +R
Sbjct: 204 VR 205



>gi|323456624|gb|EGB12491.1| hypothetical protein AURANDRAFT_20412 [Aureococcus anophagefferens]
          Length = 194

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 105/157 (66%), Gaps = 15/157 (9%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLR--------DDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           REIG  A+WSLS+ K GNGV+++R        D+N  TYWQSDG  PHL+NIQF +K+++
Sbjct: 21  REIGDEAVWSLSTAKPGNGVEQIRAAPGGKRRDENTETYWQSDGGQPHLINIQFHKKMSI 80

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS-GDEILSKT 159
            +++ +L+Y  DESYTP K++IRAGT   DL ++  V+L EP  WV + LS GD      
Sbjct: 81  SEMAFYLDYGLDESYTPKKMSIRAGTTFHDLVEVEVVDLHEPTGWVTVALSHGD------ 134

Query: 160 SRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPL 196
            + + A   Q+ + + HQNG+DTH+RQ K+F P+ P+
Sbjct: 135 GKALRAFFLQVCVVSMHQNGRDTHVRQAKIFGPRTPI 171



>gi|485623105|gb|EOD19341.1| hypothetical protein EMIHUDRAFT_46713, partial [Emiliania huxleyi
           CCMP1516]
          Length = 161

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 101/147 (68%), Gaps = 3/147 (2%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           EIG  A+WSLS+ K GNGV++LRDD+  TYWQSDG  PHLVNIQF +K+ +  I ++ ++
Sbjct: 1   EIGDLAVWSLSTAKPGNGVEQLRDDDVNTYWQSDGPQPHLVNIQFHRKMVIHHIRVYTDF 60

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEIL---SKTSRPVGAH 166
           K DESYTP KI+IR+GT   DLQ++   EL EP  W  I  + ++          P+  H
Sbjct: 61  KLDESYTPAKISIRSGTTFHDLQEIHVQELHEPSGWHTILPTIEQAAGGGEGGGGPLRTH 120

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPK 193
             Q+A+ ANHQNG+DTHIRQIK++ P+
Sbjct: 121 FIQVAVLANHQNGRDTHIRQIKIYTPR 147



>gi|51854317|gb|AAU10698.1| putative anaphase promoting complex subunit 10 [Oryza sativa
           Japonica Group]
 gi|215693935|dbj|BAG89134.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 201

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 119/182 (65%), Gaps = 21/182 (11%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 34  DDMREMAKTAAWSVSSCKPGNGVASLRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVV 93

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI++RAG    +L++++TVEL +P+ WV I LSG +      R    
Sbjct: 94  YVDFKLDESYTPSKISVRAGDGFHNLKEIKTVELSKPVGWVHISLSGAD-----PRETFI 148

Query: 166 HLF--QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-----FKTVEFAMHET 218
           H F  QI++ +NH NG+DTHIRQIK++ P+          + +P     F + EF  + T
Sbjct: 149 HTFMLQISVLSNHLNGRDTHIRQIKIYGPR---------PNHVPHQPFHFTSREFVTYST 199

Query: 219 IR 220
           +R
Sbjct: 200 VR 201



>gi|303272633|ref|XP_003055678.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226463652|gb|EEH60930.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 216

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 110/187 (58%), Gaps = 18/187 (9%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           EIG  A+WS++S K GNGV+ LRDD   TYWQSDG  PHLVN+QF +KV + +++L+  Y
Sbjct: 32  EIGKLAVWSVTSAKPGNGVELLRDDCLDTYWQSDGAQPHLVNVQFQKKVRLRELALYAKY 91

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS----------------GD 153
             DESYTP+KI+IRAG    DL++++ V+L+EP  W+ + L+                 D
Sbjct: 92  ALDESYTPSKISIRAGNSFHDLREIKVVDLEEPGGWMHVSLAKDDSGGGGGGGVGGDGDD 151

Query: 154 EILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEF 213
                    + A   QIA+ +NHQNG+DTH+RQ+K+F P+            I F T EF
Sbjct: 152 GGGGDDGECLRAFFLQIAVLSNHQNGRDTHVRQMKIFGPRTD--PTALMGRGISFATPEF 209

Query: 214 AMHETIR 220
               T+R
Sbjct: 210 GQFATVR 216



>gi|336370694|gb|EGN99034.1| hypothetical protein SERLA73DRAFT_73609 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336383460|gb|EGO24609.1| hypothetical protein SERLADRAFT_438236 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 210

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 112/174 (64%), Gaps = 8/174 (4%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + LRD +  T+W SDG  PH + I+FP+KV + +IS++L++
Sbjct: 42  DIGRLAKWSVSSYKFGFGTECLRDGDPDTFWHSDGPQPHFITIEFPRKVAIQKISIYLSW 101

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGD-EILSKTSRPVGAHLF 168
             D+SYTP+ + IRAGT   DLQD+R   LD+P  W+   +S + +    T +PV A++ 
Sbjct: 102 PQDDSYTPSTLAIRAGTGPSDLQDVRVATLDKPDGWITFDVSSEPDEDGHTFKPVHAYVL 161

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDD--IPFKTVEFAMHETIR 220
           QI + ANH +GKDTHIR ++V  P      ED++ D    PF +  F M+ETIR
Sbjct: 162 QIIVVANHMSGKDTHIRGLRVLGP-----LEDHASDGDPFPFTSPPFKMYETIR 210



>gi|5091606|gb|AAD39595.1|AC007858_9 10A19I.10 [Oryza sativa Japonica Group]
          Length = 239

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 119/182 (65%), Gaps = 21/182 (11%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 34  DDMREMAKTAAWSVSSCKPGNGVASLRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVV 93

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           ++++K DESYTP+KI++RAG    +L++++TVEL +P+ WV I LSG +      R    
Sbjct: 94  YVDFKLDESYTPSKISVRAGDGFHNLKEIKTVELSKPVGWVHISLSGAD-----PRETFI 148

Query: 166 HLF--QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-----FKTVEFAMHET 218
           H F  QI++ +NH NG+DTHIRQIK++ P+          + +P     F + EF  + T
Sbjct: 149 HTFMLQISVLSNHLNGRDTHIRQIKIYGPR---------PNHVPHQPFHFTSREFVTYST 199

Query: 219 IR 220
           +R
Sbjct: 200 VR 201



>gi|393221190|gb|EJD06675.1| anaphase-promoting complex, subunit 10 [Fomitiporia mediterranea
           MF3/22]
          Length = 219

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 107/172 (62%), Gaps = 4/172 (2%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + LRD +  T+W SDG  PH V IQFP+K  V +ISL L++
Sbjct: 51  DIGHLAKWSVSSYKFGFGPECLRDGDPDTFWHSDGAQPHSVFIQFPRKTAVQKISLHLSF 110

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGD-EILSKTSRPVGAHLF 168
             D+SYTP+ I +RAGT  GDLQD+R V LD+P  W+   +S +     +  +PV  ++ 
Sbjct: 111 PLDDSYTPSTICLRAGTSLGDLQDVRVVSLDKPNGWITFDVSAELNEEGQEFKPVYCYVL 170

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           QI I ANH NGKDTH+R +++     PL    + DD  PF +  F M E IR
Sbjct: 171 QIIILANHMNGKDTHVRGLRILG---PLEESTHEDDPFPFVSPRFKMFECIR 219



>gi|300681546|emb|CBH32643.1| anaphase-promoting complex subunit, putative,expressed [Triticum
           aestivum]
          Length = 184

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 105/149 (70%), Gaps = 7/149 (4%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  +RDD+  TYWQSD   PHLVNIQF +KV +  + L+
Sbjct: 40  DMREMAKTAAWSVSSCKPGNGVASIRDDSLDTYWQSDDAQPHLVNIQFQKKVQLHLVVLY 99

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           +++K DESYTPNKI+IRAG    +L++++TV+L +P+ WV I LSG +      R    H
Sbjct: 100 VDFKLDESYTPNKISIRAGDGFHNLKEMKTVDLLKPVGWVHISLSGTD-----PRETFIH 154

Query: 167 LF--QIAIKANHQNGKDTHIRQIKVFAPK 193
            F  QIA+ ANH NG+DTH+ QIK++ P+
Sbjct: 155 TFMLQIAVLANHLNGRDTHVWQIKIYGPR 183



>gi|395735392|ref|XP_002815232.2| PREDICTED: anaphase-promoting complex subunit 10 [Pongo abelii]
          Length = 182

 Score =  149 bits (375), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 105/157 (66%), Gaps = 11/157 (7%)

Query: 65  GNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRA 124
           G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ +YKSDESYTP+KI++R 
Sbjct: 36  GFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRV 95

Query: 125 GTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQIAIKANHQNGKDTHI 184
           G +  +LQ++R +EL EP  W+ + L+ +       +P    + QIA+ ANHQNG+DTH+
Sbjct: 96  GNNFHNLQEIRQLELVEPSGWIHVPLTDNH-----KKPTRTFMIQIAVLANHQNGRDTHM 150

Query: 185 RQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
           RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 151 RQIKIYTP-----VEESSIGKFPRCTTIDFMMYRSIR 182



>gi|146184245|ref|XP_001028080.2| anaphase-promoting complex, subunit 10 [Tetrahymena thermophila]
 gi|146143314|gb|EAS07838.2| anaphase-promoting complex, subunit 10 [Tetrahymena thermophila
           SB210]
          Length = 189

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 105/146 (71%), Gaps = 2/146 (1%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           REIG  A+W+LSS K GNGVD+LRD +  T+WQSDG  PHL+NIQF +K+ V +++++L+
Sbjct: 21  REIGDDAVWTLSSAKPGNGVDQLRDGDEKTFWQSDGNQPHLINIQFLKKMRVQEVAMYLD 80

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL- 167
           +K+DESYTP+KI+IRAGT+  DL++   VEL EP  W    L   ++L ++ +P    + 
Sbjct: 81  FKTDESYTPSKISIRAGTNLQDLKENVYVELVEPSGWYIFPLK-TKLLDESEKPYILTMN 139

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPK 193
            QIAI  N  +GKDTHIRQ+ VF P+
Sbjct: 140 LQIAILQNQHSGKDTHIRQVLVFGPR 165



>gi|512861091|ref|XP_004889798.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Heterocephalus glaber]
 gi|512972212|ref|XP_004848220.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2
           [Heterocephalus glaber]
 gi|351703329|gb|EHB06248.1| Anaphase-promoting complex subunit 10 [Heterocephalus glaber]
          Length = 185

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/174 (42%), Positives = 112/174 (64%), Gaps = 11/174 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS +   GVD+L+DDN  TYWQS+ + PHL+NIQF +K     + ++ 
Sbjct: 22  VREIGSQAVWSLSSCESVFGVDQLQDDNLETYWQSESSQPHLLNIQFRRKTTAKTLCIYS 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK DE+YTP+KI++R G +  +LQ+++ +EL EP  W  + L+ +       +P+   +
Sbjct: 82  DYKPDENYTPSKISVRVGNNFHNLQEIQQLELVEPSSWFHVPLTDNH-----KKPMHTFM 136

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QIA+ ANHQN  D H+RQIK++ P      E+ S    P   T++F M+ +IR
Sbjct: 137 IQIAVLANHQNETDNHMRQIKIYTP-----VEESSIGKFPRCTTIDFIMYHSIR 185



>gi|403417991|emb|CCM04691.1| predicted protein [Fibroporia radiculosa]
          Length = 231

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/174 (42%), Positives = 109/174 (62%), Gaps = 3/174 (1%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L +IG  A WS+SS+K G G + LRD +  T+W SDG  PH + I+FP+KV + ++ L L
Sbjct: 60  LPDIGYLAKWSVSSFKFGFGPECLRDSDPETFWHSDGPQPHFITIEFPRKVAIQKLCLCL 119

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTS-RPVGAH 166
           +Y+ D+SYTP  I +RAGT   DLQD+R + L++P  W+   +S +        +PV A+
Sbjct: 120 SYQMDDSYTPATIAVRAGTGPSDLQDVRIITLEKPEGWIIFDVSAEPNEDGDGYKPVNAY 179

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           + Q+ I ANH NGKDTH+R ++V  P      E+  +D  PF + +F M+E IR
Sbjct: 180 IIQMIILANHMNGKDTHVRGLRVLGPLDESGEEE--EDPFPFVSPQFKMYECIR 231



>gi|119627198|gb|EAX06793.1| hCG1640061 [Homo sapiens]
          Length = 157

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/136 (53%), Positives = 97/136 (71%), Gaps = 5/136 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLYIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YKSDESYTP+KI+ + G +  +LQ++R +EL EP  W+ I L+ +       +P    +
Sbjct: 82  DYKSDESYTPSKISAKVGNNFHNLQEIRQLELVEPSGWIHIPLTDNH-----RKPTWTLM 136

Query: 168 FQIAIKANHQNGKDTH 183
            QIA+ A+HQNGKDTH
Sbjct: 137 IQIAVLASHQNGKDTH 152



>gi|392594858|gb|EIW84182.1| anaphase-promoting complex subunit 10 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 198

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 112/183 (61%), Gaps = 16/183 (8%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + LRD +  T+W SDG  PH + I+FP+KV + +IS++L++
Sbjct: 20  DIGRLARWSVSSYKFGFGAECLRDGDPETFWHSDGPQPHFITIEFPRKVAIQKISIYLSW 79

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSG-----------DEILSK 158
             D+SYTP+ I +RAGT   DLQD+R   LD+P  W+   +S            D+    
Sbjct: 80  PQDDSYTPSTIAVRAGTGPSDLQDVRVATLDKPDGWITFDVSSEPDNDGSSLHVDKPPGL 139

Query: 159 TSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDD-IPFKTVEFAMHE 217
             +P+ A++ Q+ + ANH +GKDTHIR +++  P      E  +D+D  PF + +F M+E
Sbjct: 140 HPKPINAYILQVIVVANHMSGKDTHIRGLRILGP----IEETTTDEDPFPFVSQKFKMYE 195

Query: 218 TIR 220
           TIR
Sbjct: 196 TIR 198



>gi|296417930|ref|XP_002838600.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634550|emb|CAZ82791.1| unnamed protein product [Tuber melanosporum]
          Length = 231

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 113/165 (68%), Gaps = 5/165 (3%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           E L+EIG+ A W++SS K GNGV++LRD+N   +WQSDG  PH +NI F ++V V +I +
Sbjct: 62  EGLKEIGNLACWTVSSAKPGNGVEQLRDENTNLFWQSDGPQPHTINIHFAKRVFVRKIRM 121

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           +L++++DESYTP +++I +GT   DLQ++ T+  ++P  W+++ L G     K+ R +  
Sbjct: 122 YLDFENDESYTPTRMSILSGTGYHDLQEVTTMNFEQPSGWINVPLDGVHEDLKSGR-LRT 180

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKT 210
            L Q+ I ANHQNGKDTH+R +++F+ +   F    + D++PF +
Sbjct: 181 FLIQVCIHANHQNGKDTHVRGLQIFSDEPSSF----NPDEVPFTS 221



>gi|388582841|gb|EIM23144.1| anaphase-promoting complex, subunit 10 [Wallemia sebi CBS 633.66]
          Length = 186

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 112/184 (60%), Gaps = 17/184 (9%)

Query: 51  IGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYK 110
           + S A WS+SS+K GN +D L D N  T WQSDG  PHL+ +QF ++V++ Q+S++L++ 
Sbjct: 6   LSSIAQWSVSSYKEGNVLDCLMDTNPDTVWQSDGPQPHLITLQFTRRVSINQVSMYLDHT 65

Query: 111 SDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRW--------------VDIQLSGDEIL 156
            D+SYTP  I+IRAGT+ GDLQ++R ++L++P  W              +D  L     +
Sbjct: 66  LDDSYTPKTISIRAGTYLGDLQEIRHIDLNQPRGWHHFALDNETKDVVTLDKSLEDSHGV 125

Query: 157 SKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMH 216
           S  ++P+   + Q+AI  NH NGKD+HIR I VFAP+     +    D +PF +  F MH
Sbjct: 126 SDDAKPITGFVLQLAILTNHLNGKDSHIRGIAVFAPRDKATNK---QDSLPFTSPTFQMH 182

Query: 217 ETIR 220
             IR
Sbjct: 183 SRIR 186



>gi|353236924|emb|CCA68909.1| related to anaphase promoting complex subunit 10 [Piriformospora
           indica DSM 11827]
          Length = 189

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 117/190 (61%), Gaps = 3/190 (1%)

Query: 32  RRGERKIIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVN 91
           +RG      SE       +IG+ A WS+SSWK+G G++ LRD+N  T+W S+G  PH + 
Sbjct: 2   QRGHINPGASEQAWAVYPDIGNLARWSVSSWKYGFGLECLRDNNPDTFWHSEGNQPHSIT 61

Query: 92  IQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS 151
           ++FP++V V +I + L+ K D+SYTP  I IRAGT   DLQD+R V  D+P  WV   ++
Sbjct: 62  LEFPKRVAVQKIIVHLDQKKDDSYTPEIIGIRAGTSLRDLQDVRQVNFDKPSGWVAFDVT 121

Query: 152 GDEIL-SKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKT 210
            D     +T +P+ A++ Q+ I +N+ NGKDTHIR +K+  P      +D   +  PF +
Sbjct: 122 NDLAEDGQTFKPLYAYVVQLVIISNYMNGKDTHIRGLKIVGPLEEPLLDD--TEVFPFVS 179

Query: 211 VEFAMHETIR 220
            EF M+ETIR
Sbjct: 180 PEFKMYETIR 189



>gi|409048425|gb|EKM57903.1| hypothetical protein PHACADRAFT_158961 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 187

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 107/173 (61%), Gaps = 8/173 (4%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + L+D +  T+W SDG  PH + I+FP+KV V ++S++L +
Sbjct: 21  DIGQMAKWSVSSFKFGFGPECLQDGDPETFWHSDGPQPHFITIEFPRKVAVQKLSIYLCF 80

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEIL--SKTSRPVGAHL 167
             D+SYTP  I +RAGT   DLQD R V L++P  W    +S + +    +  +P+ A++
Sbjct: 81  PLDDSYTPATIAVRAGTGPLDLQDCRVVSLEKPDGWFTFDVSMEPLGEDGEGFKPIYAYV 140

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            Q+ I ANH NGKDTH+R ++V  P       D +DD  PF +  F M++ IR
Sbjct: 141 LQVIIVANHMNGKDTHVRGLRVLGPL------DDTDDPFPFVSSNFTMYKCIR 187



>gi|281200809|gb|EFA75026.1| anaphase promoting complex subunit 10 [Polysphondylium pallidum
           PN500]
          Length = 225

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 113/174 (64%), Gaps = 10/174 (5%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L +IG +A W+LSS K G G+++L D+N  TYWQSD   PH +NIQF ++  +  + L+ 
Sbjct: 61  LVDIGKNATWTLSSAKPGFGIEQLLDENLSTYWQSDAPQPHTINIQFNRRYEIESLLLYT 120

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           ++K DESYTP+KI+I+ G+   DL+++   +L+EP  W++I L     L++  +P+ A+L
Sbjct: 121 DFKEDESYTPSKISIKIGSTFHDLEEIINTDLEEPNGWINIPL-----LNEKQKPLRANL 175

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
            QI+I ANHQNG+DTH+RQIKV   K+ L     S   IP F   EF  +  IR
Sbjct: 176 LQISIIANHQNGRDTHVRQIKVLGKKVTL----ESKLRIPNFSQPEFNFYNNIR 225



>gi|393246511|gb|EJD54020.1| anaphase-promoting complex, subunit 10 [Auricularia delicata
           TFB-10046 SS5]
          Length = 202

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 111/178 (62%), Gaps = 10/178 (5%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E  +IG    WS+SS+K G G + LRDD+  T+W SDG  PH V + F ++V + +I+L+
Sbjct: 31  EHPDIGDLGTWSVSSFKFGFGTECLRDDDPGTFWHSDGPQPHHVTVHFARRVAIQKIALY 90

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWV--DIQLSGDEILSKTSRPVG 164
           + ++ D+SYTP  + +RAGT   DLQD+RT+  D+P  WV  D+ L  DE   +  +P+ 
Sbjct: 91  IAFQQDDSYTPQALLLRAGTSLNDLQDVRTIAFDKPTGWVVFDVSLEHDED-GEGYKPLH 149

Query: 165 AHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDY--SDDDIPFKTVEFAMHETIR 220
           A++ Q+ +  NH  G+DTH+R +KV  P      +DY  ++D  PF + +F M+E IR
Sbjct: 150 AYVIQVVVMENHMKGRDTHVRGMKVLGP-----VDDYKSAEDPFPFTSPQFKMYEVIR 202



>gi|66827201|ref|XP_646955.1| anaphase promoting complex subunit 10 [Dictyostelium discoideum
           AX4]
 gi|74859038|sp|Q55ER5.1|APC10_DICDI RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10
 gi|60475149|gb|EAL73085.1| anaphase promoting complex subunit 10 [Dictyostelium discoideum
           AX4]
          Length = 188

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 114/171 (66%), Gaps = 9/171 (5%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           EIG  A WS+SS K G+GV++LRD+N  T+WQSD   PH + IQFP+K  +  + +  +Y
Sbjct: 27  EIGKHASWSVSSAKPGSGVEQLRDNNLDTFWQSDAQQPHHITIQFPKKCYIENLLIHCDY 86

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQ 169
           K DESYTP KI+I+AGT   DLQ++   EL+EP  W++I LS +      +  + A+L Q
Sbjct: 87  KLDESYTPCKISIKAGTILHDLQEIILTELEEPSGWINIPLSFN------NNSLKANLLQ 140

Query: 170 IAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           I+I +N +NG+D+HIRQIKV+  K+ +  E+Y+     F + E +M +T+R
Sbjct: 141 ISILSNLKNGRDSHIRQIKVYGKKISI--ENYTQYP-KFNSPEVSMFQTLR 188



>gi|389750025|gb|EIM91196.1| anaphase-promoting complex subunit 10 [Stereum hirsutum FP-91666
           SS1]
          Length = 204

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 74/174 (42%), Positives = 113/174 (64%), Gaps = 8/174 (4%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + L+D++  T+W SDG  PH V I+FP+K+ V +ISL+L++
Sbjct: 36  DIGHLAKWSVSSFKFGFGPECLQDNDPDTFWHSDGPQPHFVTIEFPRKMAVQKISLFLSF 95

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEI-LSKTSRPVGAHLF 168
             D+SYTP  ++IRAGT   DLQ++R++ LD+P  W+   +S +     +  +PV  ++ 
Sbjct: 96  PLDDSYTPAALSIRAGTTASDLQEVRSLVLDKPDGWITFDVSAEPSDDGEGFKPVNVYIL 155

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYS--DDDIPFKTVEFAMHETIR 220
           Q+ I  NH NGKDTH+R +++  P      E+ +  DD  PF +V+F MHE IR
Sbjct: 156 QVIIITNHMNGKDTHLRGMRILGP-----VEEPTPWDDPFPFVSVKFKMHEFIR 204



>gi|470237864|ref|XP_004350889.1| anaphase promoting complex subunit 10 [Dictyostelium fasciculatum]
 gi|328865795|gb|EGG14181.1| anaphase promoting complex subunit 10 [Dictyostelium fasciculatum]
          Length = 194

 Score =  142 bits (359), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 112/176 (63%), Gaps = 12/176 (6%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++L +IG  A W LSS K G GVD+LRD++  T+WQSD   PH ++IQF ++  +  I L
Sbjct: 30  QDLVDIGEHATWLLSSAKPGFGVDQLRDESLSTFWQSDAPQPHTISIQFNKRYEIENILL 89

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           + ++K DESYTP+KI+I+AGT   DL+++ + EL+EP  W++I L+         R + A
Sbjct: 90  YTDHKLDESYTPSKISIKAGTTFHDLEEIISTELEEPSGWINIPLN-------EQRRLKA 142

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP-FKTVEFAMHETIR 220
           +L QI+I +NHQNG+DTH+RQ+KV   K  +     S   IP F   E  M  TIR
Sbjct: 143 NLVQISIHSNHQNGRDTHLRQVKVLGKKCTI----ESQLKIPMFAQSELNMFNTIR 194



>gi|195999362|ref|XP_002109549.1| hypothetical protein TRIADDRAFT_21690 [Trichoplax adhaerens]
 gi|190587673|gb|EDV27715.1| hypothetical protein TRIADDRAFT_21690 [Trichoplax adhaerens]
          Length = 175

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 108/160 (67%), Gaps = 13/160 (8%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           RE+G+ A+WS+SS K G G+ +L D+++ TYWQSDG+ PHL+NIQF +K  +  + ++ +
Sbjct: 20  REVGNEAVWSVSSCKPGLGIHQLLDNSYETYWQSDGSQPHLINIQFFKKTYISCLKIYTD 79

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLF 168
           +K DESYTP +I++R G H+ DL ++  +EL+EP  W+ I L+           + A L 
Sbjct: 80  FKLDESYTPKEISVRVGLHDHDLHEIHKMELNEPDGWITIPLN-----------IRAFLL 128

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPKLP--LFYEDYSDDDI 206
           Q+AI +NHQNG+++H+RQIKV  P     +F   YS++++
Sbjct: 129 QLAILSNHQNGRNSHLRQIKVCVPADSDYIFNHKYSNNEM 168



>gi|390595528|gb|EIN04933.1| anaphase-promoting complex subunit 10 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 221

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 111/181 (61%), Gaps = 15/181 (8%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K+G G + L D++  T+W SDG  PH + ++FP+K+ + ++S++L++
Sbjct: 46  DIGRYAKWSVSSFKYGFGAECLIDNDPDTFWHSDGPQPHFITVEFPRKMAIQKLSIYLSF 105

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTS-RPVGAHLF 168
             D+SYTP+ + IRAGT   DLQD+R + LD+P  W+   +S +        +PV A++ 
Sbjct: 106 PLDDSYTPSTLAIRAGTGPSDLQDVRVLTLDKPDGWITFDISSEASEEGEGFKPVHAYVL 165

Query: 169 QIAIKANHQNGKDTHIRQIKVFAP---------KLPLFYEDYSDDDIPFKTVEFAMHETI 219
           QI I  NH NGKDTH+R ++V  P          LPL       D  P+ + +F M++TI
Sbjct: 166 QIIIVTNHMNGKDTHVRGLRVLGPLEEMIRQPQNLPL-----DQDPFPWSSAKFKMYQTI 220

Query: 220 R 220
           R
Sbjct: 221 R 221



>gi|402224635|gb|EJU04697.1| galactose-binding like protein, partial [Dacryopinax sp. DJM-731
           SS1]
          Length = 163

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 101/166 (60%), Gaps = 3/166 (1%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           A WS+SS K+G GV+ L DD+  T+WQSDG  PH + + FP++V V +ISL L+   DES
Sbjct: 1   ASWSVSSSKYGFGVECLYDDDPSTFWQSDGPQPHFITLYFPRQVKVQKISLHLDALQDES 60

Query: 115 YTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQIAIKA 174
           YTPNK+ +RAGT   DLQD+R V  ++P  WV   +  +      +  +  H+ QI I  
Sbjct: 61  YTPNKLCVRAGTTVHDLQDVRMVSFEKPTGWVTFDVLMEAEQPDVAHVLDLHVLQIVIVG 120

Query: 175 NHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           NH +GKDTH+R + V  P+     E++     PF +  F MH+TIR
Sbjct: 121 NHLSGKDTHVRGMLVLGPRAAKEEEEHL---FPFTSAAFRMHQTIR 163



>gi|358060516|dbj|GAA93921.1| hypothetical protein E5Q_00567 [Mixia osmundae IAM 14324]
          Length = 190

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 105/155 (67%), Gaps = 8/155 (5%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           R++G  A WS+SS K G GV +L D +  T WQS+G  PHL+NIQF +++ + Q+SL+++
Sbjct: 33  RDVGRFAQWSVSSAKPGYGVQQLLDPSVETLWQSEGPQPHLINIQFRRRMPITQVSLFVD 92

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS----GDEILSKTSRP-- 162
             +D+SYTP++I IRAG+ +GDLQ+++ VEL+ P  W  + +      ++  S  + P  
Sbjct: 93  VNTDDSYTPHRIAIRAGSFSGDLQEIKVVELERPRGWSHLIMGEEDDEEDQDSADADPER 152

Query: 163 --VGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLP 195
             + AH  Q+AI ANH NGKDTH+R IK+FAP+ P
Sbjct: 153 GVIRAHYIQLAILANHLNGKDTHVRHIKIFAPRGP 187



>gi|209878440|ref|XP_002140661.1| anaphase-promoting complex, subunit 10 family protein
           [Cryptosporidium muris RN66]
 gi|209556267|gb|EEA06312.1| anaphase-promoting complex, subunit 10 family protein
           [Cryptosporidium muris RN66]
          Length = 227

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 99/161 (61%), Gaps = 15/161 (9%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L EIG  A W+LSS K GNGV++LRD+N  T+WQSDG  PH + ++FP K  V  I L+L
Sbjct: 36  LIEIGDFASWTLSSAKPGNGVNQLRDNNSSTFWQSDGQSPHTITLRFPSKTKVSMIDLYL 95

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEI------------ 155
            YK DESYTP  I+IRAG    DL++++ ++L EP  W+ I +S  +I            
Sbjct: 96  AYKIDESYTPQIISIRAGNQESDLEEIKEMQLAEPDGWIRIPISPRDIAEHFLKDIIPSQ 155

Query: 156 ---LSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPK 193
              +  +   +     QIAI +NHQ G+DTH+RQ++++ P+
Sbjct: 156 IKSICDSQNYISTFCIQIAILSNHQTGRDTHVRQMRIWGPR 196



>gi|256081509|ref|XP_002577012.1| tbc1 domain family member [Schistosoma mansoni]
          Length = 533

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 98/146 (67%), Gaps = 5/146 (3%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++R++   A+WSLSS K G+G+D+L  ++  T+WQSDG  PH VNIQFP+K+ + ++ L+
Sbjct: 21  KVRDVCDHAVWSLSSCKPGHGIDQLLSESTDTFWQSDGPQPHCVNIQFPRKMILSKLCLY 80

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
            +YK DESYTP+++ IR G    DL +L  VEL EP  W  I L+  +       P+   
Sbjct: 81  TDYKVDESYTPSRLAIRVGNTIHDLIELLEVELQEPTGWSVIPLNWPD-----GSPLRTF 135

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAP 192
           L QIAI ANHQNG+DTH+R I++ +P
Sbjct: 136 LLQIAISANHQNGRDTHLRAIRLHSP 161



>gi|409078210|gb|EKM78573.1| hypothetical protein AGABI1DRAFT_100625 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 196

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 109/174 (62%), Gaps = 8/174 (4%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++ S   WS+SS+K G G + LRD +  T+W SDG  PH + I+FP+KV + +IS++L+Y
Sbjct: 28  DVSSQGKWSVSSYKFGFGAECLRDGDPDTFWHSDGPQPHYITIEFPRKVAIQKISIFLSY 87

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTS-RPVGAHLF 168
             D+SYTP  + +RAGT   DLQD+R + L++P  W+   +S +         PV A++ 
Sbjct: 88  PQDDSYTPTTLAVRAGTGLSDLQDVRVITLEKPEGWITFDVSPEPNEDNDGLNPVYAYVV 147

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP--FKTVEFAMHETIR 220
           Q+ I ANH +GKDTH+R +++ AP      ED + DD P  F++  +  +ETIR
Sbjct: 148 QVIILANHMSGKDTHVRGLRILAP-----IEDQAHDDDPFAFESAVYKWYETIR 196



>gi|426199202|gb|EKV49127.1| hypothetical protein AGABI2DRAFT_116179 [Agaricus bisporus var.
           bisporus H97]
          Length = 197

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 109/174 (62%), Gaps = 8/174 (4%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++ S   WS+SS+K G G + LRD +  T+W SDG  PH + ++FP+KV + +IS++L+Y
Sbjct: 29  DVSSQGKWSVSSYKFGFGAECLRDGDPDTFWHSDGPQPHYITVEFPRKVAIQKISIFLSY 88

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTS-RPVGAHLF 168
             D+SYTP  + +RAGT   DLQD+R + L++P  W+   +S +         PV A++ 
Sbjct: 89  PQDDSYTPTTLAVRAGTGLSDLQDVRVITLEKPEGWITFDVSPEPNEDNDGLNPVYAYVV 148

Query: 169 QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP--FKTVEFAMHETIR 220
           Q+ I ANH +GKDTH+R +++ AP      ED + DD P  F++  +  +ETIR
Sbjct: 149 QVIILANHMSGKDTHVRGLRILAP-----IEDQAHDDDPFAFESAVYKWYETIR 197



>gi|353229474|emb|CCD75645.1| putative tbc1 domain family member [Schistosoma mansoni]
          Length = 355

 Score =  139 bits (349), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 98/146 (67%), Gaps = 5/146 (3%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++R++   A+WSLSS K G+G+D+L  ++  T+WQSDG  PH VNIQFP+K+ + ++ L+
Sbjct: 21  KVRDVCDHAVWSLSSCKPGHGIDQLLSESTDTFWQSDGPQPHCVNIQFPRKMILSKLCLY 80

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
            +YK DESYTP+++ IR G    DL +L  VEL EP  W  I L+  +       P+   
Sbjct: 81  TDYKVDESYTPSRLAIRVGNTIHDLIELLEVELQEPTGWSVIPLNWPD-----GSPLRTF 135

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAP 192
           L QIAI ANHQNG+DTH+R I++ +P
Sbjct: 136 LLQIAISANHQNGRDTHLRAIRLHSP 161



>gi|125553459|gb|EAY99168.1| hypothetical protein OsI_21127 [Oryza sativa Indica Group]
 gi|222632683|gb|EEE64815.1| hypothetical protein OsJ_19671 [Oryza sativa Japonica Group]
          Length = 223

 Score =  138 bits (348), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 85/204 (41%), Positives = 120/204 (58%), Gaps = 43/204 (21%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           +++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + +
Sbjct: 34  DDMREMAKTAAWSVSSCKPGNGVASLRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVV 93

Query: 106 WLNYKSDESYTPNKITIRAGT--HN------------GDL--------QDLRTVELDEPL 143
           ++++K DESYTP+KI++RAG   HN            G L         +++TVEL +P+
Sbjct: 94  YVDFKLDESYTPSKISVRAGDGFHNLKEYIDIRLGRTGKLWQDFVSVNMEIKTVELSKPV 153

Query: 144 RWVDIQLSGDEILSKTSRPVGAHLF--QIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDY 201
            WV I LSG +      R    H F  QI++ +NH NG+DTHIRQIK++ P+        
Sbjct: 154 GWVHISLSGAD-----PRETFIHTFMLQISVLSNHLNGRDTHIRQIKIYGPR-------- 200

Query: 202 SDDDIP-----FKTVEFAMHETIR 220
             + +P     F + EF  + T+R
Sbjct: 201 -PNHVPHQPFHFTSREFVTYSTVR 223



>gi|392564646|gb|EIW57824.1| anaphase-promoting complex subunit 10 [Trametes versicolor
           FP-101664 SS1]
          Length = 225

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 109/179 (60%), Gaps = 14/179 (7%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQS---DGTLPHLVNIQFPQKVNVVQISLW 106
           +IG  A WS+SS+K G G + L DD+  T+W S   DG  PH V I+FP+KV V ++S+ 
Sbjct: 53  DIGGLAKWSVSSFKFGFGPECLTDDDPETFWHSSSSDGPQPHFVTIEFPRKVAVQKLSIH 112

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWV--DIQLSGDEILSKTSRPVG 164
           L+Y  D+SYTP  I +RAGT   D+QDLR + L++P  WV  DI +   E   +  +P+ 
Sbjct: 113 LSYPLDDSYTPANICVRAGTGPVDIQDLRIISLEKPDGWVTFDICMEPSED-GEGYKPID 171

Query: 165 AHLFQIAIKANHQNGKDTHIRQIKVFAP---KLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            ++ QI I  NH NGKDTH+R +KV  P   +L  + E +     PF + +F M+E IR
Sbjct: 172 VYVIQIHIMNNHMNGKDTHVRGVKVLGPLERRLKAYEEPF-----PFVSPQFKMYECIR 225



>gi|395324050|gb|EJF56498.1| APC10-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 227

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 113/176 (64%), Gaps = 11/176 (6%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + L D++  T+W SDG  PH + ++FP+KV++ ++S++L++
Sbjct: 58  DIGHLAKWSVSSFKFGFGAECLTDEDPDTFWHSDGPQPHFITVEFPRKVSIQKLSMYLSF 117

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWV--DIQLSGDEILSKTSRPVGAHL 167
             D+SYTP  I +RAGT   DLQD+R +++++P  W+  D+ +  +E      + + A++
Sbjct: 118 PMDDSYTPATIAVRAGTGPVDLQDVRILQVEKPDGWITFDVCMEPNED-GDGFKHIEAYI 176

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAP---KLPLFYEDYSDDDIPFKTVEFAMHETIR 220
            Q+ I  NH NGKDTH+R +KV  P   KL ++ E +     PF + +F M+E IR
Sbjct: 177 LQVIILTNHMNGKDTHVRGLKVLGPVEAKLQVYEEPF-----PFVSPQFKMYECIR 227



>gi|19112595|ref|NP_595803.1| anaphase-promoting complex subunit Apc10 [Schizosaccharomyces pombe
           972h-]
 gi|26390994|sp|O42971.1|APC10_SCHPO RecName: Full=Anaphase-promoting complex subunit 10; AltName:
           Full=20S cyclosome/APC complex protein apc10
 gi|2842526|emb|CAA16839.1| anaphase-promoting complex subunit Apc10 [Schizosaccharomyces
           pombe]
 gi|3402334|dbj|BAA32157.1| Apc10 (anaphase promoting complex) [Schizosaccharomyces pombe]
          Length = 189

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 110/184 (59%), Gaps = 24/184 (13%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           E   +IG+ A W+ SS K G  +  +RDDN  TYWQSDG+ PH ++I+F ++V++  +S+
Sbjct: 21  EGFVDIGNLAQWTCSSEKSGFPIRLVRDDNIDTYWQSDGSQPHTIHIKFVKRVSIKYVSM 80

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG- 164
           +L Y  DESYTP+ + I AGT   DL+ + TV+++EP  WV +             PVG 
Sbjct: 81  YLQYTLDESYTPSTLRISAGTGFQDLEIVTTVQVEEPTGWVHV-------------PVGD 127

Query: 165 --------AHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMH 216
                    HL QI I ANHQ+GKD+H+R IK++AP++       + D+IP+ +++F   
Sbjct: 128 FGRNGLLDVHLIQIKILANHQSGKDSHVRLIKIYAPEIE--QPAIAVDEIPYTSLQFISR 185

Query: 217 ETIR 220
             +R
Sbjct: 186 NQLR 189



>gi|242214745|ref|XP_002473193.1| predicted protein [Postia placenta Mad-698-R]
 gi|220727695|gb|EED81606.1| predicted protein [Postia placenta Mad-698-R]
          Length = 149

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (64%), Gaps = 1/144 (0%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +IG  A WS+SS+K G G + LRDD   T+W SDG  PH + ++FP+KV V ++S+ L +
Sbjct: 6   DIGHLAKWSVSSYKFGFGPECLRDDEPDTFWHSDGPQPHFITLEFPRKVAVQKLSVCLCF 65

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTS-RPVGAHLF 168
             D+SYTP  I +RAGT   DLQD+R + LD+P  W+   +S D        +P+ A++ 
Sbjct: 66  PLDDSYTPATIAVRAGTGPSDLQDVRVLSLDKPDGWITFDVSADANEEGDGFKPLHAYIV 125

Query: 169 QIAIKANHQNGKDTHIRQIKVFAP 192
           Q+ I ANH NGKDTH+R ++V  P
Sbjct: 126 QLIIIANHMNGKDTHVRGLRVLGP 149



>gi|328770902|gb|EGF80943.1| hypothetical protein BATDEDRAFT_11110 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 186

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 94/147 (63%), Gaps = 5/147 (3%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           EL++I S A WSLSS K   GVD+L D N  TYWQSDG  PH +N+ F +   + Q+S++
Sbjct: 36  ELKDISSLAKWSLSSNKEAFGVDRLHDGNLDTYWQSDGPQPHYINMYFHKCWAIAQVSVY 95

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAH 166
           L++K DESYTP +I +R G    DL  +  +EL+EP  W+DI +S  +       P+ A 
Sbjct: 96  LDFKQDESYTPRQIALRVGNRVQDLYQISQLELNEPSGWIDILVSDPD-----KPPIKAF 150

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPK 193
           + Q+ + +NHQ GKDTH+RQ+K+   K
Sbjct: 151 MLQLLVLSNHQGGKDTHVRQVKIMQHK 177



>gi|328854174|gb|EGG03308.1| hypothetical protein MELLADRAFT_29060 [Melampsora larici-populina
           98AG31]
          Length = 130

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 93/144 (64%), Gaps = 14/144 (9%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++G  A+WS+SS K G GV +LRDD+  T WQS+G  PH + I+FP+K  V +IS++++ 
Sbjct: 1   DLGDRAVWSVSSAKPGFGVAQLRDDSIHTLWQSEGPQPHFIRIEFPKKTAVSRISIFVDV 60

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQ 169
             D+SYTP +++I  G+   DLQ ++ ++L  P  W DI+L               HLFQ
Sbjct: 61  SMDDSYTPCRLSIAVGSFKQDLQQIKQLDLRNPRGWQDIKL--------------GHLFQ 106

Query: 170 IAIKANHQNGKDTHIRQIKVFAPK 193
           IA+ ANH NGKDTHIR +K+F P+
Sbjct: 107 IAVLANHLNGKDTHIRALKIFGPR 130



>gi|320584174|gb|EFW98385.1| anaphase-promoting complex processivity factor Apc10, putative
           [Ogataea parapolymorpha DL-1]
          Length = 402

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 4/150 (2%)

Query: 43  FKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQ 102
            +H  L +IG+ A W +S++K G G+ +LR+D+  +YWQSDG  PH + I F ++V V +
Sbjct: 55  LEHLGLIDIGNLAAWGVSTYKQGYGIKELREDSPFSYWQSDGQQPHFITIHFTKRVTVQR 114

Query: 103 ISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRP 162
           +S + NY+ DESYTP+KI + AG+   DL ++ + E  EP  W  I   G     ++   
Sbjct: 115 LSFYFNYQLDESYTPSKILVLAGSGEHDLMEVSSKEFFEPSGWQHIFFKG----VRSDNL 170

Query: 163 VGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
           +  +L +I   +NHQNGKD+H+R IKVF+P
Sbjct: 171 LKCYLIKICFLSNHQNGKDSHVRSIKVFSP 200



>gi|254571777|ref|XP_002492998.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238032796|emb|CAY70819.1| hypothetical protein PAS_chr3_1218 [Komagataella pastoris GS115]
          Length = 192

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/164 (43%), Positives = 104/164 (63%), Gaps = 10/164 (6%)

Query: 43  FKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQ 102
           F  + L EI S A WS+SS+KH NG+ +LR+DN  TYWQSDG LPH + + F +KV+V +
Sbjct: 16  FTKKGLVEISSLAWWSVSSYKHNNGLKELREDNPDTYWQSDGNLPHSLKLHFSKKVSVER 75

Query: 103 ISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSG---DEILSKT 159
           ISL+ NY+ DESY+P  I++ +G    DL  + T EL EP+ W  I  +G   D IL+  
Sbjct: 76  ISLFTNYQLDESYSPQVISVYSGNGEHDLIKVTTCELVEPIGWSHIIFNGVREDGILN-- 133

Query: 160 SRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSD 203
                    +++ ++NHQ+GKDTHIR +KV +P+  +   D +D
Sbjct: 134 -----TFFIKLSFESNHQSGKDTHIRSLKVCSPRNIVNKSDSTD 172



>gi|213407856|ref|XP_002174699.1| anaphase-promoting complex subunit 10 [Schizosaccharomyces
           japonicus yFS275]
 gi|212002746|gb|EEB08406.1| anaphase-promoting complex subunit 10 [Schizosaccharomyces
           japonicus yFS275]
          Length = 178

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 115/185 (62%), Gaps = 11/185 (5%)

Query: 38  IIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQK 97
           I + E K   L ++G+ A WS S+ K G  +  +RDD+  TYWQSDG+ PH++  +F ++
Sbjct: 3   ITEHEKKIHGLVDVGNLAQWSASTEKTGFPISNVRDDDINTYWQSDGSQPHVLYAKFIKR 62

Query: 98  VNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS--GDEI 155
           V +  +S++L Y  DESYTP+KI I AGT   DLQ + T EL+E   W+ I +   G   
Sbjct: 63  VEIKYLSIYLMYSLDESYTPSKIRIAAGTGLHDLQPVVTTELEEQEGWLHIPVGDYGRNG 122

Query: 156 LSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAM 215
           L +T      ++ Q++I +NHQNGKD+HIR IK++AP+ P   +  + D+IP+ +++F  
Sbjct: 123 LLET------YMLQLSILSNHQNGKDSHIRLIKIYAPEAP---QALAVDEIPYTSIQFHS 173

Query: 216 HETIR 220
              +R
Sbjct: 174 RSQLR 178



>gi|299749485|ref|XP_001836141.2| anaphase-promoting complex [Coprinopsis cinerea okayama7#130]
 gi|298408461|gb|EAU85650.2| anaphase-promoting complex [Coprinopsis cinerea okayama7#130]
          Length = 194

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 93/149 (62%), Gaps = 11/149 (7%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +I   A WS+SS+K G GV+ LRD +  T+W SDG  PH + ++FP KV + +IS+ L +
Sbjct: 36  DISDRAKWSVSSYKFGFGVECLRDGDPDTFWHSDGPQPHFITLEFPCKVAIQKISILLRF 95

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS------GDEILSKTSRPV 163
             D+SYTP+ + IRAGT   DLQD+R V  D+P  W+   +S      GD +      PV
Sbjct: 96  PLDDSYTPSTLAIRAGTGPSDLQDVRMVTFDKPDGWITFDVSSEPNEDGDGL-----APV 150

Query: 164 GAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
            A++ QI I ANH +GKDTH+R ++V  P
Sbjct: 151 YAYVLQIIIAANHMSGKDTHVRGLRVLGP 179



>gi|321260060|ref|XP_003194750.1| hypothetical protein CGB_F3450W [Cryptococcus gattii WM276]
 gi|317461222|gb|ADV22963.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 185

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 95/150 (63%), Gaps = 4/150 (2%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E  E+   A WS+SS K+G GVD LRD N  T+WQS+G  PH +++ FP+KV +  I++ 
Sbjct: 26  ERPELSHLAQWSVSSHKYGFGVDNLRDGNDGTFWQSEGAQPHTIDLAFPRKVMISAIAVH 85

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSR----P 162
           +++  D+SYTP+KI IR GT   DLQ++R +E  +P  W  I L   E  + ++     P
Sbjct: 86  MSHPRDDSYTPSKIGIRCGTGVHDLQEVRYLEFSKPDGWHLIPLRPMEHTTSSAEKEGPP 145

Query: 163 VGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
           +  H  +I I ANH NGKDTH+R +KVF P
Sbjct: 146 IPCHFLRILIFANHLNGKDTHVRGVKVFGP 175



>gi|58269076|ref|XP_571694.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57227929|gb|AAW44387.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 190

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 94/150 (62%), Gaps = 4/150 (2%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E  E+   A WS+SS K+G GVD LRD N  T+WQS+G  PH +++ FP+KV +  I++ 
Sbjct: 26  ERPELSHLAQWSVSSHKYGFGVDNLRDGNDSTFWQSEGAQPHTIDLAFPRKVMISAIAVH 85

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDE----ILSKTSRP 162
           +++  D+SYTP+KI IR GT   DLQ++R +E  +P  W  I L   E     + K   P
Sbjct: 86  MSHPRDDSYTPSKIGIRCGTGVHDLQEVRYMEFSKPDGWHLIPLRPMEHTASRMEKEGPP 145

Query: 163 VGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
           +  H  ++ I ANH NGKDTH+R +KVF P
Sbjct: 146 IPCHFLRVLIFANHLNGKDTHVRGLKVFGP 175



>gi|134113060|ref|XP_774806.1| hypothetical protein CNBF2360 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257452|gb|EAL20159.1| hypothetical protein CNBF2360 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 190

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 94/150 (62%), Gaps = 4/150 (2%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           E  E+   A WS+SS K+G GVD LRD N  T+WQS+G  PH +++ FP+KV +  I++ 
Sbjct: 26  ERPELSHLAQWSVSSHKYGFGVDNLRDGNDSTFWQSEGAQPHTIDLAFPRKVMISAIAVH 85

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDE----ILSKTSRP 162
           +++  D+SYTP+KI IR GT   DLQ++R +E  +P  W  I L   E     + K   P
Sbjct: 86  MSHPRDDSYTPSKIGIRCGTGVHDLQEVRYMEFSKPDGWHLIPLRPMEHTASRMEKEGPP 145

Query: 163 VGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
           +  H  ++ I ANH NGKDTH+R +KVF P
Sbjct: 146 IPCHFLRVLIFANHLNGKDTHVRGLKVFGP 175



>gi|406866491|gb|EKD19531.1| anaphase promoting complex subunit 10 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 417

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 95/146 (65%), Gaps = 5/146 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           LREIG+ A W++SS K G GVD LRDD+   +WQSDG  PH +NI F + V+++ I ++L
Sbjct: 226 LREIGNLASWTVSSCKPGCGVDALRDDDTGLFWQSDGPQPHHLNIHFSRLVSILSIRIFL 285

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS--GDEILSKTSRPVGA 165
           ++++DESYTP +IT+ AGT   DL     +  ++P  W+D+ L   G     +T R    
Sbjct: 286 DFEADESYTPTRITLLAGTAYHDLIPFAALSFEQPKGWIDVPLDHVGGAPDGRTLR---V 342

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFA 191
            L Q+ I  NHQNGKDTH+R +K++A
Sbjct: 343 FLVQVRIIENHQNGKDTHLRGLKIYA 368



>gi|440631730|gb|ELR01649.1| hypothetical protein GMDG_00025 [Geomyces destructans 20631-21]
          Length = 320

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 100/157 (63%), Gaps = 9/157 (5%)

Query: 39  IKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKV 98
           + S F    L+EIG+ A W++S+ K G+GV+ LRDD+   YWQSDG  PH +NI F + V
Sbjct: 122 VDSVFDPTGLKEIGNLASWTVSTCKPGSGVEALRDDDTSLYWQSDGPQPHHLNIHFSRLV 181

Query: 99  NVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSK 158
           +++ I ++L++++DESYTP +IT+ AGT   DL    ++E  +P  W+++ L G      
Sbjct: 182 SILSIRIFLDFEADESYTPTRITLLAGTGYHDLIPFSSLEFTQPKGWINVPLDG-----V 236

Query: 159 TSRPVG----AHLFQIAIKANHQNGKDTHIRQIKVFA 191
              P G    A L Q+ +  NHQNGKDTH+R ++++A
Sbjct: 237 GGGPDGNTLRAFLVQVKVVENHQNGKDTHVRGLRIYA 273



>gi|238006074|gb|ACR34072.1| unknown [Zea mays]
 gi|413948346|gb|AFW80995.1| hypothetical protein ZEAMMB73_722151 [Zea mays]
          Length = 147

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/106 (57%), Positives = 81/106 (76%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLW 106
           ++RE+  +A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L+
Sbjct: 35  DMREMAKTAAWSVSSCKAGNGVAALRDDNLDTYWQSDGAQPHLVNIQFQKKVQLQLVVLY 94

Query: 107 LNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSG 152
           +++K DESYTP+KI+IRAG    +L+++RTVEL +P+ WV I LSG
Sbjct: 95  VDFKLDESYTPSKISIRAGDGFHNLKEIRTVELAKPVGWVHISLSG 140



>gi|508699165|gb|EOX91061.1| Anaphase-promoting complex subunit 10 isoform 3 [Theobroma cacao]
          Length = 157

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 61/109 (55%), Positives = 82/109 (75%)

Query: 46  EELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++LRE+G  A WS+SS K GNGV  LRDDN  TYWQSDG  PHLVNIQF +KV +  + L
Sbjct: 25  DDLREMGKKAAWSVSSCKTGNGVSSLRDDNLETYWQSDGAQPHLVNIQFQKKVKLQLVVL 84

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDE 154
           ++++K DESYTP+KI IRAG    +L++++TVEL +P  WV + LSG++
Sbjct: 85  YVDFKLDESYTPSKICIRAGDGFHNLKEIKTVELVKPTGWVYLSLSGND 133



>gi|403158039|ref|XP_003307384.2| hypothetical protein PGTG_00334 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375163653|gb|EFP74378.2| hypothetical protein PGTG_00334 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 204

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 102/182 (56%), Gaps = 13/182 (7%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++G   +WS+SS K G GV+ LRDD+  T WQS+G  PH + I+FP+K  V QIS++++ 
Sbjct: 25  DLGDLGLWSVSSAKPGFGVENLRDDSVHTLWQSEGPQPHFIRIEFPKKTIVTQISIFVDV 84

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDE-----------ILSK 158
             D+SYTP K++I  GT   DLQ ++ +EL  P  W  I+L   E             S 
Sbjct: 85  TLDDSYTPCKLSISLGTFKQDLQVVKIIELINPRGWHHIRLVDREEEEPGDDDDDSDDSD 144

Query: 159 TSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHET 218
           +      HLFQ+AI ANH NGKDTHIR +K+  P+         D   P +     MHET
Sbjct: 145 SGFAAKGHLFQVAILANHLNGKDTHIRCLKILGPRSQ--SRQRWDGFGPNRHELLLMHET 202

Query: 219 IR 220
           IR
Sbjct: 203 IR 204



>gi|345563773|gb|EGX46758.1| hypothetical protein AOL_s00097g506 [Arthrobotrys oligospora ATCC
           24927]
          Length = 404

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 94/148 (63%), Gaps = 10/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EIG  A W++S+ K G GV +LR ++   +WQSDG  PHL+NI F ++V V +I ++L
Sbjct: 154 LKEIGHLASWTVSTSKPGCGVAELRSEDTNLFWQSDGPQPHLINIHFAKRVFVKRIRVFL 213

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSG---DEILSKTSRPVG 164
           +Y  DESYTP KI I AGT   DLQ++  +E  +P  W +  L G   D IL        
Sbjct: 214 DYGQDESYTPTKIAIYAGTGYHDLQEVCILEFHQPTGWQEAPLEGVHADGILR------- 266

Query: 165 AHLFQIAIKANHQNGKDTHIRQIKVFAP 192
             L Q+ + +NHQNGKDTH+R +++++P
Sbjct: 267 TFLIQVCVLSNHQNGKDTHVRGLQIYSP 294



>gi|50552486|ref|XP_503653.1| YALI0E07117p [Yarrowia lipolytica]
 gi|49649522|emb|CAG79235.1| YALI0E07117p [Yarrowia lipolytica CLIB122]
          Length = 184

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 100/154 (64%), Gaps = 10/154 (6%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           ++GS A WS+SS K G GV+ LR D+   +WQSDG  PH ++I F ++V++ ++S++ +Y
Sbjct: 21  DLGSLAHWSVSSHKTGCGVEALRSDDHQLFWQSDGPQPHHLDIHFSKRVSIERVSIYTDY 80

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSG---DEILSKTSRPVGAH 166
           + DESYTP+KI I AG+   DL ++  V+LDEP  W  + L G   D +L         +
Sbjct: 81  ELDESYTPSKIKILAGSGYHDLLEVTEVDLDEPQGWTHLVLDGLREDGVLK-------TY 133

Query: 167 LFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYED 200
           L ++ I ANHQ+GKDTH+R +KV+ P+  +  +D
Sbjct: 134 LLRLLIPANHQHGKDTHLRAVKVYGPRKHMVMDD 167



>gi|512204326|gb|EPE33149.1| Galactose-binding protein [Glarea lozoyensis ATCC 20868]
          Length = 348

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/146 (44%), Positives = 94/146 (64%), Gaps = 5/146 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EIG+ A W++SS K G GV+ LRDD+   +WQSDG  PH +NI F + V+++ I ++L
Sbjct: 145 LKEIGNLASWTVSSSKPGCGVEALRDDDTSLFWQSDGPQPHHLNIHFSRLVSILSIRIFL 204

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS--GDEILSKTSRPVGA 165
           ++ +DESYTP +I + AGT   DL     ++ + P  WVD+ L   G     +  R + A
Sbjct: 205 DFAADESYTPTRIVLLAGTGYHDLIQFSELKFERPSGWVDVPLEHVGG---GRDGRTLRA 261

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFA 191
            L Q+ I  NHQNGKDTH+R +KV+A
Sbjct: 262 FLVQVRIMENHQNGKDTHVRGLKVYA 287



>gi|302684263|ref|XP_003031812.1| hypothetical protein SCHCODRAFT_37734 [Schizophyllum commune H4-8]
 gi|300105505|gb|EFI96909.1| hypothetical protein SCHCODRAFT_37734, partial [Schizophyllum
           commune H4-8]
          Length = 145

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 92/144 (63%), Gaps = 2/144 (1%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           +I   A WS+SS+K G G + L D +  T+W SDG  PH ++I+FP+KV + ++SL+L++
Sbjct: 2   DISDKAKWSVSSFKFGFGAECLTDGDPDTFWHSDGPQPHFISIEFPKKVAIQKLSLFLSF 61

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--AHL 167
             D+SYTP  I IRAGT   DLQ ++ +  D+P  W+   +  +   ++   P G  A++
Sbjct: 62  NEDDSYTPATIEIRAGTGANDLQSIQIINFDKPDGWITFDVGTEPAETEEDPPEGVYAYV 121

Query: 168 FQIAIKANHQNGKDTHIRQIKVFA 191
            QIAI ANH +GKDTH+R ++V  
Sbjct: 122 VQIAILANHMSGKDTHVRGLRVLG 145



>gi|241570589|ref|XP_002402817.1| anaphase-promoting complex, subunit, putative [Ixodes scapularis]
 gi|215500135|gb|EEC09629.1| anaphase-promoting complex, subunit, putative [Ixodes scapularis]
          Length = 184

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 18/181 (9%)

Query: 47  ELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQK----VNVVQ 102
           ++RE+G+ A+WSLSS K G GVD+LRD+   TYWQSDG  PHLVNI   +     ++   
Sbjct: 15  KVREVGAQAVWSLSSCKPGFGVDQLRDNCLDTYWQSDGPQPHLVNIHGDRTRGTILSACT 74

Query: 103 ISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRP 162
            +    + SD S+   +I++R G+   DLQ+L  ++L+EP  WV I          + RP
Sbjct: 75  ETTEFGHLSDHSHAV-EISVRVGSSFHDLQELEAIDLNEPTGWVHISTR-----DTSGRP 128

Query: 163 VGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIP---FKTVEFAMHETI 219
           +     QIA+ +NHQNG+DTH+RQIKV +P      E  S   +P   F +VE     +I
Sbjct: 129 IRTFFVQIAVLSNHQNGRDTHLRQIKVHSP-----VEQASVSILPKVSFTSVECCAFSSI 183

Query: 220 R 220
           R
Sbjct: 184 R 184



>gi|308494404|ref|XP_003109391.1| hypothetical protein CRE_08300 [Caenorhabditis remanei]
 gi|308246804|gb|EFO90756.1| hypothetical protein CRE_08300 [Caenorhabditis remanei]
          Length = 216

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 91/150 (60%), Gaps = 5/150 (3%)

Query: 44  KHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQI 103
           K + L +I S AIW LSS K+G GVD+L  D+   YWQSDG  PH ++++F +K +V  +
Sbjct: 26  KDQPLLDISSQAIWCLSSCKNGYGVDELMSDSVEKYWQSDGPQPHTIHLEFQKKTDVAMM 85

Query: 104 SLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPV 163
             +L++K+DESYTP+KI ++ G+ + D+    T   +EP  W  I L       K  RP 
Sbjct: 86  MFYLDFKNDESYTPSKIQVKMGSSHQDIFFRTTQSFNEPQGWTYIDLR-----DKNKRPQ 140

Query: 164 GAHLFQIAIKANHQNGKDTHIRQIKVFAPK 193
                QI +  NHQNG+DTHIR ++V  P+
Sbjct: 141 RVFWIQIQVIQNHQNGRDTHIRHVRVLGPE 170



>gi|268565105|ref|XP_002639335.1| Hypothetical protein CBG03913 [Caenorhabditis briggsae]
          Length = 220

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 90/146 (61%), Gaps = 5/146 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L +I + AIW++SS K+G G+D+L  DN   YWQSDG  PH ++++F +K +V  +  +L
Sbjct: 35  LLDISNQAIWTVSSCKNGYGIDELMSDNVEKYWQSDGPQPHTIHLEFQKKTDVAFMMFYL 94

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +YK+DESYTP+KI I+ G+ + D+        +EP  W  I     +I  K  RP     
Sbjct: 95  DYKNDESYTPSKIQIKLGSSHQDIFFRNAQSFNEPQGWCAI-----DIRDKMERPQRVFW 149

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPK 193
            QI +  NHQNG+DTHIR ++V  PK
Sbjct: 150 IQIQVIQNHQNGRDTHIRHVRVLGPK 175



>gi|406601603|emb|CCH46768.1| Anaphase-promoting complex subunit 10 [Wickerhamomyces ciferrii]
          Length = 230

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 95/144 (65%), Gaps = 3/144 (2%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L ++GS A W+ SS K  N V KLRD++  TYWQSDG  PH ++I F +KV++ +IS+++
Sbjct: 63  LVDVGSLASWTASSEKQDNEVMKLRDESPDTYWQSDGVQPHYIDIHFAKKVSISKISIYI 122

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y  DESYTP+KIT+ AG    DL ++  +EL+EP  WV +    +    +  R     L
Sbjct: 123 DYALDESYTPSKITVLAGNGFHDLMEVTGIELNEPEGWVHLGFPTEVDQGQILRTF---L 179

Query: 168 FQIAIKANHQNGKDTHIRQIKVFA 191
            ++ I ANHQ+GKDTH+R IK+++
Sbjct: 180 VRVLIVANHQHGKDTHVRAIKIYS 203



>gi|380479957|emb|CCF42709.1| anaphase-promoting complex subunit 10 [Colletotrichum higginsianum]
          Length = 342

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 103/176 (58%), Gaps = 19/176 (10%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV++LRDD+  TYWQSDG  PH + + F ++V +  I  ++
Sbjct: 145 LKEISNLGKFTVSSHKQGNGVEQLRDDSLKTYWQSDGPQPHKLTVYFIKRVGIRDIRFFV 204

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--- 164
           +Y  DESYTP KI  ++GT   +L    T+E+ +P  W  + ++G         P G   
Sbjct: 205 DYSEDESYTPTKIIFKSGTSENNLIQFATMEMSQPSGWQKVPVAG-----AGGGPDGNTL 259

Query: 165 -AHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETI 219
            +++FQ+ I  NHQNGKDTH+R IK++A          +D+D P   V+   H+ +
Sbjct: 260 VSYVFQMQILENHQNGKDTHLRSIKIYA----------ADNDAPNVDVDSTNHKIV 305



>gi|326427051|gb|EGD72621.1| hypothetical protein PTSG_04356 [Salpingoeca sp. ATCC 50818]
          Length = 198

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 96/146 (65%), Gaps = 6/146 (4%)

Query: 49  REIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLN 108
           R+IG S +W+LSS K G G+ +LRD +   YWQSDG  PHLV I+F Q+  +   S++++
Sbjct: 34  RDIGDSGVWTLSSCKAGFGIQQLRDPSTTIYWQSDGPQPHLVTIEFLQRTALASFSIYVD 93

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLR-WVDIQLSGDEILSKTSRPVGAHL 167
              DESYTP  +++R G+H+ DL++++ V L   ++ W +I L+     +K  R V   +
Sbjct: 94  STLDESYTPKTLSVRVGSHHHDLREVKVVNLQAAVQGWRNITLATP---TKGYRKV--FV 148

Query: 168 FQIAIKANHQNGKDTHIRQIKVFAPK 193
            Q+AI ANHQNG+DTH+R ++V  P+
Sbjct: 149 LQVAIIANHQNGRDTHLRALRVHPPE 174



>gi|312065554|ref|XP_003135847.1| anaphase promoting complex subunit 10 [Loa loa]
 gi|307768997|gb|EFO28231.1| anaphase promoting complex subunit 10 [Loa loa]
          Length = 213

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 92/147 (62%), Gaps = 6/147 (4%)

Query: 47  ELREIGSSAIWSLSSWK-HGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++R+I + A W+LSS K  G G+ +L DD+   YWQSDG  PH V I+F +K N+  + L
Sbjct: 34  DVRDISNQAFWTLSSCKTDGFGIQQLLDDDLEQYWQSDGPQPHTVTIEFNKKTNISYLLL 93

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           +L+YK+DESYTP+K+ +R G+   D+ +  TV   EP+ W  I L   +       P  A
Sbjct: 94  YLDYKTDESYTPSKVVVRLGSSVLDVDEGLTVVFSEPVGWQVIDLRDAD-----GGPSRA 148

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAP 192
            + Q+ +  NHQNG+DTHIRQ+++  P
Sbjct: 149 FILQLQVVQNHQNGRDTHIRQMRIIGP 175



>gi|320592894|gb|EFX05303.1| anaphase promoting complex subunit 10 [Grosmannia clavigera kw1407]
          Length = 373

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 91/144 (63%), Gaps = 1/144 (0%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI + A +S+SS K GNGVD+L  D+   YWQSDG  PHL+ I F ++V +  I  ++
Sbjct: 162 LKEINNLAHFSVSSHKPGNGVDELLIDDLNKYWQSDGPQPHLLTIHFLRRVEIRAIRFYV 221

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y  DESYTP  + + AGT + DL +  T+ +  P+ W ++ LSG        + +   +
Sbjct: 222 DYNQDESYTPTVVMLSAGTGHHDLIEFATLSMTSPVGWQEVDLSG-AGGGNDGQSLCCWI 280

Query: 168 FQIAIKANHQNGKDTHIRQIKVFA 191
            Q+ +K NHQNGKDTHIR IK++A
Sbjct: 281 VQVKVKENHQNGKDTHIRGIKIYA 304



>gi|512190635|gb|EPE06398.1| anaphase-promoting complex subunit 10 [Ophiostoma piceae UAMH
           11346]
          Length = 438

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 93/144 (64%), Gaps = 1/144 (0%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI + A +S+SS K GNGV++L +D+   +WQSDG  PHL+ I F ++V +  I L++
Sbjct: 203 LKEINNLAHFSVSSHKPGNGVEELLNDDLDKFWQSDGPQPHLLTIHFLRRVEIRAIRLFV 262

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y  DESYTP  +++ AGT + DL +  T+ L+ P+ W +I LS D         +   +
Sbjct: 263 DYNQDESYTPTSVSLSAGTGHHDLLEFSTLALNRPVGWQEINLS-DVGGGADGNSLCCWI 321

Query: 168 FQIAIKANHQNGKDTHIRQIKVFA 191
            Q+ +K NHQNGKDTHIR IK++ 
Sbjct: 322 VQVRVKENHQNGKDTHIRGIKLYG 345



>gi|167524537|ref|XP_001746604.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163774874|gb|EDQ88500.1| predicted protein [Monosiga brevicollis MX1]
          Length = 220

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 103/187 (55%), Gaps = 14/187 (7%)

Query: 38  IIKSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQK 97
           + K  F   + +EIG+  +WSLSS K   G+  LRD    TYWQSDG  PH V I F  +
Sbjct: 44  VGKEPFDVHQYQEIGNDGVWSLSSRKLDFGIRLLRDGRDETYWQSDGPQPHTVTISFSSR 103

Query: 98  VNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILS 157
                ++L  +Y+ DESYTP  + IRAG    +L ++ T ++     W  I+L  ++   
Sbjct: 104 RKFAYMALNTSYQHDESYTPKVVEIRAGPRIANLTEVVTADVGMNEGWFYIKLEKED--- 160

Query: 158 KTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPK----LPLFYEDYSDDDIPFKTVEF 213
              +P+   + Q+A+  NHQNGKDTH+R ++++AP+     PL     S+  +PF T  F
Sbjct: 161 --GQPIEDFVIQLAVLVNHQNGKDTHLRGVRIYAPRQRQLTPL-----SEPTMPFSTNAF 213

Query: 214 AMHETIR 220
           A  E IR
Sbjct: 214 ARFEFIR 220



>gi|170594453|ref|XP_001901978.1| Anaphase promoting complex subunit 10 [Brugia malayi]
 gi|158590922|gb|EDP29537.1| Anaphase promoting complex subunit 10, putative [Brugia malayi]
          Length = 213

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 92/147 (62%), Gaps = 6/147 (4%)

Query: 47  ELREIGSSAIWSLSSWK-HGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++R+I + A W+LSS K  G G+ +L D++   YWQSDG  PH V I+F +K N+  + L
Sbjct: 34  DVRDISNQAFWTLSSCKTDGFGIQQLLDEDLEQYWQSDGPQPHTVTIEFSRKTNISYLLL 93

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           +L+YK+DESYTP+K+ +R G+   D+ +  TV   EP+ W  I L   +       P  A
Sbjct: 94  YLDYKTDESYTPSKVVVRLGSSVLDVDEGLTVVFSEPVGWQVIDLRDAD-----GGPSRA 148

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFAP 192
            + Q+ +  NHQNG+DTHIRQ+++  P
Sbjct: 149 FVLQLQVVQNHQNGRDTHIRQMRIIGP 175



>gi|241673384|ref|XP_002399965.1| anaphase-promoting complex, subunit, putative [Ixodes scapularis]
 gi|215504164|gb|EEC13658.1| anaphase-promoting complex, subunit, putative [Ixodes scapularis]
          Length = 183

 Score =  122 bits (306), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 102/176 (57%), Gaps = 6/176 (3%)

Query: 45  HEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQIS 104
           H  +RE+GS A+WS+SS + G+GV +LRD +  T+WQSDG LPH +++QF +++++  + 
Sbjct: 14  HGRVREVGSQAVWSVSSGRRGHGVSQLRDGDLDTFWQSDGELPHRIDVQFGRRLSIQAVL 73

Query: 105 LWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG 164
           + + +  DE++TPN +++ AG    D++ +  V +  P  WV I+    E      RP  
Sbjct: 74  INVCHDLDENFTPNVVSVSAGNDPHDMRTVGGVSMTRPSGWVLIETEDSE-----ERPPR 128

Query: 165 AHLFQIAIKANHQNGKDTHIRQIKVFAPKLPLFYEDYSDDDIPFKTVEFAMHETIR 220
           A   ++ +  NHQ G D+ +RQ+KV+ P           +++ F ++E  M   IR
Sbjct: 129 AFCLRLYVHINHQFGMDSRVRQMKVYTPAQETVVSTLP-EEVTFSSLECRMFSRIR 183



>gi|511011748|gb|EPB92953.1| hypothetical protein HMPREF1544_00027 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 284

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 91/147 (61%), Gaps = 8/147 (5%)

Query: 49  REIGS-SAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLP---HLVNIQFPQKVNVVQIS 104
           REIG   AIWS+SS++   G DKLRD+N LTYWQSD   P   H +++ F Q   + Q+S
Sbjct: 112 REIGEHEAIWSVSSFRPHWGPDKLRDNNALTYWQSDCPNPQLNHTIDLSFHQATLIRQVS 171

Query: 105 LWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG 164
           ++++Y  DESYTP  I +R GT   DLQ+L  VE +E + WV+I ++          P  
Sbjct: 172 VFIDYFQDESYTPKTIMVRGGTTYRDLQELDRVECEEFVGWVNIDIAS----KNDGNPFR 227

Query: 165 AHLFQIAIKANHQNGKDTHIRQIKVFA 191
               QIAI   H NG+DTHIRQ+KV++
Sbjct: 228 VFRLQIAILNTHLNGRDTHIRQVKVYS 254



>gi|398408289|ref|XP_003855610.1| hypothetical protein MYCGRDRAFT_28674, partial [Zymoseptoria
           tritici IPO323]
 gi|339475494|gb|EGP90586.1| hypothetical protein MYCGRDRAFT_28674 [Zymoseptoria tritici IPO323]
          Length = 137

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 90/143 (62%), Gaps = 7/143 (4%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI S A W++S+ K GNGV  LR  +   +WQSDG  PHL++I F + V++V + ++L
Sbjct: 2   LKEISSLASWTVSTAKPGNGVAALRSPDTSMFWQSDGPQPHLLSIHFFKLVSIVHMRIFL 61

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +++SDESYTP KI   AG    D+Q+   +  ++P  W+D+  S   +L        A L
Sbjct: 62  DFQSDESYTPTKIQFLAGMGVHDIQEFAEMSFEQPTGWIDVDWSRRPVLR-------AFL 114

Query: 168 FQIAIKANHQNGKDTHIRQIKVF 190
            Q+ I  NHQNGKDTH+R +++F
Sbjct: 115 VQVRILENHQNGKDTHLRAVQLF 137



>gi|310795688|gb|EFQ31149.1| anaphase-promoting complex [Glomerella graminicola M1.001]
          Length = 224

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 92/148 (62%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV++LR+D+  TYWQSDG  PH + + F ++V +  I  ++
Sbjct: 61  LKEISNLGKFTVSSHKQGNGVEQLRNDSLKTYWQSDGPQPHKLTVYFIKRVGIRDIRFFV 120

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--- 164
           ++  DESYTP KI  ++GT   +L    T+E+ +P  W  +      I+     P G   
Sbjct: 121 DFNEDESYTPTKIIFKSGTSENNLVQFATMEMSQPSGWQQV-----PIVGAGGGPDGNTL 175

Query: 165 -AHLFQIAIKANHQNGKDTHIRQIKVFA 191
            +++FQ+ I  NHQNGKDTH+R IK++A
Sbjct: 176 VSYVFQMQILENHQNGKDTHLRSIKIYA 203



>gi|302412997|ref|XP_003004331.1| anaphase-promoting complex subunit 10 [Verticillium albo-atrum
           VaMs.102]
 gi|261356907|gb|EEY19335.1| anaphase-promoting complex subunit 10 [Verticillium albo-atrum
           VaMs.102]
          Length = 385

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 90/144 (62%), Gaps = 1/144 (0%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGVD++R D+   YWQSDG  PH + + F ++V +  I  ++
Sbjct: 168 LKEISNLGKFTVSSHKPGNGVDEMRSDDTDEYWQSDGPQPHRMTVYFVKRVGIRDIRFYV 227

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y++DESYTP KI  ++GT   +L +   +EL  P  W  + ++G          +  ++
Sbjct: 228 DYQADESYTPTKILFKSGTSENNLIEFAVMELTTPSGWQQVPIAG-TGGGPDGNTLACYV 286

Query: 168 FQIAIKANHQNGKDTHIRQIKVFA 191
           FQ+ I  NHQNGKDTH+R IK++A
Sbjct: 287 FQMQILENHQNGKDTHLRGIKIYA 310



>gi|477536047|gb|ENH87532.1| anaphase promoting complex subunit 10 [Colletotrichum orbiculare
           MAFF 240422]
          Length = 366

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 91/148 (61%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGVD+LR+D+  TYWQSDG  PH + + F ++V +  I  ++
Sbjct: 163 LKEISNLGKFTVSSHKQGNGVDQLRNDSLKTYWQSDGPQPHKLTVYFIKRVGIRDIRFYV 222

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--- 164
           ++  DESYTP KI  ++GT    L     +EL  P+ W  + ++G         P G   
Sbjct: 223 DFNEDESYTPTKIVFKSGTSENHLIQFAQMELRTPVGWQQVPVAG-----AGGGPDGNTL 277

Query: 165 -AHLFQIAIKANHQNGKDTHIRQIKVFA 191
            +++FQ+ I  NHQNGKDTH+R IK++A
Sbjct: 278 VSYVFQMQILENHQNGKDTHLRSIKIYA 305



>gi|260940176|ref|XP_002614388.1| hypothetical protein CLUG_05874 [Clavispora lusitaniae ATCC 42720]
 gi|238852282|gb|EEQ41746.1| hypothetical protein CLUG_05874 [Clavispora lusitaniae ATCC 42720]
          Length = 322

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 89/156 (57%), Gaps = 21/156 (13%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTL-----------------PHLVNIQFPQK 97
           A W LSS K G G+D+LRDD   TYWQSDG+                  PH V +QF +K
Sbjct: 78  ATWKLSSCKQGYGLDQLRDDTPSTYWQSDGSTENTIEQQANAENAQLNHPHTVTLQFSKK 137

Query: 98  VNVVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILS 157
           V++ +IS++ NY+ DESYTP++I I AG  N DL ++  V  D+P+ W  I   G     
Sbjct: 138 VSLERISIFTNYQLDESYTPSRIKIMAGNSNWDLTEVCVVTFDKPIGWSHIIFKG----V 193

Query: 158 KTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPK 193
           +    +   + +I + ANHQ+GKD+HIR I+ F  K
Sbjct: 194 RADGLLKCFVVKIVVLANHQDGKDSHIRAIRCFGKK 229



>gi|71995011|ref|NP_001021777.1| Protein Y48G1C.12 [Caenorhabditis elegans]
 gi|373220040|emb|CCD71733.1| Protein Y48G1C.12 [Caenorhabditis elegans]
          Length = 216

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 5/150 (3%)

Query: 44  KHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQI 103
           K   L +I S AIW+LSS K G G+D+L  D+   YWQSDG  PH + ++F +K +V  +
Sbjct: 26  KDTPLLDISSQAIWALSSCKSGFGIDELLSDSVEKYWQSDGPQPHTILLEFQKKTDVAMM 85

Query: 104 SLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPV 163
             +L++K+DESYTP+KI ++ G+ + D+   +T   +EP  W  I L       K  +P 
Sbjct: 86  MFYLDFKNDESYTPSKIQVKMGSSHQDIFFRQTQTFNEPQGWTFIDLR-----DKNGKPN 140

Query: 164 GAHLFQIAIKANHQNGKDTHIRQIKVFAPK 193
                Q+ +  NHQNG+DTHIR ++V  P+
Sbjct: 141 RVFWLQVQVIQNHQNGRDTHIRHVRVLGPQ 170



>gi|429863828|gb|ELA38235.1| anaphase promoting complex subunit 10 [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 260

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 91/148 (61%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGVD+LR D+  +YWQSDG  PH + + F ++V +  I  ++
Sbjct: 59  LKEISNLGKFTVSSHKQGNGVDQLRHDSLKSYWQSDGPQPHKLTVYFIKRVGIRDIRFYV 118

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--- 164
           +Y  DESYTP KI  ++GT   +L    T++L  P  W  + ++G         P G   
Sbjct: 119 DYNEDESYTPTKIIFKSGTSENNLIQFATMDLSAPSGWQLVPIAG-----SGGGPDGNTL 173

Query: 165 -AHLFQIAIKANHQNGKDTHIRQIKVFA 191
            +++FQ+ I  NHQNGKDTH+R IK++A
Sbjct: 174 VSYVFQMQILENHQNGKDTHLRSIKIYA 201



>gi|452845284|gb|EME47217.1| hypothetical protein DOTSEDRAFT_145664 [Dothistroma septosporum
           NZE10]
          Length = 282

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 101/180 (56%), Gaps = 24/180 (13%)

Query: 41  SEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNV 100
           + F    L+EI S A W++S+ K GNGV  LR  +   +WQSDG  PHL++I F + V++
Sbjct: 64  TPFPPPGLKEISSLASWTVSTAKPGNGVAALRSPDTSHFWQSDGPQPHLLSIHFFKLVSI 123

Query: 101 VQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS--------- 151
           V I ++L++ +DESYTP K+   AG    D+Q+   +  ++P  W+D+  S         
Sbjct: 124 VHIRIYLDFAADESYTPTKVQFLAGMGIHDIQEFAEMSFEQPTGWIDVDFSNVGPIEDDD 183

Query: 152 --GDEILSK----TSRPV-GAHLFQIAIKANHQNGKDTHIRQIKVFA--------PKLPL 196
             G+    K    + RPV  A L Q+ I  NHQNGKDTH+R +++FA        P +PL
Sbjct: 184 ADGNSNSPKEIDWSKRPVLRAFLVQVRILENHQNGKDTHLRAVQLFARDETQQTRPAVPL 243



>gi|452986531|gb|EME86287.1| hypothetical protein MYCFIDRAFT_23413, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 158

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 94/157 (59%), Gaps = 14/157 (8%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI S A W++S+ K GNGV  LR  +  T+WQSDG  PHL++I F + V++V + ++L
Sbjct: 2   LKEISSLASWTVSTAKPGNGVAALRSPDTTTFWQSDGPQPHLLSIHFFKLVSIVHMRIYL 61

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSK--------- 158
           ++ SDESYTP KI   AG    D+Q+   +  ++P  W+D+  S    + +         
Sbjct: 62  DFISDESYTPTKIQFLAGMGVHDIQEFAEMSFEQPTGWIDVDFSNVGPIQEDDDDDDGSR 121

Query: 159 ----TSRPV-GAHLFQIAIKANHQNGKDTHIRQIKVF 190
               + RPV  A L Q+ I  NHQNGKDTH+R +++F
Sbjct: 122 DIDWSKRPVLRAFLVQVRILENHQNGKDTHLRAVQLF 158



>gi|341890478|gb|EGT46413.1| hypothetical protein CAEBREN_06735 [Caenorhabditis brenneri]
          Length = 216

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 88/150 (58%), Gaps = 5/150 (3%)

Query: 44  KHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQI 103
           K   L +I S A+W+LSS K+G GVD+L  DN   YWQSDG  PH + ++F +K +V  +
Sbjct: 26  KDRPLLDISSQAVWALSSCKNGYGVDELLSDNVEKYWQSDGPQPHTILLEFQKKTDVAMM 85

Query: 104 SLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPV 163
             + ++K+DESYTP+KI I+ G+ + D+    T    EP  W  I L       K  +P 
Sbjct: 86  MFYFDFKNDESYTPSKIQIKMGSSHQDIFFRTTQSFQEPQGWQFIDLR-----DKWRKPN 140

Query: 164 GAHLFQIAIKANHQNGKDTHIRQIKVFAPK 193
                QI I  NHQNG+DTH+R ++V  P+
Sbjct: 141 RVFWIQIQIMQNHQNGRDTHVRHVRVLGPQ 170



>gi|392572960|gb|EIW66103.1| hypothetical protein TREMEDRAFT_70338 [Tremella mesenterica DSM
           1558]
          Length = 174

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 92/146 (63%), Gaps = 4/146 (2%)

Query: 50  EIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNY 109
           E+G  A WS+SS K+G GV+ L+D N  T+WQS+G  PH +++ FP++V +  I+L  ++
Sbjct: 25  ELGHLATWSVSSHKYGFGVENLQDGNENTFWQSEGPQPHTIDLAFPKRVFISSIALHTSH 84

Query: 110 KSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQL----SGDEILSKTSRPVGA 165
             D+SYTP+K++IRAGT   DLQ++   E  +P  W+ I L    S  E       P+  
Sbjct: 85  PRDDSYTPSKLSIRAGTGLHDLQEVMFKEFFKPDGWLLIPLRPHDSSPEGQMIEGPPIPC 144

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFA 191
           H  +I + ANH NGKDTH+R +K+F 
Sbjct: 145 HHLRILVLANHLNGKDTHVRGLKIFG 170



>gi|400600133|gb|EJP67824.1| anaphase-promoting complex subunit 10 [Beauveria bassiana ARSEF
           2860]
          Length = 530

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 91/148 (61%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K G+GV +LR D+   YWQSDG  PH + + F ++V +  I  ++
Sbjct: 314 LKEISNLGKFTVSSHKPGHGVQELRSDDLKLYWQSDGPQPHKLTVYFVKRVGIRVIRFFV 373

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--- 164
           +Y+ DESYTP KI  R+GT   ++ +  T+ +D P  W D+ +SG         P G   
Sbjct: 374 DYQEDESYTPTKILFRSGTSENNMIEFATMTMDNPYGWQDVPISG-----AGGEPDGNTL 428

Query: 165 -AHLFQIAIKANHQNGKDTHIRQIKVFA 191
            +++ Q+ I  NHQNGKDTH+R IK++A
Sbjct: 429 VSYVLQMQILENHQNGKDTHLRGIKIYA 456



>gi|148678931|gb|EDL10878.1| anaphase promoting complex subunit 10, isoform CRA_b [Mus musculus]
          Length = 111

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 71/90 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTV 137
           +YKSDESYTP+KI++R G +  +LQ++R V
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRAV 111



>gi|90085633|dbj|BAE91557.1| unnamed protein product [Macaca fascicularis]
          Length = 119

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/89 (61%), Positives = 71/89 (79%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRT 136
           +YKSDESYTP+KI++R G +  +LQ++RT
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRT 110



>gi|346972477|gb|EGY15929.1| anaphase-promoting complex subunit 10 [Verticillium dahliae
           VdLs.17]
          Length = 385

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 90/144 (62%), Gaps = 1/144 (0%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV+++R D+   YWQSDG  PH + + F ++V +  I  ++
Sbjct: 168 LKEISNLGKFTVSSHKPGNGVEEMRSDDTDEYWQSDGPQPHRMTVYFVKRVGIRDIRFYV 227

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y++DESYTP KI  ++GT   +L +   +EL  P  W  + ++G          +  ++
Sbjct: 228 DYQADESYTPTKILFKSGTSENNLIEFAVMELTTPSGWQQVPIAG-TGGGPDGNTLACYV 286

Query: 168 FQIAIKANHQNGKDTHIRQIKVFA 191
           FQ+ I  NHQNGKDTH+R IK++A
Sbjct: 287 FQMQILENHQNGKDTHLRGIKIYA 310



>gi|410038762|ref|XP_003950471.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
          Length = 126

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 78/105 (74%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSG 152
           +YKSDESYTP+KI++R G +  +LQ++R   L      +++Q+SG
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRPHVLHVNEESMNLQVSG 126



>gi|426345599|ref|XP_004040493.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 8 [Gorilla
           gorilla gorilla]
          Length = 126

 Score =  119 bits (299), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 78/105 (74%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSG 152
           +YKSDESYTP+KI++R G +  +LQ++R   L      +++Q+SG
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRPHVLHVNGESMNLQVSG 126



>gi|346318881|gb|EGX88483.1| anaphase promoting complex subunit 10 [Cordyceps militaris CM01]
          Length = 549

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 90/148 (60%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV +LR D+   YWQSDG  PH + + F ++V +  I  ++
Sbjct: 339 LKEISNLGKFTVSSHKPGNGVHELRSDDLKLYWQSDGPQPHKLTVYFIKRVGIRVIRFFV 398

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--- 164
           +Y+ DESYTP KI  R+GT   ++    T+ ++ P  W D+ +SG         P G   
Sbjct: 399 DYQEDESYTPTKIVFRSGTSENNMIPFATMTMENPYGWQDVPISG-----AGGEPDGNTL 453

Query: 165 -AHLFQIAIKANHQNGKDTHIRQIKVFA 191
            +++ Q+ I  NHQNGKDTH+R IK++A
Sbjct: 454 VSYVLQMEILENHQNGKDTHLRGIKIYA 481



>gi|302899183|ref|XP_003047998.1| hypothetical protein NECHADRAFT_93339 [Nectria haematococca mpVI
           77-13-4]
 gi|256728930|gb|EEU42285.1| hypothetical protein NECHADRAFT_93339 [Nectria haematococca mpVI
           77-13-4]
          Length = 508

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 92/148 (62%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI + A +++SS K GNGV++L+ D+   YWQSDG  PH + + F ++V++  I  ++
Sbjct: 298 LKEISNLARFTVSSHKPGNGVEELKSDDLKMYWQSDGPQPHKLTMYFTRRVDIRDIRFYV 357

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--- 164
           +Y  DESYTP K+  +AGT   +L +  T+ LD P+ W  + ++G         P G   
Sbjct: 358 DYNEDESYTPTKVVFKAGTGENNLIEFATMALDNPVGWQQVPVAG-----AGGDPDGNTL 412

Query: 165 -AHLFQIAIKANHQNGKDTHIRQIKVFA 191
            A + Q+ I  NHQNGKDTH+R IK+++
Sbjct: 413 VAWVLQMQILENHQNGKDTHLRGIKIYS 440



>gi|219125124|ref|XP_002182838.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405632|gb|EEC45574.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 148

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 95/152 (62%), Gaps = 14/152 (9%)

Query: 50  EIGSSAI-WSLSSWKHGNGVDKLRDDNFLTYWQSDGTL-PHLVNIQFPQKVNVVQISLWL 107
           EIG  A+ W LSS K GNGV+++RD +  TYWQSDGT  PH + + F ++V +  + L+L
Sbjct: 1   EIGREALCWQLSSAKPGNGVEQIRDKSVTTYWQSDGTAQPHWIQVHFGRRVAISHVCLYL 60

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDL-----RTVELDEPLRWVDIQLSGDEILSKTSRP 162
           ++  DESYTP +ITI AG    DL         ++E+ EP+ W        ++    SR 
Sbjct: 61  DFSLDESYTPKRITIEAGMTTQDLSFATYPVNTSIEVHEPVGW------SRQLDPYNSRK 114

Query: 163 -VGAHLFQIAIKANHQNGKDTHIRQIKVFAPK 193
            V AHL +I+I + HQNG+DTH+RQ++++ P+
Sbjct: 115 LVRAHLIRISIISMHQNGRDTHVRQVQLYGPR 146



>gi|358377857|gb|EHK15540.1| hypothetical protein TRIVIDRAFT_232648 [Trichoderma virens Gv29-8]
          Length = 404

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 87/148 (58%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV++LR D+  +YWQSDG  PH + I F ++V +  I  ++
Sbjct: 194 LKEISNLGKFTVSSHKPGNGVEQLRSDDLTSYWQSDGPQPHKLTIYFVKRVGIRDIRFYV 253

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           NY  DESYTP KI  ++GT   +L     + L  P+ W  + L+G         P G  L
Sbjct: 254 NYNEDESYTPTKIIFKSGTSENNLIQFAAMNLASPVGWQQVPLAG-----VGGEPDGNTL 308

Query: 168 ----FQIAIKANHQNGKDTHIRQIKVFA 191
                Q+ I  NHQNGKDTH+R IK++A
Sbjct: 309 VSWVLQMQILENHQNGKDTHLRGIKIYA 336



>gi|471574616|gb|EMR72421.1| putative anaphase-promoting complex subunit 10 protein [Eutypa lata
           UCREL1]
          Length = 289

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 88/144 (61%), Gaps = 1/144 (0%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI + A +++SS+K G GV +LRDD+   +WQSDG  PH +NI F ++V +  + L+L
Sbjct: 71  LKEISNLASFTVSSYKPGCGVKELRDDDVNQFWQSDGPQPHRLNIHFIKRVEIRALRLYL 130

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y+ DESYTP KI I AG          T+EL  P  W+D+ ++G          +    
Sbjct: 131 DYELDESYTPTKIQITAGFGPNQTIPFTTMELSMPKGWIDVPIAG-AGGGPDENSLCCWF 189

Query: 168 FQIAIKANHQNGKDTHIRQIKVFA 191
            ++ +  NHQNGKDTHIR +KV+A
Sbjct: 190 VRVIVLENHQNGKDTHIRGVKVYA 213



>gi|322698580|gb|EFY90349.1| putative anaphase promoting complex subunit 10 [Metarhizium acridum
           CQMa 102]
          Length = 428

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 91/148 (61%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV++LR D+   YWQSDG  PH + + F ++V +  I  ++
Sbjct: 223 LKEISNLGRFTVSSHKPGNGVEELRSDDLKLYWQSDGPQPHKLTVYFVKRVGIRDIRFFV 282

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--- 164
           +Y  DESYTP KI  ++GT   +L +  T+ ++ P+ W  + ++G         P G   
Sbjct: 283 DYSEDESYTPTKIVFKSGTSENNLIEFATMAMESPVGWQQVPIAG-----AGGDPDGNTL 337

Query: 165 -AHLFQIAIKANHQNGKDTHIRQIKVFA 191
            +++ Q+ I  NHQNGKDTH+R IK++A
Sbjct: 338 VSYVLQMQILENHQNGKDTHLRGIKIYA 365



>gi|322709787|gb|EFZ01362.1| putative anaphase promoting complex subunit 10 [Metarhizium
           anisopliae ARSEF 23]
          Length = 427

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 91/148 (61%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV++LR D+   YWQSDG  PH + + F ++V +  I  ++
Sbjct: 223 LKEISNLGRFTVSSHKPGNGVEELRSDDLKLYWQSDGPQPHKLTVYFVKRVGIRDIRFFV 282

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVG--- 164
           +Y  DESYTP KI  ++GT   +L +  T+ ++ P+ W  + ++G         P G   
Sbjct: 283 DYSEDESYTPTKIIFKSGTSENNLIEFATMAMESPVGWQQVPIAG-----AGGDPDGNTL 337

Query: 165 -AHLFQIAIKANHQNGKDTHIRQIKVFA 191
            +++ Q+ I  NHQNGKDTH+R IK++A
Sbjct: 338 VSYVLQMQILENHQNGKDTHLRGIKIYA 365



>gi|375493587|ref|NP_001243639.1| anaphase-promoting complex subunit 10 isoform 3 [Homo sapiens]
 gi|375493589|ref|NP_001243640.1| anaphase-promoting complex subunit 10 isoform 3 [Homo sapiens]
          Length = 114

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 71/90 (78%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTV 137
           +YKSDESYTP+KI++R G +  +LQ++R +
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRAL 111



>gi|342185082|emb|CCC94564.1| putative anaphase promoting complex, subunit 10-like protein
           [Trypanosoma congolense IL3000]
          Length = 231

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 98/174 (56%), Gaps = 27/174 (15%)

Query: 55  AIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWLNYKSDES 114
           A+WS+SS KHGNGV  L D +  T+WQSDG +PH+++I F +  +V  ++++L++  D S
Sbjct: 50  AVWSVSSAKHGNGVMCLLDGSHDTFWQSDGVVPHVISIDFARLTSVAVVAIYLDFAEDNS 109

Query: 115 YTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS--GDEILSKTSRPV-GAHL---- 167
           YTP K+ ++AGTHNGD+ D  TV +D+P  WV IQ++   + + S  +R V G H     
Sbjct: 110 YTPRKMRVQAGTHNGDMADAVTVVVDDPQGWVLIQMAPETETLNSWGARDVNGEHCGDDA 169

Query: 168 -------------------FQIAIKANHQNGKDTHIRQIKVFA-PKLPLFYEDY 201
                               +I ++ N Q G+D H+R ++V    K  LF   Y
Sbjct: 170 VLDHADYAEFIEDGVWCTRLRIIVEENRQEGRDCHVRGLRVLGHIKQSLFTTAY 223



>gi|410038764|ref|XP_003950472.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
 gi|426345601|ref|XP_004040494.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 9 [Gorilla
           gorilla gorilla]
 gi|441619206|ref|XP_004088558.1| PREDICTED: anaphase-promoting complex subunit 10 [Nomascus
           leucogenys]
          Length = 110

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (79%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLR 135
           +YKSDESYTP+KI++R G +  +LQ++R
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIR 109



>gi|426345597|ref|XP_004040492.1| PREDICTED: anaphase-promoting complex subunit 10 isoform 7 [Gorilla
           gorilla gorilla]
          Length = 142

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 70/92 (76%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVEL 139
           +YKSDESYTP+KI++R G +  +LQ++R    
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRVAAF 113



>gi|336273512|ref|XP_003351510.1| DOC1 protein [Sordaria macrospora k-hell]
 gi|380095789|emb|CCC05835.1| putative DOC1 protein [Sordaria macrospora k-hell]
          Length = 417

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 87/148 (58%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           LREI + A + +SS K GNGV++L  ++   YWQSDG  PHL+ I F ++V +  I  ++
Sbjct: 181 LREINNLAHFGVSSHKPGNGVEELLAEDLDKYWQSDGQQPHLLTIHFLRRVEIRAIRFYV 240

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y  DESYTP  I   AGT + DL +   V+L  P+ W D+      I +    P G  L
Sbjct: 241 DYNQDESYTPTNIVWHAGTGHHDLIEFADVKLTNPVGWQDVP-----IANCGGAPDGHSL 295

Query: 168 F----QIAIKANHQNGKDTHIRQIKVFA 191
                Q  IK NHQNGKDTHIR IK+FA
Sbjct: 296 CCWIVQAHIKENHQNGKDTHIRGIKIFA 323



>gi|410038760|ref|XP_003950470.1| PREDICTED: anaphase-promoting complex subunit 10 [Pan troglodytes]
          Length = 142

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (77%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           +REIGS A+WSLSS K G GVD+LRDDN  TYWQSDG+ PHLVNIQF +K  V  + ++ 
Sbjct: 22  VREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYA 81

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTV 137
           +YKSDESYTP+KI++R G +  +LQ++R  
Sbjct: 82  DYKSDESYTPSKISVRVGNNFHNLQEIRVA 111



>gi|344304948|gb|EGW35180.1| hypothetical protein SPAPADRAFT_146140 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 332

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 97/158 (61%), Gaps = 10/158 (6%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGT-----LPHLVNIQFPQ 96
           E +  +L ++   A W LSS+K G G+ +LRDD+  TYWQSDG+     L H + IQF +
Sbjct: 90  ELESLQLFDLSPLANWKLSSYKPGFGLVQLRDDSPDTYWQSDGSNQGNNLQHSITIQFSK 149

Query: 97  KVNVVQISLWLNYKSDESYTPNKITIRAGTHNG-DLQDLRTVELDEPLRWVDIQLSGDEI 155
           KV + +IS++ NY  DESYTP+KI I AG+ +G D+ D+ TV  ++P+ W  I  +G   
Sbjct: 150 KVALERISIFTNYSLDESYTPSKIKIMAGSCDGWDMIDVCTVNFNQPIGWSHIIFNG--- 206

Query: 156 LSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPK 193
             +    +   + ++ + ANHQ GKD+HIR I+ F  K
Sbjct: 207 -IRNDGVLKCFMVKLIVLANHQEGKDSHIRAIRCFGKK 243



>gi|358391944|gb|EHK41348.1| hypothetical protein TRIATDRAFT_228021 [Trichoderma atroviride IMI
           206040]
          Length = 252

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/148 (39%), Positives = 88/148 (59%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EI +   +++SS K GNGV++LR+D   +YWQSDG  PH + I F ++V +  I  ++
Sbjct: 50  LKEISNLGKFTVSSHKPGNGVEQLRNDELTSYWQSDGPQPHKLTIYFVKRVGIRDIRFYV 109

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y  DESYTP KI  ++GT   +L     + ++ P+ W  + L+G         P G  L
Sbjct: 110 DYNEDESYTPTKIIFKSGTSENNLIQFAAMNMESPVGWQQVPLTG-----VGGEPDGNTL 164

Query: 168 ----FQIAIKANHQNGKDTHIRQIKVFA 191
                Q+ I  NHQNGKDTH+R IK++A
Sbjct: 165 VSWVLQMQILENHQNGKDTHLRGIKIYA 192



>gi|156043912|ref|XP_001588512.1| hypothetical protein SS1G_10059 [Sclerotinia sclerotiorum 1980]
 gi|154694448|gb|EDN94186.1| hypothetical protein SS1G_10059 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 341

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 89/146 (60%), Gaps = 5/146 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EIG+ A W++SS K G GV  LRDD+   +WQSDG  PH +NI F +   +  I ++L
Sbjct: 120 LKEIGNLASWTVSSSKPGCGVLALRDDDTNLFWQSDGPQPHYLNIHFAKFAKIRAIRIFL 179

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS--GDEILSKTSRPVGA 165
           ++++DESYTP +I +  GT   DL     +   +P  W+D+ L   G     KT R   A
Sbjct: 180 DFEADESYTPTRIQLLGGTGYHDLIPFSELSFVQPKGWIDVNLDHVGGGSDGKTLR---A 236

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFA 191
            + Q+ +  NHQNGKDTH+R +K+++
Sbjct: 237 FIIQVKVLENHQNGKDTHVRGLKIYS 262



>gi|126649289|ref|XP_001388316.1| anaphase promoting complex subunit 10 [Cryptosporidium parvum Iowa
           II]
 gi|126117410|gb|EAZ51510.1| anaphase promoting complex subunit 10, putative [Cryptosporidium
           parvum Iowa II]
          Length = 132

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/108 (53%), Positives = 74/108 (68%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L EIG  A WSLSS K GNG+ +LRD+N  T+WQSDG  PH + ++FP+K  V  I L+L
Sbjct: 16  LIEIGDLASWSLSSAKPGNGIQQLRDNNSSTFWQSDGQSPHTITLRFPKKTKVSVIDLYL 75

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEI 155
            YK DESYTP  I+IR+G    DL++L+ ++L EP  WV I LS  EI
Sbjct: 76  AYKIDESYTPQIISIRSGNQESDLEELKEMQLTEPDGWVRIPLSPREI 123



>gi|472238448|gb|EMR83315.1| putative anaphase-promoting complex subunit 10 protein [Botryotinia
           fuckeliana BcDW1]
          Length = 333

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 89/146 (60%), Gaps = 5/146 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EIG+ A W++SS K G GV  LRDD+   +WQSDG  PH +NI F +   +  I ++L
Sbjct: 112 LKEIGNLASWTVSSSKPGCGVLALRDDDTNLFWQSDGPQPHYLNIHFAKFAKIRAIRIFL 171

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS--GDEILSKTSRPVGA 165
           ++++DESYTP +I +  GT   DL     +   +P  W+D+ L   G     KT R   A
Sbjct: 172 DFEADESYTPTRIQLLGGTGYHDLIPFSELSFVQPKGWIDVNLDHVGGGSDGKTLR---A 228

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFA 191
            + Q+ +  NHQNGKDTH+R +K+++
Sbjct: 229 FIIQVKVLENHQNGKDTHVRGLKIYS 254



>gi|449018510|dbj|BAM81912.1| similar to anaphase-promoting complex subunit 10 [Cyanidioschyzon
           merolae strain 10D]
          Length = 391

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 76/111 (68%)

Query: 40  KSEFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVN 99
           KSE + E LRE+G  A+WS+SS K GNG++ +RD N  T++Q+DG  PH ++IQF QK  
Sbjct: 127 KSETQLEALRELGDEAVWSVSSAKQGNGIELMRDGNVQTFFQTDGAQPHKISIQFRQKTK 186

Query: 100 VVQISLWLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQL 150
           V QI ++LNY+ DESYTPN+I +  GT   DL++    +L EP  W+ I L
Sbjct: 187 VSQIRMFLNYQLDESYTPNRIGVWTGTDFHDLRETVFCQLHEPRGWITIPL 237



>gi|154296826|ref|XP_001548842.1| hypothetical protein BC1G_12502 [Botryotinia fuckeliana B05.10]
 gi|347827876|emb|CCD43573.1| hypothetical protein BofuT4_P012490.1 [Botryotinia fuckeliana T4]
          Length = 333

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 89/146 (60%), Gaps = 5/146 (3%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           L+EIG+ A W++SS K G GV  LRDD+   +WQSDG  PH +NI F +   +  I ++L
Sbjct: 112 LKEIGNLASWTVSSSKPGCGVLALRDDDTNLFWQSDGPQPHYLNIHFAKFAKIRAIRIFL 171

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLS--GDEILSKTSRPVGA 165
           ++++DESYTP +I +  GT   DL     +   +P  W+D+ L   G     KT R   A
Sbjct: 172 DFEADESYTPTRIQLLGGTGYHDLIPFSELSFVQPKGWIDVNLDHVGGGSDGKTLR---A 228

Query: 166 HLFQIAIKANHQNGKDTHIRQIKVFA 191
            + Q+ +  NHQNGKDTH+R +K+++
Sbjct: 229 FIIQVKVLENHQNGKDTHVRGLKIYS 254



>gi|402585479|gb|EJW79419.1| hypothetical protein WUBG_09670 [Wuchereria bancrofti]
          Length = 177

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 87/140 (62%), Gaps = 6/140 (4%)

Query: 47  ELREIGSSAIWSLSSWK-HGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISL 105
           ++R+I + A W+LSS K  G G+ +L DD+   YWQSDG  PH V I+F +K N+  + L
Sbjct: 34  DVRDISNQAFWTLSSCKTDGFGIQQLLDDDLEQYWQSDGPQPHTVTIEFSKKTNISYLLL 93

Query: 106 WLNYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGA 165
           +L+YK+DESYTP+K+ +R G+   D+ +  TV   EP+ W  I L   +       P  A
Sbjct: 94  YLDYKTDESYTPSKVVVRLGSSVLDVDEGLTVVFSEPVGWQVIDLRDAD-----GGPSRA 148

Query: 166 HLFQIAIKANHQNGKDTHIR 185
            + Q+ +  NHQNG+DTHIR
Sbjct: 149 FVLQLQVVQNHQNGRDTHIR 168



>gi|336468027|gb|EGO56190.1| hypothetical protein NEUTE1DRAFT_44798 [Neurospora tetrasperma FGSC
           2508]
 gi|350289730|gb|EGZ70955.1| galactose-binding like protein [Neurospora tetrasperma FGSC 2509]
          Length = 419

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 87/148 (58%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           LREI + A + +SS K GNGV++L  ++   YWQSDG  PHL+ I F ++V +  I  ++
Sbjct: 184 LREINNLAHFGVSSHKPGNGVEELLTEDLDKYWQSDGQQPHLLTIHFLRRVEIRAIRFYV 243

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y  DESYTP  I   AGT + DL +   V+L  P+ W D+      I +    P G  L
Sbjct: 244 DYNLDESYTPTNIVWYAGTGHHDLIEFADVKLTNPVGWQDVP-----IANCGGGPDGHSL 298

Query: 168 F----QIAIKANHQNGKDTHIRQIKVFA 191
                Q  IK NHQNGKDTHIR IK+FA
Sbjct: 299 CCWIVQAHIKENHQNGKDTHIRGIKIFA 326



>gi|465794490|emb|CCU99278.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 254

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 84/160 (52%), Gaps = 21/160 (13%)

Query: 57  WSLSSWKHGNGVDKLRDDNFLTYWQ--------SDGTLPHLVNIQFPQKVNVVQISLWLN 108
           W LSS K  NGV +L+ D+  T WQ        SDG+ PH V I FP++  V  IS++L+
Sbjct: 15  WMLSSAKAQNGVQQLQSDDLDTLWQCVWLADRRSDGSQPHSVYIHFPRRTAVTHISIYLD 74

Query: 109 YKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTS-------- 160
              D+SYTP KI +RAGTH  DL D+R  E  EP  W    LSG   +            
Sbjct: 75  CLRDDSYTPTKILVRAGTHPYDLVDVRYREFVEPQGWYHFMLSGTSDMEPEEAQAARASS 134

Query: 161 -----RPVGAHLFQIAIKANHQNGKDTHIRQIKVFAPKLP 195
                R +   + Q+ I  NH NGKD+HIR +KVF P  P
Sbjct: 135 ASMPLRAIELFVLQVNILGNHLNGKDSHIRCMKVFGPTPP 174



>gi|12718366|emb|CAC28560.1| related to anaphase promoting complex subunit 10 [Neurospora
           crassa]
          Length = 419

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 87/148 (58%), Gaps = 9/148 (6%)

Query: 48  LREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTLPHLVNIQFPQKVNVVQISLWL 107
           LREI + A + +SS K GNGV++L  ++   YWQSDG  PHL+ I F ++V +  I  ++
Sbjct: 184 LREINNLAHFGVSSHKPGNGVEELLTEDLDKYWQSDGQQPHLLTIHFLRRVEIRAIRFYV 243

Query: 108 NYKSDESYTPNKITIRAGTHNGDLQDLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHL 167
           +Y  DESYTP  I   AGT + DL +   V+L  P+ W D+      I +    P G  L
Sbjct: 244 DYNLDESYTPTNIVWYAGTGHHDLIEFADVKLTNPVGWQDVP-----IANCGGGPDGHSL 298

Query: 168 F----QIAIKANHQNGKDTHIRQIKVFA 191
                Q  IK NHQNGKDTHIR IK+FA
Sbjct: 299 CCWIVQAHIKENHQNGKDTHIRGIKIFA 326



>gi|238878786|gb|EEQ42424.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 479

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 96/181 (53%), Gaps = 33/181 (18%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTL--------------- 86
           E +  +L ++   A W LSSWK G G+ +LRDD+  +YWQSDG+                
Sbjct: 176 ELEELQLFDLSPLATWKLSSWKQGFGLKQLRDDSPDSYWQSDGSNTGNSGNDDNNSNQSQ 235

Query: 87  -------------PHLVNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNG-DLQ 132
                        PH + IQF +KV + +IS++ NY  DESYTP++I I AG+  G DL 
Sbjct: 236 NPNNSMLLNQLSNPHSITIQFSKKVALERISIFTNYSLDESYTPSRIKIMAGSSEGWDLI 295

Query: 133 DLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
           ++ TV  D+P+ W  I  +G     +    +   L +I I ANHQ GKD+HIR I+ F  
Sbjct: 296 EVCTVNFDQPVGWSHIIFNG----IRADGVLKCFLIKIIILANHQEGKDSHIRAIRCFGK 351

Query: 193 K 193
           K
Sbjct: 352 K 352



>gi|68476752|ref|XP_717521.1| potential anaphase-promoting complex processivity factor Apc10
           [Candida albicans SC5314]
 gi|46439235|gb|EAK98555.1| potential anaphase-promoting complex processivity factor Apc10
           [Candida albicans SC5314]
          Length = 479

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 96/181 (53%), Gaps = 33/181 (18%)

Query: 42  EFKHEELREIGSSAIWSLSSWKHGNGVDKLRDDNFLTYWQSDGTL--------------- 86
           E +  +L ++   A W LSSWK G G+ +LRDD+  +YWQSDG+                
Sbjct: 176 ELEELQLFDLSPLATWKLSSWKQGFGLKQLRDDSPDSYWQSDGSNTGNSGNDDNNSNQSQ 235

Query: 87  -------------PHLVNIQFPQKVNVVQISLWLNYKSDESYTPNKITIRAGTHNG-DLQ 132
                        PH + IQF +KV + +IS++ NY  DESYTP++I I AG+  G DL 
Sbjct: 236 NPNNSMLLNQLSNPHSITIQFSKKVALERISIFTNYSLDESYTPSRIKIMAGSSEGWDLI 295

Query: 133 DLRTVELDEPLRWVDIQLSGDEILSKTSRPVGAHLFQIAIKANHQNGKDTHIRQIKVFAP 192
           ++ TV  D+P+ W  I  +G     +    +   L +I I ANHQ GKD+HIR I+ F  
Sbjct: 296 EVCTVNFDQPVGWSHIIFNG----IRADGVLKCFLIKIIILANHQEGKDSHIRAIRCFGK 351

Query: 193 K 193
           K
Sbjct: 352 K 352