BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10402_c0_seq1-m.160 complete 210-1166(+) 319 (+)
         (318 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|50548463|ref|XP_501701.1| YALI0C10945p [Yarrowia lipolytica] ...   267   2e-69   Yarrowia lipolytica CLIB122
gi|511011714|gb|EPB92922.1| hypothetical protein HMPREF1544_0036...   267   3e-69   Mucor circinelloides f. circinelloides 1006PhL
gi|254569318|ref|XP_002491769.1| Vacuolar membrane protein invol...   265   2e-68   Komagataella phaffii GS115
gi|189210858|ref|XP_001941760.1| negative regulator of cdc42p [P...   259   8e-67   Pyrenophora tritici-repentis Pt-1C-BFP
gi|328774367|gb|EGF84404.1| hypothetical protein BATDEDRAFT_1867...   256   7e-66   Batrachochytrium dendrobatidis JAM81
gi|50312119|ref|XP_456091.1| hypothetical protein [Kluyveromyces...   256   8e-66   Kluyveromyces lactis NRRL Y-1140
gi|241954508|ref|XP_002419975.1| vacuolar transporter chaperone,...   255   1e-65   Candida dubliniensis CD36
gi|255721583|ref|XP_002545726.1| vacuolar transporter chaperone ...   253   5e-65   Candida tropicalis MYA-3404
gi|320580414|gb|EFW94637.1| Vacuolar membrane protein [Ogataea p...   252   9e-65   
gi|255711200|ref|XP_002551883.1| KLTH0B02156p [Lachancea thermot...   251   1e-64   Lachancea thermotolerans CBS 6340
gi|68489079|ref|XP_711605.1| hypothetical protein CaO19.10871 [C...   251   1e-64   Candida albicans SC5314
gi|448124185|ref|XP_004204854.1| Piso0_000136 [Millerozyma farin...   251   2e-64   Millerozyma farinosa CBS 7064
gi|459370019|gb|EMG48228.1| Vacuolar transporter chaperone 4 [Ca...   249   6e-64   Candida maltosa Xu316
gi|150865302|ref|XP_001384458.2| polyphosphate synthetase Protei...   249   6e-64   Scheffersomyces stipitis CBS 6054
gi|344305243|gb|EGW35475.1| hypothetical protein SPAPADRAFT_5870...   245   9e-63   Spathaspora passalidarum NRRL Y-27907
gi|448121783|ref|XP_004204298.1| Piso0_000136 [Millerozyma farin...   245   1e-62   Millerozyma farinosa CBS 7064
gi|294660012|ref|XP_462468.2| DEHA2G21296p [Debaryomyces hanseni...   245   1e-62   Debaryomyces hansenii CBS767
gi|50288467|ref|XP_446663.1| hypothetical protein [Candida glabr...   245   1e-62   Candida glabrata CBS 138
gi|406602620|emb|CCH45830.1| Vacuolar transporter chaperone 4 [W...   245   2e-62   Wickerhamomyces ciferrii
gi|260948174|ref|XP_002618384.1| hypothetical protein CLUG_01843...   241   1e-61   Clavispora lusitaniae ATCC 42720
gi|444316696|ref|XP_004179005.1| hypothetical protein TBLA_0B066...   241   1e-61   Tetrapisispora blattae CBS 6284
gi|213403149|ref|XP_002172347.1| vacuolar transporter chaperone ...   241   2e-61   Schizosaccharomyces japonicus yFS275
gi|385304577|gb|EIF48589.1| vacuolar transporter chaperone 4 [De...   241   2e-61   Brettanomyces bruxellensis AWRI1499
gi|448530417|ref|XP_003870058.1| Vtc4 polyphosphate synthetase [...   240   3e-61   Candida orthopsilosis Co 90-125
gi|344228758|gb|EGV60644.1| SPX-domain-containing protein [Candi...   240   3e-61   Candida tenuis ATCC 10573
gi|384501584|gb|EIE92075.1| hypothetical protein RO3G_16786 [Rhi...   240   4e-61   Rhizopus delemar RA 99-880
gi|19075642|ref|NP_588142.1| vacuolar transporter chaperone (VTC...   240   5e-61   Schizosaccharomyces pombe 972h-
gi|149237266|ref|XP_001524510.1| vacuolar transporter chaperone ...   239   7e-61   Lodderomyces elongisporus NRRL YB-4239
gi|156844366|ref|XP_001645246.1| hypothetical protein Kpol_1060p...   238   1e-60   Vanderwaltozyma polyspora DSM 70294
gi|367014847|ref|XP_003681923.1| hypothetical protein TDEL_0E046...   237   3e-60   Torulaspora delbrueckii
gi|1749526|dbj|BAA13821.1| unnamed protein product [Schizosaccha...   236   5e-60   Schizosaccharomyces pombe
gi|354547799|emb|CCE44534.1| hypothetical protein CPAR2_403370 [...   236   7e-60   Candida parapsilosis
gi|511010844|gb|EPB92060.1| hypothetical protein HMPREF1544_0112...   233   5e-59   Mucor circinelloides f. circinelloides 1006PhL
gi|410079785|ref|XP_003957473.1| hypothetical protein KAFR_0E018...   230   3e-58   Kazachstania africana CBS 2517
gi|254585901|ref|XP_002498518.1| ZYRO0G12210p [Zygosaccharomyces...   222   1e-55   Zygosaccharomyces rouxii CBS 732
gi|323348004|gb|EGA82263.1| Vtc4p [Saccharomyces cerevisiae Lalv...   216   5e-54   Saccharomyces cerevisiae Lalvin QA23
gi|349579179|dbj|GAA24342.1| K7_Vtc4p [Saccharomyces cerevisiae ...   216   6e-54   Saccharomyces cerevisiae Kyokai no. 7
gi|323304334|gb|EGA58107.1| Vtc4p [Saccharomyces cerevisiae Fost...   216   6e-54   Saccharomyces cerevisiae FostersB
gi|42742256|ref|NP_012522.2| Vtc4p [Saccharomyces cerevisiae S28...   216   7e-54   Saccharomyces cerevisiae S288c
gi|363756190|ref|XP_003648311.1| hypothetical protein Ecym_8209 ...   214   2e-53   Eremothecium cymbalariae DBVPG#7215
gi|71024295|ref|XP_762377.1| hypothetical protein UM06230.1 [Ust...   192   1e-46   
gi|501305998|dbj|GAC95104.1| hypothetical protein PHSY_002679 [P...   192   1e-46   Pseudozyma hubeiensis SY62
gi|164658734|ref|XP_001730492.1| hypothetical protein MGL_2288 [...   191   3e-46   Malassezia globosa CBS 7966
gi|343427977|emb|CBQ71502.1| probable VTC4-Vacuolar Transporter ...   191   3e-46   Sporisorium reilianum SRZ2
gi|406858843|gb|EKD11929.1| VTC domain-containing protein [Marss...   189   1e-45   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|156062318|ref|XP_001597081.1| hypothetical protein SS1G_01275...   187   3e-45   Sclerotinia sclerotiorum 1980 UF-70
gi|388857645|emb|CCF48794.1| probable VTC4-Vacuolar Transporter ...   187   3e-45   Ustilago hordei
gi|154297372|ref|XP_001549113.1| hypothetical protein BC1G_12090...   186   5e-45   Botrytis cinerea B05.10
gi|472246277|gb|EMR90816.1| putative vacuolar transporter chaper...   186   5e-45   Botrytis cinerea BcDW1
gi|465794509|emb|CCU99297.1| unnamed protein product [Malassezia...   186   6e-45   Malassezia sympodialis ATCC 42132
gi|327303090|ref|XP_003236237.1| vacuolar transporter chaperone ...   185   1e-44   Trichophyton rubrum CBS 118892
gi|326479414|gb|EGE03424.1| vacuolar transporter chaperone 4 [Tr...   185   1e-44   Trichophyton equinum CBS 127.97
gi|388581709|gb|EIM22016.1| SPX-domain-containing protein [Walle...   185   1e-44   Wallemia mellicola CBS 633.66
gi|315050232|ref|XP_003174490.1| vacuolar transporter chaperone ...   185   1e-44   Microsporum gypseum CBS 118893
gi|326471320|gb|EGD95329.1| vacuolar transporter chaperone 4 [Tr...   185   2e-44   Trichophyton tonsurans CBS 112818
gi|302509596|ref|XP_003016758.1| hypothetical protein ARB_05051 ...   185   2e-44   Arthroderma benhamiae CBS 112371
gi|443899777|dbj|GAC77106.1| component of vacuolar transporter c...   185   2e-44   Moesziomyces antarcticus T-34
gi|296813211|ref|XP_002846943.1| vacuolar transporter chaperone ...   185   2e-44   Arthroderma otae CBS 113480
gi|302665545|ref|XP_003024382.1| hypothetical protein TRV_01448 ...   184   3e-44   Trichophyton verrucosum HKI 0517
gi|358398714|gb|EHK48065.1| hypothetical protein TRIATDRAFT_4690...   184   4e-44   Trichoderma atroviride IMI 206040
gi|512190028|gb|EPE05793.1| vacuolar transporter chaperone 4 [Op...   183   4e-44   Ophiostoma piceae UAMH 11346
gi|429963158|gb|ELA42702.1| hypothetical protein VICG_00017 [Vit...   183   4e-44   Vittaforma corneae ATCC 50505
gi|340924194|gb|EGS19097.1| hypothetical protein CTHT_0057210 [C...   182   1e-43   Chaetomium thermophilum var. thermophilum DSM 1495
gi|512197536|gb|EPE26372.1| hypothetical protein GLAREA_02284 [G...   182   1e-43   Glarea lozoyensis ATCC 20868
gi|342879367|gb|EGU80618.1| hypothetical protein FOXB_08841 [Fus...   182   1e-43   Fusarium oxysporum Fo5176
gi|477507750|gb|ENH61044.1| Vacuolar transporter chaperone 4 [Fu...   182   1e-43   Fusarium oxysporum f. sp. cubense race 1
gi|475664101|gb|EMT61896.1| Vacuolar transporter chaperone 4 [Fu...   182   1e-43   Fusarium oxysporum f. sp. cubense race 4
gi|336265396|ref|XP_003347469.1| hypothetical protein SMAC_08036...   182   2e-43   Sordaria macrospora k-hell
gi|500260724|gb|EOO03248.1| putative vacuolar transporter chaper...   181   2e-43   Phaeoacremonium minimum UCRPA7
gi|46107238|ref|XP_380678.1| hypothetical protein FG00502.1 [Fus...   181   3e-43   
gi|358387175|gb|EHK24770.1| hypothetical protein TRIVIDRAFT_1900...   180   4e-43   Trichoderma virens Gv29-8
gi|261195064|ref|XP_002623936.1| vacuolar transporter chaperone ...   180   5e-43   Blastomyces gilchristii SLH14081
gi|239610699|gb|EEQ87686.1| vacuolar transporter chaperone Vtc4 ...   180   5e-43   Blastomyces dermatitidis ER-3
gi|401826794|ref|XP_003887490.1| SPX domain-containing vacuolar ...   180   5e-43   Encephalitozoon hellem ATCC 50504
gi|171695946|ref|XP_001912897.1| hypothetical protein [Podospora...   179   7e-43   Podospora anserina S mat+
gi|320591300|gb|EFX03739.1| vacuolar transporter chaperone [Gros...   179   7e-43   Grosmannia clavigera kw1407
gi|440633461|gb|ELR03380.1| hypothetical protein GMDG_06121 [Geo...   179   7e-43   Pseudogymnoascus destructans 20631-21
gi|340522473|gb|EGR52706.1| predicted protein [Trichoderma reese...   179   7e-43   Trichoderma reesei QM6a
gi|71001114|ref|XP_755238.1| vacuolar transporter chaperone (Vtc...   179   8e-43   Aspergillus fumigatus Af293
gi|384497174|gb|EIE87665.1| hypothetical protein RO3G_12376 [Rhi...   179   8e-43   Rhizopus delemar RA 99-880
gi|393221035|gb|EJD06520.1| SPX-domain-containing protein [Fomit...   179   8e-43   Fomitiporia mediterranea MF3/22
gi|310790732|gb|EFQ26265.1| VTC domain-containing protein [Glome...   179   9e-43   Colletotrichum graminicola M1.001
gi|429860553|gb|ELA35285.1| vacuolar transporter chaperone 4 [Co...   179   1e-42   Colletotrichum gloeosporioides Nara gc5
gi|400595364|gb|EJP63169.1| VTC domain-containing protein [Beauv...   179   1e-42   Beauveria bassiana ARSEF 2860
gi|408396226|gb|EKJ75388.1| hypothetical protein FPSE_04407 [Fus...   179   1e-42   Fusarium pseudograminearum CS3096
gi|505755455|gb|EOQ99662.1| Vacuolar transporter chaperone 4 [Wa...   179   1e-42   Wallemia ichthyophaga EXF-994
gi|317157661|ref|XP_001826373.2| vacuolar transporter chaperone ...   179   1e-42   Aspergillus oryzae RIB40
gi|115443378|ref|XP_001218496.1| vacuolar transporter chaperone ...   178   1e-42   Aspergillus terreus NIH2624
gi|83775117|dbj|BAE65240.1| unnamed protein product [Aspergillus...   178   1e-42   Aspergillus oryzae RIB40
gi|322699097|gb|EFY90861.1| vacuolar transporter chaperone 4 [Me...   178   2e-42   Metarhizium acridum CQMa 102
gi|159129323|gb|EDP54437.1| vacuolar transporter chaperone (Vtc4...   177   3e-42   Aspergillus fumigatus A1163
gi|322708853|gb|EFZ00430.1| vacuolar transporter chaperone 4 [Me...   177   3e-42   Metarhizium robertsii ARSEF 23
gi|346322519|gb|EGX92118.1| vacuolar transporter chaperone 4 [Co...   177   3e-42   Cordyceps militaris CM01
gi|452840416|gb|EME42354.1| hypothetical protein DOTSEDRAFT_8977...   177   3e-42   Dothistroma septosporum NZE10
gi|302926516|ref|XP_003054310.1| predicted protein [Nectria haem...   177   3e-42   Nectria haematococca mpVI 77-13-4
gi|258574533|ref|XP_002541448.1| vacuolar transporter chaperone ...   177   3e-42   Uncinocarpus reesii 1704
gi|380481613|emb|CCF41743.1| VTC domain-containing protein [Coll...   177   3e-42   Colletotrichum higginsianum
gi|116180904|ref|XP_001220301.1| hypothetical protein CHGG_01080...   177   3e-42   Chaetomium globosum CBS 148.51
gi|494831489|gb|EON67944.1| hypothetical protein W97_07441 [Coni...   177   4e-42   Coniosporium apollinis CBS 100218
gi|367019662|ref|XP_003659116.1| hypothetical protein MYCTH_2295...   177   4e-42   Myceliophthora thermophila ATCC 42464
gi|119480749|ref|XP_001260403.1| vacuolar transporter chaperone ...   177   4e-42   Aspergillus fischeri NRRL 181
gi|485920039|gb|EOD46168.1| putative vacuolar transporter chaper...   177   4e-42   Neofusicoccum parvum UCRNP2
gi|402080265|gb|EJT75410.1| vacuolar transporter chaperone 4 [Ga...   177   4e-42   Gaeumannomyces graminis var. tritici R3-111a-1
gi|449299992|gb|EMC96005.1| hypothetical protein BAUCODRAFT_3477...   177   5e-42   Baudoinia panamericana UAMH 10762
gi|303312211|ref|XP_003066117.1| SPX domain containing protein [...   176   5e-42   Coccidioides posadasii C735 delta SOWgp
gi|320040106|gb|EFW22040.1| vacuolar transporter chaperone [Cocc...   176   6e-42   Coccidioides posadasii str. Silveira
gi|296418710|ref|XP_002838968.1| hypothetical protein [Tuber mel...   176   6e-42   Tuber melanosporum Mel28
gi|119193280|ref|XP_001247246.1| hypothetical protein CIMG_01017...   176   6e-42   
gi|477526390|gb|ENH78257.1| vacuolar transporter chaperone 4 [Co...   176   6e-42   Colletotrichum orbiculare MAFF 240422
gi|392863515|gb|EAS35730.2| vacuolar transporter chaperone [Cocc...   176   7e-42   
gi|384483613|gb|EIE75793.1| hypothetical protein RO3G_00497 [Rhi...   176   8e-42   Rhizopus delemar RA 99-880
gi|511006186|gb|EPB87504.1| hypothetical protein HMPREF1544_0569...   176   8e-42   Mucor circinelloides f. circinelloides 1006PhL
gi|238493645|ref|XP_002378059.1| vacuolar transporter chaperone ...   176   8e-42   Aspergillus flavus NRRL3357
gi|391869466|gb|EIT78664.1| protein involved in vacuolar polypho...   176   9e-42   Aspergillus oryzae 3.042
gi|121698853|ref|XP_001267828.1| vacuolar transporter chaperone ...   176   9e-42   Aspergillus clavatus NRRL 1
gi|358369871|dbj|GAA86484.1| vacuolar transporter chaperone 4 [A...   176   1e-41   Aspergillus kawachii IFO 4308
gi|378731425|gb|EHY57884.1| hypothetical protein HMPREF1120_0590...   175   1e-41   Exophiala dermatitidis NIH/UT8656
gi|453084542|gb|EMF12586.1| SPX-domain-containing protein [Mycos...   175   1e-41   Sphaerulina musiva SO2202
gi|346979199|gb|EGY22651.1| vacuolar transporter chaperone 4 [Ve...   175   2e-41   Verticillium dahliae VdLs.17
gi|302414212|ref|XP_003004938.1| vacuolar transporter chaperone ...   175   2e-41   Verticillium alfalfae VaMs.102
gi|398396620|ref|XP_003851768.1| hypothetical protein MYCGRDRAFT...   175   2e-41   Zymoseptoria tritici IPO323
gi|367044202|ref|XP_003652481.1| hypothetical protein THITE_2114...   174   2e-41   Thielavia terrestris NRRL 8126
gi|452981043|gb|EME80803.1| hypothetical protein MYCFIDRAFT_2157...   174   3e-41   Cercospora fijiensis CIRAD86
gi|407928290|gb|EKG21150.1| hypothetical protein MPH_01506 [Macr...   174   3e-41   Macrophomina phaseolina MS6
gi|212528884|ref|XP_002144599.1| vacuolar transporter chaperone ...   174   3e-41   Talaromyces marneffei ATCC 18224
gi|255941170|ref|XP_002561354.1| Pc16g10440 [Penicillium chrysog...   174   4e-41   Penicillium rubens Wisconsin 54-1255
gi|295673262|ref|XP_002797177.1| negative regulator of cdc42 [Pa...   174   4e-41   
gi|225681015|gb|EEH19299.1| vacuolar transporter chaperone [Para...   174   4e-41   
gi|399167743|emb|CCE31329.1| related to polyphosphate synthetase...   174   4e-41   Claviceps purpurea 20.1
gi|226292290|gb|EEH47710.1| vacuolar transporter chaperone 1 [Pa...   174   4e-41   
gi|145246584|ref|XP_001395541.1| vacuolar transporter chaperone ...   173   5e-41   Aspergillus niger CBS 513.88
gi|242765250|ref|XP_002340936.1| vacuolar transporter chaperone ...   173   5e-41   Talaromyces stipitatus ATCC 10500
gi|350636888|gb|EHA25246.1| hypothetical protein ASPNIDRAFT_4966...   173   5e-41   Aspergillus niger ATCC 1015
gi|19074392|ref|NP_585898.1| putative POLYPHOSPHATE SYNTHETASE V...   173   6e-41   Encephalitozoon cuniculi GB-M1
gi|425773037|gb|EKV11412.1| Vacuolar transporter chaperone (Vtc4...   172   1e-40   Penicillium digitatum PHI26
gi|154281535|ref|XP_001541580.1| vacuolar transporter chaperone ...   172   1e-40   Histoplasma capsulatum NAm1
gi|225563140|gb|EEH11419.1| vacuolar transporter chaperone 4 [Aj...   172   1e-40   Histoplasma capsulatum G186AR
gi|389750342|gb|EIM91513.1| SPX-domain-containing protein [Stere...   171   2e-40   Stereum hirsutum FP-91666 SS1
gi|472583927|gb|EMS21543.1| vacuolar transporter chaperone 4 [Rh...   171   2e-40   Rhodotorula toruloides NP11
gi|325093095|gb|EGC46405.1| vacuolar transporter chaperone 4 [Aj...   171   2e-40   Histoplasma capsulatum H88
gi|240275722|gb|EER39235.1| vacuolar transporter chaperone 4 [Aj...   171   2e-40   Histoplasma capsulatum H143
gi|366992738|ref|XP_003676134.1| hypothetical protein NCAS_0D019...   170   4e-40   Naumovozyma castellii CBS 4309
gi|401625102|gb|EJS43127.1| vtc4p [Saccharomyces arboricola H-6]      170   6e-40   Saccharomyces arboricola H-6
gi|401838834|gb|EJT42272.1| VTC4-like protein [Saccharomyces kud...   169   7e-40   Saccharomyces kudriavzevii IFO 1802
gi|323333045|gb|EGA74447.1| Vtc4p [Saccharomyces cerevisiae AWRI...   169   7e-40   Saccharomyces cerevisiae AWRI796
gi|365759950|gb|EHN01704.1| Vtc4p [Saccharomyces cerevisiae x Sa...   169   8e-40   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|323308428|gb|EGA61673.1| Vtc4p [Saccharomyces cerevisiae Fost...   169   1e-39   Saccharomyces cerevisiae FostersO
gi|1006727|emb|CAA89303.1| unnamed protein product [Saccharomyce...   169   1e-39   Saccharomyces cerevisiae [brewer's yeast]
gi|238605145|ref|XP_002396378.1| hypothetical protein MPER_03406...   169   1e-39   
gi|164422653|ref|XP_963840.2| vacuolar transporter chaperone 4 [...   168   2e-39   
gi|336463167|gb|EGO51407.1| vacuolar transporter chaperone 4 [Ne...   168   2e-39   Neurospora tetrasperma FGSC 2508
gi|395332427|gb|EJF64806.1| SPX-domain-containing protein [Dicho...   168   2e-39   Dichomitus squalens LYAD-421 SS1
gi|353227570|emb|CCA78073.1| probable VTC4-Vacuolar Transporter ...   168   2e-39   Serendipita indica DSM 11827
gi|451850198|gb|EMD63500.1| hypothetical protein COCSADRAFT_1907...   168   2e-39   Bipolaris sorokiniana ND90Pr
gi|392594973|gb|EIW84297.1| SPX-domain-containing protein [Conio...   167   3e-39   Coniophora puteana RWD-64-598 SS2
gi|513031984|gb|AGO11993.1| AaceriAGR316Cp [Saccharomycetaceae s...   167   3e-39   Saccharomycetaceae sp. 'Ashbya aceri'
gi|366998475|ref|XP_003683974.1| hypothetical protein TPHA_0A046...   167   3e-39   Tetrapisispora phaffii CBS 4417
gi|389624573|ref|XP_003709940.1| vacuolar transporter chaperone ...   167   3e-39   Magnaporthe oryzae 70-15
gi|451993330|gb|EMD85804.1| hypothetical protein COCHEDRAFT_1187...   167   3e-39   Bipolaris maydis C5
gi|403218506|emb|CCK72996.1| hypothetical protein KNAG_0M01430 [...   167   4e-39   Kazachstania naganishii CBS 8797
gi|484856350|gb|EOB14139.1| Vacuolar transporter chaperone 4 [No...   166   7e-39   Nosema bombycis CQ1
gi|396473987|ref|XP_003839467.1| similar to vacuolar transporter...   166   7e-39   Leptosphaeria maculans JN3
gi|482806467|gb|EOA83540.1| hypothetical protein SETTUDRAFT_1648...   166   9e-39   Setosphaeria turcica Et28A
gi|484857422|gb|EOB15164.1| Vacuolar transporter chaperone 4 [No...   166   1e-38   Nosema bombycis CQ1
gi|365984751|ref|XP_003669208.1| hypothetical protein NDAI_0C030...   166   1e-38   Naumovozyma dairenensis CBS 421
gi|393241368|gb|EJD48890.1| SPX-domain-containing protein [Auric...   166   1e-38   Auricularia subglabra TFB-10046 SS5
gi|451994807|gb|EMD87276.1| hypothetical protein COCHEDRAFT_1206...   165   1e-38   Bipolaris maydis C5
gi|477583230|gb|ENI00330.1| hypothetical protein COCC4DRAFT_7578...   165   1e-38   Bipolaris maydis ATCC 48331
gi|345565290|gb|EGX48241.1| hypothetical protein AOL_s00080g366 ...   165   1e-38   Arthrobotrys oligospora ATCC 24927
gi|358058497|dbj|GAA95460.1| hypothetical protein E5Q_02114 [Mix...   165   1e-38   Mixia osmundae IAM 14324
gi|336370492|gb|EGN98832.1| hypothetical protein SERLA73DRAFT_10...   165   1e-38   Serpula lacrymans var. lacrymans S7.3
gi|336383273|gb|EGO24422.1| hypothetical protein SERLADRAFT_4155...   165   1e-38   Serpula lacrymans var. lacrymans S7.9
gi|449543039|gb|EMD34016.1| hypothetical protein CERSUDRAFT_1077...   165   2e-38   Gelatoporia subvermispora B
gi|242209321|ref|XP_002470508.1| predicted protein [Postia place...   165   2e-38   Postia placenta Mad-698-R
gi|330924130|ref|XP_003300530.1| hypothetical protein PTT_11778 ...   164   4e-38   Pyrenophora teres f. teres 0-1
gi|170098797|ref|XP_001880617.1| predicted protein [Laccaria bic...   163   5e-38   Laccaria bicolor S238N-H82
gi|146417590|ref|XP_001484763.1| hypothetical protein PGUG_02492...   163   6e-38   Meyerozyma guilliermondii ATCC 6260
gi|392564062|gb|EIW57240.1| SPX-domain-containing protein [Trame...   163   7e-38   Trametes versicolor FP-101664 SS1
gi|302684685|ref|XP_003032023.1| hypothetical protein SCHCODRAFT...   162   9e-38   Schizophyllum commune H4-8
gi|390600592|gb|EIN09987.1| SPX-domain-containing protein [Punct...   162   1e-37   Punctularia strigosozonata HHB-11173 SS5
gi|451846559|gb|EMD59868.1| hypothetical protein COCSADRAFT_1749...   161   2e-37   Bipolaris sorokiniana ND90Pr
gi|45201412|ref|NP_986982.1| AGR316Cp [Ashbya gossypii ATCC 1089...   161   3e-37   Eremothecium gossypii ATCC 10895
gi|302907604|ref|XP_003049683.1| predicted protein [Nectria haem...   161   3e-37   Nectria haematococca mpVI 77-13-4
gi|409048965|gb|EKM58443.1| hypothetical protein PHACADRAFT_2527...   160   4e-37   Phanerochaete carnosa HHB-10118-sp
gi|471567672|gb|EMR67571.1| putative vacuolar transporter chaper...   160   5e-37   Eutypa lata UCREL1
gi|443920063|gb|ELU40058.1| vacuolar transporter chaperone 4 [Rh...   160   5e-37   Rhizoctonia solani AG-1 IA
gi|409077716|gb|EKM78081.1| hypothetical protein AGABI1DRAFT_610...   160   6e-37   Agaricus bisporus var. burnettii JB137-S8
gi|320581568|gb|EFW95788.1| hypothetical protein HPODL_2641 [Oga...   160   6e-37   
gi|501752508|emb|CCG83546.1| Vacuolar transporter chaperone 1 [T...   160   6e-37   Taphrina deformans PYCC 5710
gi|512198296|gb|EPE27131.1| hypothetical protein GLAREA_03045 [G...   159   7e-37   Glarea lozoyensis ATCC 20868
gi|501753635|emb|CCG82780.1| SPX domain protein [Taphrina deform...   159   8e-37   Taphrina deformans PYCC 5710
gi|511005431|gb|EPB86773.1| vacuolar transporter chaperone 1 [Mu...   159   8e-37   Mucor circinelloides f. circinelloides 1006PhL
gi|426199054|gb|EKV48979.1| hypothetical protein AGABI2DRAFT_200...   159   9e-37   Agaricus bisporus var. bisporus H97
gi|511000708|gb|EPB82227.1| vacuolar transporter chaperone 1 [Mu...   159   9e-37   Mucor circinelloides f. circinelloides 1006PhL
gi|361128656|gb|EHL00586.1| putative Vacuolar transporter chaper...   159   9e-37   Glarea lozoyensis 74030
gi|169613048|ref|XP_001799941.1| hypothetical protein SNOG_09652...   159   1e-36   Parastagonospora nodorum SN15
gi|299749903|ref|XP_001836415.2| vacuolar transporter chaperone ...   159   1e-36   Coprinopsis cinerea okayama7#130
gi|388581319|gb|EIM21628.1| hypothetical protein WALSEDRAFT_6035...   158   2e-36   Wallemia mellicola CBS 633.66
gi|358056568|dbj|GAA97537.1| hypothetical protein E5Q_04215 [Mix...   158   2e-36   Mixia osmundae IAM 14324
gi|471877938|emb|CCO35307.1| Vacuolar transporter chaperone 4 [R...   158   2e-36   Rhizoctonia solani AG-1 IB
gi|511007570|gb|EPB88856.1| hypothetical protein HMPREF1544_0436...   157   3e-36   Mucor circinelloides f. circinelloides 1006PhL
gi|501750622|emb|CCG84758.1| protein of unknown function [Taphri...   157   3e-36   Taphrina deformans PYCC 5710
gi|300707392|ref|XP_002995906.1| hypothetical protein NCER_10108...   157   5e-36   Nosema ceranae BRL01
gi|384491577|gb|EIE82773.1| hypothetical protein RO3G_07478 [Rhi...   156   8e-36   Rhizopus delemar RA 99-880
gi|405120108|gb|AFR94879.1| vacuolar transporter chaperone 4 [Cr...   156   9e-36   Cryptococcus neoformans var. grubii H99
gi|210075365|ref|XP_501265.2| YALI0B23408p [Yarrowia lipolytica]...   155   1e-35   Yarrowia lipolytica CLIB122
gi|260950393|ref|XP_002619493.1| conserved hypothetical protein ...   155   1e-35   Clavispora lusitaniae ATCC 42720
gi|254573194|ref|XP_002493706.1| Vacuolar transporter chaperon (...   155   1e-35   Komagataella phaffii GS115
gi|402224825|gb|EJU04887.1| SPX-domain-containing protein [Dacry...   155   1e-35   Dacryopinax primogenitus
gi|328354468|emb|CCA40865.1| Vacuolar transporter chaperone 1 [K...   154   2e-35   Komagataella phaffii CBS 7435
gi|505756844|gb|EOR00985.1| Vacuolar transporter chaperone 1 [Wa...   154   2e-35   Wallemia ichthyophaga EXF-994
gi|58266938|ref|XP_570625.1| vacuole fusion, non-autophagic-rela...   154   3e-35   Cryptococcus neoformans var. neoformans JEC21
gi|134110746|ref|XP_775837.1| hypothetical protein CNBD2470 [Cry...   154   3e-35   Cryptococcus neoformans var. neoformans B-3501A
gi|384496085|gb|EIE86576.1| vacuolar transporter chaperone 1 [Rh...   154   4e-35   Rhizopus delemar RA 99-880
gi|403412102|emb|CCL98802.1| predicted protein [Fibroporia radic...   153   5e-35   Fibroporia radiculosa
gi|448118396|ref|XP_004203486.1| Piso0_001095 [Millerozyma farin...   153   5e-35   Millerozyma farinosa CBS 7064
gi|472585950|gb|EMS23492.1| vacuolar transporter chaperone 1 [Rh...   153   6e-35   Rhodotorula toruloides NP11
gi|363751154|ref|XP_003645794.1| hypothetical protein Ecym_3496 ...   152   8e-35   Eremothecium cymbalariae DBVPG#7215
gi|406694367|gb|EKC97695.1| vacuole fusion, non-autophagic-relat...   152   1e-34   Trichosporon asahii var. asahii CBS 8904
gi|399165959|emb|CCE33217.1| probable negative regulator of cdc4...   152   1e-34   Claviceps purpurea 20.1
gi|401884795|gb|EJT48937.1| vacuole fusion, non-autophagic-relat...   152   1e-34   Trichosporon asahii var. asahii CBS 2479
gi|321257860|ref|XP_003193732.1| vacuole fusion, non-autophagic-...   152   1e-34   Cryptococcus gattii WM276
gi|50426209|ref|XP_461701.1| DEHA2G03586p [Debaryomyces hansenii...   152   1e-34   Debaryomyces hansenii CBS767
gi|388856019|emb|CCF50396.1| probable VTC1-protein controls Sec1...   151   2e-34   Ustilago hordei
gi|322698328|gb|EFY90099.1| vacuolar transporter chaperone 1 [Me...   151   2e-34   Metarhizium acridum CQMa 102
gi|344234885|gb|EGV66753.1| hypothetical protein CANTEDRAFT_1121...   151   2e-34   Candida tenuis ATCC 10573
gi|71023025|ref|XP_761742.1| hypothetical protein UM05595.1 [Ust...   151   2e-34   
gi|68476353|ref|XP_717826.1| hypothetical protein CaO19.5455 [Ca...   151   2e-34   Candida albicans SC5314
gi|343426476|emb|CBQ70006.1| probable VTC1-protein controls Sec1...   151   2e-34   Sporisorium reilianum SRZ2
gi|169597351|ref|XP_001792099.1| hypothetical protein SNOG_01461...   150   3e-34   Parastagonospora nodorum SN15
gi|126132696|ref|XP_001382873.1| Vacuolar transporter chaperone ...   150   3e-34   Scheffersomyces stipitis CBS 6054
gi|342882737|gb|EGU83337.1| hypothetical protein FOXB_06188 [Fus...   150   3e-34   Fusarium oxysporum Fo5176
gi|146417567|ref|XP_001484752.1| vacuolar transporter chaperone ...   150   4e-34   Meyerozyma guilliermondii ATCC 6260
gi|354547453|emb|CCE44188.1| hypothetical protein CPAR2_504120 [...   150   5e-34   Candida parapsilosis
gi|494825525|gb|EON62679.1| vacuolar transporter chaperone 1 [Co...   150   6e-34   Coniosporium apollinis CBS 100218
gi|482811850|gb|EOA88595.1| hypothetical protein SETTUDRAFT_1766...   149   7e-34   Setosphaeria turcica Et28A
gi|255723506|ref|XP_002546686.1| vacuolar transporter chaperone ...   149   7e-34   Candida tropicalis MYA-3404
gi|345561652|gb|EGX44740.1| hypothetical protein AOL_s00188g78 [...   149   7e-34   Arthrobotrys oligospora ATCC 24927
gi|340522892|gb|EGR53125.1| predicted protein [Trichoderma reese...   149   8e-34   Trichoderma reesei QM6a
gi|448528502|ref|XP_003869724.1| Vtc1 protein [Candida orthopsil...   149   8e-34   Candida orthopsilosis Co 90-125
gi|149245960|ref|XP_001527450.1| vacuolar transporter chaperone ...   149   8e-34   Lodderomyces elongisporus NRRL YB-4239
gi|358395616|gb|EHK45003.1| hypothetical protein TRIATDRAFT_2997...   149   8e-34   Trichoderma atroviride IMI 206040
gi|344300879|gb|EGW31191.1| hypothetical protein SPAPADRAFT_6176...   149   9e-34   Spathaspora passalidarum NRRL Y-27907
gi|358389567|gb|EHK27159.1| hypothetical protein TRIVIDRAFT_9512...   149   1e-33   Trichoderma virens Gv29-8
gi|170090726|ref|XP_001876585.1| predicted protein [Laccaria bic...   149   1e-33   Laccaria bicolor S238N-H82
gi|403174841|ref|XP_003333759.2| hypothetical protein PGTG_15519...   149   1e-33   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|500256845|gb|EOO00086.1| putative vacuolar transporter chaper...   148   2e-33   Phaeoacremonium minimum UCRPA7
gi|328854527|gb|EGG03659.1| hypothetical protein MELLADRAFT_4948...   148   2e-33   Melampsora larici-populina 98AG31
gi|392593017|gb|EIW82343.1| vacuolar transporter chaperone 1 [Co...   148   2e-33   Coniophora puteana RWD-64-598 SS2
gi|330906977|ref|XP_003295664.1| hypothetical protein PTT_02198 ...   148   2e-33   Pyrenophora teres f. teres 0-1
gi|392568401|gb|EIW61575.1| hypothetical protein TRAVEDRAFT_2713...   147   3e-33   Trametes versicolor FP-101664 SS1
gi|426198545|gb|EKV48471.1| hypothetical protein AGABI2DRAFT_687...   147   3e-33   Agaricus bisporus var. bisporus H97
gi|336364681|gb|EGN93036.1| hypothetical protein SERLA73DRAFT_19...   147   4e-33   Serpula lacrymans var. lacrymans S7.3
gi|451846856|gb|EMD60165.1| hypothetical protein COCSADRAFT_1752...   147   4e-33   Bipolaris sorokiniana ND90Pr
gi|19112475|ref|NP_595683.1| GTPase regulator Nrf1 [Schizosaccha...   147   4e-33   Schizosaccharomyces pombe 972h-
gi|477520295|gb|ENH72421.1| Vacuolar transporter chaperone 3 [Fu...   147   5e-33   Fusarium oxysporum f. sp. cubense race 1
gi|475666675|gb|EMT64465.1| Vacuolar transporter chaperone 3 [Fu...   147   5e-33   Fusarium oxysporum f. sp. cubense race 4
gi|389747106|gb|EIM88285.1| hypothetical protein STEHIDRAFT_9535...   147   5e-33   Stereum hirsutum FP-91666 SS1
gi|408391916|gb|EKJ71282.1| hypothetical protein FPSE_08521 [Fus...   147   5e-33   Fusarium pseudograminearum CS3096
gi|189196712|ref|XP_001934694.1| vacuolar transporter chaperone ...   146   6e-33   Pyrenophora tritici-repentis Pt-1C-BFP
gi|511008852|gb|EPB90108.1| hypothetical protein HMPREF1544_0308...   146   6e-33   Mucor circinelloides f. circinelloides 1006PhL
gi|396461377|ref|XP_003835300.1| similar to vacuolar transporter...   146   6e-33   Leptosphaeria maculans JN3
gi|296425297|ref|XP_002842179.1| hypothetical protein [Tuber mel...   146   6e-33   Tuber melanosporum Mel28
gi|452005371|gb|EMD97827.1| hypothetical protein COCHEDRAFT_1165...   146   6e-33   Bipolaris maydis C5
gi|400600185|gb|EJP67859.1| VTC domain-containing protein [Beauv...   146   6e-33   Beauveria bassiana ARSEF 2860
gi|296803687|ref|XP_002842696.1| vacuolar transporter chaperone ...   146   6e-33   Arthroderma otae CBS 113480
gi|471909148|emb|CCO28119.1| SCF E3 ubiquitin ligase complex F-b...   146   7e-33   Rhizoctonia solani AG-1 IB
gi|482808944|gb|EOA85805.1| hypothetical protein SETTUDRAFT_2898...   146   7e-33   Setosphaeria turcica Et28A
gi|242208509|ref|XP_002470105.1| predicted protein [Postia place...   146   7e-33   Postia placenta Mad-698-R
gi|342879037|gb|EGU80314.1| hypothetical protein FOXB_09241 [Fus...   146   8e-33   Fusarium oxysporum Fo5176
gi|229597872|pdb|3G3Q|A Chain A, Crystal Structure Of A Eukaryot...   146   8e-33   Saccharomyces cerevisiae [brewer's yeast]
gi|465794993|emb|CCU99633.1| unnamed protein product [Malassezia...   146   8e-33   Malassezia sympodialis ATCC 42132
gi|429860721|gb|ELA35445.1| vacuolar transporter chaperone 1 [Co...   146   9e-33   Colletotrichum gloeosporioides Nara gc5
gi|393216128|gb|EJD01619.1| hypothetical protein FOMMEDRAFT_8939...   146   9e-33   Fomitiporia mediterranea MF3/22
gi|353238741|emb|CCA70678.1| probable VTC1-protein controls Sec1...   145   1e-32   Serendipita indica DSM 11827
gi|477509387|gb|ENH62679.1| Vacuolar transporter chaperone 1 [Fu...   145   1e-32   Fusarium oxysporum f. sp. cubense race 1
gi|302912819|ref|XP_003050784.1| predicted protein [Nectria haem...   145   1e-32   Nectria haematococca mpVI 77-13-4
gi|403415063|emb|CCM01763.1| predicted protein [Fibroporia radic...   145   1e-32   Fibroporia radiculosa
gi|310796748|gb|EFQ32209.1| VTC domain-containing protein [Glome...   145   1e-32   Colletotrichum graminicola M1.001
gi|310800133|gb|EFQ35026.1| hypothetical protein GLRG_10170 [Glo...   145   2e-32   
gi|400598599|gb|EJP66308.1| vacuolar transporter chaperone 1 [Be...   145   2e-32   
gi|302421920|ref|XP_003008790.1| vacuolar transporter chaperone ...   145   2e-32   
gi|380492148|emb|CCF34814.1| hypothetical protein CH063_06730 [C...   145   2e-32   
gi|346324167|gb|EGX93764.1| vacuolar transporter chaperone 1 [Co...   145   2e-32   
gi|390601436|gb|EIN10830.1| vacuolar transporter chaperone 1 [Pu...   145   2e-32   
gi|302694091|ref|XP_003036724.1| hypothetical protein SCHCODRAFT...   145   2e-32   
gi|384485888|gb|EIE78068.1| hypothetical protein RO3G_02772 [Rhi...   145   2e-32   
gi|169861666|ref|XP_001837467.1| vacuolar transporter chaperone ...   144   2e-32   
gi|322710664|gb|EFZ02238.1| SPX domain-containing protein [Metar...   144   3e-32   
gi|164660212|ref|XP_001731229.1| hypothetical protein MGL_1412 [...   144   3e-32   
gi|320592296|gb|EFX04735.1| vacuolar transporter chaperon [Grosm...   144   3e-32   
gi|46136873|ref|XP_390128.1| hypothetical protein FG09952.1 [Fus...   144   3e-32   
gi|367030419|ref|XP_003664493.1| hypothetical protein MYCTH_2307...   144   4e-32   
gi|169603914|ref|XP_001795378.1| hypothetical protein SNOG_04966...   144   5e-32   
gi|380472061|emb|CCF46972.1| VTC domain-containing protein [Coll...   143   5e-32   
gi|384488554|gb|EIE80734.1| hypothetical protein RO3G_05439 [Rhi...   143   5e-32   
gi|121702345|ref|XP_001269437.1| SPX domain protein [Aspergillus...   143   6e-32   
gi|449301307|gb|EMC97318.1| hypothetical protein BAUCODRAFT_4468...   143   7e-32   
gi|401882512|gb|EJT46768.1| GTPase regulator Nrf1 [Trichosporon ...   143   7e-32   
gi|255939790|ref|XP_002560664.1| Pc16g02940 [Penicillium chrysog...   143   8e-32   
gi|336262249|ref|XP_003345909.1| hypothetical protein SMAC_06310...   143   8e-32   
gi|425774324|gb|EKV12632.1| Vacuolar transporter chaperon Vtc1, ...   143   8e-32   
gi|115402171|ref|XP_001217162.1| vacuolar transporter chaperone ...   142   9e-32   
gi|317030268|ref|XP_001392229.2| vacuolar transporter chaperone ...   142   9e-32   
gi|384498432|gb|EIE88923.1| hypothetical protein RO3G_13634 [Rhi...   142   1e-31   
gi|340939466|gb|EGS20088.1| putative vacuolar transporter chaper...   142   1e-31   
gi|171677967|ref|XP_001903934.1| hypothetical protein [Podospora...   142   1e-31   
gi|121702081|ref|XP_001269305.1| vacuolar transporter chaperon V...   142   1e-31   
gi|328856816|gb|EGG05936.1| hypothetical protein MELLADRAFT_3646...   142   2e-31   
gi|119496075|ref|XP_001264811.1| vacuolar transporter chaperon V...   142   2e-31   
gi|70995110|ref|XP_752321.1| vacuolar transporter chaperon Vtc1 ...   141   2e-31   
gi|213403590|ref|XP_002172567.1| GTPase regulator Nrf1 [Schizosa...   141   2e-31   
gi|367040987|ref|XP_003650874.1| hypothetical protein THITE_2110...   141   2e-31   
gi|67521754|ref|XP_658938.1| hypothetical protein AN1334.2 [Aspe...   141   2e-31   
gi|134076733|emb|CAK39792.1| unnamed protein product [Aspergillu...   141   2e-31   
gi|452842571|gb|EME44507.1| hypothetical protein DOTSEDRAFT_1727...   141   3e-31   
gi|116201569|ref|XP_001226596.1| conserved hypothetical protein ...   141   3e-31   
gi|405117937|gb|AFR92712.1| hypothetical protein CNAG_00582 [Cry...   140   3e-31   
gi|154310284|ref|XP_001554474.1| hypothetical protein BC1G_07062...   140   3e-31   
gi|366994001|ref|XP_003676765.1| hypothetical protein NCAS_0E033...   140   3e-31   
gi|471560222|gb|EMR62377.1| putative vacuolar transporter chaper...   140   4e-31   
gi|46109100|ref|XP_381608.1| hypothetical protein FG01432.1 [Fus...   140   4e-31   
gi|392579896|gb|EIW73023.1| hypothetical protein TREMEDRAFT_3711...   140   4e-31   
gi|154289345|ref|XP_001545305.1| negative regulator of cdc42p [B...   140   5e-31   
gi|406860692|gb|EKD13749.1| negative regulator of cdc42p [Marsso...   140   5e-31   
gi|213407636|ref|XP_002174589.1| vacuolar transporter chaperone ...   140   5e-31   
gi|392580372|gb|EIW73499.1| hypothetical protein TREMEDRAFT_5967...   140   6e-31   
gi|500261041|gb|EOO03444.1| putative vacuolar transporter chaper...   140   7e-31   
gi|365987441|ref|XP_003670552.1| hypothetical protein NDAI_0E049...   139   8e-31   
gi|115385841|ref|XP_001209467.1| conserved hypothetical protein ...   139   8e-31   
gi|307104357|gb|EFN52611.1| hypothetical protein CHLNCDRAFT_5881...   139   8e-31   
gi|398388996|ref|XP_003847959.1| vacuolar transporter chaperone ...   139   8e-31   
gi|365761072|gb|EHN02748.1| Vtc1p [Saccharomyces cerevisiae x Sa...   139   8e-31   
gi|401838779|gb|EJT42235.1| VTC1-like protein [Saccharomyces kud...   139   9e-31   
gi|401626003|gb|EJS43971.1| vtc1p [Saccharomyces arboricola H-6]      139   9e-31   
gi|6320916|ref|NP_010995.1| Vtc1p [Saccharomyces cerevisiae S288...   139   1e-30   
gi|365766095|gb|EHN07596.1| Vtc1p [Saccharomyces cerevisiae x Sa...   139   1e-30   
gi|384496219|gb|EIE86710.1| hypothetical protein RO3G_11421 [Rhi...   139   1e-30   
gi|452985144|gb|EME84901.1| hypothetical protein MYCFIDRAFT_4140...   139   1e-30   
gi|443898294|dbj|GAC75631.1| mismatch repair ATPase MSH4 [Pseudo...   138   2e-30   
gi|19115828|ref|NP_594916.1| polyphosphate synthetase (predicted...   138   2e-30   
gi|407928456|gb|EKG21312.1| hypothetical protein MPH_01304 [Macr...   138   2e-30   
gi|485927523|gb|EOD51502.1| putative vacuolar transporter chaper...   137   3e-30   
gi|511003750|gb|EPB85141.1| hypothetical protein HMPREF1544_0811...   137   4e-30   
gi|367005248|ref|XP_003687356.1| hypothetical protein TPHA_0J010...   137   5e-30   
gi|50305177|ref|XP_452547.1| hypothetical protein [Kluyveromyces...   137   5e-30   
gi|255710761|ref|XP_002551664.1| KLTH0A04774p [Lachancea thermot...   137   5e-30   
gi|254580069|ref|XP_002496020.1| ZYRO0C08602p [Zygosaccharomyces...   137   5e-30   
gi|156835831|ref|XP_001642177.1| hypothetical protein Kpol_147p2...   136   6e-30   
gi|429851689|gb|ELA26867.1| vacuolar transporter chaperone 2 [Co...   136   7e-30   
gi|403218294|emb|CCK72785.1| hypothetical protein KNAG_0L01650 [...   136   9e-30   
gi|255948646|ref|XP_002565090.1| Pc22g11430 [Penicillium chrysog...   135   1e-29   
gi|440471064|gb|ELQ40101.1| vacuolar transporter chaperone 1 [Ma...   135   1e-29   
gi|367017512|ref|XP_003683254.1| hypothetical protein TDEL_0H018...   135   2e-29   
gi|511003752|gb|EPB85143.1| hypothetical protein HMPREF1544_0811...   135   2e-29   
gi|410084539|ref|XP_003959846.1| hypothetical protein KAFR_0L010...   134   3e-29   
gi|259484591|tpe|CBF80946.1| TPA: SPX domain protein (AFU_orthol...   134   4e-29   
gi|444318269|ref|XP_004179792.1| hypothetical protein TBLA_0C047...   134   4e-29   
gi|425774715|gb|EKV13016.1| hypothetical protein PDIG_40400 [Pen...   134   4e-29   
gi|402072969|gb|EJT68627.1| vacuolar transporter chaperone 1 [Ga...   134   4e-29   
gi|511007666|gb|EPB88949.1| hypothetical protein HMPREF1544_0420...   134   4e-29   
gi|225558872|gb|EEH07155.1| vacuolar transporter chaperone 1 [Aj...   134   4e-29   
gi|358368964|dbj|GAA85580.1| SPX domain protein [Aspergillus kaw...   134   4e-29   
gi|389640611|ref|XP_003717938.1| vacuolar transporter chaperone ...   134   5e-29   
gi|242767434|ref|XP_002341367.1| vacuolar transporter chaperon V...   133   5e-29   
gi|347831622|emb|CCD47319.1| similar to vacuolar transporter cha...   133   6e-29   
gi|154293980|ref|XP_001547434.1| hypothetical protein BC1G_14169...   133   6e-29   
gi|358378306|gb|EHK15988.1| hypothetical protein TRIVIDRAFT_3952...   133   7e-29   
gi|295668072|ref|XP_002794585.1| vacuolar transporter chaperone ...   133   7e-29   
gi|406604685|emb|CCH43881.1| Vacuolar transporter chaperone 2 [W...   133   8e-29   
gi|327302222|ref|XP_003235803.1| vacuolar transporter chaperone ...   132   1e-28   
gi|315039513|ref|XP_003169132.1| vacuolar transporter chaperone ...   132   1e-28   
gi|358397060|gb|EHK46435.1| hypothetical protein TRIATDRAFT_1325...   132   1e-28   
gi|212528042|ref|XP_002144178.1| vacuolar transporter chaperon V...   132   1e-28   
gi|302659201|ref|XP_003021294.1| hypothetical protein TRV_04607 ...   132   2e-28   
gi|513031194|gb|AGO11218.1| AaceriACL045Wp [Saccharomycetaceae s...   132   2e-28   
gi|50294968|ref|XP_449895.1| hypothetical protein [Candida glabr...   132   2e-28   
gi|302503853|ref|XP_003013886.1| hypothetical protein ARB_07998 ...   132   2e-28   
gi|119496339|ref|XP_001264943.1| SPX domain protein [Neosartorya...   132   2e-28   
gi|512192398|gb|EPE08157.1| vacuolar transporter chaperone 1 [Op...   131   2e-28   
gi|169763912|ref|XP_001727856.1| vacuolar transporter chaperone ...   131   2e-28   
gi|261205926|ref|XP_002627700.1| vacuolar transporter chaperone ...   131   2e-28   
gi|387592934|gb|EIJ87958.1| hypothetical protein NEQG_02030 [Nem...   130   5e-28   
gi|378729448|gb|EHY55907.1| vacuolar transporter chaperone 1 [Ex...   130   5e-28   
gi|453080534|gb|EMF08585.1| vacuolar transporter chaperone 1 [My...   130   5e-28   
gi|512205706|gb|EPE34527.1| hypothetical protein GLAREA_10221 [G...   129   7e-28   
gi|225679732|gb|EEH18016.1| vacuolar transporter chaperone 1 [Pa...   129   1e-27   
gi|322701792|gb|EFY93540.1| SPX domain protein [Metarhizium acri...   128   2e-27   
gi|384490657|gb|EIE81879.1| hypothetical protein RO3G_06584 [Rhi...   127   3e-27   
gi|85080508|ref|XP_956556.1| vacuolar transporter chaperone 1 [N...   127   3e-27   
gi|384496029|gb|EIE86520.1| hypothetical protein RO3G_11231 [Rhi...   127   5e-27   
gi|340517704|gb|EGR47947.1| predicted protein [Trichoderma reese...   126   8e-27   
gi|406701286|gb|EKD04435.1| hypothetical protein A1Q2_01211 [Tri...   126   1e-26   
gi|303320521|ref|XP_003070260.1| Vacuolar transporter chaperone ...   125   2e-26   
gi|393240898|gb|EJD48422.1| vacuolar transporter chaperone 1 [Au...   125   2e-26   
gi|258568702|ref|XP_002585095.1| vacuolar transporter chaperone ...   125   2e-26   
gi|255710577|ref|XP_002551572.1| KLTH0A02640p [Lachancea thermot...   125   2e-26   
gi|443927003|gb|ELU45540.1| SCF E3 ubiquitin ligase complex F-bo...   125   2e-26   
gi|409050252|gb|EKM59729.1| hypothetical protein PHACADRAFT_1581...   124   3e-26   
gi|134107073|ref|XP_777849.1| hypothetical protein CNBA5460 [Cry...   124   4e-26   
gi|321249592|ref|XP_003191502.1| vacuole fusion, non-autophagic-...   123   5e-26   
gi|58258951|ref|XP_566888.1| vacuole fusion, non-autophagic-rela...   123   5e-26   
gi|396081615|gb|AFN83231.1| putative polyphosphate synthetase Vt...   123   8e-26   
gi|119184684|ref|XP_001243219.1| hypothetical protein CIMG_07115...   122   9e-26   
gi|156050521|ref|XP_001591222.1| hypothetical protein SS1G_07848...   122   9e-26   
gi|511007473|gb|EPB88760.1| hypothetical protein HMPREF1544_0440...   122   1e-25   
gi|303389742|ref|XP_003073103.1| putative polyphosphate syntheta...   121   2e-25   
gi|397642403|gb|EJK75212.1| hypothetical protein THAOC_03076 [Th...   120   5e-25   
gi|50425261|ref|XP_461222.1| DEHA2F20152p [Debaryomyces hansenii...   120   5e-25   
gi|224013341|ref|XP_002295322.1| predicted protein [Thalassiosir...   120   6e-25   
gi|260945205|ref|XP_002616900.1| hypothetical protein CLUG_02344...   120   7e-25   
gi|67537946|ref|XP_662747.1| hypothetical protein AN5143.2 [Aspe...   119   8e-25   
gi|401842531|gb|EJT44701.1| VTC2-like protein [Saccharomyces kud...   119   1e-24   
gi|402468707|gb|EJW03825.1| hypothetical protein EDEG_01883 [Edh...   119   1e-24   
gi|511007472|gb|EPB88759.1| hypothetical protein HMPREF1544_0439...   119   2e-24   
gi|511002819|gb|EPB84243.1| hypothetical protein HMPREF1544_0903...   118   2e-24   
gi|156059376|ref|XP_001595611.1| hypothetical protein SS1G_03700...   118   2e-24   
gi|254568968|ref|XP_002491594.1| Vacuolar membrane protein invol...   117   3e-24   
gi|440636400|gb|ELR06319.1| hypothetical protein GMDG_07910 [Geo...   116   6e-24   
gi|398406777|ref|XP_003854854.1| hypothetical protein MYCGRDRAFT...   116   7e-24   
gi|384483593|gb|EIE75773.1| hypothetical protein RO3G_00477 [Rhi...   116   9e-24   
gi|45185643|ref|NP_983359.1| ACL045Wp [Ashbya gossypii ATCC 1089...   115   1e-23   
gi|401625919|gb|EJS43899.1| vtc2p [Saccharomyces arboricola H-6]      115   2e-23   
gi|452986115|gb|EME85871.1| hypothetical protein MYCFIDRAFT_8819...   114   5e-23   
gi|452846110|gb|EME48043.1| hypothetical protein DOTSEDRAFT_1675...   113   6e-23   
gi|384491576|gb|EIE82772.1| hypothetical protein RO3G_07477 [Rhi...   113   7e-23   
gi|317137723|ref|XP_001727915.2| vacuolar transporter chaperone ...   112   1e-22   
gi|238490015|ref|XP_002376245.1| SPX domain protein [Aspergillus...   112   1e-22   
gi|406864467|gb|EKD17512.1| VTC domain-containing protein [Marss...   112   1e-22   
gi|440492935|gb|ELQ75461.1| putative VTC domain, Protein of unkn...   112   1e-22   
gi|429965481|gb|ELA47478.1| hypothetical protein VCUG_01010 [Vav...   112   1e-22   
gi|83770943|dbj|BAE61076.1| unnamed protein product [Aspergillus...   112   2e-22   
gi|346325622|gb|EGX95219.1| SPX domain protein [Cordyceps milita...   110   5e-22   
gi|440631764|gb|ELR01683.1| hypothetical protein GMDG_00059 [Geo...   110   7e-22   
gi|336272007|ref|XP_003350761.1| hypothetical protein SMAC_02432...   109   8e-22   
gi|407917993|gb|EKG11292.1| hypothetical protein MPH_11637 [Macr...   109   8e-22   
gi|494824468|gb|EON61759.1| hypothetical protein W97_00975 [Coni...   108   2e-21   
gi|453087506|gb|EMF15547.1| SPX domain protein [Mycosphaerella p...   108   2e-21   
gi|378754828|gb|EHY64856.1| hypothetical protein NERG_01912 [Nem...   108   2e-21   
gi|296810256|ref|XP_002845466.1| SPX domain-containing protein [...   108   3e-21   
gi|448106397|ref|XP_004200737.1| Piso0_003333 [Millerozyma farin...   107   4e-21   
gi|512193062|gb|EPE08820.1| vacuolar transporter chaperone 2 [Op...   107   4e-21   
gi|485925113|gb|EOD49762.1| putative spx domain protein [Neofusi...   107   5e-21   
gi|396477916|ref|XP_003840408.1| hypothetical protein LEMA_P1006...   107   6e-21   
gi|330941910|ref|XP_003306095.1| hypothetical protein PTT_19128 ...   106   6e-21   
gi|45201076|ref|NP_986646.1| AGL020Wp [Ashbya gossypii ATCC 1089...   106   7e-21   
gi|345564444|gb|EGX47407.1| hypothetical protein AOL_s00083g500 ...   106   7e-21   
gi|85083710|ref|XP_957168.1| hypothetical protein NCU01745 [Neur...   106   9e-21   
gi|336468374|gb|EGO56537.1| hypothetical protein NEUTE1DRAFT_123...   106   1e-20   
gi|119196207|ref|XP_001248707.1| hypothetical protein CIMG_02478...   106   1e-20   
gi|392862080|gb|EAS37313.2| SPX domain-containing protein [Cocci...   106   1e-20   
gi|303321970|ref|XP_003070979.1| SPX domain containing protein [...   106   1e-20   
gi|440469179|gb|ELQ38299.1| vacuolar transporter chaperone 2 [Ma...   105   1e-20   
gi|389635477|ref|XP_003715391.1| vacuolar transporter chaperone ...   105   2e-20   
gi|449300198|gb|EMC96210.1| hypothetical protein BAUCODRAFT_3355...   105   2e-20   
gi|242806939|ref|XP_002484848.1| SPX domain protein [Talaromyces...   104   2e-20   
gi|169805984|ref|XP_001827737.1| phosphate regulated protein [En...   104   4e-20   
gi|323309404|gb|EGA62621.1| Vtc1p [Saccharomyces cerevisiae Fost...   103   4e-20   
gi|302510749|ref|XP_003017326.1| hypothetical protein ARB_04206 ...   103   5e-20   
gi|116204977|ref|XP_001228299.1| hypothetical protein CHGG_10372...   103   5e-20   
gi|326472272|gb|EGD96281.1| SPX domain-containing protein [Trich...   103   6e-20   
gi|159130946|gb|EDP56059.1| SPX domain protein [Aspergillus fumi...   103   7e-20   
gi|70991248|ref|XP_750473.1| SPX domain protein [Aspergillus fum...   103   7e-20   
gi|315044941|ref|XP_003171846.1| vacuolar transporter chaperone ...   103   8e-20   
gi|477532732|gb|ENH84338.1| vacuolar transporter chaperone 2 [Co...   102   1e-19   
gi|367055260|ref|XP_003658008.1| hypothetical protein THITE_2124...   102   1e-19   
gi|302666306|ref|XP_003024754.1| hypothetical protein TRV_01103 ...   102   1e-19   
gi|350635980|gb|EHA24341.1| hypothetical protein ASPNIDRAFT_2092...   102   1e-19   
gi|346972167|gb|EGY15619.1| vacuolar transporter chaperone 2 [Ve...   102   1e-19   
gi|239613612|gb|EEQ90599.1| SPX domain-containing protein [Ajell...   102   2e-19   
gi|327352624|gb|EGE81481.1| SPX domain-containing protein [Ajell...   102   2e-19   
gi|471569275|gb|EMR68696.1| putative vacuolar transporter chaper...   102   2e-19   
gi|261192976|ref|XP_002622894.1| SPX domain-containing protein [...   102   2e-19   
gi|145238816|ref|XP_001392055.1| vacuolar transporter chaperone ...   101   2e-19   
gi|320585921|gb|EFW98600.1| spx domain containing protein [Grosm...   101   2e-19   
gi|154287088|ref|XP_001544339.1| conserved hypothetical protein ...   101   2e-19   
gi|511003751|gb|EPB85142.1| hypothetical protein HMPREF1544_0811...   101   2e-19   
gi|258569825|ref|XP_002543716.1| conserved hypothetical protein ...   101   2e-19   
gi|367035738|ref|XP_003667151.1| hypothetical protein MYCTH_2312...   101   3e-19   
gi|325094799|gb|EGC48109.1| SPX domain-containing protein [Ajell...   101   3e-19   
gi|302409470|ref|XP_003002569.1| vacuolar transporter chaperone ...   100   4e-19   
gi|295659084|ref|XP_002790101.1| vacuolar transporter chaperone ...   100   4e-19   
gi|402084079|gb|EJT79097.1| vacuolar transporter chaperone 2 [Ga...   100   5e-19   
gi|320580924|gb|EFW95146.1| Vacuolar membrane protein [Ogataea p...   100   5e-19   
gi|240273768|gb|EER37287.1| SPX domain-containing protein [Ajell...   100   6e-19   
gi|296419702|ref|XP_002839436.1| hypothetical protein [Tuber mel...   100   6e-19   
gi|212538317|ref|XP_002149314.1| SPX domain protein [Talaromyces...   100   6e-19   
gi|225683006|gb|EEH21290.1| SPX domain-containing protein [Parac...   100   1e-18   
gi|340992612|gb|EGS23167.1| hypothetical protein CTHT_0008280 [C...    99   1e-18   
gi|399166563|emb|CCE32546.1| related to VTC2-putative polyphosph...    99   1e-18   
gi|226290456|gb|EEH45940.1| vacuolar transporter chaperone 3 [Pa...    99   1e-18   
gi|207340467|gb|EDZ68805.1| YPL019Cp-like protein [Saccharomyces...    99   1e-18   
gi|392295992|gb|EIW07095.1| Vtc3p [Saccharomyces cerevisiae CEN....    99   1e-18   
gi|365762475|gb|EHN04009.1| Vtc3p [Saccharomyces cerevisiae x Sa...    99   1e-18   
gi|6325238|ref|NP_015306.1| Vtc3p [Saccharomyces cerevisiae S288...    99   1e-18   
gi|259150137|emb|CAY86940.1| Vtc3p [Saccharomyces cerevisiae EC1...    99   1e-18   
gi|50308979|ref|XP_454495.1| hypothetical protein [Kluyveromyces...    99   2e-18   
gi|151942773|gb|EDN61119.1| vacuolar transporter chaperone [Sacc...    98   3e-18   
gi|171689132|ref|XP_001909506.1| hypothetical protein [Podospora...    96   2e-17   
gi|378728432|gb|EHY54891.1| hypothetical protein HMPREF1120_0305...    96   2e-17   


>gi|50548463|ref|XP_501701.1| YALI0C10945p [Yarrowia lipolytica]
 gi|49647568|emb|CAG82010.1| YALI0C10945p [Yarrowia lipolytica CLIB122]
          Length = 736

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 207/358 (57%), Gaps = 48/358 (13%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRRMDIG+D+PF++LP+ ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 381 MVREDNFDGQNR--TNGNWRRMDIGVDWPFNQLPEKDVLRFPYAVLEVKLQTQLGQEPPA 438

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFR-LERP 119
           WV+ELV SHLVEAVPKFSKFIHG ATL+    + L PFWLPQMD+DIRKP + F+ +ER 
Sbjct: 439 WVRELVSSHLVEAVPKFSKFIHGCATLLPD-MVDLIPFWLPQMDVDIRKPATTFQGIERA 497

Query: 120 SASNPTT---------------------PANERGN------PFSGTXXXXXXXXXXXXXX 152
             ++ ++                        ER         F+G               
Sbjct: 498 QVASGSSVSGSDELDDLDDLDDNEGNYLDEEERAGGADGHVSFNGNGAVASSSNGTASSS 557

Query: 153 XXXXXXXN----TPLLSESSQNT---NTQLRSTPHISSLEELEEYLATVTPAGKVPKTY- 204
                  N    TPLL   S +T   N  L+S  + S   + + ++A      KVP    
Sbjct: 558 AAANTSPNATENTPLLGSGSGHTGGDNALLKSLKNASDWFK-DTFIAGKDDFSKVPPGTV 616

Query: 205 --------HGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAA 256
                    GK+I++PVRVEPKV+FANERTFLSW+   ++LG  A  LLN+GD++ + AA
Sbjct: 617 FDTRVVVPAGKRISVPVRVEPKVYFANERTFLSWIEIGILLGAIAGTLLNYGDRLAIQAA 676

Query: 257 SFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
                  ++ +LY++G YLWRV  IR++ +  Y+D+ GPT ICI+L +++  NF  RL
Sbjct: 677 FGFFISAVITILYSIGMYLWRVYNIRRKRAIRYDDQIGPTAICIVLALAIGANFVARL 734



>gi|511011714|gb|EPB92922.1| hypothetical protein HMPREF1544_00361 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 700

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 147/335 (43%), Positives = 201/335 (60%), Gaps = 35/335 (10%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN   N  +RSG+NWRRMDIG+DYPF +LPD +I RFPYA+LEVKLQTQ+GQEPP+
Sbjct: 376 LIREDN---NGAVRSGDNWRRMDIGVDYPFKQLPDSDICRFPYAVLEVKLQTQFGQEPPQ 432

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W+ ELV SHLVE+VPKFSKFIHG ATL++ + I + PFWLPQM+IDIRKP +N F ++RP
Sbjct: 433 WITELVNSHLVESVPKFSKFIHGCATLLEDK-INVLPFWLPQMEIDIRKPETNAFGVKRP 491

Query: 120 SASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTP 179
            A + ++ + +     SGT                     +TPLL             T 
Sbjct: 492 EAIHSSSTSFDSI---SGTNDGSKLTTVDSVQITMAEATESTPLLPPRP--------GTA 540

Query: 180 HISSLEELEEYLATVTPAG------------KVPKTYHGKKI------AIPVRVEP-KVF 220
             +  EE    L  ++PAG            +     H ++       A+PV   P K F
Sbjct: 541 RHAEQEEGSNILKQLSPAGLQTVFNKSKTIFRRKNAQHQRQASQPRSRAVPVAAPPAKTF 600

Query: 221 FANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKK 280
           FANERTFLSWL F+++LG  +IGLLNF D +   +A     + + VM+YAL  +  R   
Sbjct: 601 FANERTFLSWLRFTLLLGALSIGLLNFSDHVGRVSAVIFTLLAVGVMIYALYNFHVRANS 660

Query: 281 IRKRESGPYEDRYGPTFICIMLLISVTINFWLRLH 315
           I ++E G + D+YGP  +   ++++V+INF+LRL+
Sbjct: 661 IARKEVGDFSDKYGPAVLTTFMVVAVSINFYLRLN 695



>gi|254569318|ref|XP_002491769.1| Vacuolar membrane protein involved in vacuolar polyphosphate
           accumulation [Komagataella pastoris GS115]
 gi|238031566|emb|CAY69489.1| Vacuolar membrane protein involved in vacuolar polyphosphate
           accumulation [Komagataella pastoris GS115]
 gi|328351732|emb|CCA38131.1| Vacuolar transporter chaperone 4 [Komagataella pastoris CBS 7435]
          Length = 704

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/326 (44%), Positives = 197/326 (60%), Gaps = 20/326 (6%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDNF+   R  + NNWRRMDIGIDYPFS+LP+ ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 389 LVREDNFDGIDR--TQNNWRRMDIGIDYPFSQLPEKDVCRFPYAVLEVKLQTQLGQEPPA 446

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPS 120
           WV+E+V SHLVEAVPKFSKFIHG ATL+   ++ L PFWLPQMDIDIRKP +N   +R  
Sbjct: 447 WVKEMVGSHLVEAVPKFSKFIHGCATLL-PEKVDLIPFWLPQMDIDIRKPRNN---QRFG 502

Query: 121 ASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTPH 180
             +     NE G                           + P     S N+ T    T  
Sbjct: 503 IKHRENLGNENGIGSGNDLDEEESTGIPQLPLANGAFQSSHPASHPYSANSTT----TNC 558

Query: 181 ISSLEELEEYLATV------TPAGKVPKTYH----GKKIAIPVRVEPKVFFANERTFLSW 230
           I+S ++    +  V       P+G V         GKKIA+P+RVEPKV+FA ERT+LSW
Sbjct: 559 IASFKKWWREVRAVDDSFRKVPSGTVFDVSFSAPPGKKIAVPIRVEPKVYFATERTYLSW 618

Query: 231 LNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYE 290
           L+ ++++GG A  LL++GDK++  A+        + +LY++G YLWRV  IR++ +  Y+
Sbjct: 619 LSIAMIIGGTATLLLSYGDKVSFIASIGFFITATVTILYSMGVYLWRVVNIRRKRAIRYD 678

Query: 291 DRYGPTFICIMLLISVTINFWLRLHE 316
           D+ GP  I   L +S+ ++F  R+ +
Sbjct: 679 DQLGPRCIAACLALSIGLSFVFRVMD 704



>gi|189210858|ref|XP_001941760.1| negative regulator of cdc42p [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187977853|gb|EDU44479.1| negative regulator of cdc42p [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 693

 Score =  259 bits (661), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 187/317 (58%), Gaps = 23/317 (7%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   + RSG+NWRR DIG+D+PF +LP  + E FPYA+LEVKLQTQ G EPP+
Sbjct: 381 MTREDNLDG--KKRSGDNWRRTDIGVDWPFKQLPKEDKELFPYAVLEVKLQTQAGGEPPQ 438

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W+++L  SHLVEAVPKFSK+IHG ATL + ++I L P+W PQMD+DIRKP ++ F +ERP
Sbjct: 439 WIRDLTSSHLVEAVPKFSKYIHGTATL-NPKRIHLIPYWYPQMDVDIRKPVTHKFGIERP 497

Query: 120 SASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTP 179
            ASN  + +   GN                            PL  E+        + TP
Sbjct: 498 GASNDISTS---GN--------------LDDDSDDDDDAVELPLEREAFVTHEIIPKPTP 540

Query: 180 HISSLEELEEYLATVTPAGKVP--KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVL 237
                      + T    G+V   K   GK+I +PVRVEPKV  A ERTFLSWL FS+++
Sbjct: 541 TDVGDGGFSLGVPTWKQQGEVKRFKAPKGKRIHVPVRVEPKVQLATERTFLSWLEFSILI 600

Query: 238 GGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTF 297
           G  A  LLNFGD +   AA     +  + + Y+ G YLWRV KI++R +  Y DR+GPT 
Sbjct: 601 GSIAATLLNFGDSLAFAAAWAFTVIACIALCYSAGLYLWRVNKIKERRAVTYHDRWGPTL 660

Query: 298 ICIMLLISVTINFWLRL 314
           +C  L  +V ++F  R+
Sbjct: 661 LCAGLFFAVAMSFGFRV 677



>gi|328774367|gb|EGF84404.1| hypothetical protein BATDEDRAFT_18676 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 706

 Score =  256 bits (653), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 199/338 (58%), Gaps = 33/338 (9%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDNF    R RSG+NWRRMD G   PFS LP+ ++  FPYA+LEVKLQTQ+G E P 
Sbjct: 379 MIREDNF---GRPRSGDNWRRMDAGTIAPFSHLPEEDLCAFPYAVLEVKLQTQHGTEAPA 435

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-------SN 113
           WV EL+ SHLVE VPKFSKFIHGV+TL+++R + L PFWLPQMD DIRKP        S 
Sbjct: 436 WVTELINSHLVEEVPKFSKFIHGVSTLLENR-VSLLPFWLPQMDRDIRKPAPARPASVST 494

Query: 114 FRLERPSASNPTTPANERGNPFSGTXX----------XXXXXXXXXXXXXXXXXXXNTPL 163
           F   RP  S       + G+  SG                                 +PL
Sbjct: 495 FIETRPKRSKLNL---KNGSDTSGEDRIEVLIDEGGPSTFGSNNRDHQCDDDDSRETSPL 551

Query: 164 LSESSQNTNTQLRSTPHIS-----SLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEPK 218
           L   S   +   +  P I+      +  + +   +VT  G +P  +  K+IA+PVRVEPK
Sbjct: 552 LGRGS---SAPRKPQPAINWWTGMGMGSIFQAPPSVTANG-IPTQHLQKRIALPVRVEPK 607

Query: 219 VFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRV 278
           VFFANERTFLSWL+F +VLGG A+GLLNFGD +   +      V+MM M+YAL  + WR 
Sbjct: 608 VFFANERTFLSWLHFCIVLGGLALGLLNFGDAVGQISGLVFTLVSMMFMIYALLLFQWRA 667

Query: 279 KKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            KIR R++GPY+DR GPT +   L ++V INF+L+  +
Sbjct: 668 HKIRTRDAGPYDDRVGPTVLVFSLFLAVIINFYLKFSQ 705



>gi|50312119|ref|XP_456091.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645227|emb|CAG98799.1| KLLA0F22627p [Kluyveromyces lactis]
          Length = 729

 Score =  256 bits (653), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 146/349 (41%), Positives = 197/349 (56%), Gaps = 38/349 (10%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+ + R  +  NWRRMDIG+D+PF++LP+ +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 383 MVREDNFDGHDR--TNGNWRRMDIGVDWPFNQLPEKDICRFPYAVLEVKLQTQMGQEPPE 440

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVA+L++ R +   PFWLPQMD+DIRKP  P++  + R
Sbjct: 441 WVRELVGSHLVEPVPKFSKFIHGVASLLNDR-VSSIPFWLPQMDVDIRKPAIPTHINITR 499

Query: 119 PSASNP-----------TTPAN----ERGNPFSGTX-XXXXXXXXXXXXXXXXXXXXNTP 162
           P   +              P N    E     +GT                      NT 
Sbjct: 500 PGRDDEDEYEDTEDEELAAPGNSYDIEEAAGEAGTAPAGQSSTGNYGSITQDSARAGNTA 559

Query: 163 LLSESSQNTNTQLRSTPHISS---------LEELEEYL----ATVTPAGKVPKTY-H--- 205
               +S+N+   LR+    S+         + +++ YL     +  P G V  TY H   
Sbjct: 560 DSPAASENSAALLRNIRQASNPVAKYWHTLVYQIDHYLYGDQVSKVPEGTVFDTYVHAPP 619

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK I +PVRVEPKV+FA ERT LSW++  +VLGG +   L +G   T+ A++      + 
Sbjct: 620 GKTICVPVRVEPKVYFATERTLLSWISIGLVLGGVSTSFLTYGTPTTMVASTGFFLTALF 679

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            + ++  TY  RV  IR + S  YED+YGP  IC  L+ S+   F+  L
Sbjct: 680 TIWFSTYTYCKRVVNIRMKRSIDYEDKYGPRMICAFLMASILFTFFCNL 728



>gi|241954508|ref|XP_002419975.1| vacuolar transporter chaperone, putative [Candida dubliniensis
           CD36]
 gi|223643316|emb|CAX42190.1| vacuolar transporter chaperone, putative [Candida dubliniensis
           CD36]
          Length = 709

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 191/329 (58%), Gaps = 31/329 (9%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRRMDIG+DYPF +LP+ ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 390 MVREDNFDGYDR--THGNWRRMDIGVDYPFPQLPEKDVCRFPYAVLEVKLQTQLGQEPPA 447

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP----SNFRL 116
           WV++LV SHLVEAVPKFSKFIHG ATL+ +  + L PFW  QMD+DIRKP        R 
Sbjct: 448 WVRDLVTSHLVEAVPKFSKFIHGGATLL-TDYVNLLPFWYTQMDVDIRKPKIQQEYGIRR 506

Query: 117 ERPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLR 176
             PS    +T ANE                              +PLL ++S       R
Sbjct: 507 NAPSRIESSTSANELDEEELSGYSGSGVQFSNDVNPLEEDLEETSPLLFQNSH------R 560

Query: 177 STPHISSLEELEEYLA-----TV----------TPAGKVPKTYHGKKIAIPVRVEPKVFF 221
           S    S L +L+ Y       TV          T   K+PK   GK I +P+R+EPKV+ 
Sbjct: 561 SRHGNSLLNQLKNYFKDDREFTVKEGTNFDLNGTFKDKLPK---GKSICVPIRIEPKVYL 617

Query: 222 ANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKKI 281
           ANERTFLSWL+  +++GG A  LLN+G   T+TA+       + ++ Y+   YLWRV  I
Sbjct: 618 ANERTFLSWLSVGMLIGGVATALLNYGSNSTLTASIGFFIAALFIIGYSTYRYLWRVLMI 677

Query: 282 RKRESGPYEDRYGPTFICIMLLISVTINF 310
           R++++  Y D++GP  IC ++ +++ IN+
Sbjct: 678 REKKAVEYGDKFGPNMICGVIFLAIFINY 706



>gi|255721583|ref|XP_002545726.1| vacuolar transporter chaperone 4 [Candida tropicalis MYA-3404]
 gi|240136215|gb|EER35768.1| vacuolar transporter chaperone 4 [Candida tropicalis MYA-3404]
          Length = 723

 Score =  253 bits (646), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 197/343 (57%), Gaps = 37/343 (10%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R +   NWRRMDIG+DYPFS+LP+ ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 390 MVREDDFDGYDRTQG--NWRRMDIGVDYPFSQLPEKDVCRFPYAVLEVKLQTQLGQEPPV 447

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN------- 113
           W++ELV SHLVEAVPKFSKFIHG ATL+ +  + L PFW  QMD+DIRKP +        
Sbjct: 448 WIRELVASHLVEAVPKFSKFIHGGATLL-TDHVDLLPFWYTQMDVDIRKPKTQSEIGIQR 506

Query: 114 ---FRLERPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLL---SES 167
               R+ER S S       E     +G+                     NTPLL   + S
Sbjct: 507 NTPARIERSSTSGNDLDEEE----LTGSSYTTGVHFSNDYNPLEDDLDENTPLLLPNTYS 562

Query: 168 SQNTNTQLRSTPHISSLEEL----EEYLATVTPA----------GKVPKTYHGKKIAIPV 213
           S+++++ +R+  +      L    ++   TV P            K+PK   GK I +PV
Sbjct: 563 SRHSSSPVRNFLYHWYGRFLHFFNDDRTFTVKPGTNWDLNATFKDKLPK---GKTICVPV 619

Query: 214 RVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGT 273
           R+EPKV+FANERTFLSWL+  ++LG  A  LLN+G K  +T++       +  + Y+   
Sbjct: 620 RIEPKVYFANERTFLSWLSMGMLLGAVATTLLNYGSKSALTSSIGFFITAIFTIAYSTYK 679

Query: 274 YLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           YLWRV  IR+++   Y D++GP  IC  + ++  + F  +  E
Sbjct: 680 YLWRVLMIREKKVTAYGDKFGPNMICAFIFLATFVTFLFKYSE 722



>gi|320580414|gb|EFW94637.1| Vacuolar membrane protein [Ogataea parapolymorpha DL-1]
          Length = 701

 Score =  252 bits (644), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 135/322 (41%), Positives = 191/322 (59%), Gaps = 16/322 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRRMDIG++YPF+ LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 386 MVREDNFDGIDR--THGNWRRMDIGVNYPFANLPPKDVERFPYAVLEVKLQTQMGQEPPQ 443

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS--NFRLER 118
           WV+E+V SHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMD+DI+KP    N+ + R
Sbjct: 444 WVKEMVSSHLVEAVPKFSKFIHGCATLLSDR-VDLIPFWLPQMDVDIKKPKKDENYGIVR 502

Query: 119 PSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRST 178
                 T   +   +                          N  +   S    NT +R  
Sbjct: 503 ---QRHTESGHGELDEEELAGSSLSSGSAAPHYGSVSFNENNNRIEETSDPENNTLIRRL 559

Query: 179 PHISSLEELE--EYLATVTPAGKVPKTYH----GKKIAIPVRVEPKVFFANERTFLSWLN 232
             +S  +E+   ++     P G V         GKKI++ VRVEPKV+FA ERT+LSWL+
Sbjct: 560 --VSWYKEITKPDHSFNKVPEGTVFDAKFTAPPGKKISVVVRVEPKVYFATERTYLSWLS 617

Query: 233 FSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDR 292
            +++ G  A  LLN+GD +++  ++   F  ++ ++Y+   Y++RV  IR + +  Y+D+
Sbjct: 618 IALIFGATAHTLLNYGDLVSLITSTCFYFTAILTIVYSTYVYIFRVVNIRNKRAVRYDDK 677

Query: 293 YGPTFICIMLLISVTINFWLRL 314
           +GP  +C  L +SV +NF  RL
Sbjct: 678 FGPVLVCSALALSVFVNFLFRL 699



>gi|255711200|ref|XP_002551883.1| KLTH0B02156p [Lachancea thermotolerans]
 gi|238933261|emb|CAR21445.1| KLTH0B02156p [Lachancea thermotolerans CBS 6340]
          Length = 713

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/335 (41%), Positives = 192/335 (57%), Gaps = 26/335 (7%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R +   NWRRMDIG+D+PF +LP+ +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGYDRTKG--NWRRMDIGVDWPFKQLPEKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++++ +   PFWLPQMD+DIRKP  P++  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNNK-VESIPFWLPQMDVDIRKPPIPTHINISR 498

Query: 119 PSAS----------NPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESS 168
           P  S          N + PA    +P                          + +L   +
Sbjct: 499 PGRSDNDSDDDLYTNESHPAGNLMDPEERVGYGAIEGGDPQNSQPAADQHSASAVLQRKA 558

Query: 169 QN-TNTQLRSTPHISSLEELEEYL----ATVTPAGKVPKTYH----GKKIAIPVRVEPKV 219
           +N +N   R    + +   ++ YL     T  P G V  T      GK I +PVRVEPKV
Sbjct: 559 RNASNPVTRMFYQVGAA--VDHYLHGDQVTKVPQGTVFDTEVRAPPGKTICVPVRVEPKV 616

Query: 220 FFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVK 279
           +FA ERTFLSW++  ++  G AI +L +G + T+ A+       ++ ++Y    Y  RV 
Sbjct: 617 YFATERTFLSWMSIGLIFNGVAISMLTYGTRTTMVASVGFFLTALVTIIYNAYVYCKRVV 676

Query: 280 KIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            IR + +  Y+D+ GP  +C  LL S   +F+ +L
Sbjct: 677 NIRLKRAIDYQDKVGPPLVCACLLASTIFSFYCKL 711



>gi|68489079|ref|XP_711605.1| hypothetical protein CaO19.10871 [Candida albicans SC5314]
 gi|68489124|ref|XP_711583.1| hypothetical protein CaO19.3363 [Candida albicans SC5314]
 gi|46432897|gb|EAK92359.1| hypothetical protein CaO19.3363 [Candida albicans SC5314]
 gi|46432921|gb|EAK92382.1| hypothetical protein CaO19.10871 [Candida albicans SC5314]
 gi|238881520|gb|EEQ45158.1| vacuolar transporter chaperone 4 [Candida albicans WO-1]
          Length = 709

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 137/323 (42%), Positives = 189/323 (58%), Gaps = 19/323 (5%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRRMDIG+DYPF +LP+ ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 390 MVREDNFDGYDR--THGNWRRMDIGVDYPFPQLPEKDVCRFPYAVLEVKLQTQMGQEPPA 447

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP----SNFRL 116
           WV++LV SHLVEAVPKFSKFIHG ATL+ +  + L PFW  QMD+DIRKP        R 
Sbjct: 448 WVRDLVTSHLVEAVPKFSKFIHGGATLL-TDYVNLLPFWYTQMDVDIRKPKIQQEYGIRR 506

Query: 117 ERPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTN---- 172
             P     +T ANE                              +PLL ++S  +     
Sbjct: 507 NAPLRIESSTSANELDEEELSGYSGSGVQFSNDINPLEEDLEETSPLLFQNSHRSRQGNS 566

Query: 173 --TQLRS---TPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTF 227
              QL S        +++E   +    T   K+PK   GK I +P+R+EPKV+ ANERTF
Sbjct: 567 FFNQLMSYFKDDREFTVKEGTNFDLNGTFKDKLPK---GKSICVPIRIEPKVYLANERTF 623

Query: 228 LSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESG 287
           LSWL+  +++GG A  LLN+G   T+TA+       + ++ Y+   YLWRV  IR++++ 
Sbjct: 624 LSWLSVGMLIGGVATALLNYGSNSTLTASIGFFIAALFIIGYSTYKYLWRVLMIREKKAV 683

Query: 288 PYEDRYGPTFICIMLLISVTINF 310
            Y D++GP  IC ++ +++ IN+
Sbjct: 684 AYGDKFGPNMICGVIFLAIFINY 706



>gi|448124185|ref|XP_004204854.1| Piso0_000136 [Millerozyma farinosa CBS 7064]
 gi|358249487|emb|CCE72553.1| Piso0_000136 [Millerozyma farinosa CBS 7064]
          Length = 720

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 142/348 (40%), Positives = 196/348 (56%), Gaps = 45/348 (12%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRRMDIG+DYPFS+LP+ ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 385 MVREDNFDGIDR--TNGNWRRMDIGVDYPFSQLPEKDVCRFPYAVLEVKLQTQLGQEPPT 442

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--------- 111
           WV++LV SHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMD+DI+K           
Sbjct: 443 WVRDLVSSHLVEAVPKFSKFIHGCATLLPDR-VDLLPFWLPQMDVDIKKDKQQDDVGISR 501

Query: 112 SNFRLERPSASNPTTPA----NERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSES 167
           +  +++  S+           +ER   ++G                      ++PLL  S
Sbjct: 502 TQHKIKSSSSGGELDEEEMFDDERPTSYTGV------HFSNDVNPLEEDLDESSPLLLPS 555

Query: 168 SQNTNTQLRSTPHISSLEELEEYLA---------TVTP----------AGKVPKTYHGKK 208
             NT+   R  P    L++L  Y           T+ P          A KVP+   GK 
Sbjct: 556 GYNTDEAGRG-PISKFLDKLGGYFLHYFNDDRTFTIKPGVDFDLKKSLAHKVPE---GKS 611

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVML 268
           I IP+R+EPKV+FA ERTFL+W++  +VLG  A  LLN+G K  +TA+       + V++
Sbjct: 612 ICIPIRIEPKVYFATERTFLNWMSIGMVLGATATTLLNYGTKSALTASVGFFLTALFVLV 671

Query: 269 YALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           Y+   Y+WRV  IR + +  Y D+ GP  +CI   ++  + F  ++ E
Sbjct: 672 YSTINYIWRVLMIRNKAAVDYADKIGPNSVCIFFTVATFVTFIFKILE 719



>gi|459370019|gb|EMG48228.1| Vacuolar transporter chaperone 4 [Candida maltosa Xu316]
          Length = 720

 Score =  249 bits (637), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 143/337 (42%), Positives = 196/337 (58%), Gaps = 28/337 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRRMDIG+DYPF +LPD ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 390 MVREDNFDGYDR--THGNWRRMDIGVDYPFPQLPDRDVCRFPYAVLEVKLQTQMGQEPPA 447

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--SNFRLER 118
           WV++LV SHLVEAVPKFSKFIHG ATL+ +  + L PFW  QMD+DIRKP     + ++R
Sbjct: 448 WVRDLVASHLVEAVPKFSKFIHGGATLL-TDYVDLLPFWYTQMDVDIRKPKIQQEYGIQR 506

Query: 119 --PSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLL---SESSQNTNT 173
             P     +T  N+  +    T                     +TPLL   + SS+ TN+
Sbjct: 507 NAPHRIENSTSGNDLDDE-ELTGYSGEVHFSNDINPLEEDLDESTPLLLPNTYSSRQTNS 565

Query: 174 QLRSTPHISSLEEL----EEYLATVTPA----------GKVPKTYHGKKIAIPVRVEPKV 219
            +R+  +    + L    ++   TV P            K+PK   GK I +P+R+EPKV
Sbjct: 566 PVRNFFYHLYGKFLYYFNDDRTFTVKPGTNWDLNATFKDKIPK---GKSICVPIRIEPKV 622

Query: 220 FFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVK 279
           +FANERTFLSWL+  ++LG  A  LLN+G    +TA+       +  + YA+  YLWRV 
Sbjct: 623 YFANERTFLSWLSIGMLLGAVATTLLNYGSNSALTASIAFFITALFTIGYAIYKYLWRVI 682

Query: 280 KIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            IR++ +  Y D++GP  IC  +  +  I+F  +  E
Sbjct: 683 NIREKNAVAYGDKFGPNMICAFIFGATFISFLFKFLE 719



>gi|150865302|ref|XP_001384458.2| polyphosphate synthetase Protein [Scheffersomyces stipitis CBS
           6054]
 gi|149386558|gb|ABN66429.2| polyphosphate synthetase Protein [Scheffersomyces stipitis CBS
           6054]
          Length = 715

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 197/348 (56%), Gaps = 46/348 (13%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIRED+F+   R  +  NWRRMDIG+DYPFS+LP+ +I RFPYA+LEVKLQTQ GQEPP 
Sbjct: 383 MIREDDFDGYDR--THGNWRRMDIGVDYPFSQLPEKDICRFPYAVLEVKLQTQLGQEPPV 440

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--------- 111
           WV++LV SHLVEAVPKFSKFIHG A+L+ +  + L PFW  QMD+DIRKP          
Sbjct: 441 WVRDLVTSHLVEAVPKFSKFIHGGASLL-TDHVDLLPFWHTQMDVDIRKPKIQQEYGIRR 499

Query: 112 -SNFRLERPSASNPTTPANE-RGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQ 169
               R+   S S       E  G+ ++G                      +TPLL     
Sbjct: 500 NPQARIMASSTSGGELDEEELTGSSYTGV------HFSNDINPLEEDLDESTPLL---LP 550

Query: 170 NTNTQLRS-TPHISSLEEL---------EEYLATVTPA----------GKVPKTYHGKKI 209
           NT T  RS +P  + L  L         ++   TV P            K+PK   GK I
Sbjct: 551 NTYTNRRSESPITTFLYHLYGQFLHYFNDDRTFTVKPGTNFDLNETFKDKLPK---GKTI 607

Query: 210 AIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLY 269
            +P+R+EPKV+FANERTFLSWL+  ++LGG A+ LLN+G   ++TA+      ++  + Y
Sbjct: 608 CVPIRIEPKVYFANERTFLSWLSIGMLLGGTAMYLLNYGSNSSLTASISFFITSLFTIFY 667

Query: 270 ALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
           A+  Y+WRV  IR++ +  Y D++GP  IC  + +S    F  +  EK
Sbjct: 668 AIYKYIWRVIMIREKRAAQYGDKFGPNMICAFIFLSTFTTFLFKFLEK 715



>gi|344305243|gb|EGW35475.1| hypothetical protein SPAPADRAFT_58704 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 466

 Score =  245 bits (626), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 140/343 (40%), Positives = 197/343 (57%), Gaps = 39/343 (11%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIRED+F+   R  +  NWRRMDIG+DYPF +LP+ +I RFPYA+LEVKLQTQ GQEPP 
Sbjct: 136 MIREDDFDGYDR--THGNWRRMDIGVDYPFPQLPEKDICRFPYAVLEVKLQTQLGQEPPA 193

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--------- 111
           WV++LV SHLVEAVPKFSKFIHG ATL+ +  + L PFW  QMD+DIRKP          
Sbjct: 194 WVRDLVSSHLVEAVPKFSKFIHGGATLL-TDHVNLLPFWYSQMDVDIRKPKIQQEYGISR 252

Query: 112 SNFRLERPSASNPTTPANE-RGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLL---SES 167
            + R+ R S+S       E  G+ ++G                      +TPLL   + +
Sbjct: 253 QHNRIARSSSSGNELDEEELTGSSYTGV------HFSNDINPLEEDLDESTPLLLPNTYT 306

Query: 168 SQNTNTQLR--------------STPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPV 213
           ++ +N+ +R              +     +++E   +    T   K+PK   GK I +PV
Sbjct: 307 NRQSNSPIRKFFYQLYGQFLHYFNDDRTFTVKEGTNWDLNATFKDKLPK---GKTICVPV 363

Query: 214 RVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGT 273
           R+EPKV+FANERTFLSWL+  ++LG  A+ LLN+G+K  +TA+       +  + YA+  
Sbjct: 364 RIEPKVYFANERTFLSWLSIGMILGFTAMALLNYGNKSALTASIGFFITALFTLGYAIYK 423

Query: 274 YLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           Y+WRV  IR++ +  Y D +GP  IC  + ++    F  +  E
Sbjct: 424 YIWRVLMIREKRAVQYGDMFGPNMICGFIFLATFTTFVFKALE 466



>gi|448121783|ref|XP_004204298.1| Piso0_000136 [Millerozyma farinosa CBS 7064]
 gi|358349837|emb|CCE73116.1| Piso0_000136 [Millerozyma farinosa CBS 7064]
          Length = 720

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 139/348 (39%), Positives = 195/348 (56%), Gaps = 45/348 (12%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R  S  NWRRMDIG+DYPFS+LP+ ++ RFPYA+LEVKLQTQ GQE P 
Sbjct: 385 MVREDDFDGIDRTNS--NWRRMDIGVDYPFSQLPEKDVCRFPYAVLEVKLQTQLGQEHPT 442

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--------- 111
           WV++LV SHLVEAVPKFSKFIHG A L+  R + L PFWLPQMD+DI+K           
Sbjct: 443 WVRDLVSSHLVEAVPKFSKFIHGGAALLPDR-VDLIPFWLPQMDVDIKKDKHQDDVGISR 501

Query: 112 SNFRLERPSASNPTTPA----NERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSES 167
           +  +++  S+           +ER   ++G                      ++PLL  S
Sbjct: 502 TQHKIKSSSSGGELDEEELFDDERPTSYTGV------HFSNDVNPLEEDLDESSPLLLPS 555

Query: 168 SQNTNTQLRSTPHISSLEELEEYLA---------TVTP----------AGKVPKTYHGKK 208
           S NT+ + R  P    L++   Y           T+ P          A K+P+   GK 
Sbjct: 556 SYNTD-EARRGPISKFLDKFGSYFLHYFNDDRTFTIKPGVDFDLKKSLAHKIPE---GKS 611

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVML 268
           I IP+R+EPKV+FA ERTFL+W++  ++LG  A  LLN+G K  +TA+       + V++
Sbjct: 612 ICIPIRIEPKVYFATERTFLNWMSIGMILGATATTLLNYGTKSALTASVGFFLTALFVLV 671

Query: 269 YALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           Y+   Y+WRV  IR + +  Y D+ GP  +CI   ++  I F  ++ E
Sbjct: 672 YSTINYIWRVLMIRNKAAVDYADKIGPNSVCIFFTVATFITFIFKVLE 719



>gi|294660012|ref|XP_462468.2| DEHA2G21296p [Debaryomyces hansenii CBS767]
 gi|199434403|emb|CAG90978.2| DEHA2G21296p [Debaryomyces hansenii CBS767]
          Length = 720

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 141/334 (42%), Positives = 193/334 (57%), Gaps = 45/334 (13%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+ + R  +  NWRR DIG+DYPFS+LP+ +I RFPYA+LEVKLQTQ GQEPP 
Sbjct: 385 MVREDNFDGHDR--TNGNWRRTDIGVDYPFSQLPEKDICRFPYAVLEVKLQTQLGQEPPI 442

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLERP 119
           WV++LV SHLVEAVPKFSKFIHG A+L+    + L PFWLPQMD+DIRKP    F + R 
Sbjct: 443 WVKDLVTSHLVEAVPKFSKFIHGGASLLPD-YVNLLPFWLPQMDVDIRKPKIQEFGINRQ 501

Query: 120 SASNPTTPA------------NERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSES 167
           +     + +            N+  +P  G                       TPLL  S
Sbjct: 502 NQQRAKSSSSGGELDEEELLVNDEFSPSYGAVHFSNDVNPLEEDLDEF-----TPLLLPS 556

Query: 168 SQNTNTQLRSTPHISSLEEL---------EEYLATVTP----------AGKVPKTYHGKK 208
           S  +      +P ++   ++         ++   TV P          A K+PK   GKK
Sbjct: 557 SYASRDS--DSPVMNFFADVYGKLLHYFNDDRSFTVKPGTNFNLNETFANKIPK---GKK 611

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVML 268
           IAIP+R+EPKV+FA ERT+L WL+  ++LG  A+ LLN+G K +VTA+       + V+ 
Sbjct: 612 IAIPIRIEPKVYFATERTYLHWLSIGMILGATAMALLNYGRKSSVTASIGFFISALFVLS 671

Query: 269 YALGTYLWRVKKIRKRESGPYEDRYGPTFICIML 302
           Y+  TY+WRV  IR+++   Y D++GP  IC ++
Sbjct: 672 YSTYTYVWRVLMIREKKPVDYADKFGPNIICALI 705



>gi|50288467|ref|XP_446663.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525971|emb|CAG59590.1| unnamed protein product [Candida glabrata]
          Length = 717

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/338 (40%), Positives = 193/338 (57%), Gaps = 27/338 (7%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R +   NWRR DIG+D+ F ++ D +I RFPYA+LEVKLQTQ+GQEPPE
Sbjct: 382 MVREDNFDGIDRTKG--NWRRTDIGVDWSFKQVADKDICRFPYAVLEVKLQTQFGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV+SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  PS+  + R
Sbjct: 440 WVRELVRSHLVEPVPKFSKFIHGVATLLNDK-VESIPFWLPQMDVDIRKPALPSHINITR 498

Query: 119 PSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNT-PLLSESSQNTN----- 172
           P   N      +  +                             P  +E  +N +     
Sbjct: 499 PGQENEDDDDYDEDDEDDAALVAAMTENDRNAMDTEEMVGYGAVPSETEGHENHSPNRAY 558

Query: 173 --TQLRSTPHISS------LEELEEYL----ATVTPAGKVPKTYH----GKKIAIPVRVE 216
              Q+R++ +  S      L  ++ YL     +  P G V  T      GK I +PVRVE
Sbjct: 559 YQRQIRNSSNSISRKYYQILSTIDHYLNGDQISKIPKGTVFDTQIKAPPGKTICVPVRVE 618

Query: 217 PKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLW 276
           PKV+FA ERTFLSW++ +++L G +  LLN+G K T+ A+       ++ ++Y    Y  
Sbjct: 619 PKVYFATERTFLSWMSIAIILSGVSTSLLNYGTKTTMVASIGFFLTALITLVYTYIIYNM 678

Query: 277 RVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           RV  IR++ +  YED+ GP  IC  L++S+  +F+  +
Sbjct: 679 RVIYIREKWAVDYEDKIGPPLICGCLILSMIFSFYCNM 716



>gi|406602620|emb|CCH45830.1| Vacuolar transporter chaperone 4 [Wickerhamomyces ciferrii]
          Length = 714

 Score =  245 bits (625), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 143/335 (42%), Positives = 196/335 (58%), Gaps = 24/335 (7%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R  +  NWRRMDIG+D+PF++LP  ++ERFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDDFDGIDR--TNGNWRRMDIGVDWPFNQLPPKDVERFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ L+ SHLVEAVPKFSKFIHGVATL+  R I L PFWLPQM++DIRKP  P+   + R
Sbjct: 440 WVRNLISSHLVEAVPKFSKFIHGVATLLPQR-IDLIPFWLPQMNVDIRKPMLPNEIGIYR 498

Query: 119 PSASNPTTPA-----NERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLL-----SESS 168
            +  + T  +     +E     + T                     N PLL     S+  
Sbjct: 499 NNNHSNTNTSSGEYMDEEELIGNNTQFGSIEQVDNQLQQANDSNNENAPLLISNGQSQHQ 558

Query: 169 QNTNTQLRSTPHISSLEELEEYLATVTPAGKVPK-TYHGKKIAIP--------VRVEPKV 219
           Q++ ++    P +  + +   Y  T     KV + T    K A P        VRVEPKV
Sbjct: 559 QSSLSRSHKLPILQPIIDKFNYWFTDENTYKVSRDTVFESKFAAPAGKKICVPVRVEPKV 618

Query: 220 FFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVK 279
           +FA ERTFLSW++ +++L      LL +GDK+++ A+      T++ +LY+   Y+WRV 
Sbjct: 619 YFATERTFLSWISIALILSATTTSLLTYGDKVSLAASVGFFITTVLTILYSASIYIWRVI 678

Query: 280 KIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            IR +    Y+DRYGPT IC+ L +SV   F  R+
Sbjct: 679 NIRSKVVANYDDRYGPTGICVCLALSVFATFLFRV 713



>gi|260948174|ref|XP_002618384.1| hypothetical protein CLUG_01843 [Clavispora lusitaniae ATCC 42720]
 gi|238848256|gb|EEQ37720.1| hypothetical protein CLUG_01843 [Clavispora lusitaniae ATCC 42720]
          Length = 714

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 141/347 (40%), Positives = 193/347 (55%), Gaps = 46/347 (13%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+DYPF +LP+ ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 382 MVREDNFDGYDR--THGNWRRTDIGVDYPFPQLPEKDVCRFPYAVLEVKLQTQLGQEPPI 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS--NFRLER 118
           W+++LV SHLVEAVPK+SKFIHG A+L+  R + L PFW PQMD+DIRKP +  ++ + R
Sbjct: 440 WIRDLVASHLVEAVPKYSKFIHGCASLLTDR-VNLLPFWYPQMDVDIRKPKNEQDYGISR 498

Query: 119 PSASNPTTPANERG---------NPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQ 169
            S +  ++   E           N +S                       N+PLL  S+ 
Sbjct: 499 QSKAKFSSSGGELDEEEMISDEFNRYSNV------HFSNDINPLEEDLDENSPLLLPSNY 552

Query: 170 NTNTQLRSTPHISS--LEELEEYLA--------TVTP----------AGKVPKTYHGKKI 209
           +T T   S  H+S+  L    ++L         T+ P          A K+PK    KKI
Sbjct: 553 STRT---SNSHLSTFFLHLYGKFLHFFNDDRTFTIKPGTNFDLNSTFASKLPK---NKKI 606

Query: 210 AIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLY 269
            IPVR+EPKV+FA ERTFLSWL+  ++LG  A  LLN+G K  V A+       +  M Y
Sbjct: 607 CIPVRIEPKVYFAAERTFLSWLSIGMILGATASALLNYGSKSAVIASIGFFISALFTMTY 666

Query: 270 ALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           ++  Y+ R   IR++++  Y D +GP  IC  +  S    F  +  E
Sbjct: 667 SIYKYVRRTLAIREKKTSQYADSFGPNMICACIFASTFTTFIFKYLE 713



>gi|444316696|ref|XP_004179005.1| hypothetical protein TBLA_0B06640 [Tetrapisispora blattae CBS 6284]
 gi|387512045|emb|CCH59486.1| hypothetical protein TBLA_0B06640 [Tetrapisispora blattae CBS 6284]
          Length = 729

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/349 (38%), Positives = 189/349 (54%), Gaps = 42/349 (12%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRRMDIG+D+PF +LP+ ++ RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGIDR--TNGNWRRMDIGVDWPFKQLPEKDVCRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP   +N  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VESIPFWLPQMDVDIRKPQIQTNINITR 498

Query: 119 P--------------------------SASNPTTPANERGNPFSGTXXXXXXXXXXXXXX 152
           P                          + S+PT    ++      +              
Sbjct: 499 PVRDNDYEEGIYDDEDEDDAALVNAMLANSHPTGNLLDQEERIGSSSYGAITTNNATTNV 558

Query: 153 XXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLATVTPAGKVPKTYH------- 205
                  N          +N  + +T +   L   + YL       KVPK          
Sbjct: 559 PVEGESINAAYYRRKILESNNYI-ATKYYQLLSSFDHYLNG-DLISKVPKGTQFDTVIKA 616

Query: 206 --GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVT 263
             GK I +PVRVEPKV+FA ERTFLSWL+ +++LGG +  LL +G ++T+ A+      +
Sbjct: 617 PPGKTICVPVRVEPKVYFATERTFLSWLSVAILLGGVSTTLLTYGTRVTMLASIGFFLTS 676

Query: 264 MMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWL 312
           +  + ++   Y  RV  IR + +  YED  GP FIC  +++S+  +F+ 
Sbjct: 677 LFTIGHSTYKYATRVVDIRLKRAVNYEDSKGPAFICTFMILSMIFSFYC 725



>gi|213403149|ref|XP_002172347.1| vacuolar transporter chaperone (VTC) complex subunit
           [Schizosaccharomyces japonicus yFS275]
 gi|212000394|gb|EEB06054.1| vacuolar transporter chaperone (VTC) complex subunit
           [Schizosaccharomyces japonicus yFS275]
          Length = 716

 Score =  241 bits (616), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 138/342 (40%), Positives = 188/342 (54%), Gaps = 35/342 (10%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++RED        R+G+NWRRMDIGIDYPF +LPD +I+RFPYAILEVKLQTQ+GQEPP+
Sbjct: 380 LVREDG-----PTRAGDNWRRMDIGIDYPFEQLPDSDIDRFPYAILEVKLQTQFGQEPPD 434

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV  LV SHLVEAVPKFSKFI GV+ L   R + L P+W  QMD+DIRKPP+ NF  +  
Sbjct: 435 WVTNLVNSHLVEAVPKFSKFIQGVSNLFYDR-VDLLPYWFMQMDVDIRKPPTHNFGFDH- 492

Query: 120 SASNPTTPANERGNPFSGTXXXXXXXXXX-------------XXXXXXXXXXXNT--PLL 164
             S  T+ AN RG    G+                                  NT  PLL
Sbjct: 493 QPSTATSSANSRGIVSRGSTSDGSSTHREGLNDVENEEQYLGDSNRATLTAPENTEQPLL 552

Query: 165 SESSQNTNTQLRSTPHISSLEELEEYLATVTPAGKVPK----TYH-------GKKIAIPV 213
               +N       T      E   ++     P  + P      Y        GK+I +PV
Sbjct: 553 EAFERNNQESFVKTLTKRLQEIKRDFFLETIPKFEAPAPPTVVYEQKWTAPPGKRIHVPV 612

Query: 214 RVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGD-KITVTAASFLVFVTMMVMLYALG 272
           RVEPK +FA ERT+L +L +S+++G  A+ L ++ + K  + AA+      ++ +LY+  
Sbjct: 613 RVEPKTYFALERTYLDYLQYSILIGSVAVALFSYANTKPLLLAATTFSVTALLAILYSTF 672

Query: 273 TYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            YLWR   I K+ +  Y+DR+GPT +C M  I++ +N ++ L
Sbjct: 673 LYLWRAYHIAKQSAVRYDDRFGPTAVCTMTFIALGVNVFIAL 714



>gi|385304577|gb|EIF48589.1| vacuolar transporter chaperone 4 [Dekkera bruxellensis AWRI1499]
          Length = 720

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 183/345 (53%), Gaps = 45/345 (13%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R +   NWRRMDIGIDYPF  LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 386 MVREDNFDGIDRTKG--NWRRMDIGIDYPFQNLPPKDVERFPYAVLEVKLQTQMGQEPPQ 443

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPS 120
           WV+++V SHLVEAVPKFSKFIHG +TL+   ++ L PFWLPQM +DIRKP          
Sbjct: 444 WVRDMVASHLVEAVPKFSKFIHGCSTLL-PEKVDLIPFWLPQMGVDIRKP---------- 492

Query: 121 ASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTPH 180
             +       R                               + S  S      +R    
Sbjct: 493 KRDQNYGITHRHEGTISDSTSTSLTXPDTLGARGNHMDEEEAMTSNGSSQNYGAVRIAEA 552

Query: 181 ISSLEELEEYLATVTPAGKV------------------------PKTYHGKKIAIP---- 212
            + +EEL E + + T  GK+                        P T    ++  P    
Sbjct: 553 DNRIEELPEEVHSDTLYGKIKDDLSKVYRYFFAYGNEEFPNAVAPGTVFETRVHAPPGKK 612

Query: 213 ----VRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVML 268
               VRVEPKV+FA ERT+LSWL+ S++       L+N+GD ++   ++    + +M ++
Sbjct: 613 IAVPVRVEPKVYFATERTYLSWLSISLIFAATGQTLMNYGDLVSFITSTCFYLLAVMTVM 672

Query: 269 YALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLR 313
           Y+ G Y+WRV  +R++ +  Y+D++GP  +C  ++I+V INF  R
Sbjct: 673 YSTGMYIWRVINVRRKRAARYDDKFGPDALCAAIVIAVXINFLFR 717



>gi|448530417|ref|XP_003870058.1| Vtc4 polyphosphate synthetase [Candida orthopsilosis Co 90-125]
 gi|380354412|emb|CCG23927.1| Vtc4 polyphosphate synthetase [Candida orthopsilosis]
          Length = 724

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 194/347 (55%), Gaps = 43/347 (12%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R  +  NWRRMDIG+DYPF +LP+ ++ RF YA+LEVKLQTQ GQEPP 
Sbjct: 390 MVREDDFDGYDR--THGNWRRMDIGVDYPFPQLPEKDVCRFQYAVLEVKLQTQMGQEPPA 447

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP---------- 110
           WV++LV SHLVEAVPKFSKFIHG ATL+ +  + L PFW  QMD+DIRKP          
Sbjct: 448 WVRDLVNSHLVEAVPKFSKFIHGGATLL-TEMVDLLPFWYTQMDVDIRKPKIVQEYGIQR 506

Query: 111 ----PSNFRLERPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLL-- 164
               P   RL   ++ N        G+ ++G                       TPLL  
Sbjct: 507 HQTQPHQQRLGSSTSGNDLDEEELTGSSYTGV------HFSNDINPLEEDLDEQTPLLLP 560

Query: 165 -SESSQNTNTQLRS-TPHIS-------------SLEELEEYLATVTPAGKVPKTYHGKKI 209
            + SS++TN+ +++   HI              +++    Y    T   K+P    GK I
Sbjct: 561 NNYSSRHTNSPVKNFLYHIYGKFLHYFNDDRTFTVKPGTNYDLNATFKDKLPA---GKTI 617

Query: 210 AIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLY 269
            +PVR+EPKV+FANERTFLSW++  +++G  A  LLN+G    +TA+       +  + Y
Sbjct: 618 CVPVRIEPKVYFANERTFLSWISIGMLMGFTATALLNYGTNSALTASIGFFITALFTLGY 677

Query: 270 ALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           A   Y+WRV  IR+++   Y D++GP  IC+ L ++  ++F  +  E
Sbjct: 678 ATYRYIWRVLMIREKKPVQYGDKFGPNMICLFLFLATFVSFVFKFTE 724



>gi|344228758|gb|EGV60644.1| SPX-domain-containing protein [Candida tenuis ATCC 10573]
          Length = 706

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 189/342 (55%), Gaps = 41/342 (11%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+ + R  +  NWRRMDIG+DYPFS+LP+ +I RFPYA+LEVKLQTQ GQEPP 
Sbjct: 379 MVREDNFDGHDR--TDGNWRRMDIGVDYPFSQLPEKDICRFPYAVLEVKLQTQLGQEPPL 436

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--------- 111
           W++EL+ SHLVEAVPKFSKFIHG A+L+    +   PFWLPQMD+DIRKP          
Sbjct: 437 WIRELIGSHLVEAVPKFSKFIHGGASLLPD-YVTYLPFWLPQMDVDIRKPKILEEFGINR 495

Query: 112 SNFRLERPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLL---SESS 168
           + +RL+  S+ N        G   + +                      TPLL   S  S
Sbjct: 496 NQYRLKTSSSGNELDEEEGAGREVTFS---------NDVNPLEDDLDETTPLLFPSSYMS 546

Query: 169 QNTNTQLR--------------STPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVR 214
            +T T  +              +     +++    +    T   K+PK   GK+IAIP+R
Sbjct: 547 SSTGTPFQQWFVKVYGKFLHYFNDDRTFNVKPGTNFDLNTTFKDKIPK---GKEIAIPIR 603

Query: 215 VEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTY 274
           +EPKV+FA ERTFLSWL+  ++L   A  LLN+G K ++TA+       +   +Y+   Y
Sbjct: 604 IEPKVYFAAERTFLSWLSIGMILSITATTLLNYGTKTSLTASIGFFVTALFTFVYSTFMY 663

Query: 275 LWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           +WR   IR++    Y D +GP  IC  + +S  + F  +  E
Sbjct: 664 IWRTLMIREKRPAKYGDTFGPNMICFFIALSTFLTFVFKFTE 705



>gi|384501584|gb|EIE92075.1| hypothetical protein RO3G_16786 [Rhizopus delemar RA 99-880]
          Length = 1284

 Score =  240 bits (612), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 194/320 (60%), Gaps = 24/320 (7%)

Query: 1    MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
            +IREDN   +   RSG+NWRRMDIG+DYPF +LPD +I RFPYA+LEVKLQT  GQEPP+
Sbjct: 977  LIREDNMNKS---RSGDNWRRMDIGVDYPFKQLPDSDICRFPYAVLEVKLQTHIGQEPPQ 1033

Query: 61   WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
            WV ELV SHLVE+VPKFSKFIHG ATL++ + + + PFWLPQMD+DIRKP S  F L RP
Sbjct: 1034 WVTELVNSHLVESVPKFSKFIHGCATLLEDK-VNVLPFWLPQMDVDIRKPRSKIFGLSRP 1092

Query: 120  SASNPTTPAN----ERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQL 175
             A+   + +N    E  N                          +TPL+ + +  +N QL
Sbjct: 1093 EATASGSASNSSAYENNNEHD---------VATDEHIQVVMANESTPLIPKPAAESNKQL 1143

Query: 176  RSTPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEP-KVFFANERTFLSWLNFS 234
             S   + +L +   ++   T A +           +P +  P K +FANERTFL WL F+
Sbjct: 1144 -SPAGLKNLFKKGMFVKKDTTANRTTSRIR----PVPTKAPPAKTYFANERTFLHWLKFT 1198

Query: 235  VVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYG 294
            ++LGG AIGLLNF DKI   +A     ++M VM+YAL  Y  RV ++ + E G + D+YG
Sbjct: 1199 LLLGGLAIGLLNFSDKIGRMSAIVFTLLSMSVMIYALFKYHSRVGRVERNELGDFSDKYG 1258

Query: 295  PTFICIMLLISVTINFWLRL 314
            P  + I L++ + +N  LRL
Sbjct: 1259 PAVMTIFLVVGICVNMGLRL 1278



>gi|19075642|ref|NP_588142.1| vacuolar transporter chaperone (VTC) complex subunit (predicted)
           [Schizosaccharomyces pombe 972h-]
 gi|74583071|sp|P78810.2|VTC4_SCHPO RecName: Full=Vacuolar transporter chaperone 4
 gi|4176554|emb|CAA22867.1| vacuolar transporter chaperone (VTC) complex subunit (predicted)
           [Schizosaccharomyces pombe]
          Length = 721

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 189/347 (54%), Gaps = 38/347 (10%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IRED     P  R+GNNWRRMDIGIDYPF +LPD +I RFPYAILEVKLQTQ+GQ+PPE
Sbjct: 380 LIREDG----PS-RAGNNWRRMDIGIDYPFDQLPDEDIVRFPYAILEVKLQTQFGQDPPE 434

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPS 120
           WV  LV SHLVEAVPKFSKFIHGV+TL   R + L P+W PQMDIDIRKP ++  ++  S
Sbjct: 435 WVNNLVNSHLVEAVPKFSKFIHGVSTLFYDR-VTLLPYWFPQMDIDIRKPATHTFIQGRS 493

Query: 121 AS--------------NPTTPANERGNPFS------GTXXXXXXXXXXXXXXXXXXXXXN 160
            S              +  TP +  G+ +       G+                      
Sbjct: 494 QSGTHSSSVSANVLTDSENTPIHADGDNYVDEESRIGSSSTRNDNSTFQTSDSFQELDER 553

Query: 161 TPLLSESSQN--------TNTQLRSTPHISSLEELEEYLATVTPAGKVPKTYH---GKKI 209
           T LL  S +          N++L+       LE + ++     P     + Y    GK+I
Sbjct: 554 TNLLDISKRKGRDSFVAALNSRLKDIKDSFFLETVPKFEEPTEPTVIYEQKYVSPPGKRI 613

Query: 210 AIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGD-KITVTAASFLVFVTMMVML 268
            +PVRVEPK +FA ERT+L +L +S+++G   I L +F   +  +  A+    V +  + 
Sbjct: 614 YVPVRVEPKTYFALERTYLDYLRYSILMGSIGITLFSFAKTRSGILGAASFTLVALFAIF 673

Query: 269 YALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLH 315
           Y+   YLWR   I K  +  Y+DR+GPT IC++   +++ N  L  +
Sbjct: 674 YSTFLYLWRAVNIAKHNAVRYDDRFGPTAICVITFAAISANVILNFN 720



>gi|149237266|ref|XP_001524510.1| vacuolar transporter chaperone 4 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452045|gb|EDK46301.1| vacuolar transporter chaperone 4 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 726

 Score =  239 bits (610), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 188/340 (55%), Gaps = 33/340 (9%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R  +  NWRRMDIG+DYPF++LP+ ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 390 MVREDDFDGYDR--THGNWRRMDIGVDYPFNQLPERDVCRFPYAVLEVKLQTQLGQEPPV 447

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--SNFRLER 118
           W++EL+ SHLVEAVPKFSKFIHG ATL+ +  + L PFW  QMD+DIRKP     + + R
Sbjct: 448 WIRELINSHLVEAVPKFSKFIHGGATLL-TDYVDLLPFWYTQMDVDIRKPKIVEEYGIRR 506

Query: 119 PSA--------SNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLL---SES 167
                       + T+  +      +G+                      TPLL   + S
Sbjct: 507 HHGQGRDQQRLGDSTSGVDLDDEELTGSSYAGGVHFSNDTNPLEDDLDEQTPLLLPNNYS 566

Query: 168 SQNTNTQLRSTPH--------------ISSLEELEEYLATVTPAGKVPKTYHGKKIAIPV 213
           S++TN+ +R+  +                +++    Y    T   K+P    GK I +PV
Sbjct: 567 SRHTNSPVRNCLYHLYGKFLYYFNDDRTFTVKPGTNYDLNATFKDKLPP---GKTICVPV 623

Query: 214 RVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGT 273
           R+EPKV+FANERTFLSW+   ++LG  A  LLN+G    +TA+       +  + YA   
Sbjct: 624 RIEPKVYFANERTFLSWITIGMILGFTATTLLNYGSNSALTASIGFFITALFTLGYATYR 683

Query: 274 YLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLR 313
           Y+WRV  IR ++   Y D++GP  IC  + +S    F  R
Sbjct: 684 YIWRVLMIRDKKPVQYGDKFGPNMICAFIFLSTFATFVFR 723



>gi|156844366|ref|XP_001645246.1| hypothetical protein Kpol_1060p44 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115905|gb|EDO17388.1| hypothetical protein Kpol_1060p44 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 721

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 138/342 (40%), Positives = 191/342 (55%), Gaps = 31/342 (9%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF++  R +   NWRRMDIGID+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDSIDRTKG--NWRRMDIGIDWPFKQLNDEDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ +   + PFWLPQMD+DIRKP  P++  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDKAQSI-PFWLPQMDVDIRKPPIPTHINITR 498

Query: 119 PSASNPTTPANERGNPF----------SGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESS 168
           P   N      +               S                       +TP+++ S+
Sbjct: 499 PLRENEDDEQGDDDEEDEDIALVDAMTSAPGNYMDQEERMGYGSIANEPSGSTPIVNASA 558

Query: 169 QNTNTQ--LRSTPHI--SSLEELEEYLATVTPAGKVPKTYHG------------KKIAIP 212
                Q  + ++ +I   S  E+  +  +     ++ K  HG            K I +P
Sbjct: 559 NAVYYQNKIGNSSNILSKSYYEVASFFDSYFNGDRISKVPHGTVFDTQVKAPPGKTICVP 618

Query: 213 VRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALG 272
           VRVEPKV+FA ERTFLSWL+ +++LGG +  LL +G   T+ A+       + V+ +   
Sbjct: 619 VRVEPKVYFATERTFLSWLSIAILLGGVSTSLLTYGTPTTMIASIGFFITALAVIAHTTY 678

Query: 273 TYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            Y  RV  IR + +  YED+ GP  IC+ L +S+  +F+  L
Sbjct: 679 VYTTRVVNIRLKRAIDYEDKIGPPMICVFLTLSILFSFYCNL 720



>gi|367014847|ref|XP_003681923.1| hypothetical protein TDEL_0E04690 [Torulaspora delbrueckii]
 gi|359749584|emb|CCE92712.1| hypothetical protein TDEL_0E04690 [Torulaspora delbrueckii]
          Length = 722

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 133/348 (38%), Positives = 189/348 (54%), Gaps = 43/348 (12%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R +   NWRR DIG+D+PF++L + ++ RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGFDRTKG--NWRRTDIGVDWPFNQLDEKDVCRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--SNFRLER 118
           W++ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQM +DI+KP   SN  + R
Sbjct: 440 WIRELVGSHLVEPVPKFSKFIHGVATLLNDK-VESIPFWLPQMGVDIKKPAIKSNINITR 498

Query: 119 P------------------------SASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXX 154
           P                         A+  +    ER   +                   
Sbjct: 499 PERDDDDDDDYDDDDDEDAALVEAMGATGNSLDIEERAGNYGSIENRADASQQDNEGRSS 558

Query: 155 XXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYL----ATVTPAGKVPKTYH----G 206
                   +      NT+       +  +L +L+ YL     +  P G V  +      G
Sbjct: 559 NAKYYQRRI------NTSGNSVMKWYYKALYQLDHYLNGDQISKVPKGTVFDSQVVAPPG 612

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K I +PVRVEPKV+FA ERTFLSWL+ +++LGG A  L+ +G + T+  ++      +  
Sbjct: 613 KTICVPVRVEPKVYFATERTFLSWLSIALILGGVATTLVTYGSRTTMIVSTGFFITALAT 672

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           +++A+ TY  RV  IR + +  YED+ GP  IC  L++S+  +F+  L
Sbjct: 673 IIHAIITYATRVVNIRLKRAVDYEDKLGPPMICTFLMLSIFFSFFCNL 720



>gi|1749526|dbj|BAA13821.1| unnamed protein product [Schizosaccharomyces pombe]
          Length = 530

 Score =  236 bits (603), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 136/339 (40%), Positives = 186/339 (54%), Gaps = 38/339 (11%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IRED     P  R+GNNWRRMDIGIDYPF +LPD +I RFPYAILEVKLQTQ+GQ+PPE
Sbjct: 189 LIREDG----PS-RAGNNWRRMDIGIDYPFDQLPDEDIVRFPYAILEVKLQTQFGQDPPE 243

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPS 120
           WV  LV SHLVEAVPKFSKFIHGV+TL   R + L P+W PQMDIDIRKP ++  ++  S
Sbjct: 244 WVNNLVNSHLVEAVPKFSKFIHGVSTLFYDR-VTLLPYWFPQMDIDIRKPATHTFIQGRS 302

Query: 121 AS--------------NPTTPANERGNPFS------GTXXXXXXXXXXXXXXXXXXXXXN 160
            S              +  TP +  G+ +       G+                      
Sbjct: 303 QSGTHSSSVSANVLTDSENTPIHADGDNYVDEESRIGSSSTRNDNSTFQTSDSFQELDER 362

Query: 161 TPLLSESSQN--------TNTQLRSTPHISSLEELEEYLATVTPAGKVPKTYH---GKKI 209
           T LL  S +          N++L+       LE + ++     P     + Y    GK+I
Sbjct: 363 TNLLDISKRKGRDSFVAALNSRLKDIRDSFFLETVPKFEEPTEPTVIYEQKYVSPPGKRI 422

Query: 210 AIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGD-KITVTAASFLVFVTMMVML 268
            +PVRVEPK +FA ERT+L +L +S+++G   I L +F   +  +  A+    V +  + 
Sbjct: 423 YVPVRVEPKTYFALERTYLDYLRYSILMGSIGITLFSFAKTRSGILGAASFTLVALFAIF 482

Query: 269 YALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVT 307
           Y+   YLWR   I K  +  Y+DR+GPT IC++   +++
Sbjct: 483 YSTFLYLWRAVNIAKHNAVRYDDRFGPTAICVITFAAIS 521



>gi|354547799|emb|CCE44534.1| hypothetical protein CPAR2_403370 [Candida parapsilosis]
          Length = 724

 Score =  236 bits (602), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 190/347 (54%), Gaps = 43/347 (12%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R  +  NWRRMDIG+DYPF +LP+ ++ RF YA+LEVKLQTQ GQEPP 
Sbjct: 390 MVREDDFDGYDR--THGNWRRMDIGVDYPFPQLPEKDVCRFQYAVLEVKLQTQMGQEPPA 447

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--------- 111
           WV++LV SHLVEAVPKFSKFIHG ATL+ +  + L PFW  QMD+DIRKP          
Sbjct: 448 WVRDLVNSHLVEAVPKFSKFIHGGATLL-TEMVDLLPFWYTQMDVDIRKPKIVQEYGIQR 506

Query: 112 -----SNFRLERPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLL-- 164
                   RL   ++ N        G+ ++G                       TPLL  
Sbjct: 507 HQGQSQQQRLGSSTSGNDLDEEELTGSSYTGV------HFSNDVNPLEEDLDEQTPLLLP 560

Query: 165 -SESSQNTNTQLR--------------STPHISSLEELEEYLATVTPAGKVPKTYHGKKI 209
            + +S+ TN+ ++              +     +++    Y    T   K+P    GK I
Sbjct: 561 NNYTSRRTNSPVKNFLYRLYGKFLYYFNDDRTFTVKPGTNYDLNATFKDKLPP---GKTI 617

Query: 210 AIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLY 269
            +PVR+EPKV+FANERTFLSW++  +++G  A  LLN+G    +TA+       +  + Y
Sbjct: 618 CVPVRIEPKVYFANERTFLSWISIGMLMGFTATALLNYGTNSALTASIGFFITALFTLGY 677

Query: 270 ALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           A   Y+WRV  IR+++   Y D++GP  IC+ L ++  I+F  +  E
Sbjct: 678 ATYRYIWRVLMIREKKPVQYGDKFGPNMICLFLFLATFISFVFKFTE 724



>gi|511010844|gb|EPB92060.1| hypothetical protein HMPREF1544_01124 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 695

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 197/330 (59%), Gaps = 31/330 (9%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN   N   RSG+NWRRMDIG+DYPF +LP+ +I RFPYA+LEVKLQT  GQEPP+
Sbjct: 376 LIREDNDGKN---RSGDNWRRMDIGVDYPFKQLPESDICRFPYAVLEVKLQTHVGQEPPQ 432

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV ELV SHLVE+VPKFSKFIHG ATL++ + I   PFWLPQMDIDIRKP +  F + RP
Sbjct: 433 WVLELVNSHLVESVPKFSKFIHGCATLLEDK-INDLPFWLPQMDIDIRKPRNKVFGVSRP 491

Query: 120 SASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTP 179
            A + ++ +   G+ + G+                     +TPLL     N +T  R   
Sbjct: 492 EALSSSSVSGSSGSAYDGS----KLTTDENVQIAMREATESTPLLI-GDGNFHTGDRVNK 546

Query: 180 HISSLEELEEYLATVTPAG-----KVPKTYHGKKIA---------IPVRVEP-KVFFANE 224
             + L      L  ++PAG     K  KT   +K A         IP +  P K +FANE
Sbjct: 547 DNNGL------LKQLSPAGLKNLFKKSKTIFIRKEASPAKGRGRPIPTKAPPAKTYFANE 600

Query: 225 RTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKR 284
           RTFL WL F+++LGG AIGLLNF D +   +A     ++M VM+YAL  Y  R  ++ + 
Sbjct: 601 RTFLHWLKFTLLLGGLAIGLLNFSDDVGRISAGIFTLLSMSVMIYALYKYHDRADRVERN 660

Query: 285 ESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           E G + D+YGP  +   ++++++IN + +L
Sbjct: 661 ELGDFSDKYGPAVLTFFVVVAISINMFRKL 690



>gi|410079785|ref|XP_003957473.1| hypothetical protein KAFR_0E01840 [Kazachstania africana CBS 2517]
 gi|372464059|emb|CCF58338.1| hypothetical protein KAFR_0E01840 [Kazachstania africana CBS 2517]
          Length = 721

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 136/345 (39%), Positives = 187/345 (54%), Gaps = 41/345 (11%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIRED+F+   R +   NWRRMDIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MIREDDFDGFNRTKG--NWRRMDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP---SNFRLE 117
           WV+ELV SHLVE VPKFSKFIHG++TL + + + + PFWLPQMD+DIRK P   +   + 
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGISTLFNDK-VDMIPFWLPQMDVDIRKKPLPTNIIDIT 498

Query: 118 RPS-----------------ASNPTTPAN-----ERGNPFSGTXXXXXXXXXXXXXXXXX 155
           RP+                 A     P N     E G P  G+                 
Sbjct: 499 RPTREEEGDDEDDEDAALVEAMMDAPPGNNLDVEEGGGPSYGSINNNGTSTNLAVVRDSA 558

Query: 156 XXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYL----ATVTPAGKVPKTYH----GK 207
                   + ES     T L +  +  +L  L+ YL     +  P G +  T      GK
Sbjct: 559 NASYYRRKIRES-----TNLLTKNYYKALYGLDHYLYGEQISKIPRGTIFDTQIQAPPGK 613

Query: 208 KIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVM 267
            I +PVRVEPKV+FA ERTFLSW + S++LGG +   L +G   T+ A+       + ++
Sbjct: 614 TICVPVRVEPKVYFATERTFLSWASISIILGGVSTASLTYGTLTTMIASIGFFLTALCIL 673

Query: 268 LYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWL 312
           +++   Y  RV  IR +++  YED+ GP  +   L++S+   F+ 
Sbjct: 674 VHSTIVYGRRVVNIRTKKAVDYEDKIGPPMVSGFLILSILFTFFC 718



>gi|254585901|ref|XP_002498518.1| ZYRO0G12210p [Zygosaccharomyces rouxii]
 gi|238941412|emb|CAR29585.1| ZYRO0G12210p [Zygosaccharomyces rouxii]
          Length = 715

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 128/338 (37%), Positives = 189/338 (55%), Gaps = 29/338 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R  +  NWRR DIG+D+PF +L D ++ RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDDFDGVDR--THGNWRRTDIGVDWPFKQLDDKDVCRFPYAVLEVKLQTQMGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP--SNFRLER 118
           W++ELV SHLVE+VPKFSKF++GV++L+  R +   PFWLPQMD+DI++PP  +N  + R
Sbjct: 440 WIRELVGSHLVESVPKFSKFLNGVSSLLYDR-VQEIPFWLPQMDVDIKRPPKANNINITR 498

Query: 119 PSASNPTTPANERGNPFS---------GTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQ 169
           P+ S+      +  +  +          T                     N P +S   Q
Sbjct: 499 PNRSDEDDYDEDDEDDSAMIDAMQAPGNTMDLEEIAASGYGSIDNSDAPENNPEISGYYQ 558

Query: 170 NT-----NTQLRSTPHISSLEELEEYLATVTPAGKVPKTYHGKK--------IAIPVRVE 216
                  N  LR+  +   +  L+ Y      +   P T    K        I +PVRVE
Sbjct: 559 RKIRMAENPMLRN--YYKLMASLDHYFNGDQMSKVPPGTTFDTKVKAPPGKTIYVPVRVE 616

Query: 217 PKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLW 276
           PKV+FA ERTFLSWL+ +++L G +  LL +G   T+ A+      ++  +++++ TY  
Sbjct: 617 PKVYFATERTFLSWLSIAIILFGVSTTLLTYGTPTTMIASVGFFITSLATIIHSVITYAR 676

Query: 277 RVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           RV  IR + +  YEDR  P  IC++L +S+  +F+  +
Sbjct: 677 RVVYIRLKRAVDYEDRLAPPAICVLLTLSILFSFYCNM 714



>gi|323348004|gb|EGA82263.1| Vtc4p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 720

 Score =  216 bits (551), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 177/339 (52%), Gaps = 29/339 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  P+N  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VDSIPFWLPQMDVDIRKPPLPTNIEITR 498

Query: 119 PSASNPTTPANERGNPFSGTXXXXXXXX--------XXXXXXXXXXXXXNTPLLSESSQN 170
           P  S+      +  +                                  NT  + ES+  
Sbjct: 499 PGRSDNEDNDFDEDDEDDAALVAAMTNAPGNSLDIEESVGYGATSAPTSNTNHVVESANA 558

Query: 171 TNTQLR----STPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEP--------- 217
              Q +      P      E+  +        ++ K   G      +R  P         
Sbjct: 559 AYYQRKIRNAENPISKKYYEIVAFFDHYFNGDQISKIPKGTTFDTQIRAPPGKTICVPVR 618

Query: 218 ---KVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTY 274
              KV+FA ERT+LSWL+ S++LGG +  LL +G    +  +      ++ V++  +  Y
Sbjct: 619 VEPKVYFATERTYLSWLSISILLGGVSTTLLTYGSPTAMIGSIGFFITSLAVLIRTVMVY 678

Query: 275 LWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLR 313
             RV  IR + +  YED+ GP  + + L++S+  +F+L+
Sbjct: 679 AKRVVNIRLKRAVDYEDKIGPGMVSVFLILSILFSFFLQ 717



>gi|349579179|dbj|GAA24342.1| K7_Vtc4p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 721

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 126/343 (36%), Positives = 177/343 (51%), Gaps = 29/343 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  P+N  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VDSIPFWLPQMDVDIRKPPLPTNIEITR 498

Query: 119 PSASNPTTPANERGNPFSGTXXXXXXXX--------XXXXXXXXXXXXXNTPLLSESSQN 170
           P  S+      +  +                                  NT  + ES+  
Sbjct: 499 PGRSDNEDNDFDEDDEDDAALVAAMTNAPGNSLDIEESVGYGATSAPTSNTNHVVESANA 558

Query: 171 TNTQLR----STPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEP--------- 217
              Q +      P      E+  +        ++ K   G      +R  P         
Sbjct: 559 AYYQRKIRNAENPISKKYYEIVAFFDHYFNGDQISKIPKGTTFDTQIRAPPGKTICVPVR 618

Query: 218 ---KVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTY 274
              KV+FA ERT+LSWL+ S++LGG +  LL +G    +  +      ++ V++  +  Y
Sbjct: 619 VEPKVYFATERTYLSWLSISILLGGVSTTLLTYGSPTAMIGSIGFFITSLAVLIRTVMVY 678

Query: 275 LWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
             RV  IR + +  YED+ GP  + + L++S+  +F+  L  K
Sbjct: 679 AKRVVNIRLKRAVDYEDKIGPGMVSVFLILSIIFSFFCNLVAK 721



>gi|323304334|gb|EGA58107.1| Vtc4p [Saccharomyces cerevisiae FostersB]
          Length = 451

 Score =  216 bits (550), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 126/343 (36%), Positives = 177/343 (51%), Gaps = 29/343 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 112 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 169

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  P+N  + R
Sbjct: 170 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VDSIPFWLPQMDVDIRKPPLPTNIEITR 228

Query: 119 PSASNPTTPANERGNPFSGTXXXXXXXX--------XXXXXXXXXXXXXNTPLLSESSQN 170
           P  S+      +  +                                  NT  + ES+  
Sbjct: 229 PGRSDNEDNDFDEDDEDDAALVAAMTNAPGNSLDIEESVGYGATSAPTSNTNHVVESANA 288

Query: 171 TNTQLR----STPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEP--------- 217
              Q +      P      E+  +        ++ K   G      +R  P         
Sbjct: 289 AYYQRKIRNAENPISKKYYEIVAFFDHYFNGDQISKIPKGTTFDTQIRAPPGKTICVPVR 348

Query: 218 ---KVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTY 274
              KV+FA ERT+LSWL+ S++LGG +  LL +G    +  +      ++ V++  +  Y
Sbjct: 349 VEPKVYFATERTYLSWLSISILLGGVSTTLLTYGSPTAMIGSIGFFITSLAVLIRTVMVY 408

Query: 275 LWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
             RV  IR + +  YED+ GP  + + L++S+  +F+  L  K
Sbjct: 409 AKRVVNIRLKRAVDYEDKIGPGMVSVFLILSILFSFFCNLVAK 451



>gi|42742256|ref|NP_012522.2| Vtc4p [Saccharomyces cerevisiae S288c]
 gi|51704292|sp|P47075.2|VTC4_YEAST RecName: Full=Vacuolar transporter chaperone 4; AltName:
           Full=Phosphate metabolism protein 3
 gi|30267875|gb|AAP21767.1| Vtc4p [Saccharomyces cerevisiae]
 gi|151945066|gb|EDN63317.1| vacuolar transporter chaperone [Saccharomyces cerevisiae YJM789]
 gi|190409478|gb|EDV12743.1| vacuolar transporter chaperone 4 [Saccharomyces cerevisiae RM11-1a]
 gi|207343937|gb|EDZ71240.1| YJL012Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256271063|gb|EEU06164.1| Vtc4p [Saccharomyces cerevisiae JAY291]
 gi|285812883|tpg|DAA08781.1| TPA: Vtc4p [Saccharomyces cerevisiae S288c]
 gi|290771193|emb|CAY80765.2| Vtc4p [Saccharomyces cerevisiae EC1118]
 gi|323354479|gb|EGA86318.1| Vtc4p [Saccharomyces cerevisiae VL3]
 gi|365764851|gb|EHN06370.1| Vtc4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392298416|gb|EIW09513.1| Vtc4p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 721

 Score =  216 bits (550), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 126/343 (36%), Positives = 177/343 (51%), Gaps = 29/343 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  P+N  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VDSIPFWLPQMDVDIRKPPLPTNIEITR 498

Query: 119 PSASNPTTPANERGNPFSGTXXXXXXXX--------XXXXXXXXXXXXXNTPLLSESSQN 170
           P  S+      +  +                                  NT  + ES+  
Sbjct: 499 PGRSDNEDNDFDEDDEDDAALVAAMTNAPGNSLDIEESVGYGATSAPTSNTNHVVESANA 558

Query: 171 TNTQLR----STPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEP--------- 217
              Q +      P      E+  +        ++ K   G      +R  P         
Sbjct: 559 AYYQRKIRNAENPISKKYYEIVAFFDHYFNGDQISKIPKGTTFDTQIRAPPGKTICVPVR 618

Query: 218 ---KVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTY 274
              KV+FA ERT+LSWL+ S++LGG +  LL +G    +  +      ++ V++  +  Y
Sbjct: 619 VEPKVYFATERTYLSWLSISILLGGVSTTLLTYGSPTAMIGSIGFFITSLAVLIRTVMVY 678

Query: 275 LWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
             RV  IR + +  YED+ GP  + + L++S+  +F+  L  K
Sbjct: 679 AKRVVNIRLKRAVDYEDKIGPGMVSVFLILSILFSFFCNLVAK 721



>gi|363756190|ref|XP_003648311.1| hypothetical protein Ecym_8209 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356891511|gb|AET41494.1| Hypothetical protein Ecym_8209 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 723

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 133/350 (38%), Positives = 182/350 (52%), Gaps = 46/350 (13%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRRMDIGID+PF +L + ++ERFPYA+LEVKLQTQ G EPPE
Sbjct: 383 MVREDNFDGYDR--TNKNWRRMDIGIDWPFKQLNEMDVERFPYAVLEVKLQTQLGTEPPE 440

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPS 120
           WV+ELV SHLVE VPKFSKFIHGVATL++ R +   P+WLPQM++DIRKP      +  S
Sbjct: 441 WVRELVGSHLVEPVPKFSKFIHGVATLLNER-VDSIPYWLPQMNVDIRKP------QIQS 493

Query: 121 ASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQ-------NTN- 172
             N T P  E  +  + T                         L + S        NTN 
Sbjct: 494 LINITRPTREDDDNDNDTESFDEESQAVTRNLLDIEERTGYGALEQQSDPHPYRMANTNP 553

Query: 173 -------------------TQLRSTPHISSLEELEEYLATVTPAGKVPK-TYHGKKIAIP 212
                              + + S  +     +L+ YL       KVPK T    ++  P
Sbjct: 554 NFVAVSTNSARLRRKIASASNMFSRTYYKLYAKLDHYLNG-DQFFKVPKDTVFDTEVRAP 612

Query: 213 --------VRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTM 264
                   VRVEPKV+FA ERTFLSW+N  ++L G +  +L +G +IT+ A+       +
Sbjct: 613 PGKSICVPVRVEPKVYFATERTFLSWINIVLLLAGISTTMLTYGTRITMLASIGFFITAL 672

Query: 265 MVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
             ++ +   Y   V  IR + +  YED Y P  +  +L +S+  +F+  L
Sbjct: 673 ATLISSTIVYCRHVVNIRLKRAVDYEDTYNPPMVFGLLFVSIAFSFFCNL 722



>gi|71024295|ref|XP_762377.1| hypothetical protein UM06230.1 [Ustilago maydis 521]
 gi|46101877|gb|EAK87110.1| hypothetical protein UM06230.1 [Ustilago maydis 521]
          Length = 936

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (78%), Gaps = 12/142 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDN++   R R+GNNWRRMDIGIDYPF +LP  +IERFPY +LEVKLQTQ GQEPP+
Sbjct: 487 LVREDNWDG--RQRAGNNWRRMDIGIDYPFDQLPAEDIERFPYGVLEVKLQTQLGQEPPQ 544

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++LV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMDIDIRKPPS N  +ERP
Sbjct: 545 WIRDLVSSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMDIDIRKPPSNNLAIERP 603

Query: 120 S--------ASNPTTPANERGN 133
           S        +S P TPA+  G+
Sbjct: 604 SSMTHSPAGSSRPDTPASRSGH 625



 Score =  117 bits (292), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 78/115 (67%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKK+++P+R+EPKV+FANERTFL WL F+V L   A+GLLNF   GD+  + A+SF   V
Sbjct: 810 GKKVSVPIRIEPKVYFANERTFLKWLEFNVYLSALAVGLLNFSSPGDRTGLIASSFFTIV 869

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGP-YEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   ++ R  KIR+RES   Y D YGPT +C  +L +V +NF LR  E
Sbjct: 870 ALIGIAYSGIIFVIRALKIRQRESSNIYFDAYGPTILCGAILSAVVVNFVLRFTE 924



>gi|501305998|dbj|GAC95104.1| hypothetical protein PHSY_002679 [Pseudozyma hubeiensis SY62]
          Length = 885

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (78%), Gaps = 12/142 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDN++   R R+GNNWRRMDIGIDYPF +LP  +IERFPY +LEVKLQTQ GQEPP+
Sbjct: 434 LVREDNWDG--RQRAGNNWRRMDIGIDYPFEQLPAEDIERFPYGVLEVKLQTQLGQEPPQ 491

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++LV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMDIDIRKPPS N  +ERP
Sbjct: 492 WIRDLVSSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMDIDIRKPPSNNLAIERP 550

Query: 120 S--------ASNPTTPANERGN 133
           S        +S P TPA+  G+
Sbjct: 551 SSMTHSPAGSSRPDTPASRNGH 572



 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/119 (48%), Positives = 80/119 (67%), Gaps = 7/119 (5%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKK+++P+R+EPKV+FANERTFL WL F+V L   AIGLLNF   GD+  + A+SF   V
Sbjct: 759 GKKVSVPIRIEPKVYFANERTFLKWLEFNVYLSALAIGLLNFSSPGDRTGLIASSFFTIV 818

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGP-YEDRYGPTFICIMLLISVTINFWLRL---HEK 317
            ++ + Y+   ++ R  KIR+RES   Y D YGP+ +C  +L +V +NF LR    HEK
Sbjct: 819 ALVGIAYSGVIFVIRALKIRQRESSNVYFDAYGPSILCAAILSAVVVNFVLRFMESHEK 877



>gi|164658734|ref|XP_001730492.1| hypothetical protein MGL_2288 [Malassezia globosa CBS 7966]
 gi|159104388|gb|EDP43278.1| hypothetical protein MGL_2288 [Malassezia globosa CBS 7966]
          Length = 863

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDN++   + RSGNNWRRMDIGIDYPF +LP+G++ERFPY +LEVKLQTQ GQEPP+
Sbjct: 431 LVREDNWDG--KQRSGNNWRRMDIGIDYPFEQLPEGDVERFPYGVLEVKLQTQMGQEPPK 488

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV+ELVQSHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMDIDIRKP S N  L+RP
Sbjct: 489 WVRELVQSHLVEAVPKFSKFIHGCATLLSNR-VDLVPFWLPQMDIDIRKPVSMNLALDRP 547

Query: 120 SASNPTT 126
             S+  +
Sbjct: 548 HHSSSQS 554



 Score =  120 bits (300), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 76/117 (64%), Gaps = 4/117 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK++++P+RVEPKV+FANERTFL WL FSV++   A GLLNF   GD I +  ++    +
Sbjct: 737 GKRVSVPIRVEPKVYFANERTFLKWLEFSVMIASIATGLLNFQRAGDTIGLITSALFTLI 796

Query: 263 TMMVMLYALGTYLWRVKKIRKR-ESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +  + Y+   Y+WR  KIR+R  S  Y D YGPTFIC ++L    INF +R  E S
Sbjct: 797 ALFTIAYSGVLYMWRALKIRERCSSNVYSDLYGPTFICFVILAVTLINFGMRYFETS 853



>gi|343427977|emb|CBQ71502.1| probable VTC4-Vacuolar Transporter Chaperone [Sporisorium reilianum
           SRZ2]
          Length = 893

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 112/142 (78%), Gaps = 12/142 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDN++  PR  +G+NWRRMDIGIDYPF +LP  +IERFPY +LEVKLQTQ GQEPP+
Sbjct: 442 LVREDNWDGRPR--AGDNWRRMDIGIDYPFDQLPAEDIERFPYGVLEVKLQTQLGQEPPQ 499

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++LV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMDIDIRKPPS N  +ERP
Sbjct: 500 WIRDLVSSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMDIDIRKPPSNNLVIERP 558

Query: 120 S--------ASNPTTPANERGN 133
           S        +S P TPA+  G+
Sbjct: 559 SSMAHSPAGSSRPDTPASRNGH 580



 Score =  119 bits (299), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (67%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKK+++P+R+EPKV+FANERTFL WL F+V L   A+GLLNF   GD+  + A+SF   V
Sbjct: 767 GKKVSVPIRIEPKVYFANERTFLKWLEFNVYLSALAVGLLNFSAPGDRTGLIASSFFTIV 826

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGP-YEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   +L R  KIRKRES   Y D YGPT +C  +L +V +NF LR  E
Sbjct: 827 ALIGIAYSGIIFLIRALKIRKRESSHIYFDAYGPTILCAAILSAVVVNFVLRFIE 881



>gi|406858843|gb|EKD11929.1| VTC domain-containing protein [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 801

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/127 (70%), Positives = 106/127 (83%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   + R+G+NWRRMDIGIDYPFS+LP  +IERFPYA+LEVKLQTQ GQEPPE
Sbjct: 405 MIREDNLDG--KKRAGDNWRRMDIGIDYPFSQLPAEDIERFPYAVLEVKLQTQAGQEPPE 462

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV+EL+ SHLVEAVPKFSKFIHG ATL  +R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 463 WVRELIASHLVEAVPKFSKFIHGTATLFPTR-IKLLPFWMPQMDVDIRKPVTQHFGIRRP 521

Query: 120 SASNPTT 126
             SNP+T
Sbjct: 522 GLSNPST 528



 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (63%), Gaps = 3/113 (2%)

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKIT---VTAASFLVFVTMM 265
           I + VRVEPKV+FA ERTFLSWL  S+ +   A+ +LNFGDK T     AA     V ++
Sbjct: 678 IHVLVRVEPKVYFAAERTFLSWLENSIYISTIAVTVLNFGDKPTRGSFLAAFAFTAVAIL 737

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +LY++G YL+R + IRKR +  Y D +GPT IC +L ++V +N W    E+ 
Sbjct: 738 SLLYSVGIYLYRSQAIRKRRAIKYHDSFGPTVICAVLFVAVVLNVWWEAGERG 790



>gi|156062318|ref|XP_001597081.1| hypothetical protein SS1G_01275 [Sclerotinia sclerotiorum 1980]
 gi|154696611|gb|EDN96349.1| hypothetical protein SS1G_01275 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 785

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 4/125 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R R+G+NWRRMDIGIDYPFS+LP  ++ERFPYA+LEVKLQTQ GQEPPE
Sbjct: 403 MVREDNLDG--RRRAGDNWRRMDIGIDYPFSQLPAEDVERFPYAVLEVKLQTQAGQEPPE 460

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV+EL+ SHLVEAVPKFSKFIHG ATL  +R I L PFW+PQMD+DIRKP + +F ++RP
Sbjct: 461 WVRELISSHLVEAVPKFSKFIHGTATLFPTR-INLIPFWMPQMDVDIRKPVTQHFGIKRP 519

Query: 120 SASNP 124
             SNP
Sbjct: 520 GHSNP 524



 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 76/116 (65%), Gaps = 3/116 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK---ITVTAASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL+WL FS+ +G  A  L+NFG K   I+  AA F   V
Sbjct: 670 GKKIHVPVRVEPKVYFAAERTFLTWLEFSIYIGTIAATLVNFGAKPTAISFIAAGFFSLV 729

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +M + Y++G YL+R   IR+R++  Y D +GP+ +C  L  +V +N   +L+ K 
Sbjct: 730 AIMSLSYSVGMYLYRSNSIRQRKNIKYYDAWGPSILCASLFAAVVVNAAFQLNAKD 785



>gi|388857645|emb|CCF48794.1| probable VTC4-Vacuolar Transporter Chaperone [Ustilago hordei]
          Length = 891

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/138 (65%), Positives = 110/138 (79%), Gaps = 12/138 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDN+++  R R+GNNWRRMDIGIDYPF +LP  +IERFPY +LEVKLQTQ GQEPP+
Sbjct: 441 LVREDNWDH--RQRAGNNWRRMDIGIDYPFDQLPPEDIERFPYGVLEVKLQTQLGQEPPQ 498

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W+++LV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMD DIRKPPSN   +ERP
Sbjct: 499 WIRDLVSSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMDTDIRKPPSNHLAIERP 557

Query: 120 SA--------SNPTTPAN 129
           S+        S P TPA+
Sbjct: 558 SSMTHSPPSPSRPDTPAS 575



 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 78/115 (67%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKK+++P+R+EPKV+FANERTFL WL F+V L   A+GLLNF   GD+  + A++F   V
Sbjct: 765 GKKVSVPIRIEPKVYFANERTFLKWLEFNVYLSALAVGLLNFSSPGDRNGLIASAFFTIV 824

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGP-YEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   ++ R  KIR+RES   Y D YGPT +C  +L +V +NF +R  E
Sbjct: 825 ALIGIAYSGIIFVIRALKIRQRESSNIYFDAYGPTILCAAILAAVVVNFIIRFTE 879



>gi|154297372|ref|XP_001549113.1| hypothetical protein BC1G_12090 [Botryotinia fuckeliana B05.10]
 gi|347835826|emb|CCD50398.1| similar to vacuolar transporter chaperone (Vtc4) [Botryotinia
           fuckeliana T4]
          Length = 818

 Score =  186 bits (473), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 4/125 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   + R+GNNWRRMDIGIDYPFS+LP  ++ERFPYA+LEVKLQTQ GQEPPE
Sbjct: 436 MVREDNLDG--KRRAGNNWRRMDIGIDYPFSQLPAEDVERFPYAVLEVKLQTQAGQEPPE 493

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV+EL+ SHLVEAVPKFSKFIHG ATL  +R I L PFW+PQMD+DIRKP + +F ++RP
Sbjct: 494 WVRELIASHLVEAVPKFSKFIHGTATLFPTR-INLIPFWMPQMDVDIRKPVTQSFGIKRP 552

Query: 120 SASNP 124
             SNP
Sbjct: 553 GHSNP 557



 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 3/115 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK---ITVTAASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL+WL FS+ +G  A  L+NFG K   ++   + F   V
Sbjct: 703 GKKIHVPVRVEPKVYFAAERTFLTWLEFSIYIGTIAATLVNFGTKPTAVSFIVSGFFSIV 762

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
            +M + Y++G YL+R   IR+R +  Y D +GP+ +C  L  +V +N W  +  K
Sbjct: 763 AIMSLAYSVGMYLYRSNSIRERRNIKYYDAWGPSILCASLFAAVVVNAWFEMSAK 817



>gi|472246277|gb|EMR90816.1| putative vacuolar transporter chaperone 4 protein [Botryotinia
           fuckeliana BcDW1]
          Length = 818

 Score =  186 bits (473), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 4/125 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   + R+GNNWRRMDIGIDYPFS+LP  ++ERFPYA+LEVKLQTQ GQEPPE
Sbjct: 436 MVREDNLDG--KRRAGNNWRRMDIGIDYPFSQLPAEDVERFPYAVLEVKLQTQAGQEPPE 493

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV+EL+ SHLVEAVPKFSKFIHG ATL  +R I L PFW+PQMD+DIRKP + +F ++RP
Sbjct: 494 WVRELIASHLVEAVPKFSKFIHGTATLFPTR-INLIPFWMPQMDVDIRKPVTQSFGIKRP 552

Query: 120 SASNP 124
             SNP
Sbjct: 553 GHSNP 557



 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 3/115 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK---ITVTAASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL+WL FS+ +G  A  L+NFG K   ++   + F   V
Sbjct: 703 GKKIHVPVRVEPKVYFAAERTFLTWLEFSIYIGTIAATLVNFGTKPTAVSFIVSGFFSIV 762

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
            +M + Y++G YL+R   IR+R +  Y D +GP+ +C  L  +V +N W  +  K
Sbjct: 763 AIMSLAYSVGMYLYRSNSIRERRNIKYYDAWGPSILCASLFAAVVVNAWFEMSAK 817



>gi|465794509|emb|CCU99297.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 870

 Score =  186 bits (473), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 89/129 (68%), Positives = 108/129 (83%), Gaps = 6/129 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDN++   + RSG+NWRRMDIGIDYPF +LP+G++ERFPY +LEVKLQTQ GQEPP+
Sbjct: 444 LVREDNWDG--KQRSGDNWRRMDIGIDYPFEQLPEGDVERFPYGVLEVKLQTQMGQEPPK 501

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV+ELV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMDIDIRKP S +  L+RP
Sbjct: 502 WVRELVSSHLVEAVPKFSKFIHGCATLLSNR-VDLVPFWLPQMDIDIRKPVSMDLALDRP 560

Query: 120 --SASNPTT 126
             SASN  +
Sbjct: 561 HHSASNSES 569



 Score =  116 bits (290), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 4/112 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKK+++P+R+EPKV+FANERTFL WL  SV+L   A GLLNF   GD   +  ++    V
Sbjct: 744 GKKVSVPIRIEPKVYFANERTFLKWLELSVLLASIATGLLNFQRAGDTGGLATSAVFTLV 803

Query: 263 TMMVMLYALGTYLWRVKKIRKRE-SGPYEDRYGPTFICIMLLISVTINFWLR 313
            +  + Y+   Y+WR  KIR+R  S  Y D YGPT +CI +L +  INF+LR
Sbjct: 804 ALFAVAYSGVLYMWRAFKIRERSASNVYSDPYGPTLLCIAILSATAINFFLR 855



>gi|327303090|ref|XP_003236237.1| vacuolar transporter chaperone 4 [Trichophyton rubrum CBS 118892]
 gi|326461579|gb|EGD87032.1| vacuolar transporter chaperone 4 [Trichophyton rubrum CBS 118892]
          Length = 826

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R R G NWRRMDIGIDYPF +LP  +IERFPYA+LEVKLQTQ GQEPP+
Sbjct: 403 MIREDNLDG--RQRCGQNWRRMDIGIDYPFKQLPAADIERFPYAVLEVKLQTQAGQEPPQ 460

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATLM  R I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 461 WIKELTSSHLVEAVPKFSKFIHGTATLMPDR-INLLPFWMPQMDVDIRKPITPGFGIERP 519

Query: 120 SASNPTT 126
             SN +T
Sbjct: 520 VQSNQST 526



 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 82/118 (69%), Gaps = 6/118 (5%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
           K PK   GK+I +PVRVEPKVFFA ERTFLSWL FS+ + G A+ LLNFG DKI++  A 
Sbjct: 687 KAPK---GKRIHVPVRVEPKVFFAVERTFLSWLEFSIWVSGIALTLLNFGHDKISIITAW 743

Query: 258 FLVFVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLR 313
               +  ++++Y+   Y+WRV KIRK+      Y +++GPT +C+ +++SV INF LR
Sbjct: 744 AFTVMACLLLVYSFLLYMWRVDKIRKQRDVKNVYHEKWGPTILCLGVIVSVIINFSLR 801



>gi|326479414|gb|EGE03424.1| vacuolar transporter chaperone 4 [Trichophyton equinum CBS 127.97]
          Length = 826

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R R G NWRRMDIGIDYPF +LP  +IERFPYA+LEVKLQTQ GQEPP+
Sbjct: 403 MIREDNLDG--RQRCGQNWRRMDIGIDYPFKQLPAADIERFPYAVLEVKLQTQAGQEPPQ 460

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATLM  R I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 461 WIKELTSSHLVEAVPKFSKFIHGTATLMPDR-INLLPFWMPQMDVDIRKPITPGFGIERP 519

Query: 120 SASNPTT 126
             SN +T
Sbjct: 520 VQSNQST 526



 Score =  119 bits (297), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 82/118 (69%), Gaps = 6/118 (5%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
           K PK   GK+I +PVRVEPKVFFA ERTFLSWL FS+ + G A+ LLNFG DKI++  A 
Sbjct: 687 KAPK---GKRIHVPVRVEPKVFFAVERTFLSWLEFSIWVSGIALTLLNFGHDKISIITAW 743

Query: 258 FLVFVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLR 313
               +  ++++Y+   Y+WRV KIRK+      Y +++GPT +C+ +++SV INF LR
Sbjct: 744 AFTVMACLLLVYSFLLYMWRVDKIRKQRDVKNVYHEKWGPTILCLGVIVSVIINFSLR 801



>gi|388581709|gb|EIM22016.1| SPX-domain-containing protein [Wallemia sebi CBS 633.66]
          Length = 861

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 105/124 (84%), Gaps = 4/124 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDN++   R RSG+NWRRMDIGIDYPF++LP+ +I+RFPY ILEVKLQTQ GQEPPE
Sbjct: 411 LVREDNWDG--RQRSGDNWRRMDIGIDYPFNQLPNEDIDRFPYGILEVKLQTQMGQEPPE 468

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV++LV SHLVEAVPKFSKFIHG ATL+D+R + L PFW+PQM+IDIRKP +    +ERP
Sbjct: 469 WVRQLVSSHLVEAVPKFSKFIHGCATLLDNR-VNLLPFWMPQMEIDIRKPATKELLIERP 527

Query: 120 SASN 123
             SN
Sbjct: 528 QTSN 531



 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 80/113 (70%), Gaps = 3/113 (2%)

Query: 205 HGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVF 261
           +GKKI +PVRVEPKV+FANERTFL WL FS++L   A+ LLN+    DK    +A+   F
Sbjct: 746 NGKKIWVPVRVEPKVYFANERTFLKWLQFSILLSSIAVTLLNYTSTADKTGFISAALFTF 805

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            +++ + Y+  T++WR  KIRKRE+  Y DR GP+ +C ++LI+V +NF LRL
Sbjct: 806 ASLISISYSAFTFVWRAMKIRKREAVSYYDRIGPSILCGVMLIAVFVNFILRL 858



>gi|315050232|ref|XP_003174490.1| vacuolar transporter chaperone 4 [Arthroderma gypseum CBS 118893]
 gi|311339805|gb|EFQ99007.1| vacuolar transporter chaperone 4 [Arthroderma gypseum CBS 118893]
          Length = 826

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R R G NWRRMDIGIDYPF +LP  +IERFPYA+LEVKLQTQ GQEPP+
Sbjct: 403 MIREDNLDG--RQRCGQNWRRMDIGIDYPFKQLPAADIERFPYAVLEVKLQTQAGQEPPQ 460

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATLM  R I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 461 WIKELTSSHLVEAVPKFSKFIHGTATLMPER-INLLPFWMPQMDVDIRKPVTPGFGIERP 519

Query: 120 SASNPTT 126
             SN +T
Sbjct: 520 VQSNQST 526



 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 81/118 (68%), Gaps = 6/118 (5%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
           K PK   GK+I +PVRVEPKVFFA ERTFLSWL FS+ + G AI LLNFG D IT+  A 
Sbjct: 687 KAPK---GKRIHVPVRVEPKVFFAVERTFLSWLEFSLWVSGIAITLLNFGHDNITIITAW 743

Query: 258 FLVFVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLR 313
               +  ++++Y+   Y+WRV KIRK+      Y +++GPT +C+ +++SV INF LR
Sbjct: 744 AFTVMACLLLVYSFLLYMWRVDKIRKQRDVKSVYHEKWGPTILCLGVVVSVIINFSLR 801



>gi|326471320|gb|EGD95329.1| vacuolar transporter chaperone 4 [Trichophyton tonsurans CBS
           112818]
          Length = 826

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R R G NWRRMDIGIDYPF +LP  +IERFPYA+LEVKLQTQ GQEPP+
Sbjct: 403 MIREDNLDG--RQRCGQNWRRMDIGIDYPFKQLPAADIERFPYAVLEVKLQTQAGQEPPQ 460

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATLM  R I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 461 WIKELTSSHLVEAVPKFSKFIHGTATLMPDR-INLLPFWMPQMDVDIRKPITPGFGIERP 519

Query: 120 SASNPTT 126
             SN +T
Sbjct: 520 VQSNQST 526



 Score =  119 bits (297), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 82/118 (69%), Gaps = 6/118 (5%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
           K PK   GK+I +PVRVEPKVFFA ERTFLSWL FS+ + G A+ LLNFG DKI++  A 
Sbjct: 687 KAPK---GKRIHVPVRVEPKVFFAVERTFLSWLEFSIWVSGIALTLLNFGHDKISIITAW 743

Query: 258 FLVFVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLR 313
               +  ++++Y+   Y+WRV KIRK+      Y +++GPT +C+ +++SV INF LR
Sbjct: 744 AFTVMACLLLVYSFLLYMWRVDKIRKQRDVKNVYHEKWGPTILCLGVIVSVIINFSLR 801



>gi|302509596|ref|XP_003016758.1| hypothetical protein ARB_05051 [Arthroderma benhamiae CBS 112371]
 gi|291180328|gb|EFE36113.1| hypothetical protein ARB_05051 [Arthroderma benhamiae CBS 112371]
          Length = 887

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R R G NWRRMDIGIDYPF +LP  +IERFPYA+LEVKLQTQ GQEPP+
Sbjct: 444 MIREDNLDG--RQRCGQNWRRMDIGIDYPFKQLPAADIERFPYAVLEVKLQTQAGQEPPQ 501

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATLM  R I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 502 WIKELTSSHLVEAVPKFSKFIHGTATLMPDR-INLLPFWMPQMDVDIRKPITPGFGIERP 560

Query: 120 SASNPTT 126
             SN +T
Sbjct: 561 VQSNQST 567



 Score =  113 bits (282), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 76/108 (70%), Gaps = 3/108 (2%)

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTMMVM 267
           I +PVRVEPKVFFA ERTFLSWL FS+ + G A+ LLNFG DKI++  A     +  +++
Sbjct: 755 IHVPVRVEPKVFFAVERTFLSWLEFSIWVSGIALTLLNFGHDKISIITAWAFTVMACLLL 814

Query: 268 LYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLR 313
           +Y+   Y+WRV KIRK+      Y +++GPT +C+ +++SV INF LR
Sbjct: 815 VYSFLLYMWRVDKIRKQRDVKNVYHEKWGPTILCLGVIVSVIINFSLR 862



>gi|443899777|dbj|GAC77106.1| component of vacuolar transporter chaperone [Pseudozyma antarctica
           T-34]
          Length = 891

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 110/138 (79%), Gaps = 12/138 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDN++   R R+G+NWRRMDIGIDYPF +LP  +IERFPY +LEVKLQTQ GQEPP+
Sbjct: 441 LVREDNWDG--RQRAGHNWRRMDIGIDYPFDQLPAEDIERFPYGVLEVKLQTQLGQEPPQ 498

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++LV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMDIDIRKPP+ +  +ERP
Sbjct: 499 WIRDLVSSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMDIDIRKPPTHHLAIERP 557

Query: 120 S--------ASNPTTPAN 129
           S        +S P TPA+
Sbjct: 558 SSMVHSPAGSSRPDTPAS 575



 Score =  120 bits (300), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 78/115 (67%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKK+++P+R+EPKV+FANERTFL WL F+V L   A+GLLNF   GD+  + A+SF   V
Sbjct: 765 GKKVSVPIRIEPKVYFANERTFLKWLEFNVYLSALAVGLLNFSSPGDRTGLIASSFFTIV 824

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGP-YEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   ++ R  KIRKRES   Y D YGPT +C  +L +V +NF LR  E
Sbjct: 825 ALVGIAYSGVVFVIRALKIRKRESSHIYFDAYGPTILCAAILSAVVVNFVLRFTE 879



>gi|296813211|ref|XP_002846943.1| vacuolar transporter chaperone 4 [Arthroderma otae CBS 113480]
 gi|238842199|gb|EEQ31861.1| vacuolar transporter chaperone 4 [Arthroderma otae CBS 113480]
          Length = 860

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R R G NWRRMDIGIDYPF +LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 439 MIREDNLDG--RQRCGQNWRRMDIGIDYPFKQLPAADVERFPYAVLEVKLQTQAGQEPPQ 496

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATLM  R I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 497 WIKELTSSHLVEAVPKFSKFIHGTATLMPDR-INLLPFWMPQMDVDIRKPVTPGFGIERP 555

Query: 120 SASNPTT 126
             SN +T
Sbjct: 556 VQSNQST 562



 Score =  117 bits (293), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 81/118 (68%), Gaps = 6/118 (5%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
           K PK   GK+I +PVRVEPKVFFA ERTFLSWL FS+ + G A+ LLNFG D I++  A 
Sbjct: 721 KAPK---GKRIHVPVRVEPKVFFAVERTFLSWLEFSIYVSGIALTLLNFGHDNISIITAW 777

Query: 258 FLVFVTMMVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLR 313
               +  ++++Y+   Y+WRV KIRK+      Y +++GPT +C+ +++SV INF LR
Sbjct: 778 AFTVMACLLLVYSFLLYMWRVDKIRKQRDVKRVYHEKWGPTLLCLGVVVSVIINFSLR 835



>gi|302665545|ref|XP_003024382.1| hypothetical protein TRV_01448 [Trichophyton verrucosum HKI 0517]
 gi|291188434|gb|EFE43771.1| hypothetical protein TRV_01448 [Trichophyton verrucosum HKI 0517]
          Length = 852

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 88/130 (67%), Positives = 102/130 (78%), Gaps = 4/130 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R R G NWRRMDIGIDYPF +LP  +IERFPYA+LEVKLQTQ GQEPP+
Sbjct: 411 MIREDNLDG--RQRCGQNWRRMDIGIDYPFKQLPAADIERFPYAVLEVKLQTQAGQEPPQ 468

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEA+PKFSKFIHG ATLM  R I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 469 WIKELTSSHLVEAMPKFSKFIHGTATLMPDR-INLLPFWMPQMDVDIRKPITPGFGIERP 527

Query: 120 SASNPTTPAN 129
             SN +T  +
Sbjct: 528 VQSNQSTSDD 537



 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 76/108 (70%), Gaps = 3/108 (2%)

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTMMVM 267
           I +PVRVEPKVFFA ERTFLSWL FS+ + G A+ LLNFG DKI++  A     +  +++
Sbjct: 720 IHVPVRVEPKVFFAVERTFLSWLEFSIWVSGIALTLLNFGHDKISIITAWAFTVMACLLL 779

Query: 268 LYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLR 313
           +Y+   Y+WRV KIRK+      Y +++GPT +C+ +++SV INF LR
Sbjct: 780 VYSFLLYMWRVDKIRKQRDVKNVYHEKWGPTILCLGVIVSVIINFSLR 827



>gi|358398714|gb|EHK48065.1| hypothetical protein TRIATDRAFT_46903 [Trichoderma atroviride IMI
           206040]
          Length = 771

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 87/127 (68%), Positives = 104/127 (81%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSGNNWRR+DIG+DYPFS+LP  ++ERFPYAILEVKLQTQ GQEPPE
Sbjct: 393 MVREDNLDG--RSRSGNNWRRLDIGVDYPFSQLPPEDVERFPYAILEVKLQTQVGQEPPE 450

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L+ SHLVEAVPKFSKFIHG ATL  +R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 451 WIRQLISSHLVEAVPKFSKFIHGTATLFPNR-INLLPFWMPQMDVDIRKPVTHDFGIRRP 509

Query: 120 SASNPTT 126
             S  TT
Sbjct: 510 DISGTTT 516



 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (64%), Gaps = 3/108 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL WL +S+ +   A  LLNFGD  T T+   A    F+
Sbjct: 654 GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYISTIATTLLNFGDHPTPTSFWIAGIFTFL 713

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINF 310
            +  +LY++  YL+R + IR R++  Y DR+GP+ +C  L ++   NF
Sbjct: 714 AIFSLLYSVANYLYRSRSIRNRKAARYYDRWGPSVLCTALFVAAAFNF 761



>gi|512190028|gb|EPE05793.1| vacuolar transporter chaperone 4 [Ophiostoma piceae UAMH 11346]
          Length = 876

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 87/127 (68%), Positives = 102/127 (80%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   ++RSG+NWRRMDIGIDYPFS+LP  ++ERFPYA+LEVKLQTQ GQEPPE
Sbjct: 471 MVREDNLDG--KVRSGDNWRRMDIGIDYPFSQLPAADVERFPYAVLEVKLQTQMGQEPPE 528

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG ATL   R I L PFWLPQMD+DIRKP S +F + R 
Sbjct: 529 WVRQLISSHLVEAVPKFSKFIHGTATLFPDR-INLLPFWLPQMDVDIRKPRSHDFGIRRA 587

Query: 120 SASNPTT 126
             S  T 
Sbjct: 588 GHSATTA 594



 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK---ITVTAASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A  LLNFG K   I+   A+    +
Sbjct: 758 GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIAATLLNFGSKPSSISFVVATVFTML 817

Query: 263 TMMVMLYALGTYLWRVKKIR-KRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
            ++ +LY++G Y +R + IR +R S  + DRYGP+ +C  + I++ INF    H +
Sbjct: 818 AVLSLLYSVGIYFYRSRAIRTRRASAKFYDRYGPSVLCGAMFIAIAINFAFEGHAR 873



>gi|429963158|gb|ELA42702.1| hypothetical protein VICG_00017 [Vittaforma corneae ATCC 50505]
          Length = 612

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 148/295 (50%), Gaps = 62/295 (21%)

Query: 19  WRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPEWVQELVQSHLVEAVPKFS 78
           W+R D   ++PF  LP  +I RFPYAILEVK Q    +  P W++++V S  VE V K+S
Sbjct: 369 WKRPDAVCEWPFKHLPKEDIIRFPYAILEVKTQG-VDERKPAWIEDVVNSSYVEHVHKYS 427

Query: 79  KFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPSASNPTTPANERGNPFSGT 138
           KF+HG A L   +QI + P+WLPQM  DIRK             +P  P  E        
Sbjct: 428 KFMHGSALLY--KQIEVIPYWLPQMGTDIRK-------------DPFHPIKE-------- 464

Query: 139 XXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLATVTPAG 198
                                N  LL++S    N    S+ ++S +E             
Sbjct: 465 ----------------LKIMQNNVLLTQSEAKEN----SSENLSLIES------------ 492

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
                 HGKKIAIP+RVEPK+FFANERTFL W+ FS+ LGG    +L  GD       S 
Sbjct: 493 ------HGKKIAIPIRVEPKIFFANERTFLKWVQFSIFLGGVGTAILGLGDNNAAWCGSM 546

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLR 313
           L+ V ++ + YA   Y WR +KIR R  GPY+D  GPT +  + L+++ ++   R
Sbjct: 547 LMIVALLFIFYAFYIYKWRAEKIRIRFPGPYDDLVGPTVLVSVFLLALILSVIFR 601



>gi|340924194|gb|EGS19097.1| hypothetical protein CTHT_0057210 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 804

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 104/127 (81%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +     RSG+NWRRMDIGIDYPFS+LP G+I RFPYAILEVKLQTQ GQEPPE
Sbjct: 397 MIREDNLDGV--RRSGDNWRRMDIGIDYPFSQLPPGDIVRFPYAILEVKLQTQLGQEPPE 454

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L  SHLVEAVPKFSKFIHGVATL  +R I L P+W+PQMD+DIRKPP+ +F ++R 
Sbjct: 455 WVRQLTSSHLVEAVPKFSKFIHGVATLFPTR-IHLLPYWMPQMDVDIRKPPTHDFGIKRT 513

Query: 120 SASNPTT 126
             S  T+
Sbjct: 514 EQSATTS 520



 Score =  106 bits (265), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 86/155 (55%), Gaps = 19/155 (12%)

Query: 176 RSTPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSV 235
           RSTP +     LE  L T     +  K   GK+I +PVRVEPKV+FA ERTFL WL +S+
Sbjct: 643 RSTP-MPRNARLESLLGTGEIQTRRFKAPRGKRIHVPVRVEPKVYFAAERTFLGWLEYSI 701

Query: 236 VLGGFAIGLLNFGD------------------KITVTAASFLVFVTMMVMLYALGTYLWR 277
            +   A+ LLNFG                   K++  AA+    + ++ ++YA+  YL+R
Sbjct: 702 YISTIAVTLLNFGSRAKDETSSSSISVSLSHRKVSFIAAAAFTVLAILSLMYAVVVYLYR 761

Query: 278 VKKIRKRESGPYEDRYGPTFICIMLLISVTINFWL 312
            + IR+R    Y D++GP+ +C  LL++V +NF L
Sbjct: 762 SQAIRERRVARYYDKWGPSALCFALLVAVGLNFGL 796



>gi|512197536|gb|EPE26372.1| hypothetical protein GLAREA_02284 [Glarea lozoyensis ATCC 20868]
          Length = 1084

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 4/124 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R R+G NWRRMDIGID+PFS+LP  ++ERFPYAILEVKLQTQ GQEPP 
Sbjct: 695 MVREDNLDG--RDRAGKNWRRMDIGIDFPFSQLPPEDVERFPYAILEVKLQTQAGQEPPS 752

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV+EL+ SHLVEAVPKFSKFIHG ATL  +R I L PFW+PQMD+DIRKP + NF + RP
Sbjct: 753 WVRELIASHLVEAVPKFSKFIHGTATLFPTR-IDLLPFWMPQMDVDIRKPATQNFGIHRP 811

Query: 120 SASN 123
             SN
Sbjct: 812 GHSN 815



 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 78/124 (62%), Gaps = 8/124 (6%)

Query: 199  KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKIT----VT 254
            K PK   GKKI +PVRVEPKV+FA ERTFLSWL FS+ L   A  LLNFG K T    + 
Sbjct: 963  KAPK---GKKIHVPVRVEPKVYFAAERTFLSWLEFSIYLSTIATTLLNFGSKPTRLSFLA 1019

Query: 255  AASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            A SF V V ++ + Y++  YL+R + IR R++  Y D +GPT +C  L I+V +N    L
Sbjct: 1020 AGSFSV-VAILALFYSVVIYLYRSQAIRTRKAIKYHDEFGPTALCTCLFIAVALNMGFEL 1078

Query: 315  HEKS 318
             ++ 
Sbjct: 1079 RDRG 1082



>gi|342879367|gb|EGU80618.1| hypothetical protein FOXB_08841 [Fusarium oxysporum Fo5176]
          Length = 806

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (81%), Gaps = 4/126 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R+RSG+NWRRMDIG+DYPFS+LP  +IERFPYA+LEVKLQTQ GQ+PPE
Sbjct: 422 MVREDNLDG--RVRSGDNWRRMDIGVDYPFSQLPAEDIERFPYAVLEVKLQTQSGQKPPE 479

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 480 WVRQLISSHLVEAVPKFSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPVTHDFGIRRP 538

Query: 120 SASNPT 125
             S  T
Sbjct: 539 GLSGTT 544



 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 72/116 (62%), Gaps = 3/116 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL WL FS+ +G  A+ LLNFG   T T    +     +
Sbjct: 689 GKKIYVPVRVEPKVYFAAERTFLGWLEFSIYIGTIAVTLLNFGSHPTPTHFWISGLFTAL 748

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +  + Y++ TYL R K IR+R++  + DR+GP+ +CI L + V  NF     E+ 
Sbjct: 749 AIASLAYSVFTYLHRSKGIRERKAIGFYDRWGPSILCIALFVGVAANFGFEGKERG 804



>gi|477507750|gb|ENH61044.1| Vacuolar transporter chaperone 4 [Fusarium oxysporum f. sp. cubense
           race 1]
          Length = 806

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (81%), Gaps = 4/126 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R+RSG+NWRRMDIG+DYPFS+LP  +IERFPYA+LEVKLQTQ GQ+PPE
Sbjct: 422 MVREDNLDG--RVRSGDNWRRMDIGVDYPFSQLPAEDIERFPYAVLEVKLQTQSGQKPPE 479

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 480 WVRQLISSHLVEAVPKFSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPVTHDFGIRRP 538

Query: 120 SASNPT 125
             S  T
Sbjct: 539 GLSGTT 544



 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 72/116 (62%), Gaps = 3/116 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL WL FS+ +G  A+ LLNFG   T T    +     +
Sbjct: 689 GKKIYVPVRVEPKVYFAAERTFLGWLEFSIYIGTIAVTLLNFGSHPTPTHFWISGLFTAL 748

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +  + Y++ TYL R K IR+R++  + DR+GP+ +CI L + V  NF     E+ 
Sbjct: 749 AIASLAYSVFTYLHRSKGIRERKAIGFYDRWGPSILCIALFVGVAANFGFEGKERG 804



>gi|475664101|gb|EMT61896.1| Vacuolar transporter chaperone 4 [Fusarium oxysporum f. sp. cubense
           race 4]
          Length = 806

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (81%), Gaps = 4/126 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R+RSG+NWRRMDIG+DYPFS+LP  +IERFPYA+LEVKLQTQ GQ+PPE
Sbjct: 422 MVREDNLDG--RVRSGDNWRRMDIGVDYPFSQLPAEDIERFPYAVLEVKLQTQSGQKPPE 479

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 480 WVRQLISSHLVEAVPKFSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPVTHDFGIRRP 538

Query: 120 SASNPT 125
             S  T
Sbjct: 539 GLSGTT 544



 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 73/116 (62%), Gaps = 3/116 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL WL FS+ +G  A+ LLNFG   T T    +     +
Sbjct: 689 GKKIYVPVRVEPKVYFAAERTFLGWLEFSIYIGTIAVTLLNFGSHPTPTHFWISGLFTAL 748

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +  + Y++ TYL+R K IR+R++  + DR+GP+ +CI L + V  NF     E+ 
Sbjct: 749 AIASLAYSVFTYLYRSKGIRERKAIGFYDRWGPSILCIALFVGVAANFGFEGKERG 804



>gi|336265396|ref|XP_003347469.1| hypothetical protein SMAC_08036 [Sordaria macrospora k-hell]
 gi|380087951|emb|CCC05169.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 816

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 103/129 (79%), Gaps = 4/129 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R  SG+NWRRMDIGIDYPFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 428 MIREDNLDGVQR--SGDNWRRMDIGIDYPFSQLPPSDIVRFPYAVLEVKLQTQLGQEPPE 485

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKPP+ NF ++R 
Sbjct: 486 WVRQLISSHLVEAVPKFSKFIHGTATLFPDR-IHLLPFWMPQMDVDIRKPPTHNFGIKRL 544

Query: 120 SASNPTTPA 128
             S  T+ +
Sbjct: 545 EHSTTTSTS 553



 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 75/118 (63%), Gaps = 9/118 (7%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF------GDKIT 252
           K PK   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A+ LLNF      G + +
Sbjct: 692 KAPK---GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIAVTLLNFSSSDKGGGRGS 748

Query: 253 VTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINF 310
             AA     + +M + YA+  YL+R + IR R++  Y D++GP+ +C  L ++V +NF
Sbjct: 749 FFAAGAFTLLAIMSLCYAVVIYLYRSRAIRTRKAAKYYDKWGPSILCASLFVAVVLNF 806



>gi|500260724|gb|EOO03248.1| putative vacuolar transporter chaperone 4 protein [Togninia minima
           UCRPA7]
          Length = 763

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 103/127 (81%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   + RSG+NWRR DIGID+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPPE
Sbjct: 406 MVREDNLDG--KKRSGDNWRRTDIGIDFPFSQLPPEDVERFPYAVLEVKLQTQAGQEPPE 463

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHGVA L   R I L PFW+PQMD+DIRKP S NF ++RP
Sbjct: 464 WVRQLISSHLVEAVPKFSKFIHGVACLFPER-IKLLPFWMPQMDVDIRKPVSHNFGIQRP 522

Query: 120 SASNPTT 126
             S  T+
Sbjct: 523 GHSATTS 529



 Score =  103 bits (258), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 69/105 (65%), Gaps = 3/105 (2%)

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFVTMM 265
           I +PVRVEPKV+FA ERTFLSWL FS+ +G  A  +LNFG K T T+   +     + ++
Sbjct: 649 IYVPVRVEPKVYFAAERTFLSWLEFSIYIGTIAATVLNFGSKPTRTSFIVSGVFTLLAIL 708

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINF 310
            + Y++  YL+R + IR R +  Y DR+GP+ +C  L ++V +NF
Sbjct: 709 SLSYSVFIYLYRSRAIRTRRAAKYYDRWGPSILCAALFVAVAVNF 753



>gi|46107238|ref|XP_380678.1| hypothetical protein FG00502.1 [Fusarium graminearum PH-1]
          Length = 781

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 100/126 (79%), Gaps = 4/126 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R R G+NWRRMDIGIDYPFS+LP  ++ERFPYA+LEVKLQTQ GQEPPE
Sbjct: 392 MVREDNLDG--RTRCGDNWRRMDIGIDYPFSQLPAEDVERFPYAVLEVKLQTQAGQEPPE 449

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD DIRKP + +F + RP
Sbjct: 450 WVRQLISSHLVEAVPKFSKFIHGTATLFPDR-IDLLPFWMPQMDTDIRKPVTHDFGIRRP 508

Query: 120 SASNPT 125
             S  T
Sbjct: 509 GLSGTT 514



 Score =  107 bits (266), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 185 EELEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGL 244
           E L+      T   K  K   GKKI +PVRVEPKV+FA ERTFL WL FS+ +G  A+ L
Sbjct: 643 ERLQGLFGNDTIQNKKFKAPPGKKIYVPVRVEPKVYFAAERTFLGWLEFSIYIGTIAVTL 702

Query: 245 LNFGDKITVT---AASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIM 301
           LNFG+  T      A     + +M + Y++ TYL+R + IR R+   + DR+GP+ +C  
Sbjct: 703 LNFGNHPTPAHFWVAGVFTLLAIMSLCYSVLTYLYRSQGIRSRKVVKFYDRWGPSALCGA 762

Query: 302 LLISVTINFWLRLHEKS 318
           L I V +NF     E++
Sbjct: 763 LFIGVALNFAFEGRERN 779



>gi|358387175|gb|EHK24770.1| hypothetical protein TRIVIDRAFT_190030 [Trichoderma virens Gv29-8]
          Length = 772

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 102/127 (80%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSG+NWRRMDIG+DYPFS+LP  ++ RFPYAILEVKLQTQ GQEPPE
Sbjct: 393 MVREDNLDG--RARSGDNWRRMDIGVDYPFSQLPPEDVVRFPYAILEVKLQTQVGQEPPE 450

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L+ SHLVEAVPKFSKFIHG A L  SR I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 451 WIRQLISSHLVEAVPKFSKFIHGTACLFPSR-INLLPFWMPQMDVDIRKPVTHDFGIRRP 509

Query: 120 SASNPTT 126
             S  TT
Sbjct: 510 DISGTTT 516



 Score =  116 bits (290), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 73/108 (67%), Gaps = 3/108 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL W+ +S+ +G  A  LLNFGD  T TA   A    F+
Sbjct: 655 GKKIYVPVRVEPKVYFAAERTFLGWIEYSIYIGTIATTLLNFGDHPTPTAFWIAGIFTFL 714

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINF 310
            +  +LY++G YL+R + IR R++  Y DR+GP+ +C+ L ++   NF
Sbjct: 715 AIFSLLYSVGIYLYRSRSIRNRKAARYYDRWGPSVLCVALFVAAGFNF 762



>gi|261195064|ref|XP_002623936.1| vacuolar transporter chaperone Vtc4 [Ajellomyces dermatitidis
           SLH14081]
 gi|239587808|gb|EEQ70451.1| vacuolar transporter chaperone Vtc4 [Ajellomyces dermatitidis
           SLH14081]
 gi|327348862|gb|EGE77719.1| vacuolar transporter chaperone Vtc4 [Ajellomyces dermatitidis ATCC
           18188]
          Length = 877

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 102/127 (80%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN +   R+RSGNNWRRMDIGIDYPF +LP  ++ERFPYAILEVKLQTQ GQ+PP 
Sbjct: 454 LIREDNMDG--RIRSGNNWRRMDIGIDYPFRQLPAQDVERFPYAILEVKLQTQAGQDPPH 511

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL+ SHLVEAVPKFSKFIHG A L     I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 512 WIRELISSHLVEAVPKFSKFIHGTANLFPD-HINLLPFWMPQMDVDIRKPVTRGFGIERP 570

Query: 120 SASNPTT 126
             ++P+T
Sbjct: 571 VQASPST 577



 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 8/120 (6%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG + TVT AS 
Sbjct: 757 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAAALLNFG-RDTVTLASS 812

Query: 259 LVFVTMMV--MLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRL 314
             F  +    ++Y+L  Y+WRV KIRKR      Y +++GPT +C+ LL++V INF LR+
Sbjct: 813 WAFTVLACLSLMYSLLLYMWRVDKIRKRRDVKHVYHEKWGPTVLCVGLLVAVCINFGLRV 872



>gi|239610699|gb|EEQ87686.1| vacuolar transporter chaperone Vtc4 [Ajellomyces dermatitidis ER-3]
          Length = 877

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 102/127 (80%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN +   R+RSGNNWRRMDIGIDYPF +LP  ++ERFPYAILEVKLQTQ GQ+PP 
Sbjct: 454 LIREDNMDG--RIRSGNNWRRMDIGIDYPFRQLPAQDVERFPYAILEVKLQTQAGQDPPH 511

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL+ SHLVEAVPKFSKFIHG A L     I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 512 WIRELISSHLVEAVPKFSKFIHGTANLFPD-HINLLPFWMPQMDVDIRKPVTRGFGIERP 570

Query: 120 SASNPTT 126
             ++P+T
Sbjct: 571 VQASPST 577



 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 8/120 (6%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG + TVT AS 
Sbjct: 757 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAAALLNFG-RDTVTLASS 812

Query: 259 LVFVTMMV--MLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRL 314
             F  +    ++Y+L  Y+WRV KIRKR      Y +++GPT +C+ LL++V INF LR+
Sbjct: 813 WAFTVLACLSLMYSLLLYMWRVDKIRKRRDVKHVYHEKWGPTVLCVGLLVAVCINFGLRV 872



>gi|401826794|ref|XP_003887490.1| SPX domain-containing vacuolar polyphosphate accumulation protein
           [Encephalitozoon hellem ATCC 50504]
 gi|395460008|gb|AFM98509.1| SPX domain-containing vacuolar polyphosphate accumulation protein
           [Encephalitozoon hellem ATCC 50504]
          Length = 610

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 150/296 (50%), Gaps = 61/296 (20%)

Query: 19  WRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPEWVQELVQSHLVEAVPKFS 78
           WRR DI  ++PF  +P  EI RFP+AILEVK Q+   +  P+W++EL+   LVE V KFS
Sbjct: 371 WRRNDINCEFPFRNIPKNEIIRFPHAILEVKTQS-LDETKPKWIEELINGPLVEHVHKFS 429

Query: 79  KFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPSASNPTTPANERGNPFSGT 138
           K++HG A L     I   P+WLPQ+ +DIRK P    +++ S  +               
Sbjct: 430 KYLHGCAALYPF--IQDIPYWLPQVSVDIRKDPFQPDVDKKSFKDTVL------------ 475

Query: 139 XXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLATVTPAG 198
                                + P  SE S +                  E L+ +   G
Sbjct: 476 --------------------VDIPADSEPSNS------------------EKLSPIDVHG 497

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K        +I+IPVRVEPKVFFANERTFLSW+ F++ LGG    LL  GD+    +   
Sbjct: 498 K--------RISIPVRVEPKVFFANERTFLSWVQFAIFLGGIGSALLGLGDERASFSGLI 549

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           L+ V ++   Y+L  YLWR   IRKR+ GPY+D YGP  +  + L+++ ++ + + 
Sbjct: 550 LILVAIIFSFYSLYLYLWRASMIRKRDPGPYDDIYGPAVLVCVFLVAMGLSVFFKF 605



>gi|171695946|ref|XP_001912897.1| hypothetical protein [Podospora anserina S mat+]
 gi|170948215|emb|CAP60379.1| unnamed protein product [Podospora anserina S mat+]
          Length = 817

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 4/123 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R  SG+NWRRMDIGIDYPFS+LP G+I RFPYA+LEVKLQTQ+GQEPP+
Sbjct: 438 MIREDNLDGVTR--SGDNWRRMDIGIDYPFSQLPPGDIVRFPYAVLEVKLQTQHGQEPPD 495

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG ATL   R I L P+W+PQMD+DIRKP S +F ++R 
Sbjct: 496 WVRQLISSHLVEAVPKFSKFIHGTATLFPDR-IHLLPYWMPQMDVDIRKPASHDFGIKRT 554

Query: 120 SAS 122
             S
Sbjct: 555 EHS 557



 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/128 (47%), Positives = 80/128 (62%), Gaps = 4/128 (3%)

Query: 187 LEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLN 246
           LE  L T     K  K   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A+ LLN
Sbjct: 680 LESLLGTGEIQQKRFKAPKGKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIAVTLLN 739

Query: 247 F----GDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIML 302
           F    GDK +  AA    F+ +M + YA+ TYL+R K IR R++  Y D+ GPT +C  L
Sbjct: 740 FSTKRGDKASFIAAGAFTFLAVMSLCYAVATYLYRSKAIRTRQAAKYYDKVGPTVLCAAL 799

Query: 303 LISVTINF 310
            ++V +NF
Sbjct: 800 FVAVALNF 807



>gi|320591300|gb|EFX03739.1| vacuolar transporter chaperone [Grosmannia clavigera kw1407]
          Length = 883

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 100/126 (79%), Gaps = 4/126 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R  SG NWRRMDIGIDYPFS+LP  ++ERFPYA+LEVKLQTQ GQEPPE
Sbjct: 482 MVREDNLDGVQR--SGENWRRMDIGIDYPFSQLPPADVERFPYAVLEVKLQTQTGQEPPE 539

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKF KFIHGVATL  +R I L PFWLPQMD+DIRKP S +F + R 
Sbjct: 540 WVRQLISSHLVEAVPKFGKFIHGVATLFPTR-IHLLPFWLPQMDVDIRKPRSHDFGIRRT 598

Query: 120 SASNPT 125
             S  T
Sbjct: 599 GHSATT 604



 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 76/130 (58%), Gaps = 4/130 (3%)

Query: 185 EELEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGL 244
           E L +   T     K  +   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A  L
Sbjct: 744 ERLRQLFGTADVQTKRFRAPKGKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIAATL 803

Query: 245 LNFGDK---ITVTAASFLVFVTMMVMLYALGTYLWRVKKIR-KRESGPYEDRYGPTFICI 300
           LNFG K   ++   A     + +  ++Y+ G Y +R + IR +R S  + DR GP+ +C 
Sbjct: 804 LNFGSKPNSLSFVVAGAFTLLAVACLVYSSGMYFYRSQAIRTRRASAKFYDRVGPSVLCG 863

Query: 301 MLLISVTINF 310
            LL++V +NF
Sbjct: 864 ALLVAVMLNF 873



>gi|440633461|gb|ELR03380.1| hypothetical protein GMDG_06121 [Geomyces destructans 20631-21]
          Length = 823

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 87/128 (67%), Positives = 104/128 (81%), Gaps = 5/128 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSGNNWRRMDIGID+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP 
Sbjct: 430 MVREDNMDG--RKRSGNNWRRMDIGIDWPFSQLPSEDVERFPYAVLEVKLQTQSGQEPPG 487

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV+EL+ SHLVEAVPKFSKFIHG ATL  +R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 488 WVRELISSHLVEAVPKFSKFIHGTATLFPTR-INLLPFWMPQMDVDIRKPVTHDFGIRRP 546

Query: 120 SA-SNPTT 126
              +N +T
Sbjct: 547 GQFANSST 554



 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 80/123 (65%), Gaps = 8/123 (6%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKIT----VT 254
           K PK   GKKI +PVRVEPKV+FA ERTFL WL FS+ +G  A+ LLNF  K+     V 
Sbjct: 705 KAPK---GKKIHVPVRVEPKVYFAAERTFLGWLEFSIYIGTVAVTLLNFDAKLNSMSFVV 761

Query: 255 AASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           A +F V V +  +LY++  YL+R + IR+R++  Y D +GP+ +C  + I++ +N W  L
Sbjct: 762 AGAFTV-VAVASLLYSVAIYLYRAQAIRERKAVQYHDGWGPSVLCGCVFIAILLNGWFEL 820

Query: 315 HEK 317
            E+
Sbjct: 821 KER 823



>gi|340522473|gb|EGR52706.1| predicted protein [Trichoderma reesei QM6a]
          Length = 772

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 103/127 (81%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R+RSG+NWRRMDIG+DYPFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 393 MIREDNLDG--RIRSGDNWRRMDIGVDYPFSQLPPEDIVRFPYAVLEVKLQTQVGQEPPE 450

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++++ SHLVEAVPKFSKFIHG A L  +R I L P+W+PQMD+DIRKP + +F + RP
Sbjct: 451 WIRQVIASHLVEAVPKFSKFIHGTACLFPTR-IKLLPYWMPQMDVDIRKPVTHDFGIRRP 509

Query: 120 SASNPTT 126
             S  TT
Sbjct: 510 DISGTTT 516



 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 72/108 (66%), Gaps = 3/108 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A  LLNFGD  T TA   A     +
Sbjct: 655 GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIATTLLNFGDHPTPTAFWIAGIFTLL 714

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINF 310
            +  +LY++G Y +R + IR R++  Y DR+GP+ +C+ L ++  +NF
Sbjct: 715 AICSLLYSVGIYFYRSRSIRNRKAARYYDRWGPSALCVALFVAAGLNF 762



>gi|71001114|ref|XP_755238.1| vacuolar transporter chaperone (Vtc4) [Aspergillus fumigatus Af293]
 gi|66852876|gb|EAL93200.1| vacuolar transporter chaperone (Vtc4), putative [Aspergillus
           fumigatus Af293]
          Length = 801

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 89/131 (67%), Positives = 104/131 (79%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSGNNWRRMDIG+D+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 394 MIREDNLDG--RQRSGNNWRRMDIGVDWPFSQLPPQDVERFPYAVLEVKLQTQAGQEPPK 451

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP +  F + RP
Sbjct: 452 WIRELTASHLVEAVPKFSKFIHGTATLFPDR-IHLLPFWMPQMDVDIRKPATRRFGITRP 510

Query: 120 SASNPTTPANE 130
            AS  +  ANE
Sbjct: 511 LAST-SLSANE 520



 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D IT  ++     +  
Sbjct: 665 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGNDYITFVSSWAFTILAA 724

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + ++Y+L  Y+WRV KIRKR      Y +++GPT + + L++ + +NF LR+ +
Sbjct: 725 VALIYSLMLYIWRVDKIRKRRDVKRVYYEKWGPTVVGLGLVVIMLVNFGLRVRQ 778



>gi|384497174|gb|EIE87665.1| hypothetical protein RO3G_12376 [Rhizopus delemar RA 99-880]
          Length = 718

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 179/344 (52%), Gaps = 42/344 (12%)

Query: 2   IREDN--FENNPRLRS-GNNWRRMDIGIDYPFSKLP-DGEIERFPYAILEVKLQTQYGQE 57
           IRED+  F ++P +R   N+WRR D+  ++PF  L  + +I R+P+A  E+KL+    ++
Sbjct: 384 IREDSQLFADDPTIRRPENSWRRPDVDTNFPFDDLKNENDINRYPFATFEIKLELGANEK 443

Query: 58  PPEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP------ 111
            PEW+ +L +S ++E    FSKF+HG+A + D+R +PL P+WL Q+D ++ K P      
Sbjct: 444 EPEWILDLEESGILEEAHDFSKFVHGIAVMFDTR-VPLLPYWLAQIDNNLEKLPDMSSDK 502

Query: 112 ----SNFRLERPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSES 167
               +++ ++ P +S   +  NER +  +                         P L E 
Sbjct: 503 GKDKASYDIQSPESS---SVVNERSSLLNNNNRSPTYPSYMGINQSPL------PSLPEE 553

Query: 168 SQN---------TNTQL---RSTPHISSLEELEEYLATVTPAG-KVPKTYHGKKIAIPVR 214
            Q+          N  L   R     +   + ++    + P G KVPK     K+  P+R
Sbjct: 554 QQSEEGFPSRMVDNITLSFNRFLARFNRPSQKQDQPPVILPPGVKVPK-----KVVTPLR 608

Query: 215 VEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTY 274
           VEPKVFFANERT+ SW++F  +L  F++ L N GD +   +      V++  ++Y +G Y
Sbjct: 609 VEPKVFFANERTYFSWMSFGTLLSTFSLALFNAGDAVGKLSGIVYTLVSVSTLMYGMGLY 668

Query: 275 LWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
             R + IR R  GPY++  GPT IC+ L+ +V +N +L+   KS
Sbjct: 669 YRRRELIRNRSGGPYDEVMGPTIICLALIFAVGLNAYLKFTVKS 712



>gi|393221035|gb|EJD06520.1| SPX-domain-containing protein [Fomitiporia mediterranea MF3/22]
          Length = 855

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 107/146 (73%), Gaps = 13/146 (8%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   R RSG+NWRRMDIGID+PFS+LP  + E F Y +LEVKLQTQYGQEPPE
Sbjct: 438 MVREDNWDG--RRRSGDNWRRMDIGIDHPFSQLPSEDKELFRYGVLEVKLQTQYGQEPPE 495

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV ELVQSHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMDIDI KP +    +ERP
Sbjct: 496 WVTELVQSHLVEAVPKFSKFIHGCATLLPHR-VDLVPFWLPQMDIDILKPDTGRMHIERP 554

Query: 120 SAS---------NPTTPANERGNPFS 136
           + S         +  TP  ER  P++
Sbjct: 555 THSATPSTVETPDVATPDYERQRPYT 580



 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 78/119 (65%), Gaps = 4/119 (3%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASF 258
           K+  G++IA+PVR+EPKV+FA+ERTFL+WL F V++GG +  LLNF    D   + AAS 
Sbjct: 736 KSSPGRRIAVPVRIEPKVYFASERTFLTWLQFGVLIGGISAALLNFVPPDDTRGLIAASL 795

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
             F  ++ + Y+   +++R  K+RKR + G Y D++GP+ +C +L  ++  N  LR  E
Sbjct: 796 FTFAALLAIAYSCTIFVYRAIKLRKRHAEGLYYDKWGPSVLCFVLGAALLTNVGLRFGE 854



>gi|310790732|gb|EFQ26265.1| VTC domain-containing protein [Glomerella graminicola M1.001]
          Length = 782

 Score =  179 bits (454), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 4/121 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSG+NWRRMDIGIDYPFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 399 MVREDNLDG--RKRSGDNWRRMDIGIDYPFSQLPQEDIVRFPYAVLEVKLQTQLGQEPPE 456

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHGVA+L   R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 457 WVRQLISSHLVEAVPKFSKFIHGVASLFPDR-INLLPFWMPQMDVDIRKPVTHDFGIHRP 515

Query: 120 S 120
           +
Sbjct: 516 N 516



 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 76/122 (62%), Gaps = 6/122 (4%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA--- 255
           K PK   GKKI +PVR+EPKV+FA ERTFL WL +S+ +G  A+ LLNFG K T  +   
Sbjct: 661 KAPK---GKKIYVPVRIEPKVYFAAERTFLGWLEYSIYVGTVAVTLLNFGSKPTTASFIV 717

Query: 256 ASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLH 315
           A     + +M + Y++  YL+R   IR R +  + D++GP+ +C+ L I+V +NF     
Sbjct: 718 AGVFTLLAIMSLCYSVIIYLYRSNAIRSRRAAKFYDKWGPSALCVSLFIAVVLNFAFEGR 777

Query: 316 EK 317
           E+
Sbjct: 778 ER 779



>gi|429860553|gb|ELA35285.1| vacuolar transporter chaperone 4 [Colletotrichum gloeosporioides
           Nara gc5]
          Length = 776

 Score =  179 bits (454), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R  SG+NWRRMDIGIDYPFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 398 MVREDNLDGVNR--SGDNWRRMDIGIDYPFSQLPPSDIVRFPYAVLEVKLQTQLGQEPPE 455

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHGVA L   R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 456 WVRQLISSHLVEAVPKFSKFIHGVACLFPDR-INLLPFWMPQMDVDIRKPATHDFGIHRP 514

Query: 120 SASNPTT 126
           + S   T
Sbjct: 515 NQSATAT 521



 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/124 (45%), Positives = 80/124 (64%), Gaps = 10/124 (8%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GKKI +PVRVEPKV+FA ERTFL WL FS+ +G  A+ LLNFG K   T+ASF
Sbjct: 655 KAPK---GKKIYVPVRVEPKVYFAAERTFLGWLEFSIYVGTVAVTLLNFGSK--PTSASF 709

Query: 259 LV-----FVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLR 313
           +V      + ++ + Y++  YL+R + IR R +  + DR+GP+ +C  L I+V +NF   
Sbjct: 710 IVAGVFTLLAILSLCYSVAIYLYRSQAIRTRRAAKFYDRWGPSALCGALFIAVVLNFAFE 769

Query: 314 LHEK 317
             E+
Sbjct: 770 GRER 773



>gi|400595364|gb|EJP63169.1| VTC domain-containing protein [Beauveria bassiana ARSEF 2860]
          Length = 770

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSG+NWRRMDIGIDYPFS+LP  ++ RFPYA+LEVKLQTQ GQEPPE
Sbjct: 393 MVREDNLDG--RTRSGDNWRRMDIGIDYPFSQLPAEDVVRFPYAVLEVKLQTQMGQEPPE 450

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP + +F + R 
Sbjct: 451 WVRQLISSHLVEAVPKFSKFIHGCACLFPDR-INLLPFWMPQMDVDIRKPHTHDFGIHRA 509

Query: 120 SASNPTT 126
           + S  TT
Sbjct: 510 ALSGTTT 516



 Score =  104 bits (259), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 73/113 (64%), Gaps = 3/113 (2%)

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFVTMM 265
           I +PVRVEPKVFFA ERTFL WL +S+ +G  A+ LLN     T T+   ++   F+ ++
Sbjct: 656 IYVPVRVEPKVFFAAERTFLGWLEYSIYIGTIAMTLLNLKSHPTPTSFWVSAIFTFLAIL 715

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +LY++G YL+R   IR R++  Y D++GP+ +C+ L ++V +NF     E+ 
Sbjct: 716 SLLYSVGVYLYRSHSIRNRKAARYFDKWGPSVLCVSLFVAVALNFGFEGRERG 768



>gi|408396226|gb|EKJ75388.1| hypothetical protein FPSE_04407 [Fusarium pseudograminearum CS3096]
          Length = 781

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 4/126 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R R G+NWRRMDIGIDYPFS+LP  ++ERFPYA+LEVKLQTQ GQEPPE
Sbjct: 392 MVREDNLDG--RTRCGDNWRRMDIGIDYPFSQLPAEDVERFPYAVLEVKLQTQAGQEPPE 449

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG ATL   R I L PFW+PQM+ DIRKP + +F + RP
Sbjct: 450 WVRQLISSHLVEAVPKFSKFIHGTATLFPDR-IDLLPFWMPQMETDIRKPVTHDFGIRRP 508

Query: 120 SASNPT 125
             S  T
Sbjct: 509 GLSGTT 514



 Score =  106 bits (264), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 185 EELEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGL 244
           E L+      T   K  K   GKKI +PVRVEPKV+FA ERTFL WL FS+ +G  A+ L
Sbjct: 643 ERLQGLFGNDTIQNKKFKAPPGKKIYVPVRVEPKVYFAAERTFLGWLEFSIYIGTIAVTL 702

Query: 245 LNFGDKITVT---AASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIM 301
           LNFG   T      A     + +M + Y++ TYL+R + IR R+   + DR+GP+ +C  
Sbjct: 703 LNFGSHPTPAHFWVAGVFTLLAIMSLCYSVLTYLYRSQGIRSRKVVKFYDRWGPSALCGA 762

Query: 302 LLISVTINFWLRLHEKS 318
           L I V +NF     E++
Sbjct: 763 LFIGVALNFAFEGRERN 779



>gi|505755455|gb|EOQ99662.1| Vacuolar transporter chaperone 4 [Wallemia ichthyophaga EXF-994]
          Length = 855

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/120 (70%), Positives = 101/120 (84%), Gaps = 4/120 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN++   R RSG NWRRMDIGIDYPF++LP  +IERFPYA+LEVKLQTQ GQEPPE
Sbjct: 411 LIREDNWDG--RQRSGENWRRMDIGIDYPFNQLPPEDIERFPYAVLEVKLQTQMGQEPPE 468

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++LV SHLVEAVPKFSKFIHG A L+ +R + L PFWLPQMD+DIRKP + +  +ERP
Sbjct: 469 WVRQLVNSHLVEAVPKFSKFIHGCAKLLGNR-VNLLPFWLPQMDVDIRKPATGHMMIERP 527



 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 77/112 (68%), Gaps = 3/112 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKI +PVRVEPKV+FANERTFL WL FSV++   A+ L+NF    D+  V +A+   F 
Sbjct: 741 GKKICVPVRVEPKVYFANERTFLKWLQFSVLISTIAVALVNFTSTADRTGVISAALFTFA 800

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            +  + Y+  +++WR  KIRKRE+  Y D+ GP+ +C+ +LI+V +NF LR 
Sbjct: 801 ALASIAYSAISFVWRALKIRKREAVSYYDKVGPSALCVFMLIAVMVNFLLRF 852



>gi|317157661|ref|XP_001826373.2| vacuolar transporter chaperone 4 [Aspergillus oryzae RIB40]
          Length = 807

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 105/131 (80%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN + +   RSG+NWRRMDIG+D+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 406 MVREDNLDGH--RRSGDNWRRMDIGVDFPFSQLPPEDVERFPYAVLEVKLQTQAGQEPPQ 463

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLERP 119
           W+++L  SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP    F +ERP
Sbjct: 464 WIRDLTASHLVEAVPKFSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPAMRRFGIERP 522

Query: 120 SASNPTTPANE 130
            AS  + PANE
Sbjct: 523 LAST-SLPANE 532



 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D IT  ++     +  
Sbjct: 673 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGNDYITFASSWAFTVLAA 732

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + +LY+L  Y+WRV KIRKR      Y +++GPT + + L + + +NF LR  +
Sbjct: 733 LALLYSLVLYIWRVDKIRKRRDVKRVYYEKWGPTVVGVGLAVVLLVNFILRARQ 786



>gi|115443378|ref|XP_001218496.1| vacuolar transporter chaperone 4 [Aspergillus terreus NIH2624]
 gi|114188365|gb|EAU30065.1| vacuolar transporter chaperone 4 [Aspergillus terreus NIH2624]
          Length = 810

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSG+NWRRMDIG+D+PFSKLP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 405 MIREDNLDG--RRRSGSNWRRMDIGVDWPFSKLPPEDVERFPYAVLEVKLQTQAGQEPPK 462

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPK+SKFIHG ATL   R I L PFW+PQMD+DIRKP +  F ++RP
Sbjct: 463 WIRELTASHLVEAVPKYSKFIHGTATLFPDR-IHLLPFWMPQMDVDIRKPATRRFGIQRP 521

Query: 120 SASNPTTPANE 130
            AS  +  ANE
Sbjct: 522 LAST-SMSANE 531



 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 77/114 (67%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D IT   +     +  
Sbjct: 675 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGNDYITFACSWAFTILAA 734

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + ++Y+L  Y+WRV KIRKR      Y +++GPT + I L++ V +NF LR+ +
Sbjct: 735 LTLVYSLMLYVWRVDKIRKRRDVKRVYYEKWGPTVLGIGLVVIVLVNFGLRVRQ 788



>gi|83775117|dbj|BAE65240.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 833

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 105/131 (80%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN + +   RSG+NWRRMDIG+D+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 432 MVREDNLDGH--RRSGDNWRRMDIGVDFPFSQLPPEDVERFPYAVLEVKLQTQAGQEPPQ 489

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLERP 119
           W+++L  SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP    F +ERP
Sbjct: 490 WIRDLTASHLVEAVPKFSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPAMRRFGIERP 548

Query: 120 SASNPTTPANE 130
            AS  + PANE
Sbjct: 549 LAST-SLPANE 558



 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D IT  ++     +  
Sbjct: 699 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGNDYITFASSWAFTVLAA 758

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + +LY+L  Y+WRV KIRKR      Y +++GPT + + L + + +NF LR  +
Sbjct: 759 LALLYSLVLYIWRVDKIRKRRDVKRVYYEKWGPTVVGVGLAVVLLVNFILRARQ 812



>gi|322699097|gb|EFY90861.1| vacuolar transporter chaperone 4 [Metarhizium acridum CQMa 102]
          Length = 771

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 4/126 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSG+NWRRMDIGID+PFS+LP  ++ RFPYA+LEVKLQTQ GQEPPE
Sbjct: 393 MVREDNLDG--RQRSGDNWRRMDIGIDWPFSQLPAEDVVRFPYAVLEVKLQTQMGQEPPE 450

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP S +F + RP
Sbjct: 451 WVRQLIASHLVEAVPKFSKFIHGTACLFPDR-IKLLPFWMPQMDVDIRKPASHDFGIRRP 509

Query: 120 SASNPT 125
             S  T
Sbjct: 510 GLSGTT 515



 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 78/116 (67%), Gaps = 3/116 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  AI LLNFG+  T T+   A     +
Sbjct: 654 GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGAIAITLLNFGEHPTPTSFLVAGVFTLL 713

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            ++ + Y++G YL+R + IR R++  + D++GP+ +C+ L I+V +NF     E++
Sbjct: 714 AILSLCYSVGIYLYRSRSIRNRKAARFYDKWGPSVLCVSLFIAVALNFGFEGRERN 769



>gi|159129323|gb|EDP54437.1| vacuolar transporter chaperone (Vtc4), putative [Aspergillus
           fumigatus A1163]
          Length = 801

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 103/131 (78%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSGNNWRRMDIG+D+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 394 MIREDNLDG--RQRSGNNWRRMDIGVDWPFSQLPPQDVERFPYAVLEVKLQTQAGQEPPK 451

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP +  F + RP
Sbjct: 452 WIRELTASHLVEAVPKFSKFIHGTAALFPDR-IHLLPFWMPQMDVDIRKPATRRFGITRP 510

Query: 120 SASNPTTPANE 130
            AS  +  ANE
Sbjct: 511 LAST-SLSANE 520



 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 78/114 (68%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D IT  ++     +  
Sbjct: 665 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGNDYITFVSSWAFTILAA 724

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + ++Y+L  Y+WRV KIRKR      Y +++GPT + + L++ + +NF LR+ +
Sbjct: 725 VALIYSLMLYIWRVDKIRKRRDVKRVYYEKWGPTVVGLGLVVIMLVNFGLRVRQ 778



>gi|322708853|gb|EFZ00430.1| vacuolar transporter chaperone 4 [Metarhizium anisopliae ARSEF 23]
          Length = 801

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 4/126 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSG+NWRRMDIGID+PFS+LP  ++ RFPYA+LEVKLQTQ GQEPPE
Sbjct: 423 MVREDNLDG--RQRSGDNWRRMDIGIDWPFSQLPAEDVVRFPYAVLEVKLQTQMGQEPPE 480

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP S +F + RP
Sbjct: 481 WVRQLIASHLVEAVPKFSKFIHGTACLFPDR-INLLPFWMPQMDVDIRKPASHDFGIRRP 539

Query: 120 SASNPT 125
             S  T
Sbjct: 540 GLSGTT 545



 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 77/115 (66%), Gaps = 3/115 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA---ASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  +I LLNFG+  T T+   A     +
Sbjct: 684 GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGAISIALLNFGEHPTPTSFFVAGVFTLL 743

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
            ++ + Y++G YL+R + IR R++  + D++GP+ +C+ L I+V +NF     E+
Sbjct: 744 AILSLCYSVGIYLYRSRSIRNRKAARFYDKWGPSVLCVSLFIAVALNFGFEGRER 798



>gi|346322519|gb|EGX92118.1| vacuolar transporter chaperone 4 [Cordyceps militaris CM01]
          Length = 838

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 106/154 (68%), Gaps = 21/154 (13%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN + + R  SG+NWRRMDIGIDYPFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 462 MVREDNLDGHAR--SGDNWRRMDIGIDYPFSQLPPDDIARFPYAVLEVKLQTQMGQEPPE 519

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP + +F + R 
Sbjct: 520 WVRQLISSHLVEAVPKFSKFIHGCACLFPDR-INLLPFWMPQMDVDIRKPQTHDFGIHRA 578

Query: 120 SASNPTT-----------------PANERGNPFS 136
             S  TT                 P+   G PFS
Sbjct: 579 GLSGTTTTSDDDEEDFDSDEDVARPSTSAGRPFS 612



 Score =  108 bits (271), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 76/116 (65%), Gaps = 3/116 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK---ITVTAASFLVFV 262
           GKKI +PVRVEPKVFFA ERTFL WL +S+ +G  A+ LLN       ++   ++   F+
Sbjct: 721 GKKIYVPVRVEPKVFFAAERTFLGWLEYSIYIGTIAMTLLNLKSHPTPMSFWVSAVFTFL 780

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            ++ +LY++G YL+R   IR R +  Y D++GP+ +C+ L+++V +NF     E++
Sbjct: 781 AILSLLYSVGVYLYRSDAIRNRRAARYFDKWGPSVLCVALILAVALNFGFEGRERA 836



>gi|452840416|gb|EME42354.1| hypothetical protein DOTSEDRAFT_89772 [Dothistroma septosporum
           NZE10]
          Length = 811

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 99/127 (77%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R R+G NWRRMDIGIDYPFS+LP  ++ERFPY +LEVKLQT  GQEPPE
Sbjct: 402 MVREDNLDG--RQRAGKNWRRMDIGIDYPFSQLPPEDVERFPYGVLEVKLQTAAGQEPPE 459

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W++EL  SHLVEA+PKFSKFIHG ATL  SR I L PFW PQMD+DIRKP S+ F ++RP
Sbjct: 460 WIRELTASHLVEAIPKFSKFIHGCATLFPSR-IDLLPFWFPQMDVDIRKPVSHKFGIQRP 518

Query: 120 SASNPTT 126
             S   +
Sbjct: 519 GHSTDAS 525



 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 78/116 (67%), Gaps = 3/116 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GKKI +PVRVEPKV FA ERTFL+WL FS++LG  A  LLNFGD +++ AA  
Sbjct: 681 KAPK---GKKIHVPVRVEPKVSFAAERTFLAWLEFSIILGSIAATLLNFGDNVSMGAAIA 737

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
              V ++ + Y++  +LWRV +I +R++  Y D++GPTF+CI L+  V +    R 
Sbjct: 738 FTIVAIISLFYSMAIFLWRVDRIHQRKAVSYHDKWGPTFLCIGLVACVAVAVGFRF 793



>gi|302926516|ref|XP_003054310.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256735251|gb|EEU48597.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 771

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (79%), Gaps = 4/124 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSG+NWRRMDIGIDYPFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 392 MVREDNLDG--RTRSGDNWRRMDIGIDYPFSQLPPEDIVRFPYAVLEVKLQTQAGQEPPE 449

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP S +F + RP
Sbjct: 450 WVRQLISSHLVEAVPKFSKFIHGTACLFPDR-INLLPFWMPQMDVDIRKPVSHDFGIRRP 508

Query: 120 SASN 123
             S 
Sbjct: 509 GMSG 512



 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 82/145 (56%), Gaps = 4/145 (2%)

Query: 176 RSTPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSV 235
           RST  +   + L+    +     K  K  HGKKI +PVRVEPKV+FA ERTFL WL +S+
Sbjct: 625 RST-QVPRSDRLQALFGSAQIQTKKFKAPHGKKIYVPVRVEPKVYFAAERTFLGWLEYSI 683

Query: 236 VLGGFAIGLLNFGDKITVT---AASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDR 292
            +G  A+ LLNFG   T      A     + +M + Y++ TYL+R   IR R+   Y DR
Sbjct: 684 YIGTIAVTLLNFGTHPTPAHFWVAGIFTLLAIMSLCYSVVTYLYRSNAIRTRKVVKYYDR 743

Query: 293 YGPTFICIMLLISVTINFWLRLHEK 317
           +GP+ +C+ L + V +NF     E+
Sbjct: 744 WGPSVLCVALFLGVVLNFAFEGRER 768



>gi|258574533|ref|XP_002541448.1| vacuolar transporter chaperone 4 [Uncinocarpus reesii 1704]
 gi|237901714|gb|EEP76115.1| vacuolar transporter chaperone 4 [Uncinocarpus reesii 1704]
          Length = 1751

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 98/127 (77%), Gaps = 4/127 (3%)

Query: 1    MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
            M+REDN   N R R+G+NWRRMDIGIDYPFS+LP  ++ERFPYA+LEVKLQTQ GQE PE
Sbjct: 1442 MVREDNL--NGRKRAGDNWRRMDIGIDYPFSQLPAEDVERFPYAVLEVKLQTQAGQEAPE 1499

Query: 61   WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
            W+ EL  SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP    F +ERP
Sbjct: 1500 WITELTSSHLVEAVPKFSKFIHGTANLFPDR-INLLPFWMPQMDVDIRKPVRPGFGIERP 1558

Query: 120  SASNPTT 126
              S  +T
Sbjct: 1559 PQSTLST 1565



>gi|380481613|emb|CCF41743.1| VTC domain-containing protein [Colletotrichum higginsianum]
          Length = 783

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 4/123 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSG+NWRRMDIGID+PFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 399 MVREDNLDG--RKRSGDNWRRMDIGIDFPFSQLPPEDIVRFPYAVLEVKLQTQLGQEPPE 456

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHGVA L   R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 457 WVRQLISSHLVEAVPKFSKFIHGVACLFPDR-INLLPFWMPQMDVDIRKPVTHDFGIHRP 515

Query: 120 SAS 122
           + S
Sbjct: 516 NQS 518



 Score =  110 bits (274), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/124 (45%), Positives = 80/124 (64%), Gaps = 10/124 (8%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A+ LLNFG K   T ASF
Sbjct: 662 KAPK---GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYVGTVAVTLLNFGSK--PTTASF 716

Query: 259 LV-----FVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLR 313
           +V      + ++ +LY++  YL+R K IR R +  + D++GP+ +C  L I+V +NF   
Sbjct: 717 IVAGVFTLLAILSLLYSVVIYLYRSKAIRTRRAAKFYDKWGPSALCASLFIAVLLNFAFE 776

Query: 314 LHEK 317
             E+
Sbjct: 777 GRER 780



>gi|116180904|ref|XP_001220301.1| hypothetical protein CHGG_01080 [Chaetomium globosum CBS 148.51]
 gi|88185377|gb|EAQ92845.1| hypothetical protein CHGG_01080 [Chaetomium globosum CBS 148.51]
          Length = 784

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R  SGNNWRR DIGIDYPFS+LP G++ RFPYAILEVKLQTQ GQEPPE
Sbjct: 401 MVREDNLDGVTR--SGNNWRRTDIGIDYPFSQLPPGDVVRFPYAILEVKLQTQLGQEPPE 458

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHGVA L   R I L PFW+PQMD+DIRKP + +F ++R 
Sbjct: 459 WVRQLISSHLVEAVPKFSKFIHGVACLFPER-IDLLPFWMPQMDVDIRKPVTHDFGIKRL 517

Query: 120 SASNPTT 126
             S  T+
Sbjct: 518 EHSATTS 524



 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 75/128 (58%), Gaps = 4/128 (3%)

Query: 187 LEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLN 246
           LE  L T     +  K   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A+ LLN
Sbjct: 647 LESLLGTGEIQQRRFKAPKGKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIAVTLLN 706

Query: 247 F----GDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIML 302
           F    G++ +  AAS    + ++ + Y++  YL+R   IR R    Y D+ GP+ +C  L
Sbjct: 707 FSTEHGNRASFVAASAFTLLALLSLCYSVVIYLYRSSAIRTRRVAQYYDKVGPSILCAAL 766

Query: 303 LISVTINF 310
             +V +NF
Sbjct: 767 FAAVALNF 774



>gi|494831489|gb|EON67944.1| hypothetical protein W97_07441 [Coniosporium apollinis CBS 100218]
          Length = 816

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 103/131 (78%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   R R+G+NWRRMDIGIDYPF +LP  ++ERFPYA+LEVKLQTQ GQEPP 
Sbjct: 402 MTREDNLDG--RQRAGDNWRRMDIGIDYPFPQLPPEDVERFPYAVLEVKLQTQAGQEPPA 459

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP S+ F +ERP
Sbjct: 460 WIRELTASHLVEAVPKFSKFIHGTATLHPGR-IKLLPFWMPQMDVDIRKPISHRFGIERP 518

Query: 120 SAS-NPTTPAN 129
             S + +T AN
Sbjct: 519 GQSQDVSTSAN 529



 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 78/109 (71%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+I +PVRVEPKVFFA ERTFLSWL FS++LG  A  LLNFGD +++ +A     V  +
Sbjct: 697 GKRIHVPVRVEPKVFFAAERTFLSWLEFSIILGSIAATLLNFGDNVSLASAWAFTVVACL 756

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            +LY++G YLWR   IRKR +  Y D++GP+ +C+ L  +V ++F +RL
Sbjct: 757 SLLYSMGLYLWRSDMIRKRRAVTYHDKWGPSILCVGLFAAVAVSFGMRL 805



>gi|367019662|ref|XP_003659116.1| hypothetical protein MYCTH_2295763 [Myceliophthora thermophila ATCC
           42464]
 gi|347006383|gb|AEO53871.1| hypothetical protein MYCTH_2295763 [Myceliophthora thermophila ATCC
           42464]
          Length = 791

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 102/127 (80%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R  SG+NWRRMDIG+DYPFS+LP G+I RFPYAILEVKLQTQ GQEPPE
Sbjct: 401 MIREDNLDGTRR--SGDNWRRMDIGVDYPFSQLPPGDIVRFPYAILEVKLQTQLGQEPPE 458

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L  SHLVEAVPKFSKFIHGVA+L   R I L P+W+PQMD+DIRKP + +F ++R 
Sbjct: 459 WVRQLTSSHLVEAVPKFSKFIHGVASLFPDR-IHLLPYWMPQMDVDIRKPVTHDFGIKRL 517

Query: 120 SASNPTT 126
             S  T+
Sbjct: 518 ENSATTS 524



 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 78/128 (60%), Gaps = 4/128 (3%)

Query: 187 LEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLN 246
           LE  L T     +  K   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A+ LLN
Sbjct: 654 LESLLGTGEIQQRRFKAPKGKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIAVTLLN 713

Query: 247 F----GDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIML 302
           F    G+K++  AA     + ++ + Y++  YL+R + IR+     Y D+ GPT +C+ L
Sbjct: 714 FSTEQGNKLSFVAAGAFTVLALLSLGYSVAIYLYRSRAIREHRVARYYDKVGPTVLCVAL 773

Query: 303 LISVTINF 310
            ++V +NF
Sbjct: 774 FVAVALNF 781



>gi|119480749|ref|XP_001260403.1| vacuolar transporter chaperone (Vtc4), putative [Neosartorya
           fischeri NRRL 181]
 gi|119408557|gb|EAW18506.1| vacuolar transporter chaperone (Vtc4), putative [Neosartorya
           fischeri NRRL 181]
          Length = 801

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 103/131 (78%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   R RSGNNWRRMDIG+D+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 394 MTREDNLDG--RQRSGNNWRRMDIGVDWPFSQLPPEDVERFPYAVLEVKLQTQAGQEPPK 451

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP +  F + RP
Sbjct: 452 WIRELTASHLVEAVPKFSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPATRRFGITRP 510

Query: 120 SASNPTTPANE 130
            AS  +  ANE
Sbjct: 511 LAST-SLSANE 520



 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 78/114 (68%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D IT  ++     +  
Sbjct: 665 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGNDYITFASSWAFTILAA 724

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + ++Y+L  Y+WRV KIRKR      Y +++GPT + I L++ + +NF LR+ +
Sbjct: 725 VALVYSLMLYIWRVDKIRKRRDVKRVYYEKWGPTVVGIGLVVVMLVNFGLRVRQ 778



>gi|485920039|gb|EOD46168.1| putative vacuolar transporter chaperone protein [Neofusicoccum
           parvum UCRNP2]
          Length = 812

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (79%), Gaps = 4/123 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   R R+G NWRRMDIGIDYPFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 398 MTREDNLDG--RQRTGKNWRRMDIGIDYPFSQLPPEDVERFPYAVLEVKLQTQMGQEPPQ 455

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W++EL  SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP S+ F +ERP
Sbjct: 456 WIRELTASHLVEAVPKFSKFIHGTAKLQPKR-IHLLPFWMPQMDVDIRKPISHRFGIERP 514

Query: 120 SAS 122
             S
Sbjct: 515 GQS 517



 Score =  137 bits (344), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 82/116 (70%), Gaps = 3/116 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFGD + + +A  
Sbjct: 682 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAATLLNFGDGVALASAWA 738

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
              +    + Y++G YLWRV+KIR R +  Y D+YGPT +C+ LL++V I+F LRL
Sbjct: 739 FTIIACFSLFYSMGLYLWRVEKIRNRRAVRYHDKYGPTALCLGLLVAVAISFGLRL 794



>gi|402080265|gb|EJT75410.1| vacuolar transporter chaperone 4 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 819

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 99/121 (81%), Gaps = 4/121 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   + R+G+NWRR DIGIDYPFS+LP  +IERFPYA+LEVKLQTQ GQEPPE
Sbjct: 431 MVREDNLDG--KQRTGDNWRRTDIGIDYPFSQLPPKDIERFPYAVLEVKLQTQMGQEPPE 488

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVE+VPKFSKFIHG A L  SR I L PFWLPQMD+DIRKP + NF + RP
Sbjct: 489 WVRQLISSHLVESVPKFSKFIHGTACLFPSR-INLLPFWLPQMDVDIRKPRTHNFGIRRP 547

Query: 120 S 120
            
Sbjct: 548 G 548



 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 74/116 (63%), Gaps = 7/116 (6%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK---ITVTA 255
           K PK   GKKI +PVRVEPKVFFA ERTFL WL +S+ +G  A  LLNFGDK       A
Sbjct: 697 KAPK---GKKIHVPVRVEPKVFFAAERTFLGWLEYSIYVGTIATTLLNFGDKPNGAAFVA 753

Query: 256 ASFLVFVTMMVMLYALGTYLWRVKKIR-KRESGPYEDRYGPTFICIMLLISVTINF 310
           A     + ++ +LY++  YL R + IR +R S  Y D++GP+ +CI L ++V +N 
Sbjct: 754 AGAFTLLAVLCLLYSVVIYLHRSRAIRTRRASAKYYDKWGPSALCISLFVAVVLNL 809



>gi|449299992|gb|EMC96005.1| hypothetical protein BAUCODRAFT_34774 [Baudoinia compniacensis UAMH
           10762]
          Length = 801

 Score =  177 bits (448), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R R+G+NWRRMDIGIDYPFS+LP  ++ERFPY +LEVKLQT  GQEPPE
Sbjct: 400 MVREDNMDG--RRRAGDNWRRMDIGIDYPFSQLPPEDVERFPYGVLEVKLQTAAGQEPPE 457

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG AT+  +R I L PFW+PQMD+DIRKP + +F L+RP
Sbjct: 458 WIRELTASHLVEAVPKFSKFIHGCATMFPTR-INLLPFWMPQMDVDIRKPITHHFGLDRP 516

Query: 120 SASNPTT 126
             S   +
Sbjct: 517 GHSTDAS 523



 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 78/109 (71%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GKKI +PVRVEPKV FA ERTFL+WL FS++LG  A  LLNFGD I++ +A     V ++
Sbjct: 678 GKKIHVPVRVEPKVSFAAERTFLAWLEFSIILGSIAATLLNFGDNISLASAWAFTIVAVI 737

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            + Y++G Y+WRV  I++R +  Y D++GP+F+C  L+ +V I+F  RL
Sbjct: 738 ALFYSMGLYVWRVSNIKRRRAVNYHDKWGPSFLCAGLIGAVAISFASRL 786



>gi|303312211|ref|XP_003066117.1| SPX domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240105779|gb|EER23972.1| SPX domain containing protein [Coccidioides posadasii C735 delta
           SOWgp]
          Length = 809

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN ++  R R+G+NWRRMDIG+DYPF +LP  ++ERFPYA+LEVKLQTQ GQE P+
Sbjct: 403 MVREDNLDD--RRRAGDNWRRMDIGVDYPFRQLPAEDVERFPYAVLEVKLQTQAGQEAPQ 460

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL+ SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP    F +ERP
Sbjct: 461 WIRELISSHLVEAVPKFSKFIHGTANLFPDR-INLLPFWMPQMDVDIRKPARPGFGIERP 519

Query: 120 SASNPTT 126
             SN +T
Sbjct: 520 PQSNLST 526



 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 3/120 (2%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLV 260
           K   GK+I +P+RVEPKV+FA ERTFLSWL FS+ L   A  LLNFG D I++ +A    
Sbjct: 690 KAPRGKRIHVPIRVEPKVYFAAERTFLSWLEFSIFLSTIAATLLNFGQDTISLGSAWAFT 749

Query: 261 FVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +  + ++Y+   Y+WRV KIRK       Y +++GPT +C+ +++++ +NF LR+   S
Sbjct: 750 ILACLALIYSFLLYMWRVDKIRKHRDVKNVYYEKWGPTVLCLGVVVAMMLNFGLRIRGNS 809



>gi|320040106|gb|EFW22040.1| vacuolar transporter chaperone [Coccidioides posadasii str.
           Silveira]
          Length = 729

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN ++  R R+G+NWRRMDIG+DYPF +LP  ++ERFPYA+LEVKLQTQ GQE P+
Sbjct: 323 MVREDNLDD--RRRAGDNWRRMDIGVDYPFRQLPAEDVERFPYAVLEVKLQTQAGQEAPQ 380

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL+ SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP    F +ERP
Sbjct: 381 WIRELISSHLVEAVPKFSKFIHGTANLFPDR-INLLPFWMPQMDVDIRKPARPGFGIERP 439

Query: 120 SASNPTT 126
             SN +T
Sbjct: 440 PQSNLST 446



 Score =  109 bits (273), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 3/120 (2%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLV 260
           K   GK+I +P+RVEPKV+FA ERTFLSWL FS+ L   A  LLNFG D I++ +A    
Sbjct: 610 KAPRGKRIHVPIRVEPKVYFAAERTFLSWLEFSIFLSTIAATLLNFGQDTISLGSAWAFT 669

Query: 261 FVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +  + ++Y+   Y+WRV KIRK       Y +++GPT +C+ +++++ +NF LR+   S
Sbjct: 670 ILACLALIYSFLLYMWRVDKIRKHRDVKNVYYEKWGPTVLCLGVVVAMMLNFGLRIRGNS 729



>gi|296418710|ref|XP_002838968.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634962|emb|CAZ83159.1| unnamed protein product [Tuber melanosporum]
          Length = 707

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 4/124 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN++   R  SG+NWRRMDIGID+PF++LP  +IERFPYAILEVKLQTQ GQEPPE
Sbjct: 331 LIREDNWDGTKR--SGDNWRRMDIGIDWPFNQLPAKDIERFPYAILEVKLQTQAGQEPPE 388

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV+EL  SHLVEAVPKFSKFIHG ATL   + I L PFWLPQM IDIRKP ++ F +ERP
Sbjct: 389 WVRELTSSHLVEAVPKFSKFIHGTATLFPDK-IDLLPFWLPQMHIDIRKPTTHKFGIERP 447

Query: 120 SASN 123
           + S 
Sbjct: 448 NQSG 451



 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 81/111 (72%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+I +PVRVEPKV+FA ERTFLSW  FSV LG  A  LLNFGD++++ +A     V ++
Sbjct: 595 GKRIFVPVRVEPKVYFAAERTFLSWFEFSVYLGAIAGTLLNFGDRLSIYSAWGFTIVAIL 654

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            +LY++G YLWRV KI KR +  Y D+YGPT +C +LL++V +NFW R  E
Sbjct: 655 ALLYSMGLYLWRVDKISKRRAVRYHDKYGPTALCGLLLVAVGLNFWFRYGE 705



>gi|119193280|ref|XP_001247246.1| hypothetical protein CIMG_01017 [Coccidioides immitis RS]
          Length = 787

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN ++  R R+G+NWRRMDIG+DYPF +LP  ++ERFPYA+LEVKLQTQ GQE P+
Sbjct: 381 MVREDNLDD--RRRAGDNWRRMDIGVDYPFRQLPAEDVERFPYAVLEVKLQTQAGQEAPQ 438

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL+ SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP    F +ERP
Sbjct: 439 WIRELISSHLVEAVPKFSKFIHGTANLFPER-INLLPFWMPQMDVDIRKPARPGFGIERP 497

Query: 120 SASNPTT 126
             SN +T
Sbjct: 498 PQSNLST 504



 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 3/120 (2%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLV 260
           K   GK+I +P+RVEPKV+FA ERTFLSWL FS+ L   A  LLNFG D I++ +A    
Sbjct: 668 KAPRGKRIHVPIRVEPKVYFAAERTFLSWLEFSIFLSTIAATLLNFGQDTISLGSAWAFT 727

Query: 261 FVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +  + ++Y+   Y+WRV KIRK       Y +++GPT +C+ +++++ +NF LR+   S
Sbjct: 728 ILACLALIYSFLLYMWRVDKIRKHRDVKNVYYEKWGPTVLCLGVVVAMMLNFGLRIRGNS 787



>gi|477526390|gb|ENH78257.1| vacuolar transporter chaperone 4 [Colletotrichum orbiculare MAFF
           240422]
          Length = 779

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 4/123 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +     R+G+NWRRMDIGIDYPFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 395 MVREDNLDGA--RRAGDNWRRMDIGIDYPFSQLPPSDIVRFPYAVLEVKLQTQLGQEPPE 452

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHGVA L   R I L PFW+PQMD+DIRKP + +F + RP
Sbjct: 453 WVRQLISSHLVEAVPKFSKFIHGVACLFPER-INLLPFWMPQMDVDIRKPVTHDFGIHRP 511

Query: 120 SAS 122
           + S
Sbjct: 512 NQS 514



 Score =  109 bits (273), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 77/122 (63%), Gaps = 6/122 (4%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA--- 255
           K PK   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A+ LLNFG K T T+   
Sbjct: 658 KAPK---GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYVGTVAVTLLNFGAKPTATSFIV 714

Query: 256 ASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLH 315
           A     + ++ + Y++  YL+R K IR R +  + DR+GP+ +C  L ++V +NF     
Sbjct: 715 AGVFTLLAILSLCYSVVIYLYRSKAIRTRRAAKFYDRWGPSALCGSLFVAVMLNFVFEGR 774

Query: 316 EK 317
           E+
Sbjct: 775 ER 776



>gi|392863515|gb|EAS35730.2| vacuolar transporter chaperone [Coccidioides immitis RS]
          Length = 809

 Score =  176 bits (447), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (79%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN ++  R R+G+NWRRMDIG+DYPF +LP  ++ERFPYA+LEVKLQTQ GQE P+
Sbjct: 403 MVREDNLDD--RRRAGDNWRRMDIGVDYPFRQLPAEDVERFPYAVLEVKLQTQAGQEAPQ 460

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL+ SHLVEAVPKFSKFIHG A L   R I L PFW+PQMD+DIRKP    F +ERP
Sbjct: 461 WIRELISSHLVEAVPKFSKFIHGTANLFPER-INLLPFWMPQMDVDIRKPARPGFGIERP 519

Query: 120 SASNPTT 126
             SN +T
Sbjct: 520 PQSNLST 526



 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 3/120 (2%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLV 260
           K   GK+I +P+RVEPKV+FA ERTFLSWL FS+ L   A  LLNFG D I++ +A    
Sbjct: 690 KAPRGKRIHVPIRVEPKVYFAAERTFLSWLEFSIFLSTIAATLLNFGQDTISLGSAWAFT 749

Query: 261 FVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            +  + ++Y+   Y+WRV KIRK       Y +++GPT +C+ +++++ +NF LR+   S
Sbjct: 750 ILACLALIYSFLLYMWRVDKIRKHRDVKNVYYEKWGPTVLCLGVVVAMMLNFGLRIRGNS 809



>gi|384483613|gb|EIE75793.1| hypothetical protein RO3G_00497 [Rhizopus delemar RA 99-880]
          Length = 685

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 163/311 (52%), Gaps = 15/311 (4%)

Query: 18  NWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPEWVQELVQSHLVEAVPKF 77
           +WRR D+GIDYPF  + D +I RFPYAILE KLQT  GQE P W+  L++SHLV  VP+F
Sbjct: 361 HWRRKDVGIDYPFRNVADEDILRFPYAILETKLQTHLGQECPAWLTSLIESHLVYEVPRF 420

Query: 78  SKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLERPSASNPTTPANERGNPFS 136
           SK+IHG ATL   + I + P+WL +   DIRK P +N  L R  +  P    + R +   
Sbjct: 421 SKYIHGAATLF-KKNISVAPYWLEEFSKDIRKKPMANIGLSRSQSFKPLVNGHHRQSLLM 479

Query: 137 GTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLATVTP 196
                                  +    S      +  + +    +S    ++ ++ +  
Sbjct: 480 MYEREMQKPGRNMPKSKSLADLFSVSGSSRRHDRQHLAIETGEMANSRNAPKDIMSRIWN 539

Query: 197 AG--KVPKTYHGKKIAIPV----------RVEPKVFFANERTFLSWLNFSVVLGGFAIGL 244
           A   ++ K++  K    P+          ++EPK FFANERTF+SWL F  +L   A+ L
Sbjct: 540 ASTPRLTKSFLKKGNETPLLPRTRSNLVKKIEPKTFFANERTFISWLQFCALLLTVALNL 599

Query: 245 LNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIR-KRESGPYEDRYGPTFICIMLL 303
           LN+GD I+    +  + +   + +YAL  Y  R  ++R  R    Y+D +GPT +CI+L+
Sbjct: 600 LNYGDLISRGIGATFIVIGAALCIYALIRYQIRSWQLRTNRHIIRYDDIWGPTVLCILLV 659

Query: 304 ISVTINFWLRL 314
           +++ +NF+LR 
Sbjct: 660 VALMVNFYLRF 670



>gi|511006186|gb|EPB87504.1| hypothetical protein HMPREF1544_05698 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 739

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 109/357 (30%), Positives = 177/357 (49%), Gaps = 46/357 (12%)

Query: 2   IREDN--FENNPRLRS-GNNWRRMDIGIDYPFSKLP-DGEIERFPYAILEVKLQTQYGQE 57
           IRED+  F ++  +R   ++WRR D   ++PF  L  + +I R+P+A  E+KL+    ++
Sbjct: 383 IREDSQLFPDDSTVRRPADSWRRPDADTNFPFDNLKNESDINRYPFATFEIKLELAPNEK 442

Query: 58  PPEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIR--------- 108
            PEW+ +L +S ++E    FSKF+HG+A + D+R +PL P+WL QMD DI+         
Sbjct: 443 EPEWIVDLEESGILEEAFDFSKFVHGIAVMFDTR-VPLLPYWLAQMDNDIQELPTLPSNT 501

Query: 109 ------------KPPSNFR-LERPSASNPTTPANER----GNP----FSGTXXXXXXXXX 147
                       K PS    +   S +   + +NER    G P    + GT         
Sbjct: 502 PSVSQKNTKGKSKAPSEVDTIHSESGTRAPSSSNERSSLLGAPHTASYMGTHNHANEASA 561

Query: 148 XXXXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEE------LEEYLATVTPAGKVP 201
                        + ++   S   +  +  + H+S  ++      L      + P  K+P
Sbjct: 562 ASTIAEGHEESYPSKMIDSISSVFDKFMGKSGHLSKQQQEQRERQLNAAPVILPPGVKIP 621

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVF 261
           K     K+  P+RVEPKVFFANERT+ SW++F  ++  F++ L N GD +   +      
Sbjct: 622 K-----KVVTPLRVEPKVFFANERTYFSWMSFGTLISTFSLALFNSGDAVGKLSGVVYTL 676

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
           V++  ++Y +G Y  R + I  R +GPY++  GPT IC  LL +V +N +L+   KS
Sbjct: 677 VSVSTLMYGMGLYYRRRELIHNRAAGPYDELVGPTVICFALLFAVALNAYLKFTVKS 733



>gi|238493645|ref|XP_002378059.1| vacuolar transporter chaperone (Vtc4), putative [Aspergillus flavus
           NRRL3357]
 gi|220696553|gb|EED52895.1| vacuolar transporter chaperone (Vtc4), putative [Aspergillus flavus
           NRRL3357]
          Length = 797

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 86/131 (65%), Positives = 104/131 (79%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN + +   RSG+NWRRMDIG+D+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 396 MVREDNLDGH--RRSGDNWRRMDIGVDFPFSQLPPEDVERFPYAVLEVKLQTQAGQEPPQ 453

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLERP 119
           W+++L  SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP    F +ERP
Sbjct: 454 WIRDLTASHLVEAVPKFSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPAMRRFGIERP 512

Query: 120 SASNPTTPANE 130
            AS  +  ANE
Sbjct: 513 LAST-SLSANE 522



 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D IT  ++     +  
Sbjct: 663 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGNDYITFASSWAFTVLAA 722

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + +LY+L  Y+WRV KIRKR      Y +++GPT + + L + + +NF LR  +
Sbjct: 723 LALLYSLVLYIWRVDKIRKRRDVKRVYYEKWGPTVVGVGLAVVLLVNFILRARQ 776



>gi|391869466|gb|EIT78664.1| protein involved in vacuolar polyphosphate accumulation, contains
           SPX domain protein [Aspergillus oryzae 3.042]
          Length = 807

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 86/131 (65%), Positives = 104/131 (79%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN + +   RSG+NWRRMDIG+D+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 406 MVREDNLDGH--RRSGDNWRRMDIGVDFPFSQLPPEDVERFPYAVLEVKLQTQAGQEPPQ 463

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLERP 119
           W+++L  SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP    F +ERP
Sbjct: 464 WIRDLTASHLVEAVPKFSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPAMRRFGIERP 522

Query: 120 SASNPTTPANE 130
            AS  +  ANE
Sbjct: 523 LAST-SLSANE 532



 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D IT  ++     +  
Sbjct: 673 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGNDYITFASSWAFTVLAA 732

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + +LY+L  Y+WRV KIRKR      Y +++GPT + + L + + +NF LR  +
Sbjct: 733 LALLYSLVLYIWRVDKIRKRRDVKRVYYEKWGPTVVGVGLAVVLLVNFILRARQ 786



>gi|121698853|ref|XP_001267828.1| vacuolar transporter chaperone (Vtc4), putative [Aspergillus
           clavatus NRRL 1]
 gi|119395970|gb|EAW06402.1| vacuolar transporter chaperone (Vtc4), putative [Aspergillus
           clavatus NRRL 1]
          Length = 815

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 104/131 (79%), Gaps = 5/131 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIR+DN +   R RSGNNWRRMDIG+D+PF +LP  +I+RFPYA+LEVKLQTQ GQEPP+
Sbjct: 404 MIRDDNLDG--RQRSGNNWRRMDIGVDWPFPQLPPDDIDRFPYAVLEVKLQTQAGQEPPK 461

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATL   R I L PFW+PQMD+DIRKP +  F ++RP
Sbjct: 462 WIRELTASHLVEAVPKFSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPATRRFGIQRP 520

Query: 120 SASNPTTPANE 130
            AS  +  ANE
Sbjct: 521 LAST-SLSANE 530



 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D IT  ++     +  
Sbjct: 678 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGNDYITFASSWAFTILAA 737

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
             +LY+L  Y+WRV KIRKR      Y +++GPT + + L+  + +NF LR  +
Sbjct: 738 AALLYSLVLYMWRVDKIRKRRDVKRVYYEKWGPTVVGLGLVTVMMVNFGLRARQ 791



>gi|358369871|dbj|GAA86484.1| vacuolar transporter chaperone 4 [Aspergillus kawachii IFO 4308]
          Length = 808

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/125 (65%), Positives = 101/125 (80%), Gaps = 4/125 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   R R+G+NWRRMDIG+D+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 407 MTREDNLDG--RSRAGDNWRRMDIGVDWPFSQLPPEDVERFPYAVLEVKLQTQAGQEPPQ 464

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPK+SKFIHG ATL   R I L PFW+PQMD+DIRKP +  F ++RP
Sbjct: 465 WIRDLTASHLVEAVPKYSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPATRKFGIQRP 523

Query: 120 SASNP 124
            AS P
Sbjct: 524 PASAP 528



 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 77/114 (67%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK-ITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFGD  IT  ++     +  
Sbjct: 676 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLGTIAATLLNFGDDYITFGSSWAFTVLAA 735

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + +LY+L  Y+WRV KIRKR      Y +++GPT + + L++ V +NF LR  +
Sbjct: 736 VALLYSLMLYVWRVDKIRKRRDVKRVYYEKWGPTVVGLGLVVIVMVNFGLRARQ 789



>gi|378731425|gb|EHY57884.1| hypothetical protein HMPREF1120_05906 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 803

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/121 (68%), Positives = 101/121 (83%), Gaps = 4/121 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R R+GNNWRRMDIGID+PFS+LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 394 MVREDNLDG--RQRAGNNWRRMDIGIDWPFSQLPPEDVERFPYAVLEVKLQTQAGQEPPQ 451

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV++L  SHLVEAVPKFSKFIHGVATL  +R I L P+W PQM +DIRKP ++ F +ERP
Sbjct: 452 WVRDLTASHLVEAVPKFSKFIHGVATLFPTR-INLLPYWFPQMGVDIRKPITHRFGIERP 510

Query: 120 S 120
           +
Sbjct: 511 A 511



 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 2/113 (1%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFGD+I++ +A     V   
Sbjct: 686 GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAATLLNFGDRISLASAWGFTIVACA 745

Query: 266 VMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            + Y+   Y  RV+ IRKR +    Y D+YG T +C+ LL +  ++F  R+ +
Sbjct: 746 ALFYSAAIYYLRVQMIRKRRASVSRYYDKYGTTALCMGLLAATAVSFAFRIRQ 798



>gi|453084542|gb|EMF12586.1| SPX-domain-containing protein [Mycosphaerella populorum SO2202]
          Length = 803

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 101/129 (78%), Gaps = 4/129 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   + R+G++WRRMDIGIDYPFS+LP  +IERFPY +LEVKLQT  GQEPP+
Sbjct: 403 MIREDNLDG--KKRAGDHWRRMDIGIDYPFSQLPPEDIERFPYGVLEVKLQTAQGQEPPD 460

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATL  +R I L PFW PQMD+DIRKP S+ F +ERP
Sbjct: 461 WIRELTASHLVEAVPKFSKFIHGCATLFPTR-IDLLPFWFPQMDVDIRKPVSHKFGIERP 519

Query: 120 SASNPTTPA 128
             S   + +
Sbjct: 520 GQSTDVSTS 528



 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 74/109 (67%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GKKI +PVRVEPKV FA ERTFL+WL FS++LG  A  LLNFGD +++ AA       ++
Sbjct: 683 GKKIHVPVRVEPKVSFAAERTFLAWLEFSIILGSIAATLLNFGDNVSLAAAIAFTVTAVI 742

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            + Y++  +LWRV +I++R++  Y D++GP+ +C+ L+  V +    R 
Sbjct: 743 ALFYSMIIFLWRVDRIKQRKAVSYHDKWGPSVLCVALMACVCVAVGFRF 791



>gi|346979199|gb|EGY22651.1| vacuolar transporter chaperone 4 [Verticillium dahliae VdLs.17]
          Length = 782

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 100/127 (78%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R  SG+NWRRMDIGID+PFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 396 MVREDNLDGEQR--SGDNWRRMDIGIDWPFSQLPPKDIVRFPYAVLEVKLQTQMGQEPPE 453

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHGVA L   R I L PFW+PQMD+DIRKP + +F + R 
Sbjct: 454 WVRQLISSHLVEAVPKFSKFIHGVACLFPER-IDLLPFWMPQMDVDIRKPITHDFGIHRG 512

Query: 120 SASNPTT 126
             S  TT
Sbjct: 513 GHSANTT 519



 Score =  100 bits (250), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 73/114 (64%), Gaps = 7/114 (6%)

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLV-----FVT 263
           I +PVRVEPKV+FA ERTFL WL +S+ +G  A+ L+NFG   + T+ASF+V      + 
Sbjct: 668 IYVPVRVEPKVYFAAERTFLGWLEYSIYVGTVAVTLMNFG--TSPTSASFIVAGVFTLLA 725

Query: 264 MMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
           ++ + Y++  YL+R   IR R +  Y DR+GP+ +C  L ++V +NF     E+
Sbjct: 726 ILSLCYSVAIYLYRSSAIRNRRNIKYYDRWGPSVLCGALFVAVCLNFAFEGRER 779



>gi|302414212|ref|XP_003004938.1| vacuolar transporter chaperone 4 [Verticillium albo-atrum VaMs.102]
 gi|261356007|gb|EEY18435.1| vacuolar transporter chaperone 4 [Verticillium albo-atrum VaMs.102]
          Length = 726

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 100/127 (78%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R  SG+NWRRMDIGID+PFS+LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 340 MVREDNLDGEQR--SGDNWRRMDIGIDWPFSQLPPKDIVRFPYAVLEVKLQTQMGQEPPE 397

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHGVA L   R I L PFW+PQMD+DIRKP + +F + R 
Sbjct: 398 WVRQLISSHLVEAVPKFSKFIHGVACLFPER-IDLLPFWMPQMDVDIRKPITHDFGIHRG 456

Query: 120 SASNPTT 126
             S  TT
Sbjct: 457 GHSANTT 463



 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 73/114 (64%), Gaps = 7/114 (6%)

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLV-----FVT 263
           I +PVRVEPKV+FA ERTFL WL +S+ +G  A+ L+NFG   + T+ASF+V      + 
Sbjct: 612 IYVPVRVEPKVYFAAERTFLGWLEYSIYVGTVAVTLMNFG--TSPTSASFIVAGVFTLLA 669

Query: 264 MMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
           ++ + Y++  YL+R   IR R +  + DR+GP+ +C  L ++V +NF     E+
Sbjct: 670 ILSLCYSVAIYLYRSSAIRNRRNIKFYDRWGPSVLCGALFVAVCLNFAFEGRER 723



>gi|398396620|ref|XP_003851768.1| hypothetical protein MYCGRDRAFT_73357 [Zymoseptoria tritici IPO323]
 gi|339471648|gb|EGP86744.1| hypothetical protein MYCGRDRAFT_73357 [Zymoseptoria tritici IPO323]
          Length = 799

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 99/130 (76%), Gaps = 4/130 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   R RSG NWRRMDIGID+PFS+LP  ++E FPY +LEVKLQT  GQEPPE
Sbjct: 402 MTREDNLDG--RKRSGKNWRRMDIGIDHPFSQLPPEDVELFPYGVLEVKLQTAAGQEPPE 459

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W++EL  SHLVEAVPKFSKFIHG A+L  SR I L PFW PQMD+DIRKP S+ F +ERP
Sbjct: 460 WIRELTSSHLVEAVPKFSKFIHGCASLFPSR-IDLLPFWFPQMDVDIRKPVSHKFGIERP 518

Query: 120 SASNPTTPAN 129
             S   + +N
Sbjct: 519 GQSTDASTSN 528



 Score =  129 bits (325), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 84/116 (72%), Gaps = 3/116 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GKKI +PVRVEPKV FA ERTFL+WL FS++LG  A  LLNFGD+I++ AA  
Sbjct: 675 KAPK---GKKIHVPVRVEPKVSFAAERTFLAWLEFSIILGSIAATLLNFGDRISMAAAVA 731

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
              V+++ ++Y++G +LWRV +I++R++  Y D++GP+F+C+ L+  V +    RL
Sbjct: 732 FTVVSVIALMYSMGIFLWRVDRIKQRKAVNYHDKWGPSFLCLGLVACVGVAVGFRL 787



>gi|367044202|ref|XP_003652481.1| hypothetical protein THITE_2114025 [Thielavia terrestris NRRL 8126]
 gi|346999743|gb|AEO66145.1| hypothetical protein THITE_2114025 [Thielavia terrestris NRRL 8126]
          Length = 903

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 102/127 (80%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +     RSG+NWRRMDIGIDYPFS+LP G++ RFPYAILEVKLQTQ GQEPPE
Sbjct: 448 MVREDNLDGV--RRSGDNWRRMDIGIDYPFSQLPPGDVVRFPYAILEVKLQTQLGQEPPE 505

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L  SHLVEAVPKFSKFIHGVA+L   R I L P+W+PQMD+DIRKP + +F ++R 
Sbjct: 506 WVRQLTSSHLVEAVPKFSKFIHGVASLFPDR-IHLLPYWMPQMDVDIRKPVTHDFGIKRL 564

Query: 120 SASNPTT 126
             S  T+
Sbjct: 565 ENSATTS 571



 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 73/118 (61%), Gaps = 7/118 (5%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK----ITVT 254
           K PK   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A+ LLNF  +     +  
Sbjct: 715 KAPK---GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIAVTLLNFSTRHGSGASFA 771

Query: 255 AASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWL 312
           AA+    + +M + Y++  YL+R + IR R    Y D+ GP+ +C  L ++V +NF L
Sbjct: 772 AAAAFTLLAIMSLCYSVVIYLYRSRAIRTRRVARYYDKVGPSVLCGALFVAVALNFAL 829



>gi|452981043|gb|EME80803.1| hypothetical protein MYCFIDRAFT_215745 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 818

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 97/127 (76%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R R+G NWRRMDIGIDYPF +LP  ++ERFPY +LEVKLQT  GQEPPE
Sbjct: 401 MVREDNLDG--RQRAGKNWRRMDIGIDYPFPQLPPEDVERFPYGVLEVKLQTAQGQEPPE 458

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W++EL  SHLVEAVPKFSKFIHG ATL  +R I L PFW PQMD DIRKP S+ F +ERP
Sbjct: 459 WIRELTASHLVEAVPKFSKFIHGCATLFPTR-IDLLPFWFPQMDTDIRKPVSHKFGIERP 517

Query: 120 SASNPTT 126
             S   +
Sbjct: 518 GQSTDVS 524



 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 80/116 (68%), Gaps = 3/116 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GKKI +PVRVEPKV FA ERTFL+WL FS++LG  A+ L+NFGD++ + A+  
Sbjct: 680 KAPK---GKKIHVPVRVEPKVSFAAERTFLAWLEFSIILGSIAVTLINFGDRVGLAASVA 736

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
              + ++ + Y++  +LWRV +I++R++  Y D++GP+ +C+ LL  V++    R 
Sbjct: 737 FTILAIIALFYSIAIFLWRVDRIKQRKAVQYHDKWGPSVLCVGLLACVSVAIAYRF 792



>gi|407928290|gb|EKG21150.1| hypothetical protein MPH_01506 [Macrophomina phaseolina MS6]
          Length = 811

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 97/123 (78%), Gaps = 4/123 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   R R+G NWRRMDIGIDYPF +LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 398 MTREDNLDG--RSRAGKNWRRMDIGIDYPFPQLPPEDVERFPYAVLEVKLQTQMGQEPPQ 455

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG A L  +R I L PFW+PQMD+DIRKP S  F +ERP
Sbjct: 456 WIRELTASHLVEAVPKFSKFIHGTAKLQPNR-IHLLPFWMPQMDVDIRKPISYRFGIERP 514

Query: 120 SAS 122
             S
Sbjct: 515 GQS 517



 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 81/116 (69%), Gaps = 3/116 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKVFFA ERTFLSWL FS++LG  A  LLNFGD I + +A  
Sbjct: 681 KAPK---GKRIHVPVRVEPKVFFAAERTFLSWLEFSIILGSIAATLLNFGDNIALASAWA 737

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
              +    + Y++G YLWRV+KIR R +  Y D+YGPT +C+ LL +V I+F LR+
Sbjct: 738 FTIIACFSLFYSMGLYLWRVEKIRNRRAVRYHDKYGPTVLCVGLLAAVVISFGLRI 793



>gi|212528884|ref|XP_002144599.1| vacuolar transporter chaperone (Vtc4), putative [Talaromyces
           marneffei ATCC 18224]
 gi|210073997|gb|EEA28084.1| vacuolar transporter chaperone (Vtc4), putative [Talaromyces
           marneffei ATCC 18224]
          Length = 820

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/123 (66%), Positives = 99/123 (80%), Gaps = 4/123 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSG+NWRRMDIGID+PF +LP  +IERFPYA+LEVKLQTQ GQEPP+
Sbjct: 398 MIREDNLDG--RRRSGDNWRRMDIGIDWPFRQLPSEDIERFPYAVLEVKLQTQAGQEPPQ 455

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPKFSKFIHG AT+   + I L PFW PQMD+DIRKP +  + +ERP
Sbjct: 456 WIRDLTASHLVEAVPKFSKFIHGCATVFPDK-IHLLPFWFPQMDVDIRKPITRKYGIERP 514

Query: 120 SAS 122
           + S
Sbjct: 515 AQS 517



 Score =  118 bits (295), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 79/111 (71%), Gaps = 3/111 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +P+RVEPKV+FA ERTFLSWL FS+++G  A  LLNFG D +T  +A     + +
Sbjct: 672 GKRIHVPIRVEPKVYFAAERTFLSWLEFSILIGSIAATLLNFGSDYVTFASAWVFSIIAV 731

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLR 313
           + +LY++  Y+WRV KIRKR      Y +++GPTF+C+ L+ +V +NF LR
Sbjct: 732 ICLLYSVILYVWRVDKIRKRRDVKRIYYEKWGPTFLCLGLVAAVLVNFILR 782



>gi|255941170|ref|XP_002561354.1| Pc16g10440 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211585977|emb|CAP93714.1| Pc16g10440 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 800

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/134 (61%), Positives = 102/134 (76%), Gaps = 4/134 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSG NWRRMDIG+D+PFS+LP  +I+RFPYA+LEVKLQTQ GQEPP+
Sbjct: 404 MIREDNMDG--RQRSGKNWRRMDIGVDFPFSQLPPEDIDRFPYAVLEVKLQTQAGQEPPQ 461

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPKFSKFIHG AT+  +R I L PFW PQM +DIRKP +  F + RP
Sbjct: 462 WIRDLTASHLVEAVPKFSKFIHGTATMFPTR-IDLLPFWFPQMGVDIRKPATRQFGIHRP 520

Query: 120 SASNPTTPANERGN 133
            AS   +  +E  +
Sbjct: 521 LASTSISANDEDSD 534



 Score =  113 bits (282), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 78/114 (68%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++LGG A  LLNFG +  T+ ++     +  
Sbjct: 666 GKRIFVPVRVEPKVYFAAERTFLSWLEFSIILGGIAAALLNFGTESATLISSWAFTILAA 725

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
             ++Y+L  Y+WRV KIRKR      Y +R+GPT + + L+I + +NF LR+ +
Sbjct: 726 GALVYSLFLYIWRVDKIRKRRDVKRVYYERWGPTVVSLGLVIIILLNFGLRVRQ 779



>gi|295673262|ref|XP_002797177.1| negative regulator of cdc42 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226282549|gb|EEH38115.1| negative regulator of cdc42 [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 874

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 100/127 (78%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSG+NWRRMDIGIDYPF +LP  ++ERF YA+LEVKLQTQ GQEPP+
Sbjct: 458 MIREDNLDG--RRRSGDNWRRMDIGIDYPFRQLPAEDVERFAYAVLEVKLQTQAGQEPPK 515

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG A L     I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 516 WIRELTASHLVEAVPKFSKFIHGTANLFPD-YINLLPFWMPQMDVDIRKPVTRGFGIERP 574

Query: 120 SASNPTT 126
           + ++ TT
Sbjct: 575 TQTSQTT 581



 Score =  116 bits (290), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 6/121 (4%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
           K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNF  D +T+ ++ 
Sbjct: 753 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAAALLNFSTDTVTLASSW 809

Query: 258 FLVFVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRLH 315
               +  + ++Y+   Y+WRV  IRKR      Y +++GPT +C+ L ++V +NF LR  
Sbjct: 810 AFTILACLSLVYSFLLYMWRVDIIRKRRDVRRVYHEKWGPTVLCVGLFVAVCVNFGLRAR 869

Query: 316 E 316
           E
Sbjct: 870 E 870



>gi|225681015|gb|EEH19299.1| vacuolar transporter chaperone [Paracoccidioides brasiliensis Pb03]
          Length = 886

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 100/127 (78%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSG+NWRRMDIGIDYPF +LP  ++ERF YA+LEVKLQTQ GQEPP+
Sbjct: 469 MIREDNLDG--RRRSGDNWRRMDIGIDYPFRQLPAEDVERFAYAVLEVKLQTQAGQEPPK 526

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG A L     I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 527 WIRELTASHLVEAVPKFSKFIHGTANLFPD-YINLLPFWMPQMDVDIRKPVTRGFGIERP 585

Query: 120 SASNPTT 126
           + ++ TT
Sbjct: 586 TQTSQTT 592



 Score =  116 bits (290), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 6/121 (4%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
           K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNF  D +T+ ++ 
Sbjct: 765 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAAALLNFSTDTVTLASSW 821

Query: 258 FLVFVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRLH 315
               +  + ++Y+   Y+WRV  IRKR      Y +++GPT +C+ L ++V +NF LR  
Sbjct: 822 AFTILACLSLVYSFLLYMWRVDIIRKRRDVRRVYHEKWGPTVLCVGLFVAVCVNFGLRAR 881

Query: 316 E 316
           E
Sbjct: 882 E 882



>gi|399167743|emb|CCE31329.1| related to polyphosphate synthetase [Claviceps purpurea 20.1]
          Length = 853

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/126 (65%), Positives = 98/126 (77%), Gaps = 4/126 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSG NWRR DIGID+PFS+LP  ++ RFPYA+LEVKLQTQ GQEPPE
Sbjct: 464 MVREDNLDG--RSRSGANWRRTDIGIDWPFSQLPSEDVVRFPYAVLEVKLQTQMGQEPPE 521

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVE+VPKFSKFIHG A L   R I L PFW+PQMD+DIRKP S +F + RP
Sbjct: 522 WVRQLISSHLVESVPKFSKFIHGTACLFPDR-INLLPFWMPQMDVDIRKPASHDFGIRRP 580

Query: 120 SASNPT 125
             S  T
Sbjct: 581 GLSGTT 586



 Score =  114 bits (285), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 78/116 (67%), Gaps = 3/116 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVT---AASFLVFV 262
           GKKI +PVRVEPKV+FA ERTFL WL +S+ +   A+ LLNFG+  T T   A+     +
Sbjct: 734 GKKIYVPVRVEPKVYFAAERTFLGWLEYSIYISTIAVTLLNFGEHPTRTSFWASGLFTLL 793

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            ++ + Y++GTYL+R + IR R++  + D++GP+ +C+ L ++V +NF     E+S
Sbjct: 794 AVLSLCYSIGTYLYRSRAIRSRKAARFYDKWGPSALCVSLFVAVALNFAFEGRERS 849



>gi|226292290|gb|EEH47710.1| vacuolar transporter chaperone 1 [Paracoccidioides brasiliensis
           Pb18]
          Length = 810

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 100/127 (78%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSG+NWRRMDIGIDYPF +LP  ++ERF YA+LEVKLQTQ GQEPP+
Sbjct: 393 MIREDNLDG--RRRSGDNWRRMDIGIDYPFRQLPAEDVERFAYAVLEVKLQTQAGQEPPK 450

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W++EL  SHLVEAVPKFSKFIHG A L     I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 451 WIRELTASHLVEAVPKFSKFIHGTANLFPD-YINLLPFWMPQMDVDIRKPVTRGFGIERP 509

Query: 120 SASNPTT 126
           + ++ TT
Sbjct: 510 TQTSQTT 516



 Score =  116 bits (290), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%), Gaps = 6/121 (4%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
           K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNF  D +T+ ++ 
Sbjct: 689 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAAALLNFSTDTVTLASSW 745

Query: 258 FLVFVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLRLH 315
               +  + ++Y+   Y+WRV  IRKR      Y +++GPT +C+ L ++V +NF LR  
Sbjct: 746 AFTILACLSLVYSFLLYMWRVDIIRKRRDVRRVYHEKWGPTVLCVGLFVAVCVNFGLRAR 805

Query: 316 E 316
           E
Sbjct: 806 E 806



>gi|145246584|ref|XP_001395541.1| vacuolar transporter chaperone 4 [Aspergillus niger CBS 513.88]
 gi|134080259|emb|CAK97162.1| unnamed protein product [Aspergillus niger]
          Length = 808

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/125 (64%), Positives = 100/125 (80%), Gaps = 4/125 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   R R+G+NWRRMDIG+D+PF +LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 407 MTREDNLDG--RSRAGDNWRRMDIGVDWPFPQLPPEDVERFPYAVLEVKLQTQAGQEPPQ 464

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPK+SKFIHG ATL   R I L PFW+PQMD+DIRKP +  F ++RP
Sbjct: 465 WIRDLTASHLVEAVPKYSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPATRKFGIQRP 523

Query: 120 SASNP 124
            AS P
Sbjct: 524 PASAP 528



 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK-ITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++L   A  LLNFGD  IT  ++     +  
Sbjct: 676 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLATIAATLLNFGDDYITFGSSWAFTVLAA 735

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + +LY+L  Y+WRV KIRKR      Y +++GPT + + L++ V +NF LR  +
Sbjct: 736 VALLYSLMLYVWRVDKIRKRRDVKRVYYEKWGPTVVGLGLVVIVMVNFGLRARQ 789



>gi|242765250|ref|XP_002340936.1| vacuolar transporter chaperone (Vtc4), putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218724132|gb|EED23549.1| vacuolar transporter chaperone (Vtc4), putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 823

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 101/129 (78%), Gaps = 4/129 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R R+G+NWRRMDIGID+PF +LP  +IERFPYA+LEVKLQTQ GQEPP+
Sbjct: 398 MIREDNLDG--RRRAGDNWRRMDIGIDWPFRQLPPEDIERFPYAVLEVKLQTQAGQEPPQ 455

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPKFSKFIHG ATL   + I L PFW PQMDIDIRKP +  + +ERP
Sbjct: 456 WIRDLTASHLVEAVPKFSKFIHGCATLFPDK-IHLLPFWYPQMDIDIRKPVTRKYGIERP 514

Query: 120 SASNPTTPA 128
           + S   + +
Sbjct: 515 TQSTSISTS 523



 Score =  117 bits (292), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 79/111 (71%), Gaps = 3/111 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +P+RVEPKV+FA ERTFLSWL FS+++G  A  LLNFG D +T  +A     + +
Sbjct: 675 GKRIHVPIRVEPKVYFAAERTFLSWLEFSILIGSIAATLLNFGSDYVTFASAWVFTIIAV 734

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLR 313
           + ++Y++  Y+WRV KIRKR      Y +++GPTF+C+ L+ +V +NF LR
Sbjct: 735 ICLVYSVVLYVWRVDKIRKRRDVKRIYYEKWGPTFLCLGLVSAVLVNFILR 785



>gi|350636888|gb|EHA25246.1| hypothetical protein ASPNIDRAFT_49667 [Aspergillus niger ATCC 1015]
          Length = 798

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/125 (64%), Positives = 100/125 (80%), Gaps = 4/125 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   R R+G+NWRRMDIG+D+PF +LP  ++ERFPYA+LEVKLQTQ GQEPP+
Sbjct: 397 MTREDNLDG--RSRAGDNWRRMDIGVDWPFPQLPPEDVERFPYAVLEVKLQTQAGQEPPQ 454

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPK+SKFIHG ATL   R I L PFW+PQMD+DIRKP +  F ++RP
Sbjct: 455 WIRDLTASHLVEAVPKYSKFIHGTATLFPDR-INLLPFWMPQMDVDIRKPATRKFGIQRP 513

Query: 120 SASNP 124
            AS P
Sbjct: 514 PASAP 518



 Score =  102 bits (254), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK-ITVTAASFLVFVTM 264
           GK+I +PVRVEPKV+FA ERTFLSWL FS++L   A  LLNFGD  IT  ++     +  
Sbjct: 666 GKRIHVPVRVEPKVYFAAERTFLSWLEFSILLATIAATLLNFGDDYITFGSSWAFTVLAA 725

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRLHE 316
           + +LY+L  Y+WRV KIRKR      Y +++GPT + + L++ V +NF LR  +
Sbjct: 726 VALLYSLMLYVWRVDKIRKRRDVKRVYYEKWGPTVVGLGLVVIVMVNFGLRARQ 779



>gi|19074392|ref|NP_585898.1| putative POLYPHOSPHATE SYNTHETASE VTC4 [Encephalitozoon cuniculi
           GB-M1]
 gi|19069034|emb|CAD25502.1| putative POLYPHOSPHATE SYNTHETASE VTC4 [Encephalitozoon cuniculi
           GB-M1]
 gi|449329390|gb|AGE95662.1| putative polyphosphate synthetase vtc4 [Encephalitozoon cuniculi]
          Length = 611

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 103/296 (34%), Positives = 145/296 (48%), Gaps = 61/296 (20%)

Query: 19  WRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPEWVQELVQSHLVEAVPKFS 78
           WRR D+  D+PF  +P  EI RFP+AILE+K Q  + +  P+W++EL+   LVE V KFS
Sbjct: 372 WRRSDVNCDFPFRNVPKSEIVRFPHAILEIKTQN-FDETKPKWIEELINGPLVEHVHKFS 430

Query: 79  KFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPSASNPTTPANERGNPFSGT 138
           K++HG A L     I   P+WL                       P    + R +PF   
Sbjct: 431 KYLHGCAVLYPF--IQDIPYWL-----------------------PQVAVDIRKDPFH-- 463

Query: 139 XXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLATVTPAG 198
                                  P + + S   NT L   P  S     E+         
Sbjct: 464 -----------------------PDVDKKSFE-NTVLVDVPADSDPSNSEKL-------- 491

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
             P   HGK+I+IPVRVEPKVFFANERTFLSW+ F++ LGG    LL  GD+    +   
Sbjct: 492 -SPIDVHGKRISIPVRVEPKVFFANERTFLSWVQFAIFLGGIGSALLGLGDERASFSGLI 550

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           L+ V ++   Y+L  YLWR   IR+R+ GPY+D YGP  +  + L+++ ++ + + 
Sbjct: 551 LIIVAIIFSFYSLYLYLWRASMIRQRDPGPYDDIYGPAVLVCVFLVAMGLSVFFKF 606



>gi|425773037|gb|EKV11412.1| Vacuolar transporter chaperone (Vtc4), putative [Penicillium
           digitatum PHI26]
 gi|425782182|gb|EKV20106.1| Vacuolar transporter chaperone (Vtc4), putative [Penicillium
           digitatum Pd1]
          Length = 800

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 98/124 (79%), Gaps = 4/124 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R RSG NWRRMDIG+D+PFS+LP  +I+RFPYA+LEVKLQTQ GQEPP+
Sbjct: 404 MVREDNLDG--RRRSGKNWRRMDIGVDFPFSQLPPEDIDRFPYAVLEVKLQTQAGQEPPQ 461

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPKFSKFIHG AT+  +R I L PFW PQM +DIRKP S  F + RP
Sbjct: 462 WIRDLTASHLVEAVPKFSKFIHGTATMFPTR-INLLPFWFPQMGVDIRKPASREFGIHRP 520

Query: 120 SASN 123
            AS 
Sbjct: 521 LAST 524



 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 77/112 (68%), Gaps = 3/112 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+I +P+RVEPKV+FA ERTFLSWL FS++LGG A  LLNFG D  T+ ++     +  
Sbjct: 666 GKRIFVPIRVEPKVYFAAERTFLSWLEFSIILGGIAATLLNFGTDTATLVSSWAFTILAA 725

Query: 265 MVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLRL 314
             ++Y+L  Y+WRV KIRKR      Y +R+GPT + I L++ + +NF LR+
Sbjct: 726 GALVYSLFLYIWRVDKIRKRRDVKRVYYERWGPTVVSIGLVVIILVNFALRV 777



>gi|154281535|ref|XP_001541580.1| vacuolar transporter chaperone 4 [Ajellomyces capsulatus NAm1]
 gi|150411759|gb|EDN07147.1| vacuolar transporter chaperone 4 [Ajellomyces capsulatus NAm1]
          Length = 836

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (77%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSG+NWRRMDIGIDYPF +LP  ++ERFPYAILEVKLQTQ GQ PP 
Sbjct: 406 MIREDNLDG--RKRSGSNWRRMDIGIDYPFLQLPAQDVERFPYAILEVKLQTQAGQAPPP 463

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L+ SHLVEAVPKFSKFIHG A L     I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 464 WIRDLISSHLVEAVPKFSKFIHGTANLFPD-HIDLLPFWMPQMDVDIRKPITRRFGIERP 522

Query: 120 SASNPTT 126
             ++ +T
Sbjct: 523 VQTSQST 529



 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 8/119 (6%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNF D  TVT  S 
Sbjct: 717 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAAALLNF-DYDTVTLVSS 772

Query: 259 LVFVTMMV--MLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLR 313
            VF  +    ++Y+L  Y+WR+ KIRKR      Y +++GPT +C+ LL++V +NF LR
Sbjct: 773 WVFTILACLSLVYSLLLYMWRIDKIRKRRDVKHVYHEKWGPTVLCVGLLVAVCVNFGLR 831



>gi|225563140|gb|EEH11419.1| vacuolar transporter chaperone 4 [Ajellomyces capsulatus G186AR]
          Length = 863

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (77%), Gaps = 4/127 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R RSG+NWRRMDIGIDYPF +LP  ++ERFPYAILEVKLQTQ GQ PP 
Sbjct: 435 MIREDNLDG--RKRSGSNWRRMDIGIDYPFLQLPAQDVERFPYAILEVKLQTQAGQAPPP 492

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L+ SHLVEAVPKFSKFIHG A L     I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 493 WIRDLISSHLVEAVPKFSKFIHGTANLFPD-HIDLLPFWMPQMDVDIRKPITRRFGIERP 551

Query: 120 SASNPTT 126
             ++ +T
Sbjct: 552 VQTSQST 558



 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 82/118 (69%), Gaps = 6/118 (5%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
           K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D +T+ ++ 
Sbjct: 744 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAATLLNFGHDTVTLVSSW 800

Query: 258 FLVFVTMMVMLYALGTYLWRVKKIRKRES--GPYEDRYGPTFICIMLLISVTINFWLR 313
               +  + ++Y+L  Y+WRV KIRKR      Y +++GPT +C+ LL++V +NF LR
Sbjct: 801 VFTILACLSLVYSLLLYMWRVDKIRKRRDVKHVYHEKWGPTVLCVGLLVAVCVNFGLR 858



>gi|389750342|gb|EIM91513.1| SPX-domain-containing protein [Stereum hirsutum FP-91666 SS1]
          Length = 920

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/130 (63%), Positives = 100/130 (76%), Gaps = 4/130 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   R  +G+NWRRMDIGID+PF +LP  + E F Y +LEVKLQTQ+GQEPPE
Sbjct: 434 MVREDNWDGAER--AGDNWRRMDIGIDWPFDQLPQEDKELFKYGVLEVKLQTQFGQEPPE 491

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNF-RLERP 119
           WV ELV SHLVEAVPKFSKFIHG ATLM  R + L PFWLPQMD+DI KP + F  +ERP
Sbjct: 492 WVTELVNSHLVEAVPKFSKFIHGCATLMPHR-VDLVPFWLPQMDVDILKPNTGFLTVERP 550

Query: 120 SASNPTTPAN 129
           S  + +  A+
Sbjct: 551 SGPSTSNSAS 560



 Score =  116 bits (290), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 77/115 (66%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK++AIP+R+EPKV+FA ERTFL WLNF+V +G  A  LLNF    D   + +A+     
Sbjct: 800 GKRVAIPIRIEPKVYFATERTFLKWLNFAVYIGTIATTLLNFIPPEDYHGLISATLFTIA 859

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            +  +LY+ G +L+R  K+RKR + G Y D+YGPT +C++LL ++  N  LRL E
Sbjct: 860 ALFAILYSAGIFLYRAMKLRKRHTDGLYYDKYGPTALCVVLLAALVTNLVLRLGE 914



>gi|472583927|gb|EMS21543.1| vacuolar transporter chaperone 4 [Rhodosporidium toruloides NP11]
          Length = 811

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/141 (60%), Positives = 105/141 (74%), Gaps = 8/141 (5%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN++     RSGNNWRR DIGID+PF +LPD + E FPY +LEVKLQTQ GQEPPE
Sbjct: 414 LIREDNWDG--VTRSGNNWRRTDIGIDWPFPQLPDSDKELFPYGVLEVKLQTQMGQEPPE 471

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV+ELV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQM+ DIRKP +   +++RP
Sbjct: 472 WVRELVSSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMETDIRKPATQKAQIQRP 530

Query: 120 ----SASNPTTPANERGNPFS 136
               S +N  TP+  R    +
Sbjct: 531 PTSHSNTNSGTPSETRSTDLA 551



 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 79/115 (68%), Gaps = 3/115 (2%)

Query: 205 HGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG---DKITVTAASFLVF 261
            GKKIA+PVRVEPKVF+ANERT L+W+ FSV++    IG+L+F    D I + AA+    
Sbjct: 695 QGKKIAVPVRVEPKVFYANERTTLAWIEFSVIISAIGIGILSFSDPHDDIALAAAASFTT 754

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           V ++ +LY   TY WRV+ IR R++  Y D  GPT +C +LL++V +NF LRL +
Sbjct: 755 VALLAILYTAWTYWWRVRMIRARQAVQYHDYIGPTALCGILLVAVIVNFSLRLKQ 809



>gi|325093095|gb|EGC46405.1| vacuolar transporter chaperone 4 [Ajellomyces capsulatus H88]
          Length = 1806

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/127 (64%), Positives = 98/127 (77%), Gaps = 4/127 (3%)

Query: 1    MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
            MIREDN +   R RSG+NWRRMDIGIDYPF +LP  ++ERFPYAILEVKLQ Q GQ PP 
Sbjct: 1378 MIREDNLDG--RKRSGSNWRRMDIGIDYPFLQLPAQDVERFPYAILEVKLQMQAGQAPPP 1435

Query: 61   WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
            W+++L+ SHLVEAVPKFSKFIHG A L     I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 1436 WIRDLISSHLVEAVPKFSKFIHGTANLFPD-HIDLLPFWMPQMDVDIRKPITRRFGIERP 1494

Query: 120  SASNPTT 126
              ++ +T
Sbjct: 1495 VQTSQST 1501



 Score =  114 bits (285), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 82/118 (69%), Gaps = 6/118 (5%)

Query: 199  KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
            K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D +T+ ++ 
Sbjct: 1687 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAATLLNFGHDTVTLVSSW 1743

Query: 258  FLVFVTMMVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLR 313
                +  + ++Y+L  Y+WRV KIRKR      Y +++GPT +C+ LL++V +NF LR
Sbjct: 1744 VFTILACLSLVYSLLLYMWRVDKIRKRRDVKHVYHEKWGPTVLCVGLLVAVCVNFGLR 1801



>gi|240275722|gb|EER39235.1| vacuolar transporter chaperone 4 [Ajellomyces capsulatus H143]
          Length = 1758

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/127 (64%), Positives = 98/127 (77%), Gaps = 4/127 (3%)

Query: 1    MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
            MIREDN +   R RSG+NWRRMDIGIDYPF +LP  ++ERFPYAILEVKLQ Q GQ PP 
Sbjct: 1330 MIREDNLDG--RKRSGSNWRRMDIGIDYPFLQLPAQDVERFPYAILEVKLQMQAGQAPPP 1387

Query: 61   WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
            W+++L+ SHLVEAVPKFSKFIHG A L     I L PFW+PQMD+DIRKP +  F +ERP
Sbjct: 1388 WIRDLISSHLVEAVPKFSKFIHGTANLFPD-HIDLLPFWMPQMDVDIRKPITRRFGIERP 1446

Query: 120  SASNPTT 126
              ++ +T
Sbjct: 1447 VQTSQST 1453



 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 82/118 (69%), Gaps = 6/118 (5%)

Query: 199  KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAAS 257
            K PK   GK+I +PVRVEPKV+FA ERTFLSWL FS++LG  A  LLNFG D +T+ ++ 
Sbjct: 1639 KAPK---GKRIHVPVRVEPKVYFAAERTFLSWLEFSIILGSIAATLLNFGHDTVTLVSSW 1695

Query: 258  FLVFVTMMVMLYALGTYLWRVKKIRKRESGP--YEDRYGPTFICIMLLISVTINFWLR 313
                +  + ++Y+L  Y+WRV KIRKR      Y +++GPT +C+ LL++V +NF LR
Sbjct: 1696 VFTILACLSLVYSLLLYMWRVDKIRKRRDVKHVYHEKWGPTVLCVGLLVAVCVNFGLR 1753



>gi|366992738|ref|XP_003676134.1| hypothetical protein NCAS_0D01910 [Naumovozyma castellii CBS 4309]
 gi|342302000|emb|CCC69772.1| hypothetical protein NCAS_0D01910 [Naumovozyma castellii CBS 4309]
          Length = 723

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 80/122 (65%), Positives = 98/122 (80%), Gaps = 5/122 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +LP+ ++ RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGIDR--THGNWRRTDIGVDWPFKQLPEKDVCRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  PSN  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VDSIPFWLPQMDVDIRKPPLPSNINISR 498

Query: 119 PS 120
           P+
Sbjct: 499 PA 500



 Score =  103 bits (257), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 71/109 (65%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK I +PVRVEPKV+FA ERTFLSW++ S++LGG +  +L +G   T+ A+       ++
Sbjct: 614 GKTICVPVRVEPKVYFATERTFLSWVSISILLGGVSTTMLTYGTPTTMLASIGFFVTALV 673

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           V+ +A+  Y  RV  IR +++  YED+ GP  +C  LL+SV  +F+  L
Sbjct: 674 VLFHAVRVYATRVVNIRMKKAVDYEDKVGPPMVCTFLLLSVLFSFFCNL 722



>gi|401625102|gb|EJS43127.1| vtc4p [Saccharomyces arboricola H-6]
          Length = 721

 Score =  170 bits (430), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 5/124 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVA+L++ + +   PFWLPQMD+DIRKP  PSN  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVASLLNDK-VESIPFWLPQMDVDIRKPPLPSNIEITR 498

Query: 119 PSAS 122
           P  S
Sbjct: 499 PGRS 502



 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 68/112 (60%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK I +PVRVEPKV+FA ERT+LSWL+ S++LGG +  LL +G    +  +      ++ 
Sbjct: 610 GKTICVPVRVEPKVYFATERTYLSWLSISILLGGVSTTLLTYGSPTAMIGSIGFFITSLA 669

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
           V++  +  Y  RV  IR + +  YED+ GP  + + L++S+  +F+  L  K
Sbjct: 670 VLIRTVMVYAKRVVNIRLKRAVDYEDKIGPGMVSVFLILSILFSFFCNLVAK 721



>gi|401838834|gb|EJT42272.1| VTC4-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 721

 Score =  169 bits (429), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 5/124 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVA+L++ + +   PFWLPQMD+DIRKP  PSN  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVASLLNDK-VESIPFWLPQMDVDIRKPPLPSNIEITR 498

Query: 119 PSAS 122
           P  S
Sbjct: 499 PGRS 502



 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 68/112 (60%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK I +PVRVEPKV+FA ERT+LSWL+ S++LGG +  LL +G    +  +      ++ 
Sbjct: 610 GKTICVPVRVEPKVYFATERTYLSWLSISILLGGVSTTLLTYGSPTAMIGSIGFFITSLA 669

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
           V++  +  Y  RV  IR + +  YED+ GP  + + L++S+  +F+  L  K
Sbjct: 670 VLIRTVMVYAKRVVNIRLKRAVDYEDKIGPGMVSVFLILSILFSFFCNLIAK 721



>gi|323333045|gb|EGA74447.1| Vtc4p [Saccharomyces cerevisiae AWRI796]
          Length = 583

 Score =  169 bits (429), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 5/124 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  P+N  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VDSIPFWLPQMDVDIRKPPLPTNIEITR 498

Query: 119 PSAS 122
           P  S
Sbjct: 499 PGRS 502



>gi|365759950|gb|EHN01704.1| Vtc4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 679

 Score =  169 bits (429), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 5/124 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVA+L++ + +   PFWLPQMD+DIRKP  PSN  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVASLLNDK-VESIPFWLPQMDVDIRKPPLPSNIEITR 498

Query: 119 PSAS 122
           P  S
Sbjct: 499 PGRS 502



>gi|323308428|gb|EGA61673.1| Vtc4p [Saccharomyces cerevisiae FostersO]
          Length = 313

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 5/124 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 112 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 169

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  P+N  + R
Sbjct: 170 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VDSIPFWLPQMDVDIRKPPLPTNIEITR 228

Query: 119 PSAS 122
           P  S
Sbjct: 229 PGRS 232



>gi|1006727|emb|CAA89303.1| unnamed protein product [Saccharomyces cerevisiae]
          Length = 648

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 5/124 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR DIG+D+PF +L D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDGVDR--THKNWRRTDIGVDWPFKQLDDKDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  P+N  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VDSIPFWLPQMDVDIRKPPLPTNIEITR 498

Query: 119 PSAS 122
           P  S
Sbjct: 499 PGRS 502



>gi|238605145|ref|XP_002396378.1| hypothetical protein MPER_03406 [Moniliophthora perniciosa FA553]
 gi|215468839|gb|EEB97308.1| hypothetical protein MPER_03406 [Moniliophthora perniciosa FA553]
          Length = 200

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/149 (57%), Positives = 106/149 (71%), Gaps = 16/149 (10%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN++   R R+G+NWRR DIGID+PF +LP  + E F Y +LEVKLQTQ GQEPP+
Sbjct: 1   MIREDNWDG--RTRAGDNWRRTDIGIDHPFEQLPPEDKELFKYGVLEVKLQTQLGQEPPQ 58

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFR--LER 118
           WV ELVQSHLVEAVPKFSKFIHG +TL+ SR + L PFWLPQMD DI+KP + +   +ER
Sbjct: 59  WVTELVQSHLVEAVPKFSKFIHGCSTLLPSR-VDLVPFWLPQMDTDIQKPDTGYLSVIER 117

Query: 119 PS-----------ASNPTTPANERGNPFS 136
           P+           +S  T+P N+   P S
Sbjct: 118 PAGTSSKGSSTMVSSGETSPKNKYTEPLS 146



>gi|164422653|ref|XP_963840.2| vacuolar transporter chaperone 4 [Neurospora crassa OR74A]
 gi|157069763|gb|EAA34604.2| vacuolar transporter chaperone 4 [Neurospora crassa OR74A]
          Length = 809

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 98/124 (79%), Gaps = 4/124 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R  SG+NWRR DIGID+PF +LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 424 MIREDNLDGVQR--SGDNWRRTDIGIDWPFPQLPPSDICRFPYAVLEVKLQTQLGQEPPE 481

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG A+L   R I L P+W PQMD+DIRKPP+ +F ++R 
Sbjct: 482 WVRQLISSHLVEAVPKFSKFIHGTASLFPDR-IHLLPYWFPQMDVDIRKPPTHDFGIKRL 540

Query: 120 SASN 123
            +S 
Sbjct: 541 ESST 544



 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 78/130 (60%), Gaps = 6/130 (4%)

Query: 187 LEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLN 246
           LE  L +     K  K   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A+ LLN
Sbjct: 670 LESLLGSGEIHQKRIKAPKGKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIAVTLLN 729

Query: 247 FG--DK----ITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICI 300
           FG  DK     ++ AA     +  + + YA+  YL+R   IR R++  Y D++GP+ +C 
Sbjct: 730 FGASDKGGRGSSIIAAGVFTLLAFLSLWYAVVIYLYRSHAIRTRKAARYYDKWGPSILCA 789

Query: 301 MLLISVTINF 310
            L ++V +NF
Sbjct: 790 ALFVAVVLNF 799



>gi|336463167|gb|EGO51407.1| vacuolar transporter chaperone 4 [Neurospora tetrasperma FGSC 2508]
 gi|350297644|gb|EGZ78621.1| vacuolar transporter chaperone 4 [Neurospora tetrasperma FGSC 2509]
          Length = 809

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/123 (65%), Positives = 98/123 (79%), Gaps = 4/123 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   R  SG+NWRR DIGID+PF +LP  +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 423 MIREDNLDGVQR--SGDNWRRTDIGIDWPFPQLPPSDICRFPYAVLEVKLQTQLGQEPPE 480

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVEAVPKFSKFIHG A+L   R I L P+W PQMD+DIRKPP+ +F ++R 
Sbjct: 481 WVRQLISSHLVEAVPKFSKFIHGTASLFPDR-IHLLPYWFPQMDVDIRKPPTHDFGIKRL 539

Query: 120 SAS 122
            +S
Sbjct: 540 ESS 542



 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 78/130 (60%), Gaps = 6/130 (4%)

Query: 187 LEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLN 246
           LE  L +     K  K   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A+ LLN
Sbjct: 670 LESLLGSGEIHQKRIKAPKGKKIYVPVRVEPKVYFAAERTFLGWLEYSIYIGTIAVTLLN 729

Query: 247 FG--DK----ITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICI 300
           FG  DK     ++ AA     +  + + YA+  YL+R   IR R++  Y D++GP+ +C 
Sbjct: 730 FGASDKGGRGSSIIAAGVFTLLAFLSLWYAVVIYLYRSHAIRTRKAARYYDKWGPSILCA 789

Query: 301 MLLISVTINF 310
            L ++V +NF
Sbjct: 790 ALFVAVVLNF 799



>gi|395332427|gb|EJF64806.1| SPX-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 867

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/120 (67%), Positives = 97/120 (80%), Gaps = 4/120 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN++   R+RSG+NWRRMDIGID+PF +LP  + E F Y +LEVKLQTQYGQEPPE
Sbjct: 424 MIREDNWDG--RIRSGDNWRRMDIGIDFPFEQLPPEDKELFKYGVLEVKLQTQYGQEPPE 481

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV +LV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQM++DI KP +    +ERP
Sbjct: 482 WVTDLVSSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMEVDILKPDTGVVTIERP 540



 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 72/115 (62%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+IA+PVR+EPKV+FA ERTF  WL+  + +G  A  LLNF    D + + +A     V
Sbjct: 752 GKRIAVPVRIEPKVYFAAERTFFKWLHLGIFIGTIATTLLNFVPPDDAVGLISAWCFTGV 811

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ +LY+   +++R   +R+R + G Y D YGPT + ++L+ ++  N  LR+ E
Sbjct: 812 ALVAILYSAVVFVYRAYHLRERRAEGMYFDMYGPTVLSVLLVAALATNIGLRMRE 866



>gi|353227570|emb|CCA78073.1| probable VTC4-Vacuolar Transporter Chaperone [Piriformospora indica
           DSM 11827]
          Length = 818

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 100/121 (82%), Gaps = 4/121 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++ +  +RSG+NWRRMDIGID+PF++L   + E FPY +LEVKLQTQ+GQEPP 
Sbjct: 416 MVREDNWDGD--IRSGSNWRRMDIGIDHPFNQLRAEDRELFPYGVLEVKLQTQFGQEPPL 473

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV+ELV SHLVE++PKFSKFIHG ATL+  R + L PFWLPQMDIDIRKP + N  ++RP
Sbjct: 474 WVRELVSSHLVESIPKFSKFIHGCATLLPHR-VDLVPFWLPQMDIDIRKPDTGNVTIDRP 532

Query: 120 S 120
           +
Sbjct: 533 T 533



 Score =  109 bits (273), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 70/109 (64%), Gaps = 4/109 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+IA+PVRVEPKVFFA ERTFL WL+F+V++G  A  LLNF   GD++ +  A    F 
Sbjct: 704 GKRIAVPVRVEPKVFFAQERTFLKWLHFAVLIGTVATALLNFSKPGDRVGLICAGAFTFS 763

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGP-YEDRYGPTFICIMLLISVTINF 310
            +  + YA G +  R + +R R S   Y D YGPT +CI+L  +  INF
Sbjct: 764 ALASIAYAAGMFYHRTQSLRARSSDARYYDPYGPTALCIILAGATIINF 812



>gi|451850198|gb|EMD63500.1| hypothetical protein COCSADRAFT_190747 [Bipolaris sorokiniana
           ND90Pr]
          Length = 791

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 101/129 (78%), Gaps = 4/129 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   ++RSG+NWRR DIG+D+PF +LP  + E FPYA+LEVKLQTQ G EPP+
Sbjct: 381 MTREDNLDG--KIRSGDNWRRTDIGVDWPFKQLPKEDKELFPYAVLEVKLQTQAGGEPPQ 438

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPKFSK+IHG ATL + ++I L P+W PQMD+DIRKP S NF +ERP
Sbjct: 439 WIRDLTSSHLVEAVPKFSKYIHGTATL-NPKRIHLLPYWYPQMDVDIRKPVSHNFGIERP 497

Query: 120 SASNPTTPA 128
            ASN  + +
Sbjct: 498 GASNDISTS 506



 Score =  124 bits (310), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (64%), Gaps = 3/116 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKV  A ERTFLSWL FS+++G  A  LLNFGD +   AA  
Sbjct: 664 KAPK---GKRIHVPVRVEPKVQLATERTFLSWLEFSILIGSIAATLLNFGDSLAFAAAWS 720

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
              +  + + Y+ G Y+WRV KI++R +  Y DR+GPT +C  L  +V ++F  RL
Sbjct: 721 FTIIACLALCYSAGLYIWRVNKIKERRAVTYHDRWGPTLLCFGLFCAVAVSFGFRL 776



>gi|392594973|gb|EIW84297.1| SPX-domain-containing protein [Coniophora puteana RWD-64-598 SS2]
          Length = 828

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 84/138 (60%), Positives = 104/138 (75%), Gaps = 5/138 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN++   R R+G NWRR DIGID+PF ++   +IERF Y +LEVKLQTQ+GQEPP+
Sbjct: 419 MIREDNWDG--RTRAGENWRRTDIGIDFPFDQVVPEDIERFKYGVLEVKLQTQFGQEPPK 476

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNF-RLERP 119
           WV +LVQSHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMD DI KP + +  +ERP
Sbjct: 477 WVTDLVQSHLVEAVPKFSKFIHGCATLLPNR-VDLIPFWLPQMDADILKPNTGYLTVERP 535

Query: 120 SA-SNPTTPANERGNPFS 136
           +  S+ TTP  +     S
Sbjct: 536 AVPSSRTTPDTKSSGAVS 553



 Score =  106 bits (265), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 73/112 (65%), Gaps = 4/112 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKI +PVR+EPKV+FANERTFL WL+F+V++G  A  LLNF    D+  + +A      
Sbjct: 713 GKKIVVPVRIEPKVYFANERTFLKWLSFAVLIGTIATTLLNFIPANDRKGLISAFLFTLS 772

Query: 263 TMMVMLYALGTYLWRVKKIRKRE-SGPYEDRYGPTFICIMLLISVTINFWLR 313
            ++ + Y+   +++R  ++R R  SG Y DRYGPT +C +LL ++  N  LR
Sbjct: 773 ALLAIAYSAIIFVYRALRLRSRSASGLYYDRYGPTMLCFVLLAALATNIGLR 824



>gi|513031984|gb|AGO11993.1| AaceriAGR316Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 713

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/125 (61%), Positives = 99/125 (79%), Gaps = 5/125 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R  +  NWRRMDIG+D+PF +LP+ ++E FPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDDFDGYDR--TNGNWRRMDIGVDWPFKQLPEHDVEYFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKF+HG+ATL+ SR +   P+WLPQMD+DIRKP  P+   + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFLHGMATLLPSR-VDSIPYWLPQMDVDIRKPVIPTQINISR 498

Query: 119 PSASN 123
           P+  +
Sbjct: 499 PNCDD 503



 Score = 93.6 bits (231), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 61/109 (55%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK I +PVR+EPKV+FA ERTFLSWL+  ++    +  LL +G +  +  A       + 
Sbjct: 604 GKTICVPVRIEPKVYFATERTFLSWLDIGLIFSAISTTLLTYGSQAAMIGAIGFFLTAIG 663

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            + Y+   Y  RV  IR + +G YED+ GP  +C ML  S+   F+  L
Sbjct: 664 TIYYSAYVYCSRVIDIRLKRAGDYEDKRGPPLVCGMLFASILFVFFCNL 712



>gi|366998475|ref|XP_003683974.1| hypothetical protein TPHA_0A04670 [Tetrapisispora phaffii CBS 4417]
 gi|357522269|emb|CCE61540.1| hypothetical protein TPHA_0A04670 [Tetrapisispora phaffii CBS 4417]
          Length = 734

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (82%), Gaps = 3/110 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  + NNWRRMDIG+D+PF ++ D +I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 379 MVREDNFDGCDR--THNNWRRMDIGVDWPFKQVKDKDICRFPYAVLEVKLQTQLGQEPPE 436

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP 110
           WV+ELV SHLVE VPKFSKFIHGVATL++   +   PFWLPQMD+DIRKP
Sbjct: 437 WVRELVSSHLVEPVPKFSKFIHGVATLLND-NVNQIPFWLPQMDVDIRKP 485



 Score =  106 bits (265), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 72/109 (66%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK I +PVRVEPKV+FA ERTFLSW++ +++LGG +  LL +G + T+ A+      ++ 
Sbjct: 625 GKTICVPVRVEPKVYFATERTFLSWISIAIILGGVSTALLTYGTQTTMIASLGFFLTSLF 684

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           V+      Y+ RV  IR++++  YED+ GP+ +C  LL+S+  +F+  L
Sbjct: 685 VIARTTYVYITRVINIRQKKAADYEDKLGPSLVCAFLLLSMIFSFYCNL 733



>gi|389624573|ref|XP_003709940.1| vacuolar transporter chaperone 4 [Magnaporthe oryzae 70-15]
 gi|351649469|gb|EHA57328.1| vacuolar transporter chaperone 4 [Magnaporthe oryzae 70-15]
 gi|440471610|gb|ELQ40599.1| vacuolar transporter chaperone 4 [Magnaporthe oryzae Y34]
 gi|440481968|gb|ELQ62498.1| vacuolar transporter chaperone 4 [Magnaporthe oryzae P131]
          Length = 780

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 98/120 (81%), Gaps = 4/120 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIRED+ +   + R+G+NWRRMDIGID+PFS+LP  +I RFPYA+LEVKLQT  GQ+PP+
Sbjct: 391 MIREDDLDG--KKRAGDNWRRMDIGIDHPFSQLPPEDIVRFPYAVLEVKLQTHVGQQPPD 448

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++L+ SHLVE+VPKFSKFIHG A+L + R I L PFW PQMD+DIRKP + NF + RP
Sbjct: 449 WVRQLISSHLVESVPKFSKFIHGCASLFEDR-INLLPFWHPQMDVDIRKPRTHNFGIHRP 507



 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/124 (43%), Positives = 79/124 (63%), Gaps = 7/124 (5%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK---ITVTA 255
           K PK   GKKI +PVRVEPKV+FA ERTFL WL +S+ +G  A  LLNFGDK   +    
Sbjct: 658 KAPK---GKKIHVPVRVEPKVYFAAERTFLGWLEYSIYVGMIATTLLNFGDKPNSMAFVV 714

Query: 256 ASFLVFVTMMVMLYALGTYLWRVKKIR-KRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           A     V ++ ++Y++  YL+R + IR +R S  Y D+ GP+ +C+ L ++V +NF    
Sbjct: 715 AGAFTIVAILCLIYSVAIYLYRSRAIRTRRASAKYYDKLGPSALCVTLFLAVALNFGFEG 774

Query: 315 HEKS 318
           +++S
Sbjct: 775 YKRS 778



>gi|451993330|gb|EMD85804.1| hypothetical protein COCHEDRAFT_1187725 [Bipolaris maydis C5]
 gi|477582704|gb|ENH99809.1| hypothetical protein COCC4DRAFT_54142 [Bipolaris maydis ATCC 48331]
          Length = 790

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (77%), Gaps = 4/129 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   + RSG+NWRR DIG+D+PF +LP  + E FPYA+LEVKLQTQ G EPP+
Sbjct: 381 MTREDNLDG--KTRSGDNWRRTDIGVDWPFKQLPKEDKELFPYAVLEVKLQTQAGGEPPQ 438

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPKFSK+IHG ATL + ++I L P+W PQMD+DIRKP S NF +ERP
Sbjct: 439 WIRDLTSSHLVEAVPKFSKYIHGTATL-NPKRIHLLPYWYPQMDVDIRKPVSHNFGIERP 497

Query: 120 SASNPTTPA 128
            ASN  + +
Sbjct: 498 GASNDISTS 506



 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 76/116 (65%), Gaps = 3/116 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKV  A ERTFLSWL FS+++G  A  LLNFGD +   AA  
Sbjct: 663 KAPK---GKRIHVPVRVEPKVQLATERTFLSWLEFSILIGSIAATLLNFGDSLAFAAAWA 719

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
              +  + + Y+ G Y+WRV KI++R +  Y DR+GPT +C+ L  +V ++F  RL
Sbjct: 720 FTIIACLALCYSAGLYIWRVNKIKERRAVTYHDRWGPTLLCLGLFCAVAVSFGFRL 775



>gi|403218506|emb|CCK72996.1| hypothetical protein KNAG_0M01430 [Kazachstania naganishii CBS
           8797]
          Length = 718

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/124 (62%), Positives = 99/124 (79%), Gaps = 5/124 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   + R+  NWRR DIG+D+PF+++ DG+I RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDNFDG--KNRTHGNWRRTDIGVDWPFNQVEDGDICRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   P+WLPQMD+DIRKP   +   + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VESIPYWLPQMDVDIRKPQIQTQIDITR 498

Query: 119 PSAS 122
           P+ S
Sbjct: 499 PARS 502



 Score =  103 bits (256), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 69/108 (63%)

Query: 205 HGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTM 264
           HGK I +PVRVEPKV+FA ERTFLSWL  ++VLGG +  L+ +G + ++ A+      ++
Sbjct: 609 HGKSICVPVRVEPKVYFATERTFLSWLTIAIVLGGVSTTLVTYGTRTSMVASVGFFITSL 668

Query: 265 MVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWL 312
           + +++    Y  RV  IR + +  YED++GP  IC  L ++V  +F+ 
Sbjct: 669 VTIVHTTVVYARRVVNIRMKRAVDYEDKFGPKLICGCLFLAVLFSFFC 716



>gi|484856350|gb|EOB14139.1| Vacuolar transporter chaperone 4 [Nosema bombycis CQ1]
          Length = 384

 Score =  166 bits (421), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 144/293 (49%), Gaps = 46/293 (15%)

Query: 29  PFSKLPDGEIERFPYAILEVKLQTQYGQEPPEWVQELVQSHLVEAVPKFSKFIHGVATLM 88
           PF  L   +I RFPYAILE+K Q  Y  +P EW+ +LV+  LVE V KFSKF+HG A L 
Sbjct: 127 PFPDLKKDQIVRFPYAILEIKTQGDYDSKP-EWITDLVEGPLVEHVHKFSKFLHGCAVLY 185

Query: 89  DSRQIPLFPFWLPQMDIDIRKPPSNFRLERPSASNPT---TPANERGNPFSGTXXXXXXX 145
               I   P+WLPQ+   I+K P +        S        +N RG+P           
Sbjct: 186 PF--INEIPYWLPQVTKSIKKDPFDSEEITNKESEEGLYYDESNARGSP----------- 232

Query: 146 XXXXXXXXXXXXXXNTPLLSESSQNTN---TQLRSTPHISSLEELEEYLATVTPAGKVPK 202
                          T  ++  S N N         P I   ++L             P 
Sbjct: 233 -------------SQTHYINIPSNNDNIPPNHNNIPPFIDDSDKLS------------PI 267

Query: 203 TYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA-ASFLVF 261
             HGKKIAIPVRVEPKVFFANERTFLSW+ F++ LGG    LL   +  +       L+ 
Sbjct: 268 DTHGKKIAIPVRVEPKVFFANERTFLSWVQFAIFLGGIGTALLGMKEGTSSKMPGVLLIG 327

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           V+++   YAL  YLWR   IRKR  GPY+D YGP  + ++ LI++ ++   + 
Sbjct: 328 VSIIFSFYALYLYLWRAGMIRKRHPGPYDDIYGPPVLVVVFLIAMGLSIIYKF 380



>gi|396473987|ref|XP_003839467.1| similar to vacuolar transporter chaperone (Vtc4) [Leptosphaeria
           maculans JN3]
 gi|312216036|emb|CBX95988.1| similar to vacuolar transporter chaperone (Vtc4) [Leptosphaeria
           maculans JN3]
          Length = 677

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 79/124 (63%), Positives = 99/124 (79%), Gaps = 4/124 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN +   + R+G+NWRRMDIG+D+PF +LP  + E FPYA+LEVKLQTQ G EPP+
Sbjct: 273 MIREDNLDG--KTRAGDNWRRMDIGVDWPFKQLPKEDKELFPYAVLEVKLQTQAGGEPPQ 330

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W+++L  SHLVEAVPKFSK+IHG ATL  +R I L P+W PQM++DIRKP S+ F +ERP
Sbjct: 331 WIRDLTSSHLVEAVPKFSKYIHGTATLNPTR-INLIPYWYPQMNVDIRKPVSHKFGIERP 389

Query: 120 SASN 123
            ASN
Sbjct: 390 GASN 393



 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 3/116 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKV  A ERTFLSWL FS+++G  A  LLNFGD +T+ AA  
Sbjct: 554 KAPK---GKRIHVPVRVEPKVQLATERTFLSWLEFSILIGSIAATLLNFGDPLTLAAAWA 610

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
              V ++ + Y+ G YLWRV KIR+R +  Y D++GPT +C+ L  +V+++F  R 
Sbjct: 611 FTAVAVIALTYSAGLYLWRVAKIRERRAVVYHDKWGPTLLCLGLFAAVSVSFGYRF 666



>gi|482806467|gb|EOA83540.1| hypothetical protein SETTUDRAFT_164870 [Setosphaeria turcica Et28A]
          Length = 790

 Score =  166 bits (420), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 100/129 (77%), Gaps = 4/129 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   + RSG+NWRR DIG+D+PF +LP  + E FPYA+LEVKLQTQ G EPP+
Sbjct: 381 MTREDNLDG--KTRSGDNWRRTDIGVDWPFKQLPKEDKELFPYAVLEVKLQTQAGGEPPQ 438

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           W+++L  SHLVEAVPKFSK+IHG ATL + ++I L P+W PQMD+DIRKP + NF +ERP
Sbjct: 439 WIRDLTASHLVEAVPKFSKYIHGTATL-NPKRINLLPYWYPQMDVDIRKPVTHNFGIERP 497

Query: 120 SASNPTTPA 128
            ASN  + +
Sbjct: 498 GASNDISTS 506



 Score =  126 bits (316), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 76/116 (65%), Gaps = 3/116 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKV  A ERTFLSWL FS+++G  A  LLNFGD +   AA  
Sbjct: 663 KAPK---GKRIHVPVRVEPKVQLATERTFLSWLEFSILIGSIAATLLNFGDGLAFAAAWA 719

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
              +  + + Y+ G Y+WRV KIR+R +  Y DR+GPT +C  LL +V ++F  RL
Sbjct: 720 FTIIACLALCYSAGLYIWRVNKIRERRAVTYHDRWGPTLLCAGLLCAVAVSFGYRL 775



>gi|484857422|gb|EOB15164.1| Vacuolar transporter chaperone 4 [Nosema bombycis CQ1]
          Length = 710

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 107/283 (37%), Positives = 143/283 (50%), Gaps = 40/283 (14%)

Query: 28  YPFSKLPDGEIERFPYAILEVKLQTQYGQEPPEWVQELVQSHLVEAVPKFSKFIHGVATL 87
           YPF  L   +I RFPYAILE+K Q  Y  +P EW+ +LV+  LVE V KFSKF+HG A L
Sbjct: 458 YPFPGLKKDQIVRFPYAILEIKTQGDYDSKP-EWITDLVEGPLVEHVHKFSKFLHGCAVL 516

Query: 88  MDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPSASNPTTPANERGNPFSGTXXXXXXXXX 147
                I   P+WLPQ+   I+K P +        S+     + +G+P             
Sbjct: 517 YPF--INEIPYWLPQVTKSIKKDPFDSEEITNKESDHYENGDLKGSP------------- 561

Query: 148 XXXXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLATVTPAGKVPKTYHGK 207
                        T  ++  S N N        I   ++L             P   HGK
Sbjct: 562 -----------PQTHYINIPSNNNNIPPNHNNEIDDSDKLS------------PIDTHGK 598

Query: 208 KIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTA-ASFLVFVTMMV 266
           KIAIPVRVEPKVFFANERTFLSW+ F++ LGG    LL   +  +       L+ V+++ 
Sbjct: 599 KIAIPVRVEPKVFFANERTFLSWVQFAIFLGGIGTALLGMKEGTSSKMPGVLLIGVSIIF 658

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTIN 309
             YAL  YLWR   IRKR  GPY+D YGP  + ++ LI++ ++
Sbjct: 659 SFYALYLYLWRAGMIRKRHPGPYDDIYGPPVLVVVFLIAMGLS 701



>gi|365984751|ref|XP_003669208.1| hypothetical protein NDAI_0C03050 [Naumovozyma dairenensis CBS 421]
 gi|343767976|emb|CCD23965.1| hypothetical protein NDAI_0C03050 [Naumovozyma dairenensis CBS 421]
          Length = 730

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/122 (63%), Positives = 96/122 (78%), Gaps = 5/122 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R  +  NWRR DIG+D+PF +L D ++ RFPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDSFDGVDR--THGNWRRTDIGVDWPFKQLDDKDVCRFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKFIHGVATL++ + +   PFWLPQMD+DIRKP  P+N  + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFIHGVATLLNDK-VDSIPFWLPQMDVDIRKPPLPTNINITR 498

Query: 119 PS 120
           P 
Sbjct: 499 PG 500



 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 70/109 (64%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK I +PVRVEPKV+FA ERT+LSW++ +++LGG +  LL +G   T+ A+      +++
Sbjct: 621 GKSICVPVRVEPKVYFATERTYLSWVSIAILLGGVSTTLLTYGTPTTMLASIGFFVTSLI 680

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            + +A+  Y  R+  IR + +  YED+ GP  ICI L +S+  +F+  L
Sbjct: 681 TLFHAVKVYATRIVNIRLKRAIDYEDKVGPPMICIFLFLSIAFSFFCNL 729



>gi|393241368|gb|EJD48890.1| SPX-domain-containing protein [Auricularia delicata TFB-10046 SS5]
          Length = 839

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 93/113 (82%), Gaps = 3/113 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   R RSG NWRR DIGID+PF +LP  + E FPY +LEVKLQTQ+GQEPPE
Sbjct: 423 MVREDNWDG--RNRSGKNWRREDIGIDWPFDQLPPEDKELFPYGVLEVKLQTQFGQEPPE 480

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN 113
           WV++LV SHLVE+VPKFSKFIHG ATL+ +R + L PFWLPQMD+DIRKP + 
Sbjct: 481 WVRQLVSSHLVESVPKFSKFIHGCATLLPNR-VDLVPFWLPQMDVDIRKPDTG 532



 Score = 83.2 bits (204), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 67/110 (60%), Gaps = 5/110 (4%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKIT----VTAASFLVF 261
           G +IA+PVR+EPKV+FA+ERTFL WL FSV++      LLNF  +      + +A     
Sbjct: 716 GTRIAVPVRIEPKVYFASERTFLQWLQFSVLIAFIPTTLLNFSSEDDREPGLLSAGAFTL 775

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGP-YEDRYGPTFICIMLLISVTINF 310
             ++ + Y+   ++ R  K+R R +   Y D YGPT +C++L+ ++ +NF
Sbjct: 776 AALLALAYSCFIFVHRAFKLRARAADALYYDPYGPTVLCLVLIGAIGLNF 825



>gi|451994807|gb|EMD87276.1| hypothetical protein COCHEDRAFT_1206554 [Bipolaris maydis C5]
          Length = 841

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 113/378 (29%), Positives = 173/378 (45%), Gaps = 76/378 (20%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIG---IDYPFSKLPDGEIERFPYAILEVKLQTQYGQE 57
           +IRED+ + +   R  ++W R DI    ++YPF  L  GE+ RFPYA+LE+K++   G +
Sbjct: 445 LIREDSLDESRPCRDPDDWHRHDIDGAQMEYPFKNLKKGEVHRFPYALLEIKVK---GSQ 501

Query: 58  PPEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRL 116
             EW+++L+ SHLV+  P+FSKF+HGVA L +   +  FPFWL ++D DIRK P   F  
Sbjct: 502 KYEWIEDLMHSHLVKESPRFSKFVHGVAKLFED-NVNTFPFWLSEVDNDIRKEPEKAFDD 560

Query: 117 E--------------------------RPSASNPT-TPANERGNPFSGTXXXXXXXXXXX 149
           E                          RPS ++P  +PA  R  P S +           
Sbjct: 561 EQEKKRKAAEDEFAVGSLFGARASPSFRPSIASPVGSPAATRSVPKSASMAAHSQPAVRP 620

Query: 150 XXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLATVTPAGKVPK------- 202
                         LS+S Q+ N    +T ++  +EE  +    V   GK  +       
Sbjct: 621 SLPTIGSH------LSQSQQDRNRDANNTTNV-RVEEDSDSDNDVVAGGKTQRGGLAALF 673

Query: 203 ---------TYHGKKIAI---------------PVRVEPKVFFANERTFLSWLNFSVVLG 238
                        +KI +               PVRVE KV+ AN+RTF+ W + SV+L 
Sbjct: 674 PSFSTSKYARRQQRKIQLPPGIRDPGVWIKDQGPVRVEAKVWLANQRTFIKWQHVSVLLA 733

Query: 239 GFAIGLLNF---GDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGP 295
             ++GL N    G+ I    A     V    + +  G Y++R K IR+R    ++   GP
Sbjct: 734 SLSLGLYNAAGEGNDIARALAVVYTCVAAFTLAWGYGMYVYRAKLIRERSGKDFDAITGP 793

Query: 296 TFICIMLLISVTINFWLR 313
             +CI L +++ +NF  +
Sbjct: 794 LVVCIGLAVALCLNFGFK 811



>gi|477583230|gb|ENI00330.1| hypothetical protein COCC4DRAFT_75782 [Bipolaris maydis ATCC 48331]
          Length = 1512

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 113/378 (29%), Positives = 173/378 (45%), Gaps = 76/378 (20%)

Query: 1    MIREDNFENNPRLRSGNNWRRMDIG---IDYPFSKLPDGEIERFPYAILEVKLQTQYGQE 57
            +IRED+ + +   R  ++W R DI    ++YPF  L  GE+ RFPYA+LE+K++   G +
Sbjct: 1116 LIREDSLDESRPCRDPDDWHRHDIDGAQMEYPFKNLKKGEVHRFPYALLEIKVK---GSQ 1172

Query: 58   PPEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRL 116
              EW+++L+ SHLV+  P+FSKF+HGVA L +   +  FPFWL ++D DIRK P   F  
Sbjct: 1173 KYEWIEDLMHSHLVKESPRFSKFVHGVAKLFED-NVNTFPFWLSEVDNDIRKEPEKAFDD 1231

Query: 117  E--------------------------RPSASNPT-TPANERGNPFSGTXXXXXXXXXXX 149
            E                          RPS ++P  +PA  R  P S +           
Sbjct: 1232 EQEKKRKAAEDEFAVGSLFGARASPSFRPSIASPVGSPAATRSVPKSASMAAHSQPAVRP 1291

Query: 150  XXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLATVTPAGKVPKT------ 203
                          LS+S Q+ N    +T ++  +EE  +    V   GK  +       
Sbjct: 1292 SLPTIGSH------LSQSQQDRNRDANNTTNV-RVEEDSDSDNDVVAGGKTQRGGLAALF 1344

Query: 204  ----------YHGKKIAI---------------PVRVEPKVFFANERTFLSWLNFSVVLG 238
                         +KI +               PVRVE KV+ AN+RTF+ W + SV+L 
Sbjct: 1345 PSFSTSKYARRQQRKIQLPPGIRDPGVWIKDQGPVRVEAKVWLANQRTFIKWQHVSVLLA 1404

Query: 239  GFAIGLLNF---GDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGP 295
              ++GL N    G+ I    A     V    + +  G Y++R K IR+R    ++   GP
Sbjct: 1405 SLSLGLYNAAGEGNDIARALAVVYTCVAAFTLAWGYGMYVYRAKLIRERSGKDFDAITGP 1464

Query: 296  TFICIMLLISVTINFWLR 313
              +CI L +++ +NF  +
Sbjct: 1465 LVVCIGLAVALCLNFGFK 1482



>gi|345565290|gb|EGX48241.1| hypothetical protein AOL_s00080g366 [Arthrobotrys oligospora ATCC
           24927]
          Length = 826

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (83%), Gaps = 4/110 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN   + R R+G+NWRRMDIGID+PF  LP  +IERFPYA+LEVKLQTQ GQEPP+
Sbjct: 407 LIREDN---HGRKRAGDNWRRMDIGIDWPFKNLPAEDIERFPYAVLEVKLQTQAGQEPPQ 463

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP 110
           W+++++ SHLVEAVPKFSKF+HG ATL   + I + PFWLPQMDIDIRKP
Sbjct: 464 WIRDVIASHLVEAVPKFSKFLHGTATLF-PKDIKILPFWLPQMDIDIRKP 512



 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 82/122 (67%), Gaps = 3/122 (2%)

Query: 195 TPAGKVPKTY---HGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKI 251
           TPAG   K +    GK+I +PVR+EPKV+FANERTFLSWL +S+ +   A  LLNFGD  
Sbjct: 660 TPAGAGRKRFIAPPGKRIFVPVRIEPKVYFANERTFLSWLEYSIYISTIAATLLNFGDYR 719

Query: 252 TVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFW 311
           T  A+   + + +  +LY++  ++WR +KIR+R +  Y D +GPT +C ++L+ V INF 
Sbjct: 720 TRYASLGFMVLAIFTLLYSMTMFVWRHQKIRRRRAVRYHDAWGPTALCFLMLVCVAINFG 779

Query: 312 LR 313
           ++
Sbjct: 780 IK 781



>gi|358058497|dbj|GAA95460.1| hypothetical protein E5Q_02114 [Mixia osmundae IAM 14324]
          Length = 922

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (78%), Gaps = 7/123 (5%)

Query: 2   IREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPEW 61
           +REDN++   R+RSG+NWRR DIGID+PF +LP+ +   FPY +LEVKLQTQ GQEPPEW
Sbjct: 524 VREDNWDG--RVRSGDNWRRTDIGIDWPFEQLPEDDKHLFPYGVLEVKLQTQMGQEPPEW 581

Query: 62  VQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFR----LE 117
           V+ELV SHLVEAVPK+SKFIH  ATL+ +R + L PFWLPQMD+DIRKP  +      +E
Sbjct: 582 VRELVSSHLVEAVPKYSKFIHCCATLIPNR-VDLVPFWLPQMDVDIRKPSDDHHKAAMIE 640

Query: 118 RPS 120
           RPS
Sbjct: 641 RPS 643



 Score = 84.3 bits (207), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 3/113 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG--DKITVTAASFLVFVT 263
           GK+IA+PVR+EPKV FA ERTFLSWL F+V+L    +GLL+F   D  T      +    
Sbjct: 792 GKRIAVPVRIEPKVQFALERTFLSWLEFAVLLSAIGVGLLSFAHPDDSTALIGGIVFTAI 851

Query: 264 MMVMLYALGT-YLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLH 315
            ++ +   G  +L R  +IR+R +  Y D  GPT +CI L   V +NF LR+H
Sbjct: 852 ALIAIAYAGVIFLVRAFRIRRRAAVSYHDYVGPTALCIALFAGVVLNFALRIH 904



>gi|336370492|gb|EGN98832.1| hypothetical protein SERLA73DRAFT_107975 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 876

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 102/130 (78%), Gaps = 6/130 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN++   R+R+G+NWRR DIGIDYPF ++ + + E F Y +LEVKLQTQ+GQEPP+
Sbjct: 435 MIREDNWDG--RIRAGDNWRRTDIGIDYPFDQVHEEDKEPFKYGVLEVKLQTQFGQEPPK 492

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNF-RLERP 119
           WV +LVQSHLVEAVPKFSKFIHG ATL+ +R + L PFW+PQMD +I KP + +  +ERP
Sbjct: 493 WVTDLVQSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWMPQMDTNILKPSTGYLTIERP 551

Query: 120 SASNP--TTP 127
           S  N   TTP
Sbjct: 552 SHVNSLKTTP 561



 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 76/115 (66%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIA+PVRVEPKV+FANERTF+ WLNF+V++G  A  LLNF    D + + +A      
Sbjct: 759 GKKIAVPVRVEPKVYFANERTFIKWLNFAVLIGSIATTLLNFIPPDDYVGLISAIMFTVA 818

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   +++R  K+R R + G Y D++GPT +C++L  ++  N  LRL E
Sbjct: 819 ALLAIAYSAIIFVYRALKLRTRSADGLYYDKFGPTALCVVLFAALATNIGLRLVE 873



>gi|336383273|gb|EGO24422.1| hypothetical protein SERLADRAFT_415528 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 857

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 102/130 (78%), Gaps = 6/130 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN++   R+R+G+NWRR DIGIDYPF ++ + + E F Y +LEVKLQTQ+GQEPP+
Sbjct: 416 MIREDNWDG--RIRAGDNWRRTDIGIDYPFDQVHEEDKEPFKYGVLEVKLQTQFGQEPPK 473

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNF-RLERP 119
           WV +LVQSHLVEAVPKFSKFIHG ATL+ +R + L PFW+PQMD +I KP + +  +ERP
Sbjct: 474 WVTDLVQSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWMPQMDTNILKPSTGYLTIERP 532

Query: 120 SASNP--TTP 127
           S  N   TTP
Sbjct: 533 SHVNSLKTTP 542



 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 76/115 (66%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIA+PVRVEPKV+FANERTF+ WLNF+V++G  A  LLNF    D + + +A      
Sbjct: 740 GKKIAVPVRVEPKVYFANERTFIKWLNFAVLIGSIATTLLNFIPPDDYVGLISAIMFTVA 799

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   +++R  K+R R + G Y D++GPT +C++L  ++  N  LRL E
Sbjct: 800 ALLAIAYSAIIFVYRALKLRTRSADGLYYDKFGPTALCVVLFAALATNIGLRLVE 854



>gi|449543039|gb|EMD34016.1| hypothetical protein CERSUDRAFT_107790 [Ceriporiopsis subvermispora
           B]
          Length = 844

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/134 (58%), Positives = 102/134 (76%), Gaps = 4/134 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   R+R+G+NWRRMDIGID+PF +LP  + E F Y +LEVKLQTQ+GQEPP+
Sbjct: 422 MVREDNWDG--RIRAGDNWRRMDIGIDHPFEQLPPEDKELFKYGVLEVKLQTQFGQEPPQ 479

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV +LV SHLVEAVPK SKFIHG ATL+ +R + L PFWLPQMD DI KP +    +ERP
Sbjct: 480 WVTDLVSSHLVEAVPKSSKFIHGCATLLPNR-VDLVPFWLPQMDTDILKPDTGALMIERP 538

Query: 120 SASNPTTPANERGN 133
             S+    ++ +G+
Sbjct: 539 LHSSSKGTSDRQGS 552



 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (61%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+IA+PVR+EPKV+FA ERTFL WL+F++ +G  A  LLNF    D   + +A      
Sbjct: 727 GKRIAVPVRIEPKVYFAAERTFLKWLHFAIYIGTIATTLLNFIPPDDSTGLISAWLFTLA 786

Query: 263 TMMVMLYALGTYLW-RVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   +++  ++  R+R  G Y D+YGPT + + L+ ++  N  LRL E
Sbjct: 787 ALVAIAYSAVIFVYRALQLRRRRAEGMYYDKYGPTVLSVFLISALATNVGLRLRE 841



>gi|242209321|ref|XP_002470508.1| predicted protein [Postia placenta Mad-698-R]
 gi|220730418|gb|EED84275.1| predicted protein [Postia placenta Mad-698-R]
          Length = 785

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 83/139 (59%), Positives = 102/139 (73%), Gaps = 5/139 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   R+R+G+NWRR DIGID+PF +LP  + E F Y +LEVKLQTQYGQEPP+
Sbjct: 400 MVREDNWDG--RVRAGDNWRRTDIGIDHPFEQLPPDDKELFKYGVLEVKLQTQYGQEPPK 457

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV +LV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMD DI KP + +  +ERP
Sbjct: 458 WVADLVSSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMDTDILKPDTGSLTIERP 516

Query: 120 -SASNPTTPANERGNPFSG 137
              S+  T     G   SG
Sbjct: 517 LQTSSKGTSELSTGRESSG 535



 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 73/115 (63%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+IA+PVRVEPKV+FA ERTFL WL+F++ +G  A  LLNF    D + + +A      
Sbjct: 665 GKRIAVPVRVEPKVYFAAERTFLKWLHFAIYMGTIATTLLNFVPPRDTVGLISAGLFTLA 724

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   +++R   +RKR + G Y D+YGPT +  +LL ++  N  LR+ E
Sbjct: 725 ALVAIAYSAIIFVYRALNLRKRRAEGMYYDKYGPTVLSFLLLTALGTNIVLRMRE 779



>gi|330924130|ref|XP_003300530.1| hypothetical protein PTT_11778 [Pyrenophora teres f. teres 0-1]
 gi|311325335|gb|EFQ91384.1| hypothetical protein PTT_11778 [Pyrenophora teres f. teres 0-1]
          Length = 789

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 100/129 (77%), Gaps = 4/129 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   + RSG+NWRR DIG+D+PF +LP  + E FPYA+LEVKLQTQ G EPP+
Sbjct: 381 MTREDNLDG--KKRSGDNWRRTDIGVDWPFKQLPKEDKELFPYAVLEVKLQTQAGGEPPQ 438

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           W+++L  SHLVEAVPKFSK+IHG ATL + ++I L P+W PQMD+DIRKP ++ F +ERP
Sbjct: 439 WIRDLTSSHLVEAVPKFSKYIHGTATL-NPKRIHLIPYWYPQMDVDIRKPVTHKFGIERP 497

Query: 120 SASNPTTPA 128
            ASN  + +
Sbjct: 498 GASNDISTS 506



 Score =  119 bits (299), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 72/111 (64%), Gaps = 3/111 (2%)

Query: 199 KVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASF 258
           K PK   GK+I +PVRVEPKV  A ERTFLSWL FS+++G  A  LLNFGD +   AA  
Sbjct: 662 KAPK---GKRIHVPVRVEPKVQLATERTFLSWLEFSILIGSIAATLLNFGDSLAFAAAWA 718

Query: 259 LVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTIN 309
              +  + + Y+ G YLWRV KI++R +  Y DR+GPT +C  L  +V ++
Sbjct: 719 FTVIACIALCYSAGLYLWRVNKIKERRAVTYHDRWGPTLLCAGLFCAVAVS 769



>gi|170098797|ref|XP_001880617.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164644142|gb|EDR08392.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 871

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 78/122 (63%), Positives = 97/122 (79%), Gaps = 5/122 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDN++   R RS +NWRR D GID+PF ++P  + E F Y +LEVKLQTQ+GQ+PPE
Sbjct: 436 LVREDNWDG--RARSKDNWRRTDAGIDFPFEQVPPEDKEIFKYGVLEVKLQTQFGQQPPE 493

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFR--LER 118
           WVQELVQSHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQMD+DI KP + +   +ER
Sbjct: 494 WVQELVQSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMDVDILKPDTGYLSVIER 552

Query: 119 PS 120
           PS
Sbjct: 553 PS 554



 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIA+PVR+EPKV+FA ERTFL WLN +V +G  A  LLNF    D   + +A F  F 
Sbjct: 755 GKKIAVPVRIEPKVYFAAERTFLKWLNNAVFIGSIATTLLNFIPPDDPRGLISAWFFTFA 814

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + YA G +L+R  ++R+R + G Y D+YGPT +C +L +++  N  LR  E
Sbjct: 815 ALLSIAYAAGIFLYRSYRLRERRADGLYYDKYGPTVLCFVLFLALATNIGLRASE 869



>gi|146417590|ref|XP_001484763.1| hypothetical protein PGUG_02492 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146390236|gb|EDK38394.1| hypothetical protein PGUG_02492 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 722

 Score =  163 bits (413), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (82%), Gaps = 3/110 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+ + R  +  NWRRMDIG+DYPF +LPD ++ RFPYA+LEVKLQTQ GQEPP 
Sbjct: 385 MVREDNFDGHDR--TNGNWRRMDIGVDYPFPQLPDRDVCRFPYAVLEVKLQTQLGQEPPL 442

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP 110
           W++ELV SHLVEAVPKFSKFIHG A+L+    + L PFWLPQM++DIRKP
Sbjct: 443 WIRELVASHLVEAVPKFSKFIHGGASLLPD-YVNLLPFWLPQMEVDIRKP 491



 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 75/127 (59%), Gaps = 3/127 (2%)

Query: 190 YLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGD 249
           Y    T   K+PK   GKKI +PVR+EPKV+FANERTFLSWL+  ++LG  A  LL +G 
Sbjct: 598 YDLNQTFKNKLPK---GKKICVPVRIEPKVYFANERTFLSWLSIGMILGATATTLLTYGG 654

Query: 250 KITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTIN 309
             T+TA+       +  M+Y+   Y+WRV  IR++++  Y D++GP  IC  +  +    
Sbjct: 655 NSTITASIGFFIAALFTMIYSTYRYVWRVLMIREKKAVMYGDKFGPNMICFFIAAATFAT 714

Query: 310 FWLRLHE 316
           F  R  E
Sbjct: 715 FLFRFIE 721



>gi|392564062|gb|EIW57240.1| SPX-domain-containing protein [Trametes versicolor FP-101664 SS1]
          Length = 867

 Score =  163 bits (412), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 100/133 (75%), Gaps = 4/133 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN++   R R+G+NWRRMDIGID+PF +LP  + E F Y +LEVKLQTQ+GQEPP+
Sbjct: 430 MSREDNWDG--RTRAGDNWRRMDIGIDWPFEQLPPEDKELFKYGVLEVKLQTQFGQEPPQ 487

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV ELV SHLVEAVPKFSKFIHG ATL+ +R + L PFWLPQM++DI KP +    +ERP
Sbjct: 488 WVTELVSSHLVEAVPKFSKFIHGCATLLPNR-VDLVPFWLPQMEVDILKPDTGALIIERP 546

Query: 120 SASNPTTPANERG 132
             S+    ++  G
Sbjct: 547 LQSSSKGTSSRTG 559



 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 75/115 (65%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+IAIPVR+EPKV+FA ERTF  WL+F + +G  A  LLNF    D+  + +A    FV
Sbjct: 752 GKRIAIPVRIEPKVYFAAERTFFRWLHFGIYIGTIATTLLNFIPPDDRAGLISAWAFTFV 811

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ ++YA   +++R   +R+R + G Y DRYGPT + ++L+ ++  N  LR+ E
Sbjct: 812 ALISIVYAAVVFVYRALHLRQRRAEGMYYDRYGPTVLSVLLVGALATNIALRVRE 866



>gi|302684685|ref|XP_003032023.1| hypothetical protein SCHCODRAFT_82180 [Schizophyllum commune H4-8]
 gi|300105716|gb|EFI97120.1| hypothetical protein SCHCODRAFT_82180 [Schizophyllum commune H4-8]
          Length = 855

 Score =  162 bits (411), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 99/129 (76%), Gaps = 5/129 (3%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   ++RSG+NWRR DIGID+PF ++   + E F Y +LEVKLQTQ+GQEPP+
Sbjct: 426 MVREDNWDG--KIRSGDNWRRTDIGIDFPFPQVEPDDKEIFKYGVLEVKLQTQFGQEPPK 483

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFR--LER 118
           WV +LVQSHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMD DI KP + +   +ER
Sbjct: 484 WVTDLVQSHLVEAVPKFSKFIHGCATLLPHR-VDLVPFWLPQMDTDILKPDTGYLSVIER 542

Query: 119 PSASNPTTP 127
           P  S+  +P
Sbjct: 543 PHGSSSASP 551



 Score =  107 bits (267), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 76/115 (66%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+IA+PVR+EPKV+FA ERTFL W+N +VV+G  A  LLNF    D+  + +A      
Sbjct: 738 GKRIAVPVRIEPKVYFAAERTFLKWMNTAVVIGTIATTLLNFIPPDDRRGLISAGVFTLA 797

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+ G +++R  +IR+R + G Y D YGPT +C++LL ++  N  LR+ E
Sbjct: 798 ALLAIAYSAGIFVFRALRIRERRAEGMYYDPYGPTVLCVVLLGALGTNIGLRVAE 852



>gi|390600592|gb|EIN09987.1| SPX-domain-containing protein [Punctularia strigosozonata HHB-11173
           SS5]
          Length = 893

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 97/136 (71%), Gaps = 10/136 (7%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN++   R RSGNNWRR DIGID+PF ++   + E F Y +LEVKLQTQYGQEPP+
Sbjct: 454 MIREDNWDG--RTRSGNNWRRTDIGIDHPFDQVAPEDKELFKYGVLEVKLQTQYGQEPPQ 511

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV ELV SHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMD DI KP +    + RP
Sbjct: 512 WVLELVNSHLVEAVPKFSKFIHGCATLLPHR-VDLVPFWLPQMDTDILKPDTGALSISRP 570

Query: 120 S------ASNPTTPAN 129
           +      +S PT   N
Sbjct: 571 AVTSSQGSSEPTLGTN 586



 Score =  113 bits (282), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 78/115 (67%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIA+PVR+EPKV+FA+ERTFL WLNF+V++G  A  LLNF    D+  + +A      
Sbjct: 778 GKKIAVPVRIEPKVYFASERTFLKWLNFAVLIGTIATTLLNFIPPDDQAGLISAGLFTLA 837

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   +++R  K+R+RE+ G Y D+YGPT +C +LL ++  N  LR+ +
Sbjct: 838 ALLAIAYSAVVFVYRSIKLRRREADGLYYDKYGPTILCFVLLAALATNVGLRVAQ 892



>gi|451846559|gb|EMD59868.1| hypothetical protein COCSADRAFT_174999 [Bipolaris sorokiniana ND90Pr]
          Length = 1489

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 109/371 (29%), Positives = 168/371 (45%), Gaps = 62/371 (16%)

Query: 1    MIREDNFENNPRLRSGNNWRRMDIG---IDYPFSKLPDGEIERFPYAILEVKLQTQYGQE 57
            +IRED+ + +   R  ++W R DI    ++YPF  L  GE+ RFPYA+LE+K++   G +
Sbjct: 1093 LIREDSLDESRPCRDPDDWHRHDIDGAQMEYPFKNLKKGEVHRFPYALLEIKVK---GSQ 1149

Query: 58   PPEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLE 117
              EW+++L+ SHLV+  P+FSKF+HGVA L +   +  FPFWL ++D DIRK P     E
Sbjct: 1150 KYEWIEDLMHSHLVKESPRFSKFVHGVAKLFED-NVNTFPFWLSEVDNDIRKEPEKAFDE 1208

Query: 118  ---------------------------RPSASNPT-TPANERGNPFSGTXXXXXXXXXXX 149
                                       RPS ++P  +PA  R  P S +           
Sbjct: 1209 EQEKKRKAAEDVFAVGSLFGARASPSFRPSIASPVGSPAATRSVPKSASMAAHSQPAVRP 1268

Query: 150  XXXXXXXXXXNTPLLSESSQNTNTQLR-------STPHISSLEELEEYLATVTPAGKVPK 202
                       +        N NT +R           ++  +     LA + P+    K
Sbjct: 1269 SLPTIGSHLSQSQQDRNREANNNTNVRVEEDSDSDDDVVAGRKTQRGGLAALFPSFSTSK 1328

Query: 203  --TYHGKKIAIP---------------VRVEPKVFFANERTFLSWLNFSVVLGGFAIGLL 245
                  +KI +P               VRVE KV+ AN+RTF+ W + SV+L   ++GL 
Sbjct: 1329 YARRQQRKIQLPPGIRDPGVWIKDQGPVRVEAKVWLANQRTFIKWQHVSVLLASLSLGLY 1388

Query: 246  NF---GDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIML 302
            N    G+ I    A     V    + +  G Y++R K IR+R    ++   GP  +CI L
Sbjct: 1389 NAAGEGNDIARALAVVYTCVAAFTLAWGYGMYVYRAKLIRERSGKDFDAITGPLVVCIGL 1448

Query: 303  LISVTINFWLR 313
             +++ +NF  +
Sbjct: 1449 AVALCLNFGFK 1459



>gi|45201412|ref|NP_986982.1| AGR316Cp [Ashbya gossypii ATCC 10895]
 gi|44986346|gb|AAS54806.1| AGR316Cp [Ashbya gossypii ATCC 10895]
 gi|374110233|gb|AEY99138.1| FAGR316Cp [Ashbya gossypii FDAG1]
          Length = 713

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 97/125 (77%), Gaps = 5/125 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+F+   R  +  NWRRMDIG+D+PF +LP+ ++E FPYA+LEVKLQTQ GQEPPE
Sbjct: 382 MVREDDFDGYDR--TNGNWRRMDIGVDWPFKQLPEHDVEYFPYAVLEVKLQTQLGQEPPE 439

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP--PSNFRLER 118
           WV+ELV SHLVE VPKFSKF+HG+A L+ +R +   P+WLPQMD+DIRKP   +   + R
Sbjct: 440 WVRELVGSHLVEPVPKFSKFLHGMAALLPNR-VDSIPYWLPQMDVDIRKPVITTQINITR 498

Query: 119 PSASN 123
           P+  +
Sbjct: 499 PNCDD 503



 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 62/109 (56%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK I +PVR+EPKV+FA ERTFLSWL+  ++    +  LL +G +  +  A      ++ 
Sbjct: 604 GKTICVPVRIEPKVYFATERTFLSWLDIGLIFSAISTTLLTYGSQAAMIGAIGFFLTSIG 663

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            + Y+   Y  RV  IR R +G YED+ GP  +C ML  S+   F+  L
Sbjct: 664 TIYYSAYIYCNRVIDIRLRRAGDYEDKRGPPIVCGMLFASILFVFFCNL 712



>gi|302907604|ref|XP_003049683.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256730619|gb|EEU43970.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 745

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 108/328 (32%), Positives = 159/328 (48%), Gaps = 20/328 (6%)

Query: 2   IREDNFENNPRLRSGNNWRRMDIG---IDYPFSKLPDGEIERFPYAILEVKLQTQYGQEP 58
           IRED  + +   R  N W R+DI    + YPF K+   E+ RFPYA+LE+KL+    ++ 
Sbjct: 399 IREDTLDRDRPCRDPNEWHRLDIDDSEMTYPFKKMNQSEVNRFPYALLEIKLKEDGLRKR 458

Query: 59  PEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLE 117
           P WV++L+ SHLV A P+FSKF+HGVA L +   +   PFWL  ++ DIRK P  +F  E
Sbjct: 459 PSWVEDLMSSHLVHATPRFSKFVHGVAVLFED-YVNNLPFWLSDLEGDIRKDPQKSFEEE 517

Query: 118 RPSASNPTTPANERGNPF-SGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLR 176
               +         G+   +G                      N    S S Q    Q R
Sbjct: 518 EQRRAQRHEDVMAVGSLIGAGAKSGSYKPTQSSPVSKVANGEENGE--SSSRQQEEQQER 575

Query: 177 STPHISSL---------EELEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTF 227
           S   +SS+            +       P G V  T    K A  ++VEPKV+ ANERTF
Sbjct: 576 SYGTLSSVIPGFSLSKYSRAKRASQQALPEGVVAPT-EWIKNAGELKVEPKVWLANERTF 634

Query: 228 LSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKK--IRKRE 285
           L W +  ++ GG A+GL     K TV +   LV+V + V   A G  + RV++  I +R 
Sbjct: 635 LKWQHICILQGGLAVGLYTAAGKDTVASIMGLVYVLIAVFAGAWGYGMLRVRRTMILERS 694

Query: 286 SGPYEDRYGPTFICIMLLISVTINFWLR 313
              +++  GP  I + L+ ++ +NF+ +
Sbjct: 695 GKDFDNMIGPMIISVSLMAALILNFFFQ 722



>gi|409048965|gb|EKM58443.1| hypothetical protein PHACADRAFT_252767 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 869

 Score =  160 bits (406), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 103/140 (73%), Gaps = 6/140 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+RED+++   + RSG+NWR   IG+D+PF +LP G+ E F Y +LEVKLQTQYGQEPP 
Sbjct: 432 MVREDDWDG--KTRSGDNWRWTGIGVDWPFEQLPPGDKELFKYGVLEVKLQTQYGQEPPP 489

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRLERP 119
           WV +LV SHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMD+DI KP +   ++ERP
Sbjct: 490 WVTDLVSSHLVEAVPKFSKFIHGCATLLPER-VDLVPFWLPQMDVDILKPDTGALQIERP 548

Query: 120 --SASNPTTPANERGNPFSG 137
             S+S  T+ +  + +  SG
Sbjct: 549 LHSSSRGTSGSERQASGSSG 568



 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 73/115 (63%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIA+PVR+EPKV+FA ERTFL WL+F++ +G  A  LLNF    D   + +A+   F 
Sbjct: 753 GKKIAVPVRIEPKVYFATERTFLKWLHFAIYIGTIATTLLNFIKPEDTAGLISAALFTFA 812

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            +  + Y+   +++R   IR R + G Y D+YGPT + ++L+ ++  N  LRL +
Sbjct: 813 ALAAIAYSAIIFVYRAYSIRNRHAEGMYYDKYGPTVLSLLLVAAIGANIGLRLRD 867



>gi|471567672|gb|EMR67571.1| putative vacuolar transporter chaperone 4 protein [Eutypa lata
           UCREL1]
          Length = 788

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (80%), Gaps = 3/113 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN +   R  SG+NWRRMDIGID+PFS+L   ++ RFPYA+LEVKLQTQ GQE PE
Sbjct: 408 MVREDNSDGVKR--SGDNWRRMDIGIDWPFSQLSAQDVVRFPYAVLEVKLQTQQGQEAPE 465

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN 113
           WV++L+ SHLVEAVPKFSKFIHG ATL   R I L P+W+PQMD+DIRK  ++
Sbjct: 466 WVRQLISSHLVEAVPKFSKFIHGTATLFPHR-INLVPYWMPQMDVDIRKEATH 517



 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 67/105 (63%), Gaps = 3/105 (2%)

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG---DKITVTAASFLVFVTMM 265
           I +PVRVEPKV+FA ERTFL WL FS+ +G  A+ LLNFG    K++   A     + ++
Sbjct: 674 IYVPVRVEPKVYFAGERTFLGWLEFSIYIGTIAVTLLNFGTKPTKLSFAVAGVFTLLAIV 733

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINF 310
            + Y++G YL+R + IR+R    Y DR GP+ +CI L   V +NF
Sbjct: 734 SLCYSVGIYLYRSRSIRERRVIKYYDRIGPSALCITLFFGVVLNF 778



>gi|443920063|gb|ELU40058.1| vacuolar transporter chaperone 4 [Rhizoctonia solani AG-1 IA]
          Length = 1009

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 8/135 (5%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++    +RSG+NWRR D GID+PF  +PD + E F Y +LEVKLQTQ GQEPP+
Sbjct: 604 MVREDNWDGE--VRSGDNWRRPDAGIDFPFPNVPDRDKEIFKYGVLEVKLQTQLGQEPPQ 661

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++LV SHLVE+VPKFSKFIHG ATL+ +R + L PFWLPQM+ DIRKP + N  + RP
Sbjct: 662 WVRDLVSSHLVESVPKFSKFIHGCATLLPNR-VDLVPFWLPQMEADIRKPDTGNVAIGRP 720

Query: 120 --SASNPT--TPANE 130
             +A++P   TPA+E
Sbjct: 721 ISAATSPESHTPASE 735



 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 76/115 (66%), Gaps = 4/115 (3%)

Query: 206  GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
            GKKIA+PVRVEPKV+FANERTFL WL F+V++G  A  LLNF   GD +   +A    F 
Sbjct: 892  GKKIAVPVRVEPKVYFANERTFLKWLQFAVMIGTVATTLLNFSKPGDNVAFYSAICFTFA 951

Query: 263  TMMVMLYALGTYLWRVKKIRKRE-SGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            +++ + YA   ++ R  K+R RE S  Y DRYGPT + ++LL S+  N  +R+ E
Sbjct: 952  SLLAIAYAGVIFVIRALKLRTREVSEWYYDRYGPTVLSVVLLASIAANLGMRISE 1006



>gi|409077716|gb|EKM78081.1| hypothetical protein AGABI1DRAFT_61056 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 867

 Score =  160 bits (404), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 74/122 (60%), Positives = 96/122 (78%), Gaps = 5/122 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   ++R+G+NWRR D+GIDYPF ++   + E F Y +LEVKLQTQ+GQ+PP 
Sbjct: 441 MVREDNWDG--KVRAGDNWRRTDLGIDYPFDQVAAEDKEIFKYGVLEVKLQTQFGQQPPT 498

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFR--LER 118
           WV +LVQSHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMD+DI KP + +   +ER
Sbjct: 499 WVTDLVQSHLVEAVPKFSKFIHGCATLLPHR-VDLVPFWLPQMDVDILKPDTGYLSVIER 557

Query: 119 PS 120
           P+
Sbjct: 558 PN 559



 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+I++PVR+EPKV+FA ERTFL WLN SV +G  A  LLNF    D   +   +F  F 
Sbjct: 752 GKRISVPVRIEPKVYFALERTFLKWLNTSVFIGTIATTLLNFISAEDTRGLIITAFFTFA 811

Query: 263 TMMVMLYALGTYLWRVKKIR-KRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+ G +L+R  +IR +R +G Y D+YGPT +C +L +++  N  LR+ E
Sbjct: 812 ALLAIAYSAGIFLFRTYRIRERRATGMYYDKYGPTILCGVLFLALATNVGLRVSE 866



>gi|320581568|gb|EFW95788.1| hypothetical protein HPODL_2641 [Ogataea parapolymorpha DL-1]
          Length = 932

 Score =  160 bits (404), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (77%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+IA+P RVEPKVFFANERTFLSWLNF+VVLG  AIGLLNFGDK+   +AS    + M 
Sbjct: 822 GKRIALPTRVEPKVFFANERTFLSWLNFTVVLGSLAIGLLNFGDKVGRISASLFTLIAMG 881

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            M+YAL TY WR   IR+R SGPY+DR+GPT +C  LLI+V +NF LR+
Sbjct: 882 TMIYALVTYHWRAAAIRRRGSGPYDDRFGPTMLCFFLLIAVIVNFALRI 930



>gi|501752508|emb|CCG83546.1| Vacuolar transporter chaperone 1 [Taphrina deformans PYCC 5710]
          Length = 122

 Score =  160 bits (404), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 73/111 (65%), Positives = 87/111 (78%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+IA+PVRVEPKVFFANERTFLSWLNF+V+LGG A+GLLNFGDK+   +A     V MM
Sbjct: 12  GKRIALPVRVEPKVFFANERTFLSWLNFTVILGGLAVGLLNFGDKVGRISAGLFTVVAMM 71

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            M+YAL TY WR   IRKR SGPY+DR+GPT +CI LL +V  NF LR+ +
Sbjct: 72  TMIYALVTYHWRANAIRKRGSGPYDDRFGPTMLCIFLLAAVVTNFALRVFK 122



>gi|512198296|gb|EPE27131.1| hypothetical protein GLAREA_03045 [Glarea lozoyensis ATCC 20868]
          Length = 784

 Score =  159 bits (403), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 99/343 (28%), Positives = 164/343 (47%), Gaps = 35/343 (10%)

Query: 2   IREDNFENNPRLRSGNNWRRMDI---GIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEP 58
           IRED  + N   R+ NNW R+DI    ++YPFS +  GE+ +FPYA+LE+K++    ++ 
Sbjct: 390 IREDAIDANRPCRAPNNWHRLDIDNSAMEYPFSNINQGELSKFPYALLEIKVKEDGIKKH 449

Query: 59  PEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLE 117
           P+WV +L+ SHLV   P+FSKF+HGVATL +   +   PFWL +++ DIRK P + F  E
Sbjct: 450 PQWVDDLMSSHLVHKAPRFSKFVHGVATLFED-NVNNLPFWLSEVETDIRKDPQAAFEAE 508

Query: 118 RPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRS 177
               +         G+    +                          + + + +N   +S
Sbjct: 509 EERKARRAADEQVVGSFLGTSRPSASYKAAVSSPMAKSYMQERMAAEASAGRRSNFTGKS 568

Query: 178 TPHISSLEELE----------EYLATVTPAGKVPKTYHGK------------------KI 209
               ++ E+ E            L++V P+  + +    +                  K 
Sbjct: 569 KSQNAATEDNEGETSNRNGGYGTLSSVFPSFSLSRYAQARREKTVQLPPGVLKPTQLIKD 628

Query: 210 AIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLY 269
           + P++VEPKV+ ANERT+L W +   +LG FAI L N G   +V  A  + ++ + V   
Sbjct: 629 SGPLKVEPKVWLANERTYLKWQHICFLLGSFAIVLSNTGSHDSVRLAMGITYLVVSVFAA 688

Query: 270 ALGTYLWRVKK--IRKRESGPYEDRYGPTFICIMLLISVTINF 310
             G Y+ R ++  I  R    +++  GP  +   L+I++ +NF
Sbjct: 689 GWGYYMHRTRREMIVARSGKDFDNLIGPMIVSFALIIALILNF 731



>gi|501753635|emb|CCG82780.1| SPX domain protein [Taphrina deformans PYCC 5710]
          Length = 751

 Score =  159 bits (403), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 163/350 (46%), Gaps = 37/350 (10%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDI---GIDYPFSKLPDGEIERFPYAILEVKLQTQYGQE 57
           +IRED  +     R   NW R DI   G  YP+  +  GEI R P+ +LE+KL  + GQ 
Sbjct: 384 LIREDCLDQERPCRDPENWHRHDIDEQGQVYPYKAINKGEINRLPFGLLEIKLTRKTGQT 443

Query: 58  PPEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLE 117
            P W++EL  SHLV+  P+FSKF HGVA+L ++  + L PFWLP  D DIR+ P     +
Sbjct: 444 EPSWIEELSSSHLVKPSPRFSKFAHGVASLFEN-HVNLLPFWLPDADKDIRRDPKTAYDK 502

Query: 118 RPSASNPTTP-------------------ANERGNPFSGTXXXXXXXXXXXXXXXXXXXX 158
               S  + P                   A++      G                     
Sbjct: 503 NDPESGSSYPPKMVFTPTGKSLESSNLEEASKNAKRNGGKNRASKDGPSSKITRTGQDES 562

Query: 159 XNTPLLSESSQNTN--------TQLRSTPHI--SSLEELEEYLATVTPAGKVPKTYHGKK 208
            N+  +  SS +TN         ++RS   +   S     ++  +  P G V K     K
Sbjct: 563 MNSAGIEISSSSTNGNRSYGTVNKMRSFGQVLLGSNSNQTDFDVSKLPPG-VRKPGRLIK 621

Query: 209 IAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKIT--VTAASFLVFVTMMV 266
            + PV+VE KV+ ANERTF+ W++ + +L   ++GL N     +  V  A + V +++++
Sbjct: 622 DSGPVKVETKVWLANERTFIKWMHVAFLLTTVSLGLYNGATSTSGRVLGAVYAV-ISVLM 680

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            L+    Y  R   IR R    ++   GP F+C  L++S+ +NF  +LHE
Sbjct: 681 ALWGYFIYTKRANMIRARSPEHFDSFLGPIFVCFALMVSLIVNFVWKLHE 730



>gi|511005431|gb|EPB86773.1| vacuolar transporter chaperone 1 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 125

 Score =  159 bits (403), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 74/109 (67%), Positives = 87/109 (79%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+IA+PVRVEPKVFFANERTFLSWLNF+VVLGG AIGLLNFGD+I+  +A       M 
Sbjct: 11  GKRIALPVRVEPKVFFANERTFLSWLNFTVVLGGLAIGLLNFGDRISRLSAMLFTVTAMF 70

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           VMLYAL T+ WR  KIR RE+ PY+DR GPT +CI L+I+V  NF+LRL
Sbjct: 71  VMLYALYTFHWRATKIRNREAAPYDDRVGPTVLCIFLIIAVAFNFYLRL 119



>gi|426199054|gb|EKV48979.1| hypothetical protein AGABI2DRAFT_200998 [Agaricus bisporus var.
           bisporus H97]
          Length = 867

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 74/122 (60%), Positives = 95/122 (77%), Gaps = 5/122 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   ++R+G NWRR D+GIDYPF ++   + E F Y +LEVKLQTQ+GQ+PP 
Sbjct: 441 MVREDNWDG--KVRAGENWRRTDLGIDYPFDQVAAEDKEIFKYGVLEVKLQTQFGQQPPT 498

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFR--LER 118
           WV +LVQSHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMD+DI KP + +   +ER
Sbjct: 499 WVTDLVQSHLVEAVPKFSKFIHGCATLLPHR-VDLVPFWLPQMDVDILKPDTGYLSVIER 557

Query: 119 PS 120
           P+
Sbjct: 558 PN 559



 Score =  107 bits (268), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+I++PVR+EPKV+FA ERTFL WLN SV +G  A  LLNF    D   +   +F  F 
Sbjct: 752 GKRISVPVRIEPKVYFALERTFLKWLNTSVFIGTIATTLLNFISAEDTRGLIITAFFTFA 811

Query: 263 TMMVMLYALGTYLWRVKKIR-KRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+ G +L+R  +IR +R +G Y D+YGPT +C +L +++  N  LR+ E
Sbjct: 812 ALLAIAYSAGIFLFRTYRIRERRATGMYYDKYGPTILCGVLFLALATNVGLRVSE 866



>gi|511000708|gb|EPB82227.1| vacuolar transporter chaperone 1 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 123

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (78%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+IA+PVRVEPKVFFANERTFLSWLNF+VVLGG A+GLLNFGD+I   +A     + M 
Sbjct: 11  GKRIALPVRVEPKVFFANERTFLSWLNFTVVLGGLAMGLLNFGDRIGRMSAVLFTVIAMG 70

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
           VMLYAL T+ WR  KIR RE+ PY+DR GPT +CI LL +V INF+LR+  K
Sbjct: 71  VMLYALYTFHWRATKIRNREAAPYDDRVGPTVLCIFLLAAVCINFYLRMGSK 122



>gi|361128656|gb|EHL00586.1| putative Vacuolar transporter chaperone 2 [Glarea lozoyensis 74030]
          Length = 745

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 99/343 (28%), Positives = 164/343 (47%), Gaps = 35/343 (10%)

Query: 2   IREDNFENNPRLRSGNNWRRMDI---GIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEP 58
           IRED  + N   R+ NNW R+DI    ++YPFS +  GE+ +FPYA+LE+K++    ++ 
Sbjct: 351 IREDAIDANRPCRAPNNWHRLDIDNSAMEYPFSNINQGELSKFPYALLEIKVKEDGIKKH 410

Query: 59  PEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLE 117
           P+WV +L+ SHLV   P+FSKF+HGVATL +   +   PFWL +++ DIRK P + F  E
Sbjct: 411 PQWVDDLMSSHLVHKAPRFSKFVHGVATLFED-NVNNLPFWLSEVETDIRKDPQAAFEAE 469

Query: 118 RPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRS 177
               +         G+    +                          + + + +N   +S
Sbjct: 470 EERKARRAADEQVVGSFLGTSRPSASYKAAVSSPMAKSYMQERMAAEASAGRRSNFTGKS 529

Query: 178 TPHISSLEELE----------EYLATVTPAGKVPKTYHGK------------------KI 209
               ++ E+ E            L++V P+  + +    +                  K 
Sbjct: 530 KSQNAATEDNEGETSNRNGGYGTLSSVFPSFSLSRYAQARREKTVQLPPGVLKPTQLIKD 589

Query: 210 AIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLY 269
           + P++VEPKV+ ANERT+L W +   +LG FAI L N G   +V  A  + ++ + V   
Sbjct: 590 SGPLKVEPKVWLANERTYLKWQHICFLLGSFAIVLSNTGSHDSVRLAMGITYLVVSVFAA 649

Query: 270 ALGTYLWRVKK--IRKRESGPYEDRYGPTFICIMLLISVTINF 310
             G Y+ R ++  I  R    +++  GP  +   L+I++ +NF
Sbjct: 650 GWGYYMHRTRREMIVARSGKDFDNLIGPMIVSFALIIALILNF 692



>gi|169613048|ref|XP_001799941.1| hypothetical protein SNOG_09652 [Phaeosphaeria nodorum SN15]
 gi|160702638|gb|EAT82917.2| hypothetical protein SNOG_09652 [Phaeosphaeria nodorum SN15]
          Length = 799

 Score =  159 bits (402), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 73/113 (64%), Positives = 91/113 (80%), Gaps = 3/113 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M REDN +   + R+G+NWRRMDIG+D+PF +LP  + E FPYA+LEVKLQTQ GQ+PP+
Sbjct: 421 MTREDNLDG--KKRAGDNWRRMDIGVDWPFKQLPAEDKELFPYAVLEVKLQTQAGQDPPQ 478

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN 113
           W++EL  SHLVEAVPKFSK+IHG ATL  +R I L P+W PQMD+DIRKP S+
Sbjct: 479 WIRELTSSHLVEAVPKFSKYIHGTATLNPTR-IHLIPYWYPQMDVDIRKPVSH 530



 Score =  123 bits (308), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 80/124 (64%), Gaps = 2/124 (1%)

Query: 193 TVTPAGKVP--KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDK 250
           T   AG+V   K   GK+I +PVRVEPKV  A ERTFLSWL FS+++G  A  LLNFGD 
Sbjct: 657 TWKQAGEVKRFKAPKGKRIHVPVRVEPKVQLATERTFLSWLEFSILIGSIAATLLNFGDT 716

Query: 251 ITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINF 310
           ++  AA     +  + ++Y+   YLWRV+KIR+R +  Y D++GPT +CI L  +V ++F
Sbjct: 717 LSFAAAWAFTIIACVALIYSASLYLWRVRKIRERRAVVYHDKWGPTLLCIGLFAAVAVSF 776

Query: 311 WLRL 314
             R 
Sbjct: 777 GYRF 780



>gi|299749903|ref|XP_001836415.2| vacuolar transporter chaperone 4 [Coprinopsis cinerea okayama7#130]
 gi|298408650|gb|EAU85368.2| vacuolar transporter chaperone 4 [Coprinopsis cinerea okayama7#130]
          Length = 850

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 97/122 (79%), Gaps = 5/122 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN++   R+R+G+NWRR DIGID+PF ++   + E F Y +LEVKLQTQ GQ+PP+
Sbjct: 419 LIREDNWDG--RVRAGDNWRRTDIGIDFPFDQVLPEDKEIFKYGVLEVKLQTQLGQQPPD 476

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFR--LER 118
           W+Q+LVQSHLVEAVPKFSKFIHG +TL+ +R + L PFWLPQMD DI KP + +   +ER
Sbjct: 477 WIQDLVQSHLVEAVPKFSKFIHGCSTLLPNR-VDLVPFWLPQMDTDILKPDTGYLSVIER 535

Query: 119 PS 120
           PS
Sbjct: 536 PS 537



 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 75/112 (66%), Gaps = 4/112 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIA+PVR+EPKV+FA ERTFL WLN +V +G  A  LLNF    D   + +A+F  F 
Sbjct: 735 GKKIAVPVRIEPKVYFAAERTFLKWLNNAVFIGTIATTLLNFIPASDTRGLISAAFFTFC 794

Query: 263 TMMVMLYALGTYLWRVKKIRKRE-SGPYEDRYGPTFICIMLLISVTINFWLR 313
            ++ + Y+ G +L+R  ++R+R  SG Y D+YGPT +C++  +++  N  LR
Sbjct: 795 ALLAIAYSAGIFLYRSYRLRERSASGLYYDKYGPTVLCLVFFLALATNIGLR 846



>gi|388581319|gb|EIM21628.1| hypothetical protein WALSEDRAFT_60353 [Wallemia sebi CBS 633.66]
          Length = 127

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+PVRVEPKVFFANERTFLSWL+F+V+LGG AIGLLNFGDK+   +A    FV M++
Sbjct: 13  KRIALPVRVEPKVFFANERTFLSWLHFAVILGGLAIGLLNFGDKVGKISAGMFSFVAMLI 72

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR   IRKR +GPY+DR GPT +CI LL +V INF+LR  +
Sbjct: 73  MVYALVTYHWRASAIRKRGTGPYDDRLGPTILCICLLSAVLINFYLRFAQ 122



>gi|358056568|dbj|GAA97537.1| hypothetical protein E5Q_04215 [Mixia osmundae IAM 14324]
          Length = 147

 Score =  158 bits (400), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/136 (56%), Positives = 93/136 (68%), Gaps = 2/136 (1%)

Query: 180 HISSLEELEEYLATVTPAGKVP--KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVL 237
           H+  +  L +  A+V      P  +    K+IA+PVRVEPKVFFANERTFLSWLNF+VVL
Sbjct: 9   HLLLVVSLSDAQASVVSMSTQPLLQRTQNKRIALPVRVEPKVFFANERTFLSWLNFTVVL 68

Query: 238 GGFAIGLLNFGDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTF 297
           GG AIGLLNFGDK+   +A     V M VM YAL TY WR   IR+R SGPY+DR GPT 
Sbjct: 69  GGLAIGLLNFGDKVGQISAGLFTIVAMAVMCYALVTYHWRASAIRRRGSGPYDDRLGPTV 128

Query: 298 ICIMLLISVTINFWLR 313
           +C+ LL +V +NF LR
Sbjct: 129 LCVALLAAVIVNFVLR 144



>gi|471877938|emb|CCO35307.1| Vacuolar transporter chaperone 4 [Rhizoctonia solani AG-1 IB]
          Length = 519

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 104/135 (77%), Gaps = 8/135 (5%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++    +RSG+NWRR D GID+PF  +P+ + E F Y +LEVKLQTQ GQEPP+
Sbjct: 112 MVREDNWDGE--VRSGDNWRRPDAGIDFPFPNVPERDKEIFKYGVLEVKLQTQLGQEPPQ 169

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++LV SHLVE+VPKFSKFIHG ATL+ +R + L PFWLPQM+ DIRKP + N  + RP
Sbjct: 170 WVRDLVSSHLVESVPKFSKFIHGCATLLPNR-VDLVPFWLPQMEADIRKPDTGNVAIGRP 228

Query: 120 --SASNPT--TPANE 130
             +A++P   TPA+E
Sbjct: 229 ISAATSPESHTPASE 243



 Score =  112 bits (279), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 76/115 (66%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIA+PVRVEPKV+FANERTFL WL F+V++G  A  LLNF   GD +   +A    F 
Sbjct: 402 GKKIAVPVRVEPKVYFANERTFLKWLQFAVMIGTVATTLLNFSKPGDNVAFYSAICFTFA 461

Query: 263 TMMVMLYALGTYLWRVKKIRKRE-SGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           +++ + YA   ++ R  K+R RE S  Y DRYGPT + ++LL S+  N  +R+ E
Sbjct: 462 SLLAIAYAGVIFVIRALKLRTREVSEWYYDRYGPTVLSVVLLASIAANLGMRIAE 516



>gi|511007570|gb|EPB88856.1| hypothetical protein HMPREF1544_04365 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 736

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 167/354 (47%), Gaps = 62/354 (17%)

Query: 2   IREDN--FENNPRLRS-GNNWRRMDIGIDYPFSKLP-DGEIERFPYAILEVKLQTQYGQE 57
           +RED+  F N P +R    +WRR D  I++PF+ L  D E+ R+PYA  E+KL     + 
Sbjct: 393 MREDSGLFPNEPVVRRPKGDWRRPDADINFPFNNLKKDVEVNRYPYATFEIKLDLAPSEN 452

Query: 58  PPEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLE 117
            P+W+ +L  S L+E   +FSKF+HG+A + ++R +PL P+WL Q+D D RK       +
Sbjct: 453 EPKWITDLQDSGLLEEAYQFSKFVHGMAIMFENR-VPLLPYWLAQID-DDRKLLPILPSQ 510

Query: 118 RPSASNPTTPANERGNPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTN----- 172
            PS S    PA                                T LLS   Q +N     
Sbjct: 511 APSVS-VKKPAK------------------LQQQNQHQHVNEETSLLSGRQQTSNYLGVP 551

Query: 173 TQLRSTPHISSLEE-----------LEEYLATVTPAGKVPKTYHGKK------------- 208
           + + +TP + + EE            +++       G+  + + G               
Sbjct: 552 STISTTPSLGAEEEEPSIAQNHDNIWQKFAQFPDQFGRFLRGHRGDDHQQGQVEEEFVLP 611

Query: 209 --IAIPVRV------EPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLV 260
             + IP +V      EPKVFFANERT+ SW+ F  +L  F++ L N GD +   +     
Sbjct: 612 PGVKIPKKVVTPIKVEPKVFFANERTYFSWMKFGTILSTFSLALFNTGDAVGKLSGILYT 671

Query: 261 FVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            + +  ++Y +G Y  R + IR R +GPY++  GPT IC  L+ +V +N +L+ 
Sbjct: 672 LIALSTLIYGVGLYYRRRELIRARLAGPYDEMIGPTVICFALMAAVGVNAYLKF 725



>gi|501750622|emb|CCG84758.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 729

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/130 (56%), Positives = 98/130 (75%), Gaps = 3/130 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++RED+F+   + R+G NWRRMDIG+D+PF ++ D E E FPYA+LEVKLQT  GQE P 
Sbjct: 376 LVREDDFDGR-QDRAGKNWRRMDIGVDWPFKQIADTEKELFPYAVLEVKLQTAMGQEAPM 434

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPS-NFRLERP 119
           WV++LV SHLVEAVPKFSKFIHGVA L+   ++ + P+W PQM +DIRKP + NF +ERP
Sbjct: 435 WVRDLVSSHLVEAVPKFSKFIHGVAKLV-PEKVSVVPYWYPQMHVDIRKPVTKNFGIERP 493

Query: 120 SASNPTTPAN 129
           +     T ++
Sbjct: 494 ANMQSGTTSD 503



 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG-DKITVTAASFLVFVTM 264
           GK+IA+PVR+EPK +FA ERTFLS++ F++++G  A  LLNFG D +T++AA   +   +
Sbjct: 617 GKRIAVPVRIEPKTYFALERTFLSYMEFAILIGTIAGALLNFGKDWVTISAAWSFMSAAI 676

Query: 265 MVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
           +++ Y+LG Y+WR   IR R +  Y+DR+GP+  C +L IS  IN  L    K
Sbjct: 677 LILFYSLGMYIWRSYNIRLRRAVQYDDRFGPSAACGVLFISFAINAALHFAYK 729



>gi|300707392|ref|XP_002995906.1| hypothetical protein NCER_101084 [Nosema ceranae BRL01]
 gi|239605143|gb|EEQ82235.1| hypothetical protein NCER_101084 [Nosema ceranae BRL01]
          Length = 578

 Score =  157 bits (396), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 139/292 (47%), Gaps = 65/292 (22%)

Query: 13  LRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPEWVQELVQSHLVE 72
           +   +NWRR++I        LP  EI RFPY ILEVK Q    +  P+W+ ++    LVE
Sbjct: 335 IDKNDNWRRINIKY------LPKEEIVRFPYGILEVKTQC-IEENKPDWIIDMTTGSLVE 387

Query: 73  AVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPSASNPTTPANERG 132
            V KFSK++HG+A L  +  I   P+WLPQM   I K                       
Sbjct: 388 HVHKFSKYLHGMAVLYPN--ITEIPYWLPQMATKILK----------------------- 422

Query: 133 NPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLA 192
           +PF                        N  L+    ++ ++ + S           EYL+
Sbjct: 423 DPFENKSSYKEFDN-------------NQVLIDILPEDKDSLVDS-----------EYLS 458

Query: 193 TVTPAGKVPKTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKIT 252
           T     K        KI+IPVRVEPKVFFANERTFLSW+ F++ LGG    LL    +  
Sbjct: 459 TFDTTNK--------KISIPVRVEPKVFFANERTFLSWVQFAIFLGGIGTALLGMERERA 510

Query: 253 VTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYG-PTFICIMLL 303
           +     L+ V+++   YAL  YLWR   IR+RESGPY+D YG P  +C+ L 
Sbjct: 511 LLGGITLIGVSIVFAFYALYLYLWRAGMIRRRESGPYDDIYGPPILVCVFLF 562



>gi|384491577|gb|EIE82773.1| hypothetical protein RO3G_07478 [Rhizopus delemar RA 99-880]
          Length = 666

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 139/290 (47%), Gaps = 24/290 (8%)

Query: 2   IREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPEW 61
           IRED+ +N  R +S  +WRR D+ +DYPF K+ + ++ RFPYA+L++KLQT   Q  PEW
Sbjct: 367 IREDHMDNLIRRQSSPSWRRSDVDVDYPFDKIQEQDVLRFPYAVLKMKLQTDSNQW-PEW 425

Query: 62  VQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLERPS 120
           +  L++ HL+  VP+FSK++H  +     + I L P WL ++D+DIRKP   N  L RP 
Sbjct: 426 LSALIECHLIHEVPRFSKYLHAASCFYREKLI-LLPSWLSELDVDIRKPKRKNCGLVRPE 484

Query: 121 ASNPTTPANERG-NPFSGTXXXXXXXXXXXXXXXXXXXXXNTPLLSESSQNTNTQLR--- 176
              P      +   P                         NT      + N   Q +   
Sbjct: 485 NVKPLIDGKYKACKPRKKDKEHNPTKKTPDLSSGPATAVNNTSPTPTVTANMTKQQKKLA 544

Query: 177 ---------------STPHISSLEELEEYLATVTPAGKVPKTYHGKKIAIPVRVEPKVFF 221
                          ST +++ L++           G+V      KK  + VR EPKVFF
Sbjct: 545 LGLPAKKKDIKEPSSSTENLTFLDKCFAKRNQDIELGRVESKV--KKAKLKVRAEPKVFF 602

Query: 222 ANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYAL 271
           ANERTF+SWL F  +L   A+ L NFGD ++       + +   + +YAL
Sbjct: 603 ANERTFISWLQFCALLLTVALNLFNFGDVVSRIIGGIFITLAASISIYAL 652



>gi|405120108|gb|AFR94879.1| vacuolar transporter chaperone 4 [Cryptococcus neoformans var.
           grubii H99]
          Length = 864

 Score =  156 bits (394), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 99/138 (71%), Gaps = 7/138 (5%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRRMD+GI++PF  +P+ E E FPY +LEVKL T+ G+EPP+
Sbjct: 440 MVREDNFDGVDR--THGNWRRMDLGINHPFDSIPNSEKELFPYGVLEVKLATKVGEEPPQ 497

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP---PSNFRLE 117
           W+++L+ SHLVEAVPKFSKFIHG A+L+  R + L PFWLPQMD DIRKP    S   +E
Sbjct: 498 WIRDLINSHLVEAVPKFSKFIHGCASLLPER-VDLVPFWLPQMDQDIRKPVTAKSKILIE 556

Query: 118 RPSASNPTTPANERGNPF 135
           RP  SN  + A+  G+  
Sbjct: 557 RPQ-SNIHSNASMEGSAL 573



 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 78/114 (68%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIAIPVRVEPKV FA ERTFL W +F+++L   +IGLLNF    D + + +A    F 
Sbjct: 750 GKKIAIPVRVEPKVVFAAERTFLKWAHFAILLSAVSIGLLNFIDPTDAVGMVSAGCFTFT 809

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           ++  +LY  G Y WR++K+RKRE+  Y DR+GPT +C  LL SV +N  LRL +
Sbjct: 810 SLSAILYCGGMYAWRIRKMRKREAVDYHDRWGPTALCAALLASVMVNLVLRLRQ 863



>gi|210075365|ref|XP_501265.2| YALI0B23408p [Yarrowia lipolytica]
 gi|199425210|emb|CAG83518.2| YALI0B23408p [Yarrowia lipolytica CLIB122]
          Length = 122

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (76%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+IA+P RVEPKVFFANERTFLSWLNF+V+LGG A+GLLNFGD++   +A     V M 
Sbjct: 12  GKRIALPTRVEPKVFFANERTFLSWLNFTVILGGLAVGLLNFGDRVGRISAGMFTLVAMA 71

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            M YAL TY WR   IRKR SGPY+DR+GPT +CI LL +V +NF LR+ +
Sbjct: 72  TMGYALVTYHWRAAAIRKRGSGPYDDRFGPTMLCIFLLAAVVVNFVLRMAQ 122



>gi|260950393|ref|XP_002619493.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238847065|gb|EEQ36529.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 114

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 68/112 (60%), Positives = 86/112 (76%)

Query: 205 HGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTM 264
           H K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD+I   +A    F+ M
Sbjct: 3   HNKRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDQIGRVSAGLFTFIAM 62

Query: 265 MVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           + M+YAL TY WR K IR R SGPY+DR+GPT +C+ LL++V +NF LR+  
Sbjct: 63  LTMVYALVTYHWRAKAIRLRGSGPYDDRFGPTMLCVFLLVAVVVNFVLRIRA 114



>gi|254573194|ref|XP_002493706.1| Vacuolar transporter chaperon (VTC) involved in distributing
           V-ATPase and other membrane proteins [Komagataella
           pastoris GS115]
 gi|238033505|emb|CAY71527.1| Vacuolar transporter chaperon (VTC) involved in distributing
           V-ATPase and other membrane proteins [Komagataella
           pastoris GS115]
          Length = 122

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 85/111 (76%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGDKI   +A    F+ M 
Sbjct: 12  GKRIALPTRVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDKIGRISAGLFTFIAMG 71

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            MLYAL TY WR   IR+R SGPY+DR+GPT +C+ LLI++ +NF LR+  
Sbjct: 72  TMLYALITYHWRASAIRRRGSGPYDDRFGPTMLCLFLLIAIVVNFTLRIRS 122



>gi|402224825|gb|EJU04887.1| SPX-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 863

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 74/138 (53%), Positives = 97/138 (70%), Gaps = 3/138 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           MIREDN++   + R+G+NWRR D+GID+PF+++   +IERFPY +LEVKLQTQ GQEPP+
Sbjct: 410 MIREDNWDG--KSRAGDNWRRTDMGIDWPFNQVAKEDIERFPYGVLEVKLQTQVGQEPPQ 467

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPS 120
           WV++LV S +VE+VPKFSKFIHG ATL+ +R + L P+WLPQM + I + P   R     
Sbjct: 468 WVRDLVGSEMVESVPKFSKFIHGCATLLPNR-VDLVPYWLPQMGVKINEKPRTRRATTLR 526

Query: 121 ASNPTTPANERGNPFSGT 138
              P  P   R    SGT
Sbjct: 527 FDRPHVPPGSRSETTSGT 544



 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 15/136 (11%)

Query: 196 PAGKVPKTYH-----------GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGL 244
           PA KVP+ Y            G KIAIPVRVEPKV+FANERTFL W  F++++   A  L
Sbjct: 726 PASKVPQNYGTTYVTDIRAPPGHKIAIPVRVEPKVYFANERTFLKWQGFAILISAIATAL 785

Query: 245 LNF--GDKIT-VTAASFLVFVTMMVMLYALGTYLWRVKKIRKRE-SGPYEDRYGPTFICI 300
           LNF   D IT + +A       +  + Y+   Y+WR  K+++ E S  Y D+YGPT +C 
Sbjct: 786 LNFVPADDITGIISAGAFTAAALTAIAYSALLYVWRSIKLQRGEASSVYYDKYGPTVLCC 845

Query: 301 MLLISVTINFWLRLHE 316
           +LL +  +N  LRL E
Sbjct: 846 VLLAATLMNIGLRLRE 861



>gi|328354468|emb|CCA40865.1| Vacuolar transporter chaperone 1 [Komagataella pastoris CBS 7435]
          Length = 254

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 84/109 (77%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGDKI   +A    F+ M  
Sbjct: 145 KRIALPTRVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDKIGRISAGLFTFIAMGT 204

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLH 315
           MLYAL TY WR   IR+R SGPY+DR+GPT +C+ LLI++ +NF LR+ 
Sbjct: 205 MLYALITYHWRASAIRRRGSGPYDDRFGPTMLCLFLLIAIVVNFTLRIR 253



>gi|505756844|gb|EOR00985.1| Vacuolar transporter chaperone 1 [Wallemia ichthyophaga EXF-994]
          Length = 127

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 86/107 (80%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+PVRVEPKVFFANERTFLSWL+F+V+LGG AIGLLNFGD++   +A    FV M++
Sbjct: 13  KRIALPVRVEPKVFFANERTFLSWLHFAVILGGLAIGLLNFGDQVGKISAGMFSFVAMLI 72

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLR 313
           M+YAL TY WR   IRKR +GPY+DR GPT +C  LL +V +NF+LR
Sbjct: 73  MVYALVTYHWRASAIRKRGTGPYDDRLGPTILCFCLLSAVMVNFYLR 119



>gi|58266938|ref|XP_570625.1| vacuole fusion, non-autophagic-related protein [Cryptococcus
           neoformans var. neoformans JEC21]
 gi|57226858|gb|AAW43318.1| vacuole fusion, non-autophagic-related protein, putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 852

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 99/138 (71%), Gaps = 7/138 (5%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR D+GI++PF  +P+ E E FPY +LEVKL T+ G+EPP+
Sbjct: 428 MVREDNFDGVDR--THGNWRRTDLGINHPFDSIPNSEKELFPYGVLEVKLATKVGEEPPQ 485

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP---PSNFRLE 117
           W+++L+ SHLVEAVPKFSKFIHG A+L+ S ++ L PFWLPQMD DIRKP    S   +E
Sbjct: 486 WIRDLINSHLVEAVPKFSKFIHGCASLL-SERVDLVPFWLPQMDQDIRKPVSAKSKILIE 544

Query: 118 RPSASNPTTPANERGNPF 135
           RP  SN  + A+  G+  
Sbjct: 545 RPQ-SNIHSNASMEGSAL 561



 Score =  129 bits (323), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 77/114 (67%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIAIPVRVEPKV FA ERTFL W +F+++L   +IGLLNF    D + + +A    F 
Sbjct: 738 GKKIAIPVRVEPKVVFAAERTFLKWAHFAILLSAVSIGLLNFIDPTDAVGMVSAGCFTFT 797

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           ++  +LY  G Y WR+ K+RKRE+  Y DR+GPT +C  LL SV +N  LRL E
Sbjct: 798 SLSAILYCGGMYAWRILKMRKREAVDYHDRWGPTALCAALLASVMVNLVLRLRE 851



>gi|134110746|ref|XP_775837.1| hypothetical protein CNBD2470 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258503|gb|EAL21190.1| hypothetical protein CNBD2470 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 852

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 99/138 (71%), Gaps = 7/138 (5%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR D+GI++PF  +P+ E E FPY +LEVKL T+ G+EPP+
Sbjct: 428 MVREDNFDGVDR--THGNWRRTDLGINHPFDSIPNSEKELFPYGVLEVKLATKVGEEPPQ 485

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP---PSNFRLE 117
           W+++L+ SHLVEAVPKFSKFIHG A+L+ S ++ L PFWLPQMD DIRKP    S   +E
Sbjct: 486 WIRDLINSHLVEAVPKFSKFIHGCASLL-SERVDLVPFWLPQMDQDIRKPVSAKSKILIE 544

Query: 118 RPSASNPTTPANERGNPF 135
           RP  SN  + A+  G+  
Sbjct: 545 RPQ-SNIHSNASMEGSAL 561



 Score =  129 bits (323), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 77/114 (67%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIAIPVRVEPKV FA ERTFL W +F+++L   +IGLLNF    D + + +A    F 
Sbjct: 738 GKKIAIPVRVEPKVVFAAERTFLKWAHFAILLSAVSIGLLNFIDPTDAVGMVSAGCFTFT 797

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           ++  +LY  G Y WR+ K+RKRE+  Y DR+GPT +C  LL SV +N  LRL E
Sbjct: 798 SLSAILYCGGMYAWRILKMRKREAVDYHDRWGPTALCAALLASVMVNLVLRLRE 851



>gi|384496085|gb|EIE86576.1| vacuolar transporter chaperone 1 [Rhizopus delemar RA 99-880]
          Length = 122

 Score =  154 bits (388), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 71/111 (63%), Positives = 86/111 (77%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+PVRVEPKVFFANERTFLSWLNF+VVLGG A+GLLNFGD+I   +A     + M V
Sbjct: 11  KRIALPVRVEPKVFFANERTFLSWLNFTVVLGGLAMGLLNFGDRIGRLSAVLFTAIAMGV 70

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEK 317
           M+YAL T+ WR  KIR RE+  Y+DR GPT +CI LL +V +NFWLR+  K
Sbjct: 71  MVYALYTFHWRATKIRNREAAAYDDRVGPTVLCIFLLAAVVVNFWLRMGGK 121



>gi|403412102|emb|CCL98802.1| predicted protein [Fibroporia radiculosa]
          Length = 865

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 103/155 (66%), Gaps = 20/155 (12%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   R RSG+NWRR DIG+DYPF +LP  + E F Y +LEVKLQTQ+GQEPP+
Sbjct: 402 MVREDNWDG--RTRSGDNWRRTDIGVDYPFDQLPPEDKELFKYGVLEVKLQTQFGQEPPQ 459

Query: 61  WVQELVQSHLVEAVPKF-------------SKFIHGVATLMDSRQIPLFPFWLPQMDIDI 107
           WV +LV SHLVEAVPK              SKFIHG ATL+ +R + L PFWLPQMD DI
Sbjct: 460 WVTDLVSSHLVEAVPKSSCLTFVTGGLSLNSKFIHGCATLIPNR-VDLVPFWLPQMDTDI 518

Query: 108 RKPPSN-FRLERP---SASNPTTPANERGNPFSGT 138
            KP +    +ERP   S+   + P+  +G+  + T
Sbjct: 519 LKPDTGALTIERPLQTSSKGTSEPSAGKGSSGATT 553



 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 75/115 (65%), Gaps = 4/115 (3%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+IA+PVRVEPKV+FA ERTFL WL+F++ +G  A  LLNF    D + + +A      
Sbjct: 748 GKRIAVPVRVEPKVYFAAERTFLKWLHFAIYIGTIATTLLNFIDPRDTVGLISAGLFTLT 807

Query: 263 TMMVMLYALGTYLWRVKKIRKRES-GPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ + Y+   +++R  K+RKR + G Y D+YGPT + + L+ ++ I+  LRL E
Sbjct: 808 ALVAIAYSAIIFVYRALKLRKRHADGMYYDKYGPTVLSLFLVGALGISVVLRLRE 862



>gi|448118396|ref|XP_004203486.1| Piso0_001095 [Millerozyma farinosa CBS 7064]
 gi|448120797|ref|XP_004204069.1| Piso0_001095 [Millerozyma farinosa CBS 7064]
 gi|359384354|emb|CCE79058.1| Piso0_001095 [Millerozyma farinosa CBS 7064]
 gi|359384937|emb|CCE78472.1| Piso0_001095 [Millerozyma farinosa CBS 7064]
          Length = 114

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 68/108 (62%), Positives = 84/108 (77%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+PVRVEPKVFFANERTFLSWLNF+++LG   +GLLNFGDKI   +A    F+ M  
Sbjct: 5   KRIALPVRVEPKVFFANERTFLSWLNFTIILGSLGVGLLNFGDKIGRISAGLFTFIAMAT 64

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           MLYAL TY WR K IR R +GPY+DR+GPT +C+ LL +V +NF LR+
Sbjct: 65  MLYALVTYHWRAKAIRMRGAGPYDDRFGPTMLCVFLLAAVVVNFALRI 112



>gi|472585950|gb|EMS23492.1| vacuolar transporter chaperone 1 [Rhodosporidium toruloides NP11]
          Length = 122

 Score =  153 bits (387), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 83/107 (77%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+PVRVEPKVFFANERTFLSWLNF+VVLGG A+GLLNFGD++   +A    FV M +
Sbjct: 13  KRIALPVRVEPKVFFANERTFLSWLNFTVVLGGLAVGLLNFGDRVGKISAGMFTFVAMAI 72

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLR 313
           M+YAL TY WR   IRKR SGPY+DR GPT +C+ L  +V  NF LR
Sbjct: 73  MIYALVTYHWRANAIRKRGSGPYDDRLGPTVLCLALFAAVVTNFILR 119



>gi|363751154|ref|XP_003645794.1| hypothetical protein Ecym_3496 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356889428|gb|AET38977.1| Hypothetical protein Ecym_3496 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 124

 Score =  152 bits (385), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 86/113 (76%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GKKIA+P RVEPKVFFANERTFLSWLNF+V++GG  IGLLNFGD +   +A+    V M 
Sbjct: 12  GKKIALPTRVEPKVFFANERTFLSWLNFTVMIGGLGIGLLNFGDNVGRFSAALFTLVAMA 71

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            M+YAL TY WR   IR+R +GPY+DR GPT +C  LL++V +NF LRL+ +S
Sbjct: 72  TMMYALVTYHWRAAAIRRRGTGPYDDRIGPTMLCFFLLVAVIVNFILRLNYQS 124



>gi|406694367|gb|EKC97695.1| vacuole fusion, non-autophagic-related protein [Trichosporon asahii
           var. asahii CBS 8904]
          Length = 815

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 95/129 (73%), Gaps = 7/129 (5%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDNF+ N R  +  NWRR D GIDYPF  +   + E FPY ILEVKL T+ G+EPP+
Sbjct: 427 LVREDNFDGNDR--THGNWRRTDFGIDYPFPTVKKEDKEIFPYGILEVKLATRVGEEPPQ 484

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN---FRLE 117
           W+++LV SHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMD DIRKP S+     +E
Sbjct: 485 WIRDLVNSHLVEAVPKFSKFIHGCATLLPER-VDLVPFWLPQMDQDIRKPVSSRSRVLIE 543

Query: 118 RPSASNPTT 126
           RP+ S PT+
Sbjct: 544 RPT-SVPTS 551



 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 74/112 (66%), Gaps = 3/112 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+IAIPVR+EPKV FA ERTFL W+NF+V+L   +I L+NF    D + + A++   F 
Sbjct: 699 GKRIAIPVRIEPKVIFAAERTFLKWMNFAVLLSMVSIALMNFISADDSVGIIASACFTFS 758

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            ++   Y+   Y+ R+ +IR R +  Y D++GPTF+C  ++ SV IN  LR+
Sbjct: 759 ALLATAYSGYMYVLRILRIRDRRAINYHDKWGPTFLCFTVIASVVINLVLRV 810



>gi|399165959|emb|CCE33217.1| probable negative regulator of cdc42 [Claviceps purpurea 20.1]
          Length = 130

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 89/117 (76%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVF 261
           +T  GK+IA+P RVEPKVFFANERTFLSWLNF+V+LG  AIG+LNFGD++   +A     
Sbjct: 8   QTAQGKRIALPTRVEPKVFFANERTFLSWLNFTVILGALAIGMLNFGDRVAFISAFLFTG 67

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
           V M+ MLYAL TY WR K IR R    ++DR+GPTF+ I+LL++V +NF LR+++ S
Sbjct: 68  VAMLTMLYALVTYHWRAKAIRMRGQAGFDDRFGPTFLAIILLLAVVVNFVLRINDHS 124



>gi|401884795|gb|EJT48937.1| vacuole fusion, non-autophagic-related protein [Trichosporon asahii
           var. asahii CBS 2479]
          Length = 815

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 77/129 (59%), Positives = 95/129 (73%), Gaps = 7/129 (5%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           ++REDNF+ N R  +  NWRR D GIDYPF  +   + E FPY ILEVKL T+ G+EPP+
Sbjct: 427 LVREDNFDGNDR--THGNWRRTDFGIDYPFPTVKKEDKEIFPYGILEVKLATRVGEEPPQ 484

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN---FRLE 117
           W+++LV SHLVEAVPKFSKFIHG ATL+  R + L PFWLPQMD DIRKP S+     +E
Sbjct: 485 WIRDLVNSHLVEAVPKFSKFIHGCATLLPER-VDLVPFWLPQMDQDIRKPVSSRSRVLIE 543

Query: 118 RPSASNPTT 126
           RP+ S PT+
Sbjct: 544 RPT-SVPTS 551



 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 74/112 (66%), Gaps = 3/112 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK+IAIPVR+EPKV FA ERTFL W+NF+V+L   +I L+NF    D + + A++   F 
Sbjct: 699 GKRIAIPVRIEPKVIFAAERTFLKWMNFAVLLSMVSIALMNFISADDSVGIIASACFTFS 758

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
            ++   Y+   Y+ R+ +IR R +  Y D++GPTF+C  ++ SV IN  LR+
Sbjct: 759 ALLATAYSGYMYVLRILRIRDRRAINYHDKWGPTFLCFTVIASVVINLVLRV 810



>gi|321257860|ref|XP_003193732.1| vacuole fusion, non-autophagic-related protein [Cryptococcus gattii
           WM276]
 gi|317460202|gb|ADV21945.1| vacuole fusion, non-autophagic-related protein, putative
           [Cryptococcus gattii WM276]
          Length = 855

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 92/125 (73%), Gaps = 6/125 (4%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDNF+   R  +  NWRR D+GI++PF  +P  E E FPY +LEVKL T+ G+EPP+
Sbjct: 431 MVREDNFDGVDR--THGNWRRTDLGINHPFDSIPKSEKELFPYGVLEVKLATKVGEEPPQ 488

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP---PSNFRLE 117
           W+++L+ SHLVEAVPKFSKFIHG A+L+  R + L PFWLPQMD DIRKP    S   +E
Sbjct: 489 WIRDLINSHLVEAVPKFSKFIHGCASLLPER-VDLIPFWLPQMDQDIRKPISAKSKVVIE 547

Query: 118 RPSAS 122
           RP ++
Sbjct: 548 RPQST 552



 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 77/114 (67%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GKKIA+PVRVEPKV FA ERTFL W +F+++L   +IGLLNF    D + + +A      
Sbjct: 741 GKKIAVPVRVEPKVVFAAERTFLKWAHFAILLSAVSIGLLNFIDPTDAVGMVSAGCFTLT 800

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           ++  +LY  G Y WR+ K+RKRE+  Y DR+GPT +C  LL SV +N  LRLHE
Sbjct: 801 SLAAILYCGGMYAWRILKMRKREAVDYHDRWGPTALCAALLASVMVNLVLRLHE 854



>gi|50426209|ref|XP_461701.1| DEHA2G03586p [Debaryomyces hansenii CBS767]
 gi|49657371|emb|CAG90153.1| DEHA2G03586p [Debaryomyces hansenii CBS767]
          Length = 115

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/110 (61%), Positives = 83/110 (75%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD +   +A    F+ M+ 
Sbjct: 6   KRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDSVGRISAGLFTFIAMLT 65

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR K IR R SGPY+DR GPT +CI LL++V INF LR+  
Sbjct: 66  MVYALVTYHWRAKAIRMRGSGPYDDRLGPTMLCIFLLVAVVINFILRIRA 115



>gi|388856019|emb|CCF50396.1| probable VTC1-protein controls Sec18p/NSF-dependent priming of
           SNAREs and HOPS [Ustilago hordei]
          Length = 122

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/111 (63%), Positives = 84/111 (75%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+IA+PVRVEPKVFFANERTFLSWLNF+V L   A GLLNFGDKI   +A+   FV M 
Sbjct: 12  GKRIALPVRVEPKVFFANERTFLSWLNFTVTLSALAAGLLNFGDKIGRISAAMFSFVAMA 71

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           +M+YAL TY WR   IR R SGPY+DR GPT + +MLLI+V +NF LR + 
Sbjct: 72  IMIYALLTYHWRASAIRNRGSGPYDDRLGPTVLSVMLLIAVLVNFILRFNS 122



>gi|322698328|gb|EFY90099.1| vacuolar transporter chaperone 1 [Metarhizium acridum CQMa 102]
 gi|322710154|gb|EFZ01729.1| vacuolar transporter chaperone 1 [Metarhizium anisopliae ARSEF 23]
          Length = 130

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 88/117 (75%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVF 261
           +T  GK+IA+P RVEPKVFFANERTFLSWLNF+V+LG  AIG+LNFGD++   +A     
Sbjct: 8   QTSQGKRIALPTRVEPKVFFANERTFLSWLNFTVILGALAIGMLNFGDRVAFISAFLFTG 67

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
           V M+ MLYAL TY WR K IR R    ++DR+GPTF+ I+LL++V +NF LR+ + S
Sbjct: 68  VAMLTMLYALVTYHWRAKSIRMRGQAGFDDRFGPTFLAIILLLAVVVNFVLRITDHS 124



>gi|344234885|gb|EGV66753.1| hypothetical protein CANTEDRAFT_112153 [Candida tenuis ATCC 10573]
 gi|344234886|gb|EGV66754.1| hypothetical protein CANTEDRAFT_112153 [Candida tenuis ATCC 10573]
          Length = 114

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 84/110 (76%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD +   +A    F+ M+ 
Sbjct: 5   KRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDSVGRISAGLFTFIAMLT 64

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR K IR R SGPY+DR+GPT +C+ LL++V +NF LR+  
Sbjct: 65  MVYALVTYHWRAKAIRMRGSGPYDDRFGPTMLCLFLLVAVVVNFILRIRA 114



>gi|71023025|ref|XP_761742.1| hypothetical protein UM05595.1 [Ustilago maydis 521]
 gi|46101228|gb|EAK86461.1| hypothetical protein UM05595.1 [Ustilago maydis 521]
          Length = 122

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/111 (63%), Positives = 84/111 (75%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+IA+PVRVEPKVFFANERTFLSWLNF+V L   A GLLNFGDKI   +A+   FV M 
Sbjct: 12  GKRIALPVRVEPKVFFANERTFLSWLNFTVTLSALAAGLLNFGDKIGRISAAMFSFVAMA 71

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           +M+YAL TY WR   IR R SGPY+DR GPT + +MLLI+V +NF LR + 
Sbjct: 72  IMIYALLTYHWRASAIRNRGSGPYDDRLGPTVLSVMLLIAVLVNFILRFNA 122



>gi|68476353|ref|XP_717826.1| hypothetical protein CaO19.5455 [Candida albicans SC5314]
 gi|68476542|ref|XP_717732.1| hypothetical protein CaO19.12910 [Candida albicans SC5314]
 gi|241952485|ref|XP_002418964.1| vacuolar transporter chaperone (VTC), putative [Candida
           dubliniensis CD36]
 gi|46439458|gb|EAK98776.1| hypothetical protein CaO19.12910 [Candida albicans SC5314]
 gi|46439559|gb|EAK98876.1| hypothetical protein CaO19.5455 [Candida albicans SC5314]
 gi|223642304|emb|CAX42546.1| vacuolar transporter chaperone (VTC), putative [Candida
           dubliniensis CD36]
 gi|238880454|gb|EEQ44092.1| vacuolar transporter chaperone 1 [Candida albicans WO-1]
          Length = 115

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 84/110 (76%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD +   +A    F+ M+ 
Sbjct: 6   KRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDYVGRISAGLFTFIAMLT 65

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR K IR R SGPY+DR+GPT +CI LL++V +NF LR+  
Sbjct: 66  MVYALVTYHWRAKAIRLRGSGPYDDRFGPTMLCIFLLVAVVVNFILRIRA 115



>gi|343426476|emb|CBQ70006.1| probable VTC1-protein controls Sec18p/NSF-dependent priming of
           SNAREs and HOPS [Sporisorium reilianum SRZ2]
          Length = 122

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 71/111 (63%), Positives = 84/111 (75%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMM 265
           GK+IA+PVRVEPKVFFANERTFLSWLNF+V L   A GLLNFGDKI   +A+   FV M 
Sbjct: 12  GKRIALPVRVEPKVFFANERTFLSWLNFTVTLSALAAGLLNFGDKIGRISAAMFSFVAMA 71

Query: 266 VMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           +M+YAL TY WR   IR R SGPY+DR GPT + +MLLI+V +NF LR + 
Sbjct: 72  IMVYALLTYHWRASAIRNRGSGPYDDRLGPTVLSVMLLIAVLVNFILRFNA 122



>gi|169597351|ref|XP_001792099.1| hypothetical protein SNOG_01461 [Phaeosphaeria nodorum SN15]
 gi|160707506|gb|EAT91110.2| hypothetical protein SNOG_01461 [Phaeosphaeria nodorum SN15]
          Length = 804

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 105/371 (28%), Positives = 165/371 (44%), Gaps = 70/371 (18%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDI---GIDYPFSKLPDGEIERFPYAILEVKLQTQYGQE 57
           +IRED  + +   R  ++W R DI    +++PF  +  GEI +FPYA+LE+K++   G +
Sbjct: 419 LIREDALDMDRPCRDPDDWHRRDIDNGNMEFPFKSIKKGEIHKFPYALLEIKIK---GTK 475

Query: 58  PPEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLE 117
             EW+++L  SHLV+  P+FSKF+ GVA L +   +  FPFWL ++D DIRK P     E
Sbjct: 476 KYEWIEDLTDSHLVKESPRFSKFVQGVAKLFED-NVNTFPFWLSEVDNDIRKEPETAFDE 534

Query: 118 ---------------------------RPSASNPT-TPANERGNPFSGTXXXXXXXXXXX 149
                                      RPS S+P  TPA  R  P + +           
Sbjct: 535 EQERKRKAAEDDFAVGSLFGARASPSYRPSISSPVGTPAGARSAPKNASSAAHSQPVVKA 594

Query: 150 XXXXXXXXXXNTPLLSESSQNTNTQ-LRSTPHISSLEELEEYLATVTPAGKVPKTYHGKK 208
                         LS  SQ  +    R+   + S E+    +   +  G +  ++   K
Sbjct: 595 PVVGSH--------LSHVSQAQHENGDRTAEDVDSDEDNGPRMGKASGLGSLFPSFSTSK 646

Query: 209 IAI-----------------------PVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLL 245
            A                        PVRVE KV+ AN+RTF+ W + SV+L   ++GL 
Sbjct: 647 YARKQRNKIQLPPGIRDPGIWIKDQGPVRVEAKVWLANQRTFIKWQHVSVLLASLSLGLY 706

Query: 246 NF---GDKITVTAASFLVFVTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIML 302
           N    G+ I    A     V    + +  G Y++R+K I +R    ++   GP  +C+ L
Sbjct: 707 NAAGEGNNIARALAVVYTCVAAFTLAWGYGMYMYRMKLITERSPKDFDAITGPLVVCVGL 766

Query: 303 LISVTINFWLR 313
            +++ +NF  +
Sbjct: 767 AVALCLNFGFK 777



>gi|126132696|ref|XP_001382873.1| Vacuolar transporter chaperone 1 (Phosphate metabolism protein 4)
           (Negative regulator of CDC42 protein 1) [Scheffersomyces
           stipitis CBS 6054]
 gi|126094698|gb|ABN64844.1| Vacuolar transporter chaperone 1 (Phosphate metabolism protein 4)
           (Negative regulator of CDC42 protein 1) [Scheffersomyces
           stipitis CBS 6054]
          Length = 115

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 83/110 (75%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD +   +A    F+ M+ 
Sbjct: 6   KRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDAVGRISAGLFTFIAMLT 65

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR K IR R SGPY+DR+GPT +C  LL++V INF LR+  
Sbjct: 66  MVYALVTYHWRAKAIRLRGSGPYDDRFGPTMLCFFLLVAVVINFVLRIRA 115



>gi|342882737|gb|EGU83337.1| hypothetical protein FOXB_06188 [Fusarium oxysporum Fo5176]
          Length = 769

 Score =  150 bits (380), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 163/356 (45%), Gaps = 49/356 (13%)

Query: 2   IREDNFENNPRLRSGNNWRRMDIG---IDYPFSKLPDGEIERFPYAILEVKLQTQYGQEP 58
           IRED  + +   R  N W R+DI    + YPF K+   E+ RFPYA+LE+KL+    ++ 
Sbjct: 401 IREDTLDPSRPCRDPNEWHRLDIDESEMTYPFKKMNQSEVNRFPYALLEIKLKEDSQRKH 460

Query: 59  PEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNF---- 114
           P WV++L+ SHLV   P+FSKF+HG+A L +   +   PFWL  ++ DIRK P       
Sbjct: 461 PTWVEDLMSSHLVHPTPRFSKFVHGIAALFED-YVNNLPFWLSDLESDIRKDPQKTFEEE 519

Query: 115 ------RLERPSASNPTTPANERGNPFSGTXXX------XXXXXXXXXXXXXXXXXXNTP 162
                 R E   A      A  +   +  T                           +TP
Sbjct: 520 EQRRAQRHEDVMAVGSLIGAGAKSGSYKPTQSSPVSKSYLAERMSKDSIAQALNRRMSTP 579

Query: 163 LLSESSQNTNTQLRSTPHISSLEELEEY--LATVTPAGKVPKTYHGKKIA---IP----- 212
              E +  ++TQ RS       E+   Y  L++V P   + K    K+ +   +P     
Sbjct: 580 ANGEEAGESSTQQRS-------EQERSYGTLSSVIPGFSLSKYSRAKRASQQPLPEGVVA 632

Query: 213 ----------VRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFV 262
                     ++VEPKV+ ANERTFL W +  ++ GG A+GL     + T+ +   L+FV
Sbjct: 633 PTEWIKNMGELKVEPKVWLANERTFLKWQHICILQGGLAVGLYTAAGENTLASVVGLLFV 692

Query: 263 TMMVMLYALGTYLWRVKK--IRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            + V     G  + R+++  I +R    +++  GP  I   L++ + +NF+    E
Sbjct: 693 LIAVFAGIWGYAMLRIRRTMIVERSGKDFDNMIGPMIISGSLMLVLILNFFFAYRE 748



>gi|146417567|ref|XP_001484752.1| vacuolar transporter chaperone 1 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146390225|gb|EDK38383.1| vacuolar transporter chaperone 1 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 115

 Score =  150 bits (380), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 83/110 (75%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD I   +A    F+ M+ 
Sbjct: 6   KRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDSIGRVSAGLFTFIAMLT 65

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR + IR R SGPY+DR+GPT +C  LLI+V +NF LR+  
Sbjct: 66  MVYALVTYHWRARAIRLRGSGPYDDRFGPTMLCFFLLIAVVVNFVLRIRA 115



>gi|354547453|emb|CCE44188.1| hypothetical protein CPAR2_504120 [Candida parapsilosis]
          Length = 115

 Score =  150 bits (379), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 83/110 (75%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD +   +A    F+ M+ 
Sbjct: 6   KRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDYVGRISAGLFTFIAMLT 65

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR K IR R SGPY+DR+GPT +C  LLI+V +NF LR+  
Sbjct: 66  MIYALVTYHWRAKAIRLRGSGPYDDRFGPTMLCFFLLIAVVVNFILRIRA 115



>gi|494825525|gb|EON62679.1| vacuolar transporter chaperone 1 [Coniosporium apollinis CBS
           100218]
          Length = 127

 Score =  150 bits (378), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVF 261
           +T  GK+IA+P RVEPKVFFANERTFLSWLNF+V+LGG AIGLLNFGDK+   +A    F
Sbjct: 8   QTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGGLAIGLLNFGDKVGRISAGLFTF 67

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRL 314
           V M  M+YAL T+ WR K IR+R  G ++DR+GPT + + LL +V +NF LR+
Sbjct: 68  VAMAAMIYALFTFHWRAKSIRQRGQGGFDDRFGPTILAVALLAAVIVNFVLRV 120



>gi|482811850|gb|EOA88595.1| hypothetical protein SETTUDRAFT_176646 [Setosphaeria turcica Et28A]
          Length = 1509

 Score =  149 bits (377), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 111/378 (29%), Positives = 171/378 (45%), Gaps = 81/378 (21%)

Query: 1    MIREDNFENNPRLRSGNNWRRMDIG---IDYPFSKLPDGEIERFPYAILEVKLQTQYGQE 57
            +IRED  + +   R   +W R DI    ++YPF  L  GEI +FPYA+LE+K++   G +
Sbjct: 1117 LIREDALDESRPCRDPEDWHRRDIDDAQMEYPFKTLKKGEIHKFPYALLEIKVK---GSQ 1173

Query: 58   PPEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSN-FRL 116
              EW+ +L+ SHLV+  P+FSKF+ GVA L +   +  FPFWL ++D DIRK P   F  
Sbjct: 1174 KYEWIDDLMHSHLVKESPRFSKFVQGVAKLFED-NVNTFPFWLSEVDNDIRKEPEKAFDD 1232

Query: 117  E--------------------------RPSASNPT-TPANERGNPFSGTXXXXXXXXXXX 149
            E                          RPS ++P  +PA  R  P S +           
Sbjct: 1233 EQEKKRKAAEDEFAVGSLFGARASPSFRPSIASPVGSPAATRSVPKSAS----------- 1281

Query: 150  XXXXXXXXXXNTPLLSESSQNTNTQLRSTPHISSLEELEEYLATVTPAGKVPKT------ 203
                        PL +  S  + T+       + +EE  +    V PAGK  K+      
Sbjct: 1282 -AAAHSQPAVKPPLSNIGSHLSQTERNGNNTGARVEEDSDSDDDVVPAGKTQKSGLASLF 1340

Query: 204  ----------YHGKKIAIP---------------VRVEPKVFFANERTFLSWLNFSVVLG 238
                         +KI +P               V+VE KV+ AN+RTF+ W + SV+L 
Sbjct: 1341 PSFSTSKYARRQQRKIQLPPGIRDPGVWIKDQGPVKVEAKVWLANQRTFIKWQHVSVLLA 1400

Query: 239  GFAIGLLN-FGDKITVTAASFLVFVTMMVMLYALG--TYLWRVKKIRKRESGPYEDRYGP 295
              ++GL N  G+   +  A  +V+  +     A G   Y++R K IR+R    ++   GP
Sbjct: 1401 SLSLGLYNAAGEGNNIARALAVVYTCIAAFTLAWGYIMYMYRAKLIRERSGKDFDAITGP 1460

Query: 296  TFICIMLLISVTINFWLR 313
              +C+ L +++ +NF  +
Sbjct: 1461 LVVCVGLAVALCLNFGFK 1478



>gi|255723506|ref|XP_002546686.1| vacuolar transporter chaperone 1 [Candida tropicalis MYA-3404]
 gi|240130560|gb|EER30124.1| vacuolar transporter chaperone 1 [Candida tropicalis MYA-3404]
          Length = 115

 Score =  149 bits (377), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 83/110 (75%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+++LG   +GLLNFGD +   +A    F+ M+ 
Sbjct: 6   KRIALPARVEPKVFFANERTFLSWLNFTIILGSLGVGLLNFGDSVGRISAGLFTFIAMLT 65

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR K IR R SGPY+DR+GPT +C  LL++V +NF LR+  
Sbjct: 66  MVYALVTYHWRAKAIRLRGSGPYDDRFGPTMLCFFLLVAVVVNFILRIRA 115



>gi|345561652|gb|EGX44740.1| hypothetical protein AOL_s00188g78 [Arthrobotrys oligospora ATCC
           24927]
          Length = 123

 Score =  149 bits (377), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 88/115 (76%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVF 261
           +T  GK+IA+PVRVEPKV+FANERTFLSWLNF+V+LGG A+GLLNFGDK+   +A    F
Sbjct: 8   QTAPGKRIALPVRVEPKVYFANERTFLSWLNFTVILGGLAVGLLNFGDKVGRISAGLFTF 67

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           + M  M+YAL T+ WR   IRKR SG ++DR+GPT + + LL +V +NF LR+ E
Sbjct: 68  IAMGTMVYALFTFHWRAAAIRKRGSGSFDDRFGPTVLAVTLLAAVVVNFILRMVE 122



>gi|340522892|gb|EGR53125.1| predicted protein [Trichoderma reesei QM6a]
          Length = 133

 Score =  149 bits (377), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 90/117 (76%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVF 261
           +T  GK+IA+P RVEPKVFFANERTFLSWLNF+V+LG  AIG+LNFGD+++  +A     
Sbjct: 8   QTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGALAIGMLNFGDRVSFISAFLFTG 67

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
           V M+ M+YAL TY WR K IR R    ++DR+GPTF+ I+LL++V +NF LR+ ++S
Sbjct: 68  VAMLTMIYALVTYHWRAKSIRMRGQAGFDDRFGPTFLAIILLLAVIVNFVLRIMDQS 124



>gi|448528502|ref|XP_003869724.1| Vtc1 protein [Candida orthopsilosis Co 90-125]
 gi|380354077|emb|CCG23591.1| Vtc1 protein [Candida orthopsilosis]
          Length = 115

 Score =  149 bits (377), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD +   +A    F+ M+ 
Sbjct: 6   KRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDYVGRISAGLFTFIAMLT 65

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR K IR R SGPY+DR+GPT +C  LL++V +NF LR+  
Sbjct: 66  MVYALVTYHWRAKAIRLRGSGPYDDRFGPTMLCFFLLVAVVVNFILRIRA 115



>gi|149245960|ref|XP_001527450.1| vacuolar transporter chaperone 1 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146449844|gb|EDK44100.1| vacuolar transporter chaperone 1 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 115

 Score =  149 bits (377), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 82/109 (75%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD I   +A    F+ M+ 
Sbjct: 6   KRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDSIGRISAGLFTFIAMLT 65

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLH 315
           M+YAL TY WR K IR R SGPY+DR+GPT +C  LL +V INF LR+ 
Sbjct: 66  MVYALVTYHWRAKAIRLRGSGPYDDRFGPTMLCFFLLAAVIINFILRIR 114



>gi|358395616|gb|EHK45003.1| hypothetical protein TRIATDRAFT_299771 [Trichoderma atroviride IMI
           206040]
          Length = 133

 Score =  149 bits (377), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 90/117 (76%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVF 261
           +T  GK+IA+P RVEPKVFFANERTFLSWLNF+V+LG  AIG+LNFGD+++  +A     
Sbjct: 8   QTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGALAIGMLNFGDRVSFISAFLFTG 67

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
           V M+ M+YAL TY WR K IR R    ++DR+GPTF+ I+LL++V +NF LR+ ++S
Sbjct: 68  VAMLTMIYALVTYHWRAKSIRVRGQAGFDDRFGPTFLAIILLLAVIVNFVLRIMDQS 124



>gi|344300879|gb|EGW31191.1| hypothetical protein SPAPADRAFT_61765 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 115

 Score =  149 bits (376), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+P RVEPKVFFANERTFLSWLNF+V+LG   +GLLNFGD +   +A    F+ M+ 
Sbjct: 6   KRIALPARVEPKVFFANERTFLSWLNFTVILGSLGVGLLNFGDYVGRISAGLFTFIAMLT 65

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR K IR R SGPY+DR+GPT +C  LL++V +NF LR+  
Sbjct: 66  MIYALITYHWRAKAIRLRGSGPYDDRFGPTMLCAFLLVAVVVNFILRIRA 115



>gi|358389567|gb|EHK27159.1| hypothetical protein TRIVIDRAFT_9512, partial [Trichoderma virens
           Gv29-8]
          Length = 125

 Score =  149 bits (376), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 90/117 (76%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVF 261
           +T  GK+IA+P RVEPKVFFANERTFLSWLNF+V+LG  AIG+LNFGD+++  +A     
Sbjct: 8   QTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGALAIGMLNFGDRVSFISAFLFTG 67

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
           V M+ M+YAL TY WR K IR R    ++DR+GPTF+ I+LL++V +NF LR+ ++S
Sbjct: 68  VAMLTMIYALVTYHWRAKSIRVRGQAGFDDRFGPTFLAIILLLAVIVNFVLRIMDQS 124



>gi|170090726|ref|XP_001876585.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164648078|gb|EDR12321.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 123

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 68/110 (61%), Positives = 85/110 (77%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+PVRVEPKV FANERTFLSWL+F+VVLGG A+GLLNFGDK+   +A+    V M +
Sbjct: 13  KRIALPVRVEPKVSFANERTFLSWLHFTVVLGGLAVGLLNFGDKVGKISAAMFSLVAMAI 72

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR   IR+   GPY+DR+GPT +CI LL++V INF LR  +
Sbjct: 73  MIYALYTYHWRANSIRRGGRGPYDDRFGPTVLCISLLVAVVINFVLRFAQ 122



>gi|403174841|ref|XP_003333759.2| hypothetical protein PGTG_15519 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375171341|gb|EFP89340.2| hypothetical protein PGTG_15519 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 893

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/120 (60%), Positives = 89/120 (74%), Gaps = 2/120 (1%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           M+REDN++   R R  NNWRR D GID+PF  + + +   FPY +LEVKLQTQ GQEPPE
Sbjct: 414 MVREDNWDGKTR-RPDNNWRRTDAGIDFPFPTVEEDDKHIFPYGVLEVKLQTQLGQEPPE 472

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPPSNFRLERPS 120
           WV+ELV   LVEAVPKFSKFIHG ATLM +R + L PFWLPQM+IDI+K      ++RP+
Sbjct: 473 WVKELVSGPLVEAVPKFSKFIHGCATLMPNR-VSLVPFWLPQMEIDIKKNEPLKLIDRPA 531



 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 76/116 (65%), Gaps = 3/116 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFG---DKITVTAASFLVFV 262
           GKKIAIP+R+EPKV+FA ERTF +WL FS +L G ++ LLNF    D+     +     +
Sbjct: 768 GKKIAIPIRIEPKVYFATERTFFTWLEFSTILSGISLSLLNFSPINDRTGFRISVIFTIL 827

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
            ++ ++Y+   ++ RV KIR R++  Y D  GP+ +C  +LI+V +NF+LR  +++
Sbjct: 828 ALLSIVYSTLIFVKRVHKIRTRQASGYYDPVGPSVLCACILIAVAVNFYLRFSDQN 883



>gi|500256845|gb|EOO00086.1| putative vacuolar transporter chaperone 2 protein [Togninia minima
           UCRPA7]
          Length = 768

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 98/341 (28%), Positives = 154/341 (45%), Gaps = 33/341 (9%)

Query: 2   IREDNFENNPRLRSGNNWRRMDI---GIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEP 58
           IRED+ +     R    W R DI    I YPF  +   E+ RFPYAILE+KL+     + 
Sbjct: 398 IREDSLDTRRPCRDPGEWHRADIDNRNITYPFKDINQSEVSRFPYAILEIKLKEDGVHKR 457

Query: 59  PEWVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKPP-SNFRLE 117
           P WV+EL+ SHLV   P+FSKF+HGVA+L D   +   PFWL ++D DIRK P + F  E
Sbjct: 458 PIWVEELMASHLVHPAPRFSKFVHGVASLFDD-YVNRLPFWLSELDADIRKDPQAAFEEE 516

Query: 118 RPSASNPTTPANERGNPFSGTXXXXX------XXXXXXXXXXXXXXXXNTPLLSESSQNT 171
               +         G+                                  P  S  +   
Sbjct: 517 EQRKAERAADEQVVGSLLGSKAVSFQPARSSPMAKSYLQDRMARDSNAGLPYSSSDAHLP 576

Query: 172 NTQLRSTPHISSLEELEEY--LATVTPAGKVPKTYHGK------------------KIAI 211
            T+  +T +  + +E   Y  L++V P+  + K    K                  K A 
Sbjct: 577 RTKSPATENGDAGDEARNYGTLSSVLPSFSMTKYSKAKRAKEAPLPEGVKEPETWIKNAG 636

Query: 212 PVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMVMLYAL 271
           P+++EPKV+ ANERTFL W +  ++LGG A+ L +   +  +     + ++ + V     
Sbjct: 637 PLKIEPKVWLANERTFLKWQHICILLGGLAVALYSAAGESLIAEFMGIAYILIAVFAGLW 696

Query: 272 GTYLWRVKK--IRKRESGPYEDRYGPTFICIMLLISVTINF 310
           G Y+ + ++  I  R    +++  GP  +   L++++ +NF
Sbjct: 697 GYYMLKTRRAMIIARSGKDFDNIIGPMVVSAALMLALILNF 737



>gi|328854527|gb|EGG03659.1| hypothetical protein MELLADRAFT_49481 [Melampsora larici-populina
           98AG31]
          Length = 847

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 4/135 (2%)

Query: 1   MIREDNFENNPRLRSGNNWRRMDIGIDYPFSKLPDGEIERFPYAILEVKLQTQYGQEPPE 60
           +IREDN++   R R  NNWRR D+GID+PF  +   +   FPY +LEVKLQTQ GQEPPE
Sbjct: 413 LIREDNWDGKIR-RPDNNWRRKDVGIDFPFDNVDSDDKHLFPYGVLEVKLQTQLGQEPPE 471

Query: 61  WVQELVQSHLVEAVPKFSKFIHGVATLMDSRQIPLFPFWLPQMDIDIRKP-PSNFRLERP 119
           WV++LV   LVEAVPKFSKFIHG ATLM  R + L PFWLPQM+IDI K  PS   ++R 
Sbjct: 472 WVKDLVSGPLVEAVPKFSKFIHGCATLMPDR-VCLVPFWLPQMEIDILKADPSLKVIDRG 530

Query: 120 SASN-PTTPANERGN 133
             SN P  P+++  +
Sbjct: 531 QGSNSPPKPSSDNAS 545



 Score =  127 bits (319), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 81/114 (71%), Gaps = 3/114 (2%)

Query: 206 GKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNF---GDKITVTAASFLVFV 262
           GK++A+PVRVEPKV+FA ERTFL+WL FS +LG  A+ L++F    D +  TA+     V
Sbjct: 734 GKRVAVPVRVEPKVYFATERTFLTWLEFSTLLGAIAVTLMSFTAVDDHVGFTASITFTVV 793

Query: 263 TMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
            ++ ++Y+ GTY+WRV  IR+R +  Y D YGPT +C +L ++V INF+LRL +
Sbjct: 794 ALLSIIYSTGTYVWRVMSIRQRSASGYHDPYGPTALCGILFLAVFINFYLRLDQ 847



>gi|392593017|gb|EIW82343.1| vacuolar transporter chaperone 1 [Coniophora puteana RWD-64-598
           SS2]
          Length = 123

 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/110 (61%), Positives = 84/110 (76%)

Query: 207 KKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVFVTMMV 266
           K+IA+PVRVEPKV FANERTFLSWL+F+VVLGG A+GLLNFGDK+   +A+    V M +
Sbjct: 13  KRIALPVRVEPKVSFANERTFLSWLHFTVVLGGLAVGLLNFGDKVGKISAAMFSVVAMSI 72

Query: 267 MLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHE 316
           M+YAL TY WR   IRK   GPY+DR GPT +C+ LLI++ +NF LR  E
Sbjct: 73  MIYALYTYHWRAASIRKGGRGPYDDRLGPTLLCVALLIAIIVNFILRFTE 122



>gi|330906977|ref|XP_003295664.1| hypothetical protein PTT_02198 [Pyrenophora teres f. teres 0-1]
 gi|311332866|gb|EFQ96242.1| hypothetical protein PTT_02198 [Pyrenophora teres f. teres 0-1]
          Length = 130

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 85/117 (72%)

Query: 202 KTYHGKKIAIPVRVEPKVFFANERTFLSWLNFSVVLGGFAIGLLNFGDKITVTAASFLVF 261
           +T  GK+IA+P RVEPKVFFANERTFLSWLNF+V+LGG AIGLLNFGDKI   +A    F
Sbjct: 8   QTAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILGGLAIGLLNFGDKIGKISAGLFTF 67

Query: 262 VTMMVMLYALGTYLWRVKKIRKRESGPYEDRYGPTFICIMLLISVTINFWLRLHEKS 318
           V MM M+YAL T+ WR + IR R  G ++DR GPT + I L  +V +NF LR+   S
Sbjct: 68  VAMMAMIYALFTFHWRARSIRMRGQGGFDDRLGPTVLTIALFAAVIVNFVLRMTMGS 124