BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10407_c0_seq1-m.161 5prime_partial 368-1570(-) 401 (-)
         (400 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|395333868|gb|EJF66245.1| glycosyltransferase family 39 protei...   458   e-126   Dichomitus squalens LYAD-421 SS1
gi|392567232|gb|EIW60407.1| glycosyltransferase family 39 protei...   447   e-123   Trametes versicolor FP-101664 SS1
gi|299752673|ref|XP_001841164.2| dolichyl-phosphate-mannose-prot...   446   e-123   Coprinopsis cinerea okayama7#130
gi|409045639|gb|EKM55119.1| glycosyltransferase family 39 protei...   443   e-122   Phanerochaete carnosa HHB-10118-sp
gi|170103424|ref|XP_001882927.1| glycosyltransferase family 39 p...   442   e-122   Laccaria bicolor S238N-H82
gi|390597618|gb|EIN07017.1| glycosyltransferase family 39 protei...   441   e-121   Punctularia strigosozonata HHB-11173 SS5
gi|389748450|gb|EIM89627.1| glycosyltransferase family 39 protei...   438   e-120   Stereum hirsutum FP-91666 SS1
gi|336380210|gb|EGO21364.1| glycosyltransferase family 39 protei...   435   e-119   Serpula lacrymans var. lacrymans S7.9
gi|449547134|gb|EMD38102.1| glycosyltransferase family 39 protei...   434   e-119   Gelatoporia subvermispora B
gi|302690208|ref|XP_003034783.1| glycosyltransferase family 39 p...   431   e-118   Schizophyllum commune H4-8
gi|407918001|gb|EKG11300.1| Glycosyl transferase family 39 [Macr...   428   e-117   Macrophomina phaseolina MS6
gi|472585868|gb|EMS23410.1| protein o-mannosyl transferase, glyc...   428   e-117   Rhodotorula toruloides NP11
gi|403413793|emb|CCM00493.1| predicted protein [Fibroporia radic...   427   e-117   Fibroporia radiculosa
gi|409080813|gb|EKM81173.1| hypothetical protein AGABI1DRAFT_119...   427   e-117   Agaricus bisporus var. burnettii JB137-S8
gi|426197728|gb|EKV47655.1| hypothetical protein AGABI2DRAFT_205...   426   e-117   Agaricus bisporus var. bisporus H97
gi|393220398|gb|EJD05884.1| glycosyltransferase family 39 protei...   425   e-116   Fomitiporia mediterranea MF3/22
gi|485925109|gb|EOD49758.1| putative dolichyl-phosphate-mannose-...   425   e-116   Neofusicoccum parvum UCRNP2
gi|358058654|dbj|GAA95617.1| hypothetical protein E5Q_02273 [Mix...   423   e-116   Mixia osmundae IAM 14324
gi|67537870|ref|XP_662709.1| hypothetical protein AN5105.2 [Aspe...   423   e-116   Aspergillus nidulans FGSC A4
gi|242807915|ref|XP_002485056.1| protein O-mannosyl transferase ...   422   e-116   Talaromyces stipitatus ATCC 10500
gi|482809248|gb|EOA86083.1| glycosyltransferase family 39 protei...   419   e-115   Setosphaeria turcica Et28A
gi|169764100|ref|XP_001727950.1| dolichyl-phosphate-mannose--pro...   419   e-115   Aspergillus oryzae RIB40
gi|295658182|ref|XP_002789653.1| dolichyl-phosphate-mannose-prot...   417   e-114   Paracoccidioides lutzii Pb01
gi|449300557|gb|EMC96569.1| glycosyltransferase family 39 protei...   416   e-114   Baudoinia panamericana UAMH 10762
gi|393245706|gb|EJD53216.1| glycosyltransferase family 39 protei...   416   e-114   Auricularia subglabra TFB-10046 SS5
gi|392577985|gb|EIW71113.1| hypothetical protein TREMEDRAFT_3756...   415   e-113   Tremella mesenterica DSM 1558
gi|302510847|ref|XP_003017375.1| hypothetical protein ARB_04255 ...   415   e-113   Arthroderma benhamiae CBS 112371
gi|451846165|gb|EMD59476.1| glycosyltransferase family 39 protei...   414   e-113   Bipolaris sorokiniana ND90Pr
gi|451994859|gb|EMD87328.1| glycosyltransferase family 39 protei...   413   e-113   Bipolaris maydis C5
gi|15011522|gb|AAK77607.1|AF396953_1 protein O-mannosyl transfer...   413   e-113   Aspergillus awamori
gi|471872537|emb|CCO36440.1| dolichyl-phosphate-mannose-proteinm...   412   e-112   Rhizoctonia solani AG-1 IB
gi|402218221|gb|EJT98298.1| glycosyltransferase family 39 protei...   412   e-112   Dacryopinax primogenitus
gi|401885936|gb|EJT50015.1| dolichyl-phosphate-mannose-protein m...   411   e-112   Trichosporon asahii var. asahii CBS 2479
gi|406697559|gb|EKD00818.1| dolichyl-phosphate-mannose-protein m...   411   e-112   Trichosporon asahii var. asahii CBS 8904
gi|327297568|ref|XP_003233478.1| O-mannosyl transferase [Trichop...   411   e-112   Trichophyton rubrum CBS 118892
gi|302657403|ref|XP_003020425.1| hypothetical protein TRV_05484 ...   411   e-112   Trichophyton verrucosum HKI 0517
gi|326472217|gb|EGD96226.1| O-mannosyl transferase [Trichophyton...   411   e-112   Trichophyton tonsurans CBS 112818
gi|512193004|gb|EPE08762.1| dolichyl-phosphate-mannose-protein m...   411   e-112   Ophiostoma piceae UAMH 11346
gi|326483272|gb|EGE07282.1| O-mannosyl transferase pmtA [Trichop...   411   e-112   Trichophyton equinum CBS 127.97
gi|471872546|emb|CCO36435.1| dolichyl-phosphate-mannose-proteinm...   411   e-112   Rhizoctonia solani AG-1 IB
gi|336367500|gb|EGN95845.1| glycosyltransferase family 39 protei...   411   e-112   Serpula lacrymans var. lacrymans S7.3
gi|145238926|ref|XP_001392110.1| dolichyl-phosphate-mannose--pro...   410   e-112   Aspergillus niger CBS 513.88
gi|164428088|ref|XP_956270.2| dolichyl-phosphate-mannose-protein...   410   e-112   Neurospora crassa OR74A
gi|328858004|gb|EGG07118.1| family 39 glycosyltransferase [Melam...   410   e-112   Melampsora larici-populina 98AG31
gi|336468287|gb|EGO56450.1| dolichyl-phosphate-mannose-protein m...   410   e-112   Neurospora tetrasperma FGSC 2508
gi|9368945|emb|CAB99175.1| probable dolichyl-phosphate-mannose--...   410   e-112   Neurospora crassa
gi|296810152|ref|XP_002845414.1| dolichyl-phosphate-mannose-prot...   410   e-112   Arthroderma otae CBS 113480
gi|121702259|ref|XP_001269394.1| protein O-mannosyl transferase ...   410   e-112   Aspergillus clavatus NRRL 1
gi|429863305|gb|ELA37779.1| protein o-mannosyl transferase [Coll...   409   e-112   Colletotrichum gloeosporioides Nara gc5
gi|46109306|ref|XP_381711.1| hypothetical protein FG01535.1 [Fus...   409   e-112   
gi|408399963|gb|EKJ79052.1| hypothetical protein FPSE_00800 [Fus...   409   e-112   Fusarium pseudograminearum CS3096
gi|500255999|gb|EON99317.1| putative dolichyl-phosphate-mannose-...   409   e-111   Phaeoacremonium minimum UCRPA7
gi|380473873|emb|CCF46073.1| glycosyltransferase family 39 [Coll...   409   e-111   Colletotrichum higginsianum
gi|310798070|gb|EFQ32963.1| dolichyl-phosphate-mannose-protein m...   407   e-111   Colletotrichum graminicola M1.001
gi|302907392|ref|XP_003049636.1| glycosyltransferase family 39 [...   407   e-111   Nectria haematococca mpVI 77-13-4
gi|396458468|ref|XP_003833847.1| similar to dolichyl phosphate-D...   407   e-111   Leptosphaeria maculans JN3
gi|58259910|ref|XP_567365.1| dolichyl-phosphate-mannose-protein ...   407   e-111   Cryptococcus neoformans var. neoformans JEC21
gi|477520408|gb|ENH72534.1| Dolichyl-phosphate-mannose--protein ...   407   e-111   Fusarium oxysporum f. sp. cubense race 1
gi|342878828|gb|EGU80117.1| hypothetical protein FOXB_09392 [Fus...   407   e-111   Fusarium oxysporum Fo5176
gi|475666795|gb|EMT64585.1| Dolichyl-phosphate-mannose--protein ...   407   e-111   Fusarium oxysporum f. sp. cubense race 4
gi|400595792|gb|EJP63582.1| dolichyl-phosphate-mannose-protein m...   407   e-111   Beauveria bassiana ARSEF 2860
gi|48479770|gb|AAT44966.1| protein O-mannosyltransferase 2 [Aspe...   407   e-111   Aspergillus fumigatus
gi|392595355|gb|EIW84678.1| glycosyltransferase family 39 protei...   407   e-111   Coniophora puteana RWD-64-598 SS2
gi|119496253|ref|XP_001264900.1| protein O-mannosyl transferase ...   407   e-111   Aspergillus fischeri NRRL 181
gi|340992645|gb|EGS23200.1| dolichyl-phosphate-mannose-protein m...   406   e-111   Chaetomium thermophilum var. thermophilum DSM 1495
gi|353238988|emb|CCA70916.1| probable dolichyl-phosphate-mannose...   406   e-111   Serendipita indica DSM 11827
gi|70991332|ref|XP_750515.1| protein O-mannosyl transferase [Asp...   406   e-111   Aspergillus fumigatus Af293
gi|212537941|ref|XP_002149126.1| protein O-mannosyl transferase ...   406   e-111   Talaromyces marneffei ATCC 18224
gi|336271891|ref|XP_003350703.1| hypothetical protein SMAC_02375...   405   e-111   Sordaria macrospora k-hell
gi|225684883|gb|EEH23167.1| O-mannosyl-transferase [Paracoccidio...   405   e-111   
gi|477528421|gb|ENH80206.1| protein o-mannosyl transferase [Coll...   405   e-110   Colletotrichum orbiculare MAFF 240422
gi|405122688|gb|AFR97454.1| dolichyl-phosphate-mannose-protein m...   405   e-110   
gi|452985856|gb|EME85612.1| glycosyltransferase family 39 protei...   405   e-110   Cercospora fijiensis CIRAD86
gi|320040582|gb|EFW22515.1| O-mannosyl transferase [Coccidioides...   405   e-110   Coccidioides posadasii str. Silveira
gi|303322440|ref|XP_003071213.1| Dolichyl-phosphate-mannose--pro...   404   e-110   Coccidioides posadasii C735 delta SOWgp
gi|315044835|ref|XP_003171793.1| dolichyl-phosphate-mannose-prot...   404   e-110   Microsporum gypseum CBS 118893
gi|226287740|gb|EEH43253.1| dolichyl-phosphate-mannose-protein m...   404   e-110   Paracoccidioides brasiliensis Pb18
gi|255931607|ref|XP_002557360.1| Pc12g05130 [Penicillium chrysog...   404   e-110   Penicillium rubens Wisconsin 54-1255
gi|320586039|gb|EFW98718.1| protein O-mannosyl transferase [Gros...   403   e-110   Grosmannia clavigera kw1407
gi|340517873|gb|EGR48116.1| glycosyltransferase family 39 [Trich...   402   e-110   Trichoderma reesei QM6a
gi|403174471|ref|XP_003333435.2| dolichyl-phosphate-mannose-prot...   402   e-110   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|261192876|ref|XP_002622844.1| dolichyl-phosphate-mannose-prot...   402   e-110   Blastomyces gilchristii SLH14081
gi|240273718|gb|EER37237.1| dolichyl-phosphate-mannose-protein m...   402   e-109   Histoplasma capsulatum H143
gi|453087664|gb|EMF15705.1| glycosyltransferase family 39 protei...   402   e-109   Sphaerulina musiva SO2202
gi|239613563|gb|EEQ90550.1| dolichyl-phosphate-mannose-protein m...   402   e-109   Blastomyces dermatitidis ER-3
gi|321262843|ref|XP_003196140.1| dolichyl-phosphate-mannose-prot...   401   e-109   Cryptococcus gattii WM276
gi|358378327|gb|EHK16009.1| glycosyltransferase family 39 protei...   401   e-109   Trichoderma virens Gv29-8
gi|119196351|ref|XP_001248779.1| hypothetical protein CIMG_02550...   401   e-109   Coccidioides immitis RS
gi|156050067|ref|XP_001590995.1| hypothetical protein SS1G_07619...   400   e-109   Sclerotinia sclerotiorum 1980 UF-70
gi|346319255|gb|EGX88857.1| dolichyl-phosphate-mannose-protein m...   400   e-109   Cordyceps militaris CM01
gi|225555541|gb|EEH03833.1| dolichyl-phosphate-mannose-protein m...   400   e-109   Histoplasma capsulatum G186AR
gi|425774255|gb|EKV12568.1| Protein O-mannosyl transferase [Peni...   400   e-109   Penicillium digitatum PHI26
gi|258569719|ref|XP_002543663.1| dolichyl-phosphate-mannose--pro...   400   e-109   Uncinocarpus reesii 1704
gi|452845997|gb|EME47930.1| glycosyltransferase family 39 protei...   400   e-109   Dothistroma septosporum NZE10
gi|402084072|gb|EJT79090.1| dolichyl-phosphate-mannose-protein m...   400   e-109   Gaeumannomyces graminis var. tritici R3-111a-1
gi|384488399|gb|EIE80579.1| hypothetical protein RO3G_05284 [Rhi...   400   e-109   Rhizopus delemar RA 99-880
gi|406865997|gb|EKD19037.1| dolichyl-phosphate-mannose-protein m...   399   e-108   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|115385953|ref|XP_001209523.1| dolichyl-phosphate-mannose--pro...   398   e-108   Aspergillus terreus NIH2624
gi|171689102|ref|XP_001909491.1| hypothetical protein [Podospora...   398   e-108   Podospora anserina S mat+
gi|71022783|ref|XP_761621.1| hypothetical protein UM05474.1 [Ust...   398   e-108   
gi|189195184|ref|XP_001933930.1| protein O-mannosyl-transferase ...   397   e-108   Pyrenophora tritici-repentis Pt-1C-BFP
gi|330925781|ref|XP_003301191.1| hypothetical protein PTT_12634 ...   397   e-108   Pyrenophora teres f. teres 0-1
gi|154288412|ref|XP_001545001.1| dolichyl-phosphate-mannose--pro...   397   e-108   Histoplasma capsulatum NAm1
gi|367035654|ref|XP_003667109.1| glycosyltransferase family 39 p...   397   e-108   Myceliophthora thermophila ATCC 42464
gi|358397085|gb|EHK46460.1| glycosyltransferase family 39 protei...   397   e-108   Trichoderma atroviride IMI 206040
gi|398407257|ref|XP_003855094.1| Dolichyl-phosphate-mannose-prot...   395   e-107   Zymoseptoria tritici IPO323
gi|116204893|ref|XP_001228257.1| hypothetical protein CHGG_10330...   395   e-107   Chaetomium globosum CBS 148.51
gi|367055346|ref|XP_003658051.1| glycosyltransferase family 39 p...   394   e-107   Thielavia terrestris NRRL 8126
gi|494824411|gb|EON61702.1| dolichyl-phosphate-mannose-protein m...   393   e-107   Coniosporium apollinis CBS 100218
gi|169596911|ref|XP_001791879.1| hypothetical protein SNOG_01229...   392   e-107   Parastagonospora nodorum SN15
gi|471561503|gb|EMR63260.1| putative dolichyl-phosphate-mannose-...   391   e-106   Eutypa lata UCREL1
gi|440631744|gb|ELR01663.1| dolichyl-phosphate-mannose-protein m...   391   e-106   Pseudogymnoascus destructans 20631-21
gi|443920103|gb|ELU40091.1| protein O-mannosyl transferase [Rhiz...   391   e-106   Rhizoctonia solani AG-1 IA
gi|470316308|gb|EMR08070.1| hypothetical protein PNEG_03510 [Pne...   390   e-106   Pneumocystis murina B123
gi|443898178|dbj|GAC75515.1| dolichyl-phosphate-mannose:protein ...   390   e-106   Moesziomyces antarcticus T-34
gi|346979040|gb|EGY22492.1| dolichyl-phosphate-mannose-protein m...   389   e-106   Verticillium dahliae VdLs.17
gi|345560349|gb|EGX43474.1| hypothetical protein AOL_s00215g210 ...   389   e-106   Arthrobotrys oligospora ATCC 24927
gi|501308867|dbj|GAC97757.1| glycosyltransferase [Pseudozyma hub...   389   e-105   Pseudozyma hubeiensis SY62
gi|388856084|emb|CCF50264.1| probable dolichyl-phosphate-mannose...   389   e-105   Ustilago hordei
gi|154317996|ref|XP_001558317.1| hypothetical protein BC1G_02981...   388   e-105   Botrytis cinerea B05.10
gi|347831485|emb|CCD47182.1| glycosyltransferase family 39 prote...   388   e-105   Botrytis cinerea T4
gi|511007747|gb|EPB89028.1| dolichyl-phosphate-mannose-protein m...   388   e-105   Mucor circinelloides f. circinelloides 1006PhL
gi|512202057|gb|EPE30885.1| MIR [Glarea lozoyensis ATCC 20868]        387   e-105   Glarea lozoyensis ATCC 20868
gi|343426349|emb|CBQ69879.1| probable dolichyl-phosphate-mannose...   386   e-105   Sporisorium reilianum SRZ2
gi|378728657|gb|EHY55116.1| dolichyl-phosphate-mannose-protein m...   385   e-104   Exophiala dermatitidis NIH/UT8656
gi|399166390|emb|CCE32809.1| probable dolichyl-phosphate-mannose...   384   e-104   Claviceps purpurea 20.1
gi|322710683|gb|EFZ02257.1| dolichyl-phosphate-mannose-protein m...   382   e-104   Metarhizium robertsii ARSEF 23
gi|511010539|gb|EPB91760.1| dolichyl-phosphate-mannose-protein m...   382   e-103   Mucor circinelloides f. circinelloides 1006PhL
gi|430811869|emb|CCJ30725.1| unnamed protein product, partial [P...   381   e-103   Pneumocystis jirovecii
gi|322692625|gb|EFY84523.1| putative dolichyl-phosphate-mannose-...   380   e-103   Metarhizium acridum CQMa 102
gi|388579301|gb|EIM19626.1| glycosyltransferase family 39 protei...   379   e-103   Wallemia mellicola CBS 633.66
gi|501756504|emb|CCG80557.1| Protein O-mannosyl transferase [Tap...   378   e-102   Taphrina deformans PYCC 5710
gi|440469185|gb|ELQ38305.1| dolichyl-phosphate-mannose-protein m...   378   e-102   Magnaporthe oryzae Y34
gi|389635487|ref|XP_003715396.1| dolichyl-phosphate-mannose-prot...   378   e-102   Magnaporthe oryzae 70-15
gi|361131365|gb|EHL03063.1| putative Dolichyl-phosphate-mannose-...   371   e-100   Glarea lozoyensis 74030
gi|505755843|gb|EOR00037.1| Dolichyl-phosphate-mannose--protein ...   365   2e-98   Wallemia ichthyophaga EXF-994
gi|384483971|gb|EIE76151.1| hypothetical protein RO3G_00855 [Rhi...   356   5e-96   Rhizopus delemar RA 99-880
gi|465795908|emb|CCV00340.1| Protein O-mannosyltransferase-like ...   352   2e-94   Malassezia sympodialis ATCC 42132
gi|328768324|gb|EGF78371.1| hypothetical protein BATDEDRAFT_2050...   344   3e-92   Batrachochytrium dendrobatidis JAM81
gi|50549415|ref|XP_502178.1| YALI0C23364p [Yarrowia lipolytica] ...   334   3e-89   Yarrowia lipolytica CLIB122
gi|302418096|ref|XP_003006879.1| dolichyl-phosphate-mannose-prot...   330   4e-88   Verticillium alfalfae VaMs.102
gi|164657398|ref|XP_001729825.1| hypothetical protein MGL_2811 [...   328   1e-87   Malassezia globosa CBS 7966
gi|406602575|emb|CCH45891.1| dolichyl-phosphate-mannose-proteinm...   313   4e-83   Wickerhamomyces ciferrii
gi|444314239|ref|XP_004177777.1| hypothetical protein TBLA_0A046...   313   6e-83   Tetrapisispora blattae CBS 6284
gi|513032850|gb|AGO12842.1| AaceriACR290Wp [Saccharomycetaceae s...   312   1e-82   Saccharomycetaceae sp. 'Ashbya aceri'
gi|50291311|ref|XP_448088.1| hypothetical protein [Candida glabr...   311   1e-82   Candida glabrata CBS 138
gi|354545592|emb|CCE42320.1| hypothetical protein CPAR2_808690 [...   311   2e-82   Candida parapsilosis
gi|156839943|ref|XP_001643657.1| hypothetical protein Kpol_1040p...   311   2e-82   Vanderwaltozyma polyspora DSM 70294
gi|349576230|dbj|GAA21402.1| K7_Pmt2p [Saccharomyces cerevisiae ...   310   5e-82   Saccharomyces cerevisiae Kyokai no. 7
gi|27469358|ref|NP_009379.2| Pmt2p [Saccharomyces cerevisiae S28...   310   5e-82   Saccharomyces cerevisiae S288c
gi|323334791|gb|EGA76163.1| Pmt2p [Saccharomyces cerevisiae AWRI...   310   6e-82   Saccharomyces cerevisiae AWRI796
gi|151941369|gb|EDN59740.1| dolichyl phosphate-D-mannose:protein...   310   6e-82   Saccharomyces cerevisiae YJM789
gi|207348012|gb|EDZ73997.1| YAL023Cp-like protein [Saccharomyces...   309   8e-82   Saccharomyces cerevisiae AWRI1631
gi|255732894|ref|XP_002551370.1| dolichyl-phosphate-mannose--pro...   309   9e-82   Candida tropicalis MYA-3404
gi|448520650|ref|XP_003868329.1| Pmt2 hypothetical protein manno...   309   1e-81   Candida orthopsilosis Co 90-125
gi|150863992|ref|XP_001382657.2| Phospho Mannno Transferase; dol...   308   2e-81   Scheffersomyces stipitis CBS 6054
gi|323306152|gb|EGA59884.1| Pmt2p [Saccharomyces cerevisiae Fost...   307   4e-81   Saccharomyces cerevisiae FostersB
gi|459365940|gb|EMG45430.1| Dolichyl-phosphate-mannose--protein ...   305   1e-80   Candida maltosa Xu316
gi|401626946|gb|EJS44859.1| pmt2p [Saccharomyces arboricola H-6]      303   8e-80   Saccharomyces arboricola H-6
gi|344232248|gb|EGV64127.1| PMT-domain-containing protein [Candi...   302   9e-80   Candida tenuis ATCC 10573
gi|320581398|gb|EFW95619.1| Protein O-mannosyltransferase [Ogata...   301   2e-79   
gi|365762199|gb|EHN03800.1| Pmt2p [Saccharomyces cerevisiae x Sa...   301   2e-79   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|260943918|ref|XP_002616257.1| hypothetical protein CLUG_03498...   301   3e-79   Clavispora lusitaniae ATCC 42720
gi|367006206|ref|XP_003687834.1| hypothetical protein TPHA_0L004...   301   3e-79   Tetrapisispora phaffii CBS 4417
gi|50311535|ref|XP_455792.1| hypothetical protein [Kluyveromyces...   300   4e-79   Kluyveromyces lactis NRRL Y-1140
gi|344301487|gb|EGW31799.1| hypothetical protein SPAPADRAFT_6239...   300   7e-79   Spathaspora passalidarum NRRL Y-27907
gi|149242363|ref|XP_001526455.1| dolichyl-phosphate-mannose-prot...   299   9e-79   Lodderomyces elongisporus NRRL YB-4239
gi|241953727|ref|XP_002419585.1| dolichyl-phosphate-D-mannose:pr...   299   1e-78   Candida dubliniensis CD36
gi|255713082|ref|XP_002552823.1| KLTH0D02266p [Lachancea thermot...   299   1e-78   Lachancea thermotolerans CBS 6340
gi|367017894|ref|XP_003683445.1| hypothetical protein TDEL_0H037...   298   2e-78   Torulaspora delbrueckii
gi|238881078|gb|EEQ44716.1| dolichyl-phosphate-mannose-protein m...   298   2e-78   Candida albicans WO-1
gi|68472223|ref|XP_719907.1| hypothetical protein CaO19.6812 [Ca...   297   3e-78   Candida albicans SC5314
gi|294658242|ref|XP_460573.2| DEHA2F04840p [Debaryomyces hanseni...   296   5e-78   Debaryomyces hansenii CBS767
gi|238597974|ref|XP_002394480.1| hypothetical protein MPER_05625...   295   1e-77   
gi|259149797|emb|CAY86601.1| Pmt3p [Saccharomyces cerevisiae EC1...   294   3e-77   Saccharomyces cerevisiae EC1118
gi|19115047|ref|NP_594135.1| protein O-mannosyltransferase Ogm2 ...   294   3e-77   Schizosaccharomyces pombe 972h-
gi|45185976|ref|NP_983692.1| ACR290Wp [Ashbya gossypii ATCC 1089...   293   5e-77   Eremothecium gossypii ATCC 10895
gi|363755572|ref|XP_003648001.1| hypothetical protein Ecym_7356 ...   293   6e-77   Eremothecium cymbalariae DBVPG#7215
gi|448099446|ref|XP_004199151.1| Piso0_002564 [Millerozyma farin...   291   2e-76   Millerozyma farinosa CBS 7064
gi|6324897|ref|NP_014966.1| Pmt3p [Saccharomyces cerevisiae S288...   291   2e-76   Saccharomyces cerevisiae S288c
gi|349581471|dbj|GAA26629.1| K7_Pmt3p [Saccharomyces cerevisiae ...   291   2e-76   Saccharomyces cerevisiae Kyokai no. 7
gi|256272582|gb|EEU07561.1| Pmt3p [Saccharomyces cerevisiae JAY291]   291   2e-76   Saccharomyces cerevisiae JAY291
gi|151945401|gb|EDN63644.1| dolichyl phosphate-D-mannose:protein...   291   2e-76   Saccharomyces cerevisiae YJM789
gi|323346365|gb|EGA80654.1| Pmt3p [Saccharomyces cerevisiae Lalv...   291   3e-76   Saccharomyces cerevisiae Lalvin QA23
gi|633652|emb|CAA58728.1| PMT3 [Saccharomyces cerevisiae]             290   7e-76   Saccharomyces cerevisiae [brewer's yeast]
gi|323307268|gb|EGA60549.1| Pmt3p [Saccharomyces cerevisiae Fost...   289   1e-75   Saccharomyces cerevisiae FostersO
gi|448103305|ref|XP_004200004.1| Piso0_002564 [Millerozyma farin...   288   3e-75   Millerozyma farinosa CBS 7064
gi|410078638|ref|XP_003956900.1| hypothetical protein KAFR_0D011...   287   3e-75   Kazachstania africana CBS 2517
gi|254581354|ref|XP_002496662.1| ZYRO0D05258p [Zygosaccharomyces...   286   8e-75   Zygosaccharomyces rouxii CBS 732
gi|365989682|ref|XP_003671671.1| hypothetical protein NDAI_0H025...   285   1e-74   Naumovozyma dairenensis CBS 421
gi|365758212|gb|EHN00065.1| Pmt3p [Saccharomyces cerevisiae x Sa...   283   8e-74   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|403218180|emb|CCK72671.1| hypothetical protein KNAG_0L00480 [...   282   1e-73   Kazachstania naganishii CBS 8797
gi|254574224|ref|XP_002494221.1| Protein O-mannosyltransferase, ...   282   2e-73   Komagataella phaffii GS115
gi|344305369|gb|EGW35601.1| hypothetical protein SPAPADRAFT_1317...   281   2e-73   Spathaspora passalidarum NRRL Y-27907
gi|254568076|ref|XP_002491148.1| Protein O-mannosyltransferase, ...   280   4e-73   Komagataella phaffii GS115
gi|401623527|gb|EJS41624.1| pmt3p [Saccharomyces arboricola H-6]      278   2e-72   Saccharomyces arboricola H-6
gi|156837076|ref|XP_001642573.1| hypothetical protein Kpol_316p8...   276   7e-72   Vanderwaltozyma polyspora DSM 70294
gi|255721445|ref|XP_002545657.1| hypothetical protein CTRG_00438...   276   1e-71   Candida tropicalis MYA-3404
gi|366996587|ref|XP_003678056.1| hypothetical protein NCAS_0I004...   275   2e-71   Naumovozyma castellii CBS 4309
gi|367004348|ref|XP_003686907.1| hypothetical protein TPHA_0H027...   273   6e-71   Tetrapisispora phaffii CBS 4417
gi|367014887|ref|XP_003681943.1| hypothetical protein TDEL_0E048...   271   3e-70   Torulaspora delbrueckii
gi|403215726|emb|CCK70225.1| hypothetical protein KNAG_0D04860 [...   270   6e-70   Kazachstania naganishii CBS 8797
gi|384496594|gb|EIE87085.1| hypothetical protein RO3G_11796 [Rhi...   270   6e-70   Rhizopus delemar RA 99-880
gi|366994482|ref|XP_003677005.1| hypothetical protein NCAS_0F016...   268   2e-69   Naumovozyma castellii CBS 4309
gi|406606320|emb|CCH42311.1| dolichyl-phosphate-mannose-proteinm...   267   4e-69   Wickerhamomyces ciferrii
gi|365982845|ref|XP_003668256.1| hypothetical protein NDAI_0A086...   267   4e-69   Naumovozyma dairenensis CBS 421
gi|320582731|gb|EFW96948.1| Protein O-mannosyltransferase [Ogata...   266   1e-68   
gi|470308139|ref|XP_004363760.1| protein-O-mannosyltransferase 2...   263   7e-68   
gi|308198020|ref|XP_001387014.2| protein mannosyltransferase [Sc...   262   1e-67   Scheffersomyces stipitis CBS 6054
gi|255711158|ref|XP_002551862.1| KLTH0B01650p [Lachancea thermot...   262   1e-67   Lachancea thermotolerans CBS 6340
gi|294656631|ref|XP_458928.2| DEHA2D10648p [Debaryomyces hanseni...   260   4e-67   Debaryomyces hansenii CBS767
gi|410083956|ref|XP_003959555.1| hypothetical protein KAFR_0K006...   259   8e-67   Kazachstania africana CBS 2517
gi|50287155|ref|XP_446007.1| hypothetical protein [Candida glabr...   259   1e-66   Candida glabrata CBS 138
gi|207340887|gb|EDZ69098.1| YOR321Wp-like protein [Saccharomyces...   258   3e-66   Saccharomyces cerevisiae AWRI1631
gi|50312059|ref|XP_456061.1| hypothetical protein [Kluyveromyces...   256   7e-66   Kluyveromyces lactis NRRL Y-1140
gi|448088827|ref|XP_004196644.1| Piso0_003868 [Millerozyma farin...   254   3e-65   Millerozyma farinosa CBS 7064
gi|365985898|ref|XP_003669781.1| hypothetical protein NDAI_0D022...   253   9e-65   Naumovozyma dairenensis CBS 421
gi|260947120|ref|XP_002617857.1| hypothetical protein CLUG_01316...   253   9e-65   Clavispora lusitaniae ATCC 42720
gi|366987797|ref|XP_003673665.1| hypothetical protein NCAS_0A072...   252   1e-64   Naumovozyma castellii CBS 4309
gi|344233863|gb|EGV65733.1| PMT-domain-containing protein [Candi...   251   4e-64   Candida tenuis ATCC 10573
gi|241954746|ref|XP_002420094.1| dolichyl-phosphate-mannose-prot...   250   5e-64   Candida dubliniensis CD36
gi|403216641|emb|CCK71137.1| hypothetical protein KNAG_0G00810 [...   249   7e-64   Kazachstania naganishii CBS 8797
gi|238881391|gb|EEQ45029.1| dolichyl-phosphate-mannose-protein m...   249   1e-63   Candida albicans WO-1
gi|410081413|ref|XP_003958286.1| hypothetical protein KAFR_0G011...   248   2e-63   Kazachstania africana CBS 2517
gi|68477313|ref|XP_717283.1| hypothetical protein CaO19.11283 [C...   248   3e-63   Candida albicans SC5314
gi|366998505|ref|XP_003683989.1| hypothetical protein TPHA_0A048...   247   4e-63   Tetrapisispora phaffii CBS 4417
gi|296413150|ref|XP_002836279.1| hypothetical protein [Tuber mel...   246   1e-62   Tuber melanosporum Mel28
gi|156848302|ref|XP_001647033.1| hypothetical protein Kpol_1050p...   244   5e-62   Vanderwaltozyma polyspora DSM 70294
gi|365760510|gb|EHN02225.1| Pmt6p [Saccharomyces cerevisiae x Sa...   243   7e-62   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|354544485|emb|CCE41209.1| hypothetical protein CPAR2_301980 [...   242   2e-61   Candida parapsilosis
gi|190344842|gb|EDK36600.2| hypothetical protein PGUG_00698 [Mey...   241   2e-61   Meyerozyma guilliermondii ATCC 6260
gi|146422773|ref|XP_001487321.1| hypothetical protein PGUG_00698...   240   5e-61   Meyerozyma guilliermondii ATCC 6260
gi|402225913|gb|EJU05973.1| glycosyltransferase family 39 protei...   240   6e-61   Dacryopinax primogenitus
gi|149237540|ref|XP_001524647.1| hypothetical protein LELG_04619...   240   7e-61   Lodderomyces elongisporus NRRL YB-4239
gi|6561139|gb|AAF16867.1|AF104916_1 protein mannosyltransferase ...   239   1e-60   Candida albicans
gi|389744218|gb|EIM85401.1| glycosyltransferase family 39 protei...   238   2e-60   Stereum hirsutum FP-91666 SS1
gi|392569121|gb|EIW62295.1| glycosyltransferase family 39 protei...   238   3e-60   Trametes versicolor FP-101664 SS1
gi|190406792|gb|EDV10059.1| dolichyl-phosphate-mannose-protein m...   237   3e-60   Saccharomyces cerevisiae RM11-1a
gi|323348459|gb|EGA82704.1| Pmt6p [Saccharomyces cerevisiae Lalv...   237   4e-60   Saccharomyces cerevisiae Lalvin QA23
gi|390341472|ref|XP_786089.3| PREDICTED: protein O-mannosyl-tran...   237   5e-60   Strongylocentrotus purpuratus [purple urchin]
gi|259146701|emb|CAY79958.1| Pmt6p [Saccharomyces cerevisiae EC1...   237   5e-60   Saccharomyces cerevisiae EC1118
gi|323308951|gb|EGA62182.1| Pmt6p [Saccharomyces cerevisiae Fost...   237   6e-60   Saccharomyces cerevisiae FostersO
gi|365765461|gb|EHN06969.1| Pmt6p [Saccharomyces cerevisiae x Sa...   236   6e-60   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|6321638|ref|NP_011715.1| Pmt6p [Saccharomyces cerevisiae S288...   236   7e-60   Saccharomyces cerevisiae S288c
gi|207344990|gb|EDZ71953.1| YGR199Wp-like protein [Saccharomyces...   236   7e-60   Saccharomyces cerevisiae AWRI1631
gi|323354864|gb|EGA86697.1| Pmt6p [Saccharomyces cerevisiae VL3]      236   8e-60   Saccharomyces cerevisiae VL3
gi|151943475|gb|EDN61786.1| dolichyl phosphate-D-mannose:protein...   236   9e-60   Saccharomyces cerevisiae YJM789
gi|213408807|ref|XP_002175174.1| dolichyl-phosphate-mannose-prot...   236   9e-60   
gi|254585857|ref|XP_002498496.1| ZYRO0G11682p [Zygosaccharomyces...   236   1e-59   Zygosaccharomyces rouxii CBS 732
gi|471893796|emb|CCO31660.1| dolichyl-phosphate-mannose-proteinm...   236   1e-59   Rhizoctonia solani AG-1 IB
gi|50291669|ref|XP_448267.1| hypothetical protein [Candida glabr...   236   1e-59   Candida glabrata CBS 138
gi|459366657|gb|EMG45940.1| hypothetical protein G210_3836 [Cand...   235   2e-59   Candida maltosa Xu316
gi|349578404|dbj|GAA23570.1| K7_Pmt6p [Saccharomyces cerevisiae ...   235   2e-59   Saccharomyces cerevisiae Kyokai no. 7
gi|256271480|gb|EEU06529.1| Pmt6p [Saccharomyces cerevisiae JAY291]   235   2e-59   Saccharomyces cerevisiae JAY291
gi|478252392|gb|ENN72818.1| hypothetical protein YQE_10621, part...   233   7e-59   Dendroctonus ponderosae
gi|332376358|gb|AEE63319.1| unknown [Dendroctonus ponderosae]         233   7e-59   Dendroctonus ponderosae
gi|336389020|gb|EGO30163.1| glycosyltransferase family 39 protei...   233   9e-59   Serpula lacrymans var. lacrymans S7.9
gi|395330763|gb|EJF63146.1| glycosyltransferase family 39 protei...   231   2e-58   Dichomitus squalens LYAD-421 SS1
gi|426198634|gb|EKV48560.1| hypothetical protein AGABI2DRAFT_678...   231   3e-58   Agaricus bisporus var. bisporus H97
gi|409081798|gb|EKM82157.1| hypothetical protein AGABI1DRAFT_355...   230   4e-58   Agaricus bisporus var. burnettii JB137-S8
gi|321474046|gb|EFX85012.1| hypothetical protein DAPPUDRAFT_3008...   230   5e-58   Daphnia pulex
gi|157137169|ref|XP_001663919.1| mannosyltransferase 1, putative...   229   8e-58   Aedes aegypti
gi|449540788|gb|EMD31776.1| glycosyltransferase family 39 protei...   229   1e-57   Gelatoporia subvermispora B
gi|393228305|gb|EJD35954.1| mannosyltransferase 1 [Auricularia d...   228   3e-57   Auricularia subglabra TFB-10046 SS5
gi|347968334|ref|XP_312249.5| AGAP002674-PA [Anopheles gambiae s...   227   4e-57   Anopheles gambiae str. PEST
gi|170106263|ref|XP_001884343.1| glycosyltransferase family 39 p...   227   6e-57   Laccaria bicolor S238N-H82
gi|392573539|gb|EIW66678.1| hypothetical protein TREMEDRAFT_4555...   226   9e-57   Tremella mesenterica DSM 1558
gi|403416537|emb|CCM03237.1| predicted protein [Fibroporia radic...   225   1e-56   Fibroporia radiculosa
gi|513188447|ref|XP_004941880.1| PREDICTED: protein O-mannosyl-t...   225   1e-56   
gi|513188453|ref|XP_004941882.1| PREDICTED: protein O-mannosyl-t...   225   2e-56   
gi|513188444|ref|XP_004941879.1| PREDICTED: protein O-mannosyl-t...   225   2e-56   
gi|513188456|ref|XP_004941883.1| PREDICTED: protein O-mannosyl-t...   225   2e-56   
gi|513188476|ref|XP_004941889.1| PREDICTED: protein O-mannosyl-t...   225   2e-56   
gi|327259306|ref|XP_003214479.1| PREDICTED: protein O-mannosyl-t...   224   3e-56   Anolis carolinensis [Carolina anole]
gi|91086799|ref|XP_973439.1| PREDICTED: similar to mannosyltrans...   224   3e-56   Tribolium castaneum [rust-red flour beetle]
gi|449504440|ref|XP_002200042.2| PREDICTED: protein O-mannosyl-t...   224   3e-56   
gi|385302605|gb|EIF46729.1| dolichyl-phosphate-mannose-protein m...   224   4e-56   Brettanomyces bruxellensis AWRI1499
gi|302673186|ref|XP_003026280.1| glycosyltransferase family 39 p...   224   4e-56   Schizophyllum commune H4-8
gi|195432490|ref|XP_002064256.1| GK20066 [Drosophila willistoni]...   223   5e-56   
gi|483519839|gb|EOB05507.1| Protein O-mannosyl-transferase 2, pa...   223   7e-56   
gi|391339827|ref|XP_003744248.1| PREDICTED: protein O-mannosyl-t...   223   1e-55   
gi|299746945|ref|XP_001839434.2| mannosyltransferase 1 [Coprinop...   222   1e-55   
gi|444320295|ref|XP_004180804.1| hypothetical protein TBLA_0E023...   222   1e-55   
gi|58266730|ref|XP_570521.1| hypothetical protein [Cryptococcus ...   222   1e-55   
gi|113680040|ref|NP_001038498.1| protein O-mannosyl-transferase ...   222   2e-55   
gi|449274822|gb|EMC83900.1| Protein O-mannosyl-transferase 2, pa...   222   2e-55   
gi|125983634|ref|XP_001355582.1| GA11548 [Drosophila pseudoobscu...   221   2e-55   
gi|472583626|gb|EMS21259.1| dolichyl-phosphate-mannose-protein m...   221   3e-55   
gi|353241619|emb|CCA73422.1| related to dolichyl-phosphate-manno...   221   3e-55   
gi|195168592|ref|XP_002025115.1| GL26758 [Drosophila persimilis]...   221   3e-55   
gi|512886758|ref|XP_004921812.1| PREDICTED: protein O-mannosyl-t...   221   4e-55   
gi|471361125|ref|XP_004371128.1| PREDICTED: protein O-mannosyl-t...   221   4e-55   
gi|126282566|ref|XP_001374120.1| PREDICTED: protein O-mannosyl-t...   220   6e-55   
gi|409049529|gb|EKM59006.1| glycosyltransferase family 39 protei...   220   6e-55   
gi|344274064|ref|XP_003408838.1| PREDICTED: protein O-mannosyl-t...   219   1e-54   
gi|312385298|gb|EFR29833.1| hypothetical protein AND_00937 [Anop...   218   2e-54   
gi|512949488|ref|XP_004837190.1| PREDICTED: protein O-mannosyl-t...   218   3e-54   
gi|512949490|ref|XP_004837191.1| PREDICTED: protein O-mannosyl-t...   218   3e-54   
gi|512852698|ref|XP_004887625.1| PREDICTED: protein O-mannosyl-t...   217   5e-54   
gi|291406713|ref|XP_002719676.1| PREDICTED: protein-O-mannosyltr...   217   5e-54   
gi|149579988|ref|XP_001508555.1| PREDICTED: protein O-mannosyl-t...   216   7e-54   
gi|305407924|dbj|BAJ15896.1| protein O-mannnosyltransferase 2 [D...   216   1e-53   
gi|195059379|ref|XP_001995623.1| GH17663 [Drosophila grimshawi] ...   216   1e-53   
gi|405119872|gb|AFR94643.1| dolichyl-phosphate-mannose-protein m...   216   1e-53   
gi|507629778|ref|XP_004698790.1| PREDICTED: protein O-mannosyl-t...   215   2e-53   
gi|393215283|gb|EJD00774.1| glycosyltransferase family 39 protei...   214   3e-53   
gi|358054342|dbj|GAA99268.1| hypothetical protein E5Q_05962 [Mix...   214   3e-53   
gi|321262617|ref|XP_003196027.1| dolichyl-phosphate-mannose--pro...   214   4e-53   
gi|241862484|ref|XP_002416386.1| mannosyltransferase 1, putative...   214   5e-53   
gi|452836944|gb|EME38887.1| glycosyltransferase family 39 protei...   214   5e-53   
gi|504144001|ref|XP_004584431.1| PREDICTED: protein O-mannosyl-t...   214   5e-53   
gi|340714118|ref|XP_003395579.1| PREDICTED: protein O-mannosyl-t...   213   6e-53   
gi|260788358|ref|XP_002589217.1| hypothetical protein BRAFLDRAFT...   213   7e-53   
gi|511003859|gb|EPB85247.1| dolichyl-phosphate-mannose-protein m...   213   8e-53   
gi|403264757|ref|XP_003924639.1| PREDICTED: protein O-mannosyl-t...   213   1e-52   
gi|507619620|ref|XP_004624952.1| PREDICTED: protein O-mannosyl-t...   212   1e-52   
gi|395827596|ref|XP_003786985.1| PREDICTED: protein O-mannosyl-t...   212   1e-52   
gi|390594940|gb|EIN04348.1| glycosyltransferase family 39 protei...   212   1e-52   
gi|296215596|ref|XP_002754196.1| PREDICTED: protein O-mannosyl-t...   212   2e-52   
gi|300798194|ref|NP_001179825.1| protein O-mannosyl-transferase ...   212   2e-52   
gi|297695601|ref|XP_002825016.1| PREDICTED: protein O-mannosyl-t...   212   2e-52   
gi|119601682|gb|EAW81276.1| protein-O-mannosyltransferase 2, iso...   211   2e-52   
gi|7527762|gb|AAF63184.1|AC007375_3 POMT2 [Homo sapiens]              211   2e-52   
gi|426377587|ref|XP_004055543.1| PREDICTED: protein O-mannosyl-t...   211   3e-52   
gi|114654130|ref|XP_510091.2| PREDICTED: protein O-mannosyl-tran...   211   3e-52   
gi|32455271|ref|NP_037514.2| protein O-mannosyl-transferase 2 [H...   211   3e-52   
gi|6492005|gb|AAF14118.1|AF105020_1 putative protein O-mannosylt...   211   3e-52   
gi|425778493|gb|EKV16618.1| Protein mannosyltransferase 1 [Penic...   211   4e-52   
gi|402221652|gb|EJU01720.1| glycosyltransferase family 39 protei...   211   4e-52   
gi|386780997|ref|NP_001247555.1| protein O-mannosyl-transferase ...   210   5e-52   
gi|498958980|ref|XP_004524402.1| PREDICTED: protein O-mannosyl-t...   210   6e-52   
gi|402876816|ref|XP_003902149.1| PREDICTED: protein O-mannosyl-t...   210   6e-52   
gi|348573431|ref|XP_003472494.1| PREDICTED: protein O-mannosyl-t...   210   7e-52   
gi|355778761|gb|EHH63797.1| hypothetical protein EGM_16837, part...   210   7e-52   
gi|392592448|gb|EIW81774.1| glycosyltransferase family 39 protei...   210   7e-52   
gi|406868440|gb|EKD21477.1| dolichyl-phosphate-mannose-protein m...   209   8e-52   
gi|388583041|gb|EIM23344.1| glycosyltransferase family 39 protei...   209   8e-52   
gi|255945045|ref|XP_002563290.1| Pc20g07670 [Penicillium chrysog...   209   9e-52   
gi|410898349|ref|XP_003962660.1| PREDICTED: protein O-mannosyl-t...   209   9e-52   
gi|332223375|ref|XP_003260845.1| PREDICTED: LOW QUALITY PROTEIN:...   209   1e-51   
gi|363755600|ref|XP_003648015.1| hypothetical protein Ecym_7372 ...   209   1e-51   
gi|336268530|ref|XP_003349029.1| hypothetical protein SMAC_06805...   209   1e-51   
gi|115402577|ref|XP_001217365.1| hypothetical protein ATEG_08779...   209   2e-51   
gi|71000555|ref|XP_754961.1| protein mannosyltransferase 1 [Aspe...   208   2e-51   
gi|119493178|ref|XP_001263808.1| protein mannosyltransferase 1 [...   208   2e-51   
gi|500254571|gb|EON98163.1| putative glycosyltransferase family ...   208   2e-51   
gi|315047182|ref|XP_003172966.1| dolichyl-phosphate-mannose-prot...   208   2e-51   
gi|50949977|emb|CAH10531.1| hypothetical protein [Homo sapiens]       208   2e-51   
gi|340370628|ref|XP_003383848.1| PREDICTED: protein O-mannosyl-t...   208   3e-51   
gi|48479754|gb|AAT44965.1| protein O-D-mannosyltransferase [Aspe...   208   3e-51   
gi|296413391|ref|XP_002836397.1| hypothetical protein [Tuber mel...   207   3e-51   
gi|512206364|gb|EPE35184.1| MIR [Glarea lozoyensis ATCC 20868]        207   5e-51   
gi|328723754|ref|XP_001946715.2| PREDICTED: protein O-mannosyl-t...   207   5e-51   
gi|307178110|gb|EFN66937.1| Protein O-mannosyl-transferase 2 [Ca...   207   6e-51   
gi|378728111|gb|EHY54570.1| dolichyl-phosphate-mannose-protein m...   207   6e-51   
gi|405971700|gb|EKC36523.1| Protein O-mannosyl-transferase 2 [Cr...   206   7e-51   
gi|332026676|gb|EGI66785.1| Protein O-mannosyl-transferase 2 [Ac...   206   9e-51   
gi|453080101|gb|EMF08153.1| glycosyltransferase family 39 protei...   206   9e-51   
gi|440633318|gb|ELR03237.1| dolichyl-phosphate-mannose-protein m...   206   9e-51   
gi|239613828|gb|EEQ90815.1| mannosyltransferase 1 [Ajellomyces d...   206   9e-51   
gi|261193675|ref|XP_002623243.1| mannosyltransferase 1 [Ajellomy...   206   9e-51   
gi|321474044|gb|EFX85010.1| hypothetical protein DAPPUDRAFT_3008...   206   1e-50   
gi|331226126|ref|XP_003325733.1| dolichyl-phosphate-mannose-prot...   206   1e-50   
gi|301781949|ref|XP_002926401.1| PREDICTED: LOW QUALITY PROTEIN:...   206   1e-50   
gi|114051267|ref|NP_001040579.1| protein O-mannosyl-transferase ...   205   1e-50   
gi|385301795|gb|EIF45959.1| dolichyl-phosphate-mannose-protein m...   205   2e-50   
gi|498934856|ref|XP_004540787.1| PREDICTED: protein O-mannosyl-t...   205   2e-50   
gi|326426950|gb|EGD72520.1| hypothetical protein PTSG_11609 [Sal...   205   2e-50   
gi|355693469|gb|EHH28072.1| hypothetical protein EGK_18414 [Maca...   205   2e-50   
gi|348520660|ref|XP_003447845.1| PREDICTED: protein O-mannosyl-t...   204   3e-50   
gi|195392626|ref|XP_002054958.1| GJ19054 [Drosophila virilis] >g...   204   3e-50   
gi|440889727|gb|ELR44692.1| Protein O-mannosyl-transferase 2, pa...   204   3e-50   
gi|505757572|gb|EOR01693.1| Dolichyl-phosphate-mannose--protein ...   204   3e-50   
gi|443692391|gb|ELT93986.1| hypothetical protein CAPTEDRAFT_1525...   204   3e-50   
gi|335292821|ref|XP_001926197.3| PREDICTED: protein O-mannosyl-t...   204   4e-50   
gi|511829034|ref|XP_004739233.1| PREDICTED: protein O-mannosyl-t...   204   4e-50   
gi|452987174|gb|EME86930.1| glycosyltransferase family 39 protei...   204   4e-50   
gi|498934852|ref|XP_004540786.1| PREDICTED: protein O-mannosyl-t...   203   6e-50   
gi|477525858|gb|ENH77730.1| dolichyl-phosphate-mannose-protein m...   203   6e-50   
gi|507530717|ref|XP_004649442.1| PREDICTED: protein O-mannosyl-t...   203   7e-50   
gi|444708823|gb|ELW49862.1| Protein O-mannosyl-transferase 2 [Tu...   203   7e-50   
gi|444316886|ref|XP_004179100.1| hypothetical protein TBLA_0B076...   203   8e-50   
gi|71024181|ref|XP_762320.1| hypothetical protein UM06173.1 [Ust...   203   9e-50   
gi|498934858|ref|XP_004540788.1| PREDICTED: protein O-mannosyl-t...   203   9e-50   
gi|70794795|ref|NP_700464.2| protein O-mannosyl-transferase 2 [M...   203   9e-50   
gi|350417293|ref|XP_003491351.1| PREDICTED: protein O-mannosyl-t...   202   1e-49   
gi|154296172|ref|XP_001548518.1| hypothetical protein BC1G_12913...   202   1e-49   
gi|195469575|ref|XP_002099712.1| GE16638 [Drosophila yakuba] >gi...   202   1e-49   
gi|485915658|gb|EOD43229.1| putative protein mannosyltransferase...   202   1e-49   
gi|472236717|gb|EMR81640.1| putative dolichyl-phosphate-mannose-...   202   1e-49   
gi|326476823|gb|EGE00833.1| dolichyl-phosphate-mannose-protein m...   202   1e-49   
gi|171676205|ref|XP_001903056.1| hypothetical protein [Podospora...   202   1e-49   
gi|156056593|ref|XP_001594220.1| hypothetical protein SS1G_04027...   202   1e-49   
gi|406695584|gb|EKC98887.1| hypothetical protein A1Q2_06858 [Tri...   202   1e-49   
gi|19171639|gb|AAL85627.1|AF246235_1 putative protein O-mannosyl...   202   1e-49   
gi|327306061|ref|XP_003237722.1| mannosyltransferase [Trichophyt...   202   1e-49   
gi|346980057|gb|EGY23509.1| dolichyl-phosphate-mannose-protein m...   202   2e-49   
gi|401889015|gb|EJT52958.1| hypothetical protein A1Q1_00705 [Tri...   202   2e-49   
gi|367041866|ref|XP_003651313.1| glycosyltransferase family 39 p...   202   2e-49   
gi|336463603|gb|EGO51843.1| hypothetical protein NEUTE1DRAFT_709...   202   2e-49   
gi|85118928|ref|XP_965543.1| hypothetical protein NCU01912 [Neur...   202   2e-49   
gi|328851930|gb|EGG01080.1| family 39 glycosyltransferase [Melam...   202   2e-49   
gi|407918498|gb|EKG11769.1| Glycosyl transferase family 39 [Macr...   201   2e-49   
gi|148670974|gb|EDL02921.1| protein-O-mannosyltransferase 2, iso...   201   2e-49   
gi|302419831|ref|XP_003007746.1| dolichyl-phosphate-mannose-prot...   201   3e-49   
gi|242813269|ref|XP_002486133.1| protein mannosyltransferase 1 [...   201   3e-49   
gi|194912068|ref|XP_001982428.1| GG12810 [Drosophila erecta] >gi...   201   4e-49   
gi|350297170|gb|EGZ78147.1| MIR-domain-containing protein [Neuro...   201   4e-49   
gi|345495435|ref|XP_001600041.2| PREDICTED: protein O-mannosyl-t...   201   4e-49   
gi|20128815|ref|NP_569858.1| protein O-mannosyltransferase 2, is...   201   4e-49   
gi|116193829|ref|XP_001222727.1| hypothetical protein CHGG_06632...   201   4e-49   
gi|426234295|ref|XP_004011132.1| PREDICTED: protein O-mannosyl-t...   200   6e-49   
gi|310794004|gb|EFQ29465.1| dolichyl-phosphate-mannose-protein m...   200   6e-49   
gi|226294582|gb|EEH50002.1| dolichyl-phosphate-mannose-protein m...   200   8e-49   
gi|225685248|gb|EEH23532.1| dolichyl-phosphate-mannose-protein m...   200   8e-49   
gi|512860794|ref|XP_004917113.1| PREDICTED: protein O-mannosyl-t...   199   9e-49   
gi|507944954|ref|XP_004681723.1| PREDICTED: protein O-mannosyl-t...   199   9e-49   
gi|472359528|ref|XP_004399379.1| PREDICTED: protein O-mannosyl-t...   199   1e-48   
gi|295663138|ref|XP_002792122.1| dolichyl-phosphate-mannose-prot...   199   1e-48   
gi|340975566|gb|EGS22681.1| hypothetical protein CTHT_0011540 [C...   199   1e-48   
gi|465963931|ref|XP_004262326.1| PREDICTED: protein O-mannosyl-t...   199   1e-48   
gi|383859512|ref|XP_003705238.1| PREDICTED: protein O-mannosyl-t...   199   1e-48   
gi|512860787|ref|XP_002938909.2| PREDICTED: protein O-mannosyl-t...   199   1e-48   
gi|195134392|ref|XP_002011621.1| GI11129 [Drosophila mojavensis]...   199   2e-48   
gi|357616666|gb|EHJ70322.1| putative mannosyltransferase 1 [Dana...   199   2e-48   
gi|470604875|ref|XP_004313623.1| PREDICTED: LOW QUALITY PROTEIN:...   198   2e-48   
gi|380478393|emb|CCF43627.1| dolichyl-phosphate-mannose-proteinm...   198   2e-48   
gi|240275187|gb|EER38702.1| dolichyl-phosphate-mannose-protein m...   198   3e-48   
gi|302505014|ref|XP_003014728.1| hypothetical protein ARB_07290 ...   198   3e-48   
gi|396469973|ref|XP_003838536.1| similar to dolichyl-phosphate-m...   198   3e-48   
gi|121704800|ref|XP_001270663.1| protein mannosyltransferase 1 [...   198   3e-48   
gi|512860790|ref|XP_004917112.1| PREDICTED: protein O-mannosyl-t...   197   3e-48   
gi|513188450|ref|XP_004941881.1| PREDICTED: protein O-mannosyl-t...   197   3e-48   
gi|302664390|ref|XP_003023825.1| hypothetical protein TRV_02022 ...   197   4e-48   
gi|300708453|ref|XP_002996405.1| hypothetical protein NCER_10050...   197   4e-48   
gi|494831216|gb|EON67708.1| dolichyl-phosphate-mannose-protein m...   197   4e-48   
gi|194225236|ref|XP_001491897.2| PREDICTED: protein O-mannosyl-t...   197   5e-48   
gi|402084830|gb|EJT79848.1| dolichyl-phosphate-mannose-protein m...   197   6e-48   
gi|345566064|gb|EGX49011.1| hypothetical protein AOL_s00079g232 ...   197   7e-48   
gi|317151146|ref|XP_001824472.2| protein mannosyltransferase 1 [...   196   7e-48   
gi|238505946|ref|XP_002384175.1| protein mannosyltransferase 1 [...   196   7e-48   
gi|83773212|dbj|BAE63339.1| unnamed protein product [Aspergillus...   196   7e-48   
gi|391868705|gb|EIT77915.1| dolichyl-phosphate-mannose,protein O...   196   9e-48   
gi|344249827|gb|EGW05931.1| Protein O-mannosyl-transferase 2 [Cr...   196   1e-47   
gi|398388599|ref|XP_003847761.1| hypothetical protein MYCGRDRAFT...   196   1e-47   
gi|354475009|ref|XP_003499722.1| PREDICTED: protein O-mannosyl-t...   196   1e-47   
gi|345803732|ref|XP_537521.3| PREDICTED: protein O-mannosyl-tran...   196   1e-47   
gi|501305938|dbj|GAC95044.1| glycosyltransferase [Pseudozyma hub...   196   1e-47   
gi|389646243|ref|XP_003720753.1| dolichyl-phosphate-mannose-prot...   195   2e-47   
gi|471574442|gb|EMR72292.1| putative glycosyltransferase family ...   195   2e-47   
gi|505829973|ref|XP_004610285.1| PREDICTED: protein O-mannosyl-t...   194   3e-47   
gi|303313077|ref|XP_003066550.1| Dolichyl-phosphate-mannose-prot...   194   3e-47   
gi|320036568|gb|EFW18507.1| dolichyl-phosphate-mannose-protein m...   194   3e-47   
gi|478504304|ref|XP_004426453.1| PREDICTED: protein O-mannosyl-t...   194   4e-47   
gi|66564240|ref|XP_623973.1| PREDICTED: protein O-mannosyl-trans...   194   4e-47   
gi|328770365|gb|EGF80407.1| hypothetical protein BATDEDRAFT_8857...   194   5e-47   
gi|194763309|ref|XP_001963775.1| GF21197 [Drosophila ananassae] ...   193   6e-47   
gi|358369134|dbj|GAA85749.1| hypothetical protein AKAW_03863 [As...   193   6e-47   
gi|258573579|ref|XP_002540971.1| hypothetical protein UREG_00484...   193   7e-47   
gi|320592584|gb|EFX05014.1| protein mannosyltransferase 1 [Grosm...   193   8e-47   
gi|443899715|dbj|GAC77044.1| dolichyl-phosphate-mannose:protein ...   193   8e-47   
gi|388857595|emb|CCF48744.1| related to dolichyl-phosphate-manno...   193   8e-47   
gi|343427919|emb|CBQ71444.1| related to dolichyl-phosphate-manno...   193   8e-47   
gi|432937196|ref|XP_004082383.1| PREDICTED: protein O-mannosyl-t...   193   8e-47   
gi|346320534|gb|EGX90134.1| protein mannosyltransferase 1 [Cordy...   193   9e-47   
gi|482804363|gb|EOA81475.1| glycosyltransferase family 39 protei...   193   9e-47   
gi|498929402|ref|XP_004518639.1| PREDICTED: protein O-mannosyltr...   192   1e-46   
gi|196012118|ref|XP_002115922.1| hypothetical protein TRIADDRAFT...   192   1e-46   
gi|351701872|gb|EHB04791.1| Protein O-mannosyl-transferase 2 [He...   192   1e-46   
gi|392864095|gb|EAS35103.2| dolichyl-phosphate-mannose-protein m...   192   1e-46   
gi|380025379|ref|XP_003696452.1| PREDICTED: protein O-mannosyl-t...   192   1e-46   
gi|119192122|ref|XP_001246667.1| dolichyl-phosphate-mannose--pro...   192   1e-46   
gi|429851575|gb|ELA26760.1| dolichyl-phosphate-mannose-protein m...   192   2e-46   
gi|145245359|ref|XP_001394947.1| protein mannosyltransferase 1 [...   191   2e-46   
gi|478252391|gb|ENN72817.1| hypothetical protein YQE_10621, part...   191   2e-46   
gi|19074049|ref|NP_584655.1| DOLICHOL-PHOSPHATE MANNOSE PROTEIN ...   191   3e-46   
gi|451852141|gb|EMD65436.1| glycosyltransferase family 39 protei...   190   6e-46   
gi|350631659|gb|EHA20030.1| hypothetical protein ASPNIDRAFT_2090...   190   6e-46   
gi|312383037|gb|EFR28269.1| hypothetical protein AND_04010 [Anop...   189   1e-45   
gi|511010155|gb|EPB91381.1| hypothetical protein HMPREF1544_0170...   189   1e-45   
gi|449302517|gb|EMC98526.1| glycosyltransferase family 39 protei...   189   2e-45   
gi|156352969|ref|XP_001622853.1| predicted protein [Nematostella...   188   2e-45   
gi|302921688|ref|XP_003053332.1| glycosyltransferase family 39 [...   188   2e-45   
gi|396080976|gb|AFN82596.1| dolichyl-phosphate-mannose-protein O...   188   3e-45   
gi|399164477|emb|CCE34612.1| related to dolichyl-phosphate-manno...   188   3e-45   
gi|384491243|gb|EIE82439.1| hypothetical protein RO3G_07144 [Rhi...   188   3e-45   
gi|431839159|gb|ELK01086.1| Protein O-mannosyl-transferase 2 [Pt...   187   3e-45   
gi|195128771|ref|XP_002008835.1| GI11591 [Drosophila mojavensis]...   187   4e-45   
gi|444317252|ref|XP_004179283.1| hypothetical protein TBLA_0B094...   187   4e-45   
gi|189202610|ref|XP_001937641.1| dolichyl-phosphate-mannose-prot...   187   6e-45   
gi|451997534|gb|EMD89999.1| glycosyltransferase family 39 protei...   187   6e-45   
gi|212544722|ref|XP_002152515.1| protein mannosyltransferase 1 [...   186   7e-45   
gi|340519741|gb|EGR49979.1| glycosyltransferase family 39 [Trich...   186   8e-45   
gi|410962711|ref|XP_003987912.1| PREDICTED: protein O-mannosyl-t...   186   8e-45   
gi|400595573|gb|EJP63368.1| glycosyltransferase family 39 [Beauv...   186   9e-45   
gi|365983524|ref|XP_003668595.1| hypothetical protein NDAI_0B031...   186   1e-44   
gi|501755428|emb|CCG81347.1| Protein mannosyltransferase 1 [Taph...   186   1e-44   
gi|511004750|gb|EPB86110.1| hypothetical protein HMPREF1544_0709...   185   2e-44   
gi|361124354|gb|EHK96454.1| putative Dolichyl-phosphate-mannose-...   185   2e-44   
gi|444316520|ref|XP_004178917.1| hypothetical protein TBLA_0B057...   184   3e-44   


>gi|395333868|gb|EJF66245.1| glycosyltransferase family 39 protein [Dichomitus squalens LYAD-421
           SS1]
          Length = 824

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 213/405 (52%), Positives = 278/405 (68%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GSEQQQV+CYH+ D NNDW+IL    E  Y+  T 
Sbjct: 417 GSRVTLKNMGWGGGLLHSHVQTYPVGSEQQQVTCYHYKDENNDWVILPRWDEAPYDPETP 476

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + F+ +GD +            SH I APVT ++ EVS YGN T+GD  DYWV+EVV D 
Sbjct: 477 LRFLKDGDAVRLQHASTTRNLHSHPIPAPVTKLNNEVSCYGNSTIGDFQDYWVVEVVDDI 536

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
              +  K              H+  GCYLR+AN VLP+WGF+QIEV+CDK NN  D++T+
Sbjct: 537 HRGSKDKYEKIHSLTTRLRLRHQASGCYLRAANAVLPQWGFKQIEVSCDKENNPGDVHTY 596

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN++LP G +  +KS FL +FWHLNV M T NNAL+P+PDKED ++S P  WP+
Sbjct: 597 WNVESHWNDRLPPGDQKLYKSPFLRDFWHLNVAMATSNNALVPDPDKEDILASKPTDWPL 656

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L VGLRM  W D + K++L+G P++WW GT SLVL       Y +RQ+RKY++  P EW 
Sbjct: 657 LRVGLRMCGWGDHQTKYYLIGTPVIWWGGTISLVLGVLTAGVYLIRQQRKYVDMEPREWE 716

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLY+GK+ ++GW+LHY+PF IMGRVTY+HHY P LYFS+LM A ++DHF  S +    +
Sbjct: 717 HFLYVGKVALVGWVLHYLPFMIMGRVTYIHHYLPTLYFSVLMLAHLLDHFVFSSRRFSQR 776

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I+FG+   +IV  FW+F+ +AFGI+ P ++    KW S WNI
Sbjct: 777 TKQIVFGVCVFVIVGTFWWFRGVAFGIDGPINDHWGLKWRSNWNI 821



>gi|392567232|gb|EIW60407.1| glycosyltransferase family 39 protein [Trametes versicolor
           FP-101664 SS1]
          Length = 822

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/405 (50%), Positives = 276/405 (68%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GSEQQQV+CYH+ D NNDW++L P  +  Y+  T 
Sbjct: 415 GSKVTLKNMGWGGGLLHSHVQTYPVGSEQQQVTCYHYKDENNDWVLLPPWDQAPYSPETP 474

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + ++ +GD I            SH I APV+ ++ EVS YGN T+GD  DYWV+EVV D 
Sbjct: 475 LRYLKDGDVIRLQHASTTRNLHSHPIPAPVSKLNNEVSCYGNATVGDYQDYWVVEVVDDI 534

Query: 121 N----TKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
           +     K              H   GCYLR+AN +LP+WGF+QIEV+C+K N+ KD++T+
Sbjct: 535 HRGHKAKFETIHSLTTRLRFKHHASGCYLRAANAILPQWGFKQIEVSCEKENDPKDVHTY 594

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN+++P G    +KS FL +FWHLNV M T NNAL+P+PDKED ++S P +WP 
Sbjct: 595 WNVESHWNDRMPAGDVRFYKSPFLRDFWHLNVAMATSNNALVPDPDKEDILASKPTEWPF 654

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L VGLRM  W D + K++L+G P++WW GT SL+L    +  Y +RQ+RK+I+  P EW 
Sbjct: 655 LHVGLRMCGWGDQQTKYYLVGTPVIWWGGTISLILGGAAVLVYFMRQQRKFIDMDPREWE 714

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLY+GK+  +GWLLHY PF IMGRVTY+HHY P LYFS+LM + + DHF  + +    +
Sbjct: 715 HFLYVGKVAAVGWLLHYAPFMIMGRVTYIHHYLPTLYFSVLMFSHLTDHFIFTSRRLSDR 774

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I+FG+   +IV  FW+F+ +A+GI+ P +E    KW S WN+
Sbjct: 775 TKQIVFGVISFIIVATFWWFRGVAWGIDGPINEHWGLKWRSNWNL 819



>gi|299752673|ref|XP_001841164.2| dolichyl-phosphate-mannose-protein mannosyltransferase [Coprinopsis
           cinerea okayama7#130]
 gi|298409946|gb|EAU80701.2| dolichyl-phosphate-mannose-protein mannosyltransferase [Coprinopsis
           cinerea okayama7#130]
          Length = 758

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/406 (51%), Positives = 277/406 (68%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW+IL   +E  ++ +  
Sbjct: 350 GSKVTLKNMGWGGGLLHSHVQTYPVGSNQQQVTCYHYKDNNNDWVILPRWEESKFDPVEG 409

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           E+ ++ +GD +            SH + APVT +++EVS YGN T+GD +DYW +EVV D
Sbjct: 410 ELRYLKHGDIVRLNHAPTTRNLHSHTVTAPVTKLNYEVSCYGNSTVGDRHDYWQVEVVDD 469

Query: 120 TNTKXX----XXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYT 175
                                 HKV+GCYLR+AN VLP+WGF+QIEV+CDK NN +D +T
Sbjct: 470 IKRGKLGPGERIHSLTTRLRFRHKVLGCYLRAANAVLPQWGFKQIEVSCDKENNPRDAHT 529

Query: 176 HWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           HWNVE HWNE+LP G+   +KS FL +FWHLNV M T NNALIP+PDKED ++S P  WP
Sbjct: 530 HWNVESHWNERLPAGNMKLYKSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPFDWP 589

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
           +L +GLRM  W D+++KF+LLG P++WW+ T SLV+       Y +R +RKY++    EW
Sbjct: 590 LLHLGLRMCGWGDNQLKFYLLGTPVIWWASTISLVVGLMTFGVYMLRWQRKYVDMDQREW 649

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---P 352
            HF+Y+GKI   GW+ HY+PF IMGRVTYLHHY P LYF++LM + ++DHF  S +    
Sbjct: 650 DHFMYVGKIAFFGWVFHYVPFLIMGRVTYLHHYLPTLYFAVLMLSHVLDHFIFSSRRFST 709

Query: 353 KTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           KTK+I+FG+   +IV  FW+FK +AFGI  P +E    +W  TWNI
Sbjct: 710 KTKSIVFGVIAGIIVFTFWWFKGVAFGIQGPINEHWGLQWRKTWNI 755



>gi|409045639|gb|EKM55119.1| glycosyltransferase family 39 protein [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 813

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/403 (51%), Positives = 279/403 (69%), Gaps = 5/403 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN+G+GGGLLHSH+  +P GS QQQV+CYH+ D NNDW++L    E  Y+   E
Sbjct: 408 GSKLTLKNVGYGGGLLHSHVQTFPVGSGQQQVTCYHYKDSNNDWVVLPRWDEPPYDPDGE 467

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + F+ +GD I            SH + APVT ++ EVS YGNET+GDD DYWV+EVV D 
Sbjct: 468 IRFLKDGDVIRLNHVPTTRNLHSHTVPAPVTKLNHEVSCYGNETIGDDKDYWVVEVVDDL 527

Query: 120 -TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
            +  K              HKV+GCYLR+AN +LP+WGF+Q+EV+CD  NN +D +T+WN
Sbjct: 528 KSREKPDRIHSLTTRMRFRHKVLGCYLRAANAILPQWGFKQVEVSCDNENNPRDAHTYWN 587

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE HWN++LP G+  ++KS FL +FWHLNV M T NNALIP+PDKED ++S P  WP L 
Sbjct: 588 VESHWNDRLPPGNAKHYKSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPFDWPFLR 647

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           +GLRM  W D++ K++LLG PI+WW GT SL+L   +L  Y +R +RKY++  P EW HF
Sbjct: 648 LGLRMCGWGDNQTKYYLLGTPIIWWGGTISLILSLVVLLVYLMRLQRKYVDMEPREWDHF 707

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKP---KTK 355
           LY+GKI  +GW LH+ PF IMGRVTY+HHY P LYFS+LM A ++DHF  + +    +TK
Sbjct: 708 LYVGKIAFLGWFLHFFPFLIMGRVTYIHHYLPTLYFSVLMLAHLIDHFAFTSRRLSNQTK 767

Query: 356 NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            I+F ++ + IV+ FW++K +AFGI+ P ++     W  TWNI
Sbjct: 768 WIVFWVWVTAIVVTFWWWKGVAFGIDGPINDHWGLHWRKTWNI 810



>gi|170103424|ref|XP_001882927.1| glycosyltransferase family 39 protein [Laccaria bicolor S238N-H82]
 gi|164642298|gb|EDR06555.1| glycosyltransferase family 39 protein [Laccaria bicolor S238N-H82]
          Length = 683

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/405 (50%), Positives = 274/405 (67%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NND+++L    E  YN    
Sbjct: 276 GSKLTLKNMGWGGGLLHSHVQSYPVGSTQQQVTCYHYKDSNNDFVVLPRWDEPPYNPNDP 335

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH + APVT +++EVS YGNET+GD++DYW +EVV D 
Sbjct: 336 IRFLKDGDVIRLNHAATTRNLHSHTVLAPVTKLNYEVSCYGNETIGDNHDYWQVEVVDDI 395

Query: 121 NT----KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
                                H+ +GCYLR+AN +LP+WGF+Q+EV+CDK NN KD++T+
Sbjct: 396 KQGPKESVDRIHSLTTRLRFKHQALGCYLRAANAILPQWGFKQVEVSCDKENNPKDVHTY 455

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN++LP G    ++S FL +FWHLNV M T NNALIP+PDKED ++S P  WP 
Sbjct: 456 WNVESHWNDRLPAGDTKFYRSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPFDWPF 515

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLRM  W D ++K++L+G PI+WW+ + SL +    L  Y +R +RKY +    EW 
Sbjct: 516 LHLGLRMCGWGDTQLKYYLMGTPIIWWASSISLFVGLFALGIYLLRWQRKYHDMDAHEWD 575

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLY+GKI   GW+ HY+PF IMGRVTYLHHY P LYF++LM A ++DHF  S K    K
Sbjct: 576 HFLYVGKIAFFGWVFHYVPFLIMGRVTYLHHYLPTLYFAVLMLAHVLDHFIFSSKLLTTK 635

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            KNI FG++  L++  FW+FK +AFGI+ P ++ K  +W S+WNI
Sbjct: 636 VKNIFFGVFAFLLLFSFWWFKGVAFGIDGPIADTKGLQWRSSWNI 680



>gi|390597618|gb|EIN07017.1| glycosyltransferase family 39 protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 690

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 210/405 (51%), Positives = 273/405 (67%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN+G+GGGLLHSH+  YP GS QQQV+CYH+ D NN W+I  P  E +Y++ + 
Sbjct: 283 GSKLTLKNVGYGGGLLHSHVQTYPVGSNQQQVTCYHYKDDNNQWIIQPPWDEPVYDSSSP 342

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + ++ +GD I            SH + APV+  + EVS YGN T+GD +DYWV+EVV D 
Sbjct: 343 LRYLKHGDVIRLQHAPTTRNLHSHNVPAPVSKHNNEVSCYGNATIGDYHDYWVVEVVDDL 402

Query: 121 N----TKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
           +     K              H+V+GCYLR+AN +LP+WGF+QIEV+CDK NN KD +T+
Sbjct: 403 HRGRREKVDRIHSLTTRMRFKHQVLGCYLRAANAILPQWGFKQIEVSCDKENNPKDTHTY 462

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWNE+LP G    + S F+ +FWHLNV M T NNALIP+PDKED ++S P  WP+
Sbjct: 463 WNVESHWNERLPPGDARYYSSPFIRDFWHLNVAMMTSNNALIPDPDKEDILASKPTDWPL 522

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLRM  W D++ K++LLG PI+WW  T SL L   +L  Y +RQ+RKY++  P EW 
Sbjct: 523 LRLGLRMCGWGDNQTKYYLLGTPIIWWGSTISLGLSLVVLGVYLLRQQRKYVDMEPREWD 582

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLY+GKI   GW LH+ PF IMGRVTYLHHY P LYF++LMAA ++DH   + +    K
Sbjct: 583 HFLYVGKIAFFGWFLHFFPFLIMGRVTYLHHYLPTLYFAVLMAAHLIDHAVFTSRRLTEK 642

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK IIFG+    IV  FW+FK +AFGI+ P +E     W  TWNI
Sbjct: 643 TKWIIFGVISFSIVACFWWFKGLAFGIDGPINEHWGLLWRKTWNI 687



>gi|389748450|gb|EIM89627.1| glycosyltransferase family 39 protein [Stereum hirsutum FP-91666
           SS1]
          Length = 766

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/407 (51%), Positives = 270/407 (66%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSRLTLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW+I     E   +   E
Sbjct: 358 GSRLTLKNMGWGGGLLHSHVQTYPVGSNQQQVTCYHYKDSNNDWVISPKWDEPPVDPQGE 417

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH I AP++ ++ EVSAYGN T+GD +DYWV+EVV D 
Sbjct: 418 IRFLEDGDVIRLVHASTTRNLHSHNIVAPISKLNNEVSAYGNATIGDFHDYWVVEVVDDV 477

Query: 121 NTKXX----XXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
                                H+  GCYLR+AN  LPEWGF+QIEV+CDK NN KDI+T+
Sbjct: 478 KRGAKGHFEKIHSLTTRLRFRHEASGCYLRAANNPLPEWGFKQIEVSCDKENNPKDIHTY 537

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWNE+LP G+   ++S FL +FWHLNV M T NNALIP+PDKED ++S P  WP 
Sbjct: 538 WNVESHWNERLPAGNAKFYRSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPTDWPW 597

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLRM  W D + K++LLG PI+WW GT SL++       Y +R +R++++    EW 
Sbjct: 598 LRLGLRMCGWGDSQTKYYLLGTPIIWWGGTLSLIVSVAATGIYVLRMQRRFVDMDAREWE 657

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLY+GKI + GW+LHY PF +MGRVTY+HHY P LYFS+LM A ++DHF  S +    +
Sbjct: 658 HFLYVGKIALFGWILHYAPFLVMGRVTYVHHYLPTLYFSVLMLAHLIDHFVFSSRRLSER 717

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           TK I+FG+  S IV  FW+FK +AFGI+ P +     +W  +WNI +
Sbjct: 718 TKWIVFGVCTSSIVFSFWWFKGVAFGIDGPINNHWGLQWRESWNIYE 764



>gi|336380210|gb|EGO21364.1| glycosyltransferase family 39 protein [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 812

 Score =  435 bits (1118), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/405 (51%), Positives = 268/405 (66%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW++L    E  YN    
Sbjct: 405 GSKITLKNMGWGGGLLHSHVQTYPAGSTQQQVTCYHYKDDNNDWVVLPRWDESEYNPNDP 464

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + F+ +GD I            SH + APVT ++ EVS YGN T+GD +DYW +EVV D 
Sbjct: 465 LHFLQDGDVIRLQHAATTRNLHSHNVPAPVTKLNNEVSCYGNATIGDYHDYWKVEVVDDI 524

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
              +  K              H  +GCYLR+AN VLP+WG++QIEV+CDK NN  D +T+
Sbjct: 525 KQGSKDKVDRIHSLTTRLRFRHDTLGCYLRAANSVLPQWGYKQIEVSCDKENNPNDPHTY 584

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN++LP      FKS FL +FWHLNV M T NNALIP+PDK+D ++S P  WP 
Sbjct: 585 WNVESHWNDRLPPADTKFFKSPFLRDFWHLNVAMMTSNNALIPDPDKDDILASNPTDWPW 644

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           + +GLRM  W D + K++LLG PI+WW G+ASLV+ F +L  Y  R +RKYI+    EW 
Sbjct: 645 MHLGLRMCGWGDHQPKYYLLGTPIIWWGGSASLVVSFIVLGVYLFRHQRKYIDMDSREWD 704

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC---KPK 353
           HFLY+GKI   GW LHY PFFIMGRVTY+HHY P LYFS+LM + ++DHF  S    K K
Sbjct: 705 HFLYVGKIAFYGWFLHYAPFFIMGRVTYVHHYLPTLYFSVLMFSHLLDHFIFSSRRWKEK 764

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I FG+   LIV  FW+F+ +A+GI+ P +E     W  +WNI
Sbjct: 765 TKKISFGVCAFLIVANFWWFRGLAWGIDGPINEHWGLLWRKSWNI 809



>gi|449547134|gb|EMD38102.1| glycosyltransferase family 39 protein [Ceriporiopsis subvermispora
           B]
          Length = 823

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/407 (51%), Positives = 269/407 (66%), Gaps = 9/407 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  +P GSEQQQV+CYH+ D NN+W IL    +  Y+    
Sbjct: 411 GSRVTLKNMGWGGGLLHSHVQTFPVGSEQQQVTCYHYKDENNEWTILPRWDQPEYDPNGP 470

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++FV +GD +            SH I AP+T ++ EVS YGN T+GD +DYWV+EVV D 
Sbjct: 471 IKFVADGDIVRLRHVPTTRNLHSHSIPAPITKLNNEVSCYGNATIGDHHDYWVVEVVDDI 530

Query: 121 NTKXXXXX----XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
           +                    H  +GCYLR+AN +LP+WGF+QIEV+CDK NN  DI+T+
Sbjct: 531 HRGGKEHVDKIHSLTTRIRFRHHTLGCYLRAANAILPQWGFKQIEVSCDKENNPSDIHTY 590

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWNE+LP G    + S FL +FWHLNV M T NNALIP+PDKED ++S P  WP 
Sbjct: 591 WNVESHWNERLPAGDPKVYHSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPSDWPF 650

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLRM  W D + K++LLG P++WW+G  SL L   +L  Y +RQ+RK+++  P EW 
Sbjct: 651 LRLGLRMCGWGDLQTKYYLLGTPVIWWTGATSLCLAIPILIVYLMRQQRKFVDMEPREWD 710

Query: 297 HFLYIGKICVIGWLLHY--IPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK--- 351
           HFLY+GKI   G+ LHY  +PF IMGRVTY+HHY P LYF++LMAA ++DHF  S K   
Sbjct: 711 HFLYVGKIAFFGFFLHYVPVPFMIMGRVTYVHHYLPTLYFAVLMAAHLLDHFVFSSKRLT 770

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            +TK I FGI   LIV  FW+F   AFGI+ P ++    KW S W +
Sbjct: 771 DRTKAISFGICAFLIVTCFWWFSGFAFGIDGPINDQWGLKWRSVWPL 817



>gi|302690208|ref|XP_003034783.1| glycosyltransferase family 39 protein [Schizophyllum commune H4-8]
 gi|300108479|gb|EFI99880.1| glycosyltransferase family 39 protein [Schizophyllum commune H4-8]
          Length = 796

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 202/406 (49%), Positives = 269/406 (66%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GS++TLKN G+GGGLLHSH+  +P GS+QQQV+CYH+ D NN+W ++   +E  YN N  
Sbjct: 388 GSKITLKNYGYGGGLLHSHVQTFPTGSKQQQVTCYHYKDNNNEWNVMPTWEEPDYNPNDP 447

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           E+ F+ +GD I            SH I APVT +++EV+ YGN+T+GD NDYWV+E+V D
Sbjct: 448 EIRFLQDGDVIRLQHVSTGRNLHSHTIPAPVTKLNYEVAGYGNQTVGDHNDYWVVEIVDD 507

Query: 120 ----TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYT 175
               +  +              HKV+ CYLR+AN VLP+WGF+QIEV+CDK NN KD +T
Sbjct: 508 VKAGSKDQVPRVHSLTTRLRFRHKVLNCYLRAANAVLPQWGFKQIEVSCDKENNPKDTHT 567

Query: 176 HWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           +WNVE HWN++LP G    ++S FL +FWHLNV M T NNAL+P+PDKED ++S P  WP
Sbjct: 568 YWNVEGHWNDRLPAGDMKLYRSPFLRDFWHLNVAMMTSNNALVPDPDKEDILASKPFDWP 627

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
            L +GLRM  W D++ K++LLG P++WW  T SL+     L  Y +R++R+Y++    EW
Sbjct: 628 FLHLGLRMCGWGDNQTKYYLLGTPVIWWGSTLSLMGAVLALGVYVLRKQRRYVDMDAREW 687

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---P 352
            HFLY+GKI   GW LHY+PF IMGRVTYLHHY P LYF++LM   M+DHF  S +    
Sbjct: 688 DHFLYVGKIAFFGWALHYVPFLIMGRVTYLHHYLPTLYFAVLMLGHMLDHFIFSSRRFSE 747

Query: 353 KTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           KTK   FG     I   FW+FK ++FGI+ P +E     W  +WNI
Sbjct: 748 KTKLYTFGGIAFTIFACFWWFKGVSFGIDGPINEHWGLGWRKSWNI 793



>gi|407918001|gb|EKG11300.1| Glycosyl transferase family 39 [Macrophomina phaseolina MS6]
          Length = 739

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 203/402 (50%), Positives = 266/402 (66%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R E  Y    E
Sbjct: 338 GSRATIKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRFEPDYVVGEE 397

Query: 61  -VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            + F  +GD I            SH+IAAPV+   +EVS+YGN T+GD  D+W IEVVSD
Sbjct: 398 PMRFPKDGDVIRLIHAQTGRNLHSHQIAAPVSKADWEVSSYGNVTIGDSKDHWKIEVVSD 457

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             ++               H  +GCYLR+ N  LP+WGF+QIEVTC K NN +D+YTHWN
Sbjct: 458 AASRDYSKIRTLTTSFRLKHVDLGCYLRAGNVNLPQWGFKQIEVTCTKTNNPRDVYTHWN 517

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE HWN++LP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S P QWPIL 
Sbjct: 518 VESHWNDRLPAGDPGSYKSPFFRDFIHLNVAMMTSNNALVPDPDKQDDLASAPWQWPILH 577

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D+ VK+FLLGNP V+W+ TASL     ++ WY +R +R Y E  PA+    
Sbjct: 578 VGLRMCGWGDETVKYFLLGNPFVYWASTASLAGVGLIVAWYLIRWQRGYTELKPADIDQI 637

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   +IGW LHY PF  M RVTY+HHYFPALYF++L   F++D FT + + + + ++
Sbjct: 638 HYAGIYPIIGWFLHYFPFVAMARVTYVHHYFPALYFAILTFTFVVDWFTRNARTQIRWVV 697

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +GI Y++ + +F YF+DI FG+  P+++ K  KW STW + D
Sbjct: 698 YGILYTVTLGLFIYFRDITFGMQGPSAQWKHLKWFSTWRVTD 739



>gi|472585868|gb|EMS23410.1| protein o-mannosyl transferase, glycosyltransferase family 39
           protein [Rhodosporidium toruloides NP11]
          Length = 858

 Score =  428 bits (1100), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/409 (50%), Positives = 272/409 (66%), Gaps = 10/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKP--RKEQMYNNI 58
           GSR+TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NNDW +L P    +Q+    
Sbjct: 451 GSRITLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYKDENNDW-VLTPTWEADQIDLEN 509

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
            E+ F+ +GD +            SH IAAPVT +  EVS YGN T+GD NDYWV+EVV 
Sbjct: 510 GEIVFLRHGDQLRLVHASTGRNLHSHAIAAPVTKLANEVSCYGNATVGDSNDYWVVEVVD 569

Query: 119 D----TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIY 174
           D       K              H   GCYLR+AN VLP+WGF+Q+EV+C+K NN KD +
Sbjct: 570 DFLRGARHKFDRIHSLSTRLRFKHLNSGCYLRAANAVLPQWGFKQVEVSCEKENNPKDEH 629

Query: 175 THWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           T+WN+E HWNE+LP G++  ++S F  +FWHLNV M T NNAL+P+ DKED+I+S P +W
Sbjct: 630 TYWNIESHWNERLPTGNQKLYRSPFFRDFWHLNVAMMTSNNALVPDADKEDTIASKPFEW 689

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAE 294
           P L  G+RM+ W D  +K++L+GNP+ WW  +ASL+++   L W+ +R +RK  +F+P E
Sbjct: 690 PFLWNGMRMNGWQDFGIKYYLIGNPVTWWLSSASLIVWAFTLLWHLMRFQRKINDFAPGE 749

Query: 295 WIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK--- 351
           W HFLY+ KI   GW  HY PF IMGRVTYLHHY P L+FS+LMA  ++DHF    +   
Sbjct: 750 WNHFLYLSKIAFGGWFFHYFPFLIMGRVTYLHHYLPTLWFSVLMAGVLLDHFFFRSRRLT 809

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +TK ++F I    +V  +W+F+  A+GI+ PAS L  RKW  TWNI D
Sbjct: 810 GRTKTLVFAIVAGAVVGTWWWFRACAWGIHGPASNLWGRKWRKTWNIYD 858



>gi|403413793|emb|CCM00493.1| predicted protein [Fibroporia radiculosa]
          Length = 832

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/407 (49%), Positives = 270/407 (66%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+ GGLLHSH+  YP GS QQQV+CYH+ D NNDW+IL    E  Y+    
Sbjct: 425 GSKITLKNMGWAGGLLHSHVQTYPVGSNQQQVTCYHYKDENNDWIILPKWDEPSYDAAAP 484

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + F+++GDTI            SH I APV+ ++ EVS YG++ +GD +DYWV+EVV D 
Sbjct: 485 IRFLSDGDTIRLSHVSTRRNLHSHLIPAPVSKLNNEVSGYGDDKVGDFHDYWVVEVVDDL 544

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
              + +               H   GCYLR+AN +LP+WGF+QIEV+CDK NN  D++T+
Sbjct: 545 RRGSKSHVDKIHSLTTRLRLRHHATGCYLRAANAILPQWGFKQIEVSCDKDNNPGDVHTY 604

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE H NE+LP G    +++ F+ +FWHLNV M T NNAL+P+PDKED ++S P  WP 
Sbjct: 605 WNVETHTNERLPPGDHKLYRTSFIRDFWHLNVAMMTTNNALVPDPDKEDVLASKPSDWPW 664

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           + +GLRM  W   + K++LLG PIVWW GT SL +   +L  Y +R +RKY++    EW 
Sbjct: 665 MTLGLRMCGWGPTQTKYYLLGTPIVWWGGTLSLFVGVAVLALYLMRIQRKYVDMEAREWD 724

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF---TVSCKPK 353
           HFLY+ K+ ++GWLLHY+PF IMGRVTY+HHY P LYFS+LMAA ++DHF   T     +
Sbjct: 725 HFLYVSKVAMLGWLLHYVPFLIMGRVTYVHHYLPTLYFSVLMAAHLLDHFFFTTRRLSER 784

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           TK I+FG     +V  FW+F  +AFGI+ P ++    +W S+WNI D
Sbjct: 785 TKWIVFGSAAFAVVASFWWFSGVAFGIDGPINDHWGLRWRSSWNIYD 831



>gi|409080813|gb|EKM81173.1| hypothetical protein AGABI1DRAFT_119690, partial [Agaricus bisporus
           var. burnettii JB137-S8]
          Length = 747

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/409 (48%), Positives = 269/409 (65%), Gaps = 9/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSHI  YP GS QQQV+CYH+ D NN+W+IL P  E  Y+   E
Sbjct: 337 GSKVTLKNMGWGGGLLHSHIQTYPTGSNQQQVTCYHYKDNNNEWVILPPWNEAEYDPNAE 396

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD +            SH + AP++ +++EVS YGNET+GD +D W +EVV D 
Sbjct: 397 LRFLKDGDLVRLNHPATTRNLHSHTVLAPISKLNYEVSGYGNETVGDVHDIWRVEVVDDI 456

Query: 121 NT------KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIY 174
           +       K              H  +GCYLR+AN VLP+WGF+QIEV+CDK NNAKD +
Sbjct: 457 HRGKLVPGKDDDIHSLTTRLRFKHNQLGCYLRAANAVLPQWGFKQIEVSCDKENNAKDAH 516

Query: 175 THWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           T+WNVE HWN++LP G    +KS FL +FWHLNV M T NNAL+P+PDK D ++S P  W
Sbjct: 517 TYWNVESHWNDRLPAGDMKLYKSPFLRDFWHLNVAMMTSNNALVPDPDKADILASKPFDW 576

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAE 294
           P+L +GLRM  W D ++K++L+G P +WW GT SL+        Y +R +RKY +    E
Sbjct: 577 PLLHLGLRMCGWGDAQLKYYLIGTPTIWWGGTVSLIAGLATWGVYVLRWQRKYQDMDVRE 636

Query: 295 WIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF---TVSCK 351
           W HF+Y+GK+  +GW  H++PF IMGRVTY+HHY P LYFS+LM A ++DHF   T    
Sbjct: 637 WEHFMYVGKVAFLGWAFHFVPFLIMGRVTYIHHYLPTLYFSVLMLAHVLDHFVFTTPRLS 696

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            K K+I FGI   +IV  FW+F+ ++FGI  P ++    +W  TWNI +
Sbjct: 697 HKNKSIAFGICAFVIVATFWWFRGVSFGIGGPINDHWGLRWRKTWNIYE 745



>gi|426197728|gb|EKV47655.1| hypothetical protein AGABI2DRAFT_205019, partial [Agaricus bisporus
           var. bisporus H97]
          Length = 747

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/409 (48%), Positives = 268/409 (65%), Gaps = 9/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSHI  YP GS QQQV+CYH+ D NN+W+IL P  E  Y+    
Sbjct: 337 GSKVTLKNMGWGGGLLHSHIQTYPTGSNQQQVTCYHYKDNNNEWVILPPWNEAEYDPNAA 396

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + FV +GD +            SH + AP++ +++EVS YGNET+GD +D W +EVV D 
Sbjct: 397 LRFVKDGDLVRLNHPATTRNLHSHTVLAPISKLNYEVSGYGNETVGDVHDIWRVEVVDDI 456

Query: 121 NT------KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIY 174
           +       K              H  +GCYLR+AN VLP+WGF+QIEV+CDK NNAKD +
Sbjct: 457 HRGKLVPGKDDDIHSLTTRLRFKHNQLGCYLRAANAVLPQWGFKQIEVSCDKENNAKDAH 516

Query: 175 THWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           T+WNVE HWN++LP G    +KS FL +FWHLNV M T NNAL+P+PDK D ++S P  W
Sbjct: 517 TYWNVESHWNDRLPAGDMKLYKSPFLRDFWHLNVAMMTSNNALVPDPDKADILASKPFDW 576

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAE 294
           P+L +GLRM  W D ++K++L+G P +WW GT SL+        Y +R +RKY +    E
Sbjct: 577 PLLHLGLRMCGWGDAQLKYYLIGTPTIWWGGTVSLIAGLATWGVYVLRWQRKYQDMDVRE 636

Query: 295 WIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF---TVSCK 351
           W HF+Y+GK+  +GW  H++PF IMGRVTY+HHY P LYFS+LM A ++DHF   T    
Sbjct: 637 WEHFMYVGKVAFLGWAFHFVPFLIMGRVTYIHHYLPTLYFSVLMLAHVLDHFVFTTPRLS 696

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            K K+I FGI   +IV  FW+F+ ++FGI  P ++    +W  TWNI +
Sbjct: 697 HKNKSIAFGICAFVIVATFWWFRGVSFGIGGPINDHWGLRWRKTWNIYE 745



>gi|393220398|gb|EJD05884.1| glycosyltransferase family 39 protein [Fomitiporia mediterranea
           MF3/22]
          Length = 820

 Score =  425 bits (1093), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 267/407 (65%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN+G+GGGLLHSH+  YP GS QQQV+CYH+ D NN+W++L    E   +    
Sbjct: 410 GSKLTLKNVGYGGGLLHSHVQTYPVGSNQQQVTCYHYKDNNNEWVVLPKWDEPPVDLNGP 469

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + F+ +GD I            SH + AP++ ++ EVS YGN T+GD +DYW +EVV D 
Sbjct: 470 IRFLQDGDVIRLQHGPSTRNLHSHNVPAPISKLNNEVSCYGNATVGDFHDYWKVEVVDDL 529

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
                                H+ +GCYLR+AN +LPEWGF+Q+EV+C K NN  D++T 
Sbjct: 530 KRGNKDHVDRIHSLTTRMRLRHERMGCYLRAANAILPEWGFKQVEVSCTKENNPTDVHTW 589

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN++LP G    +KS FL +FWHLNV M T NNALIP+PDKED ++S P  WP 
Sbjct: 590 WNVESHWNDRLPAGDTKFYKSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASNPTDWPF 649

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L VGLRM  W D + K++LLG PI+WW+G+ +L++   +L  Y +RQ+RKY +F P EW 
Sbjct: 650 LYVGLRMCGWGDQQTKYYLLGTPIIWWAGSTALIVALVVLGVYLLRQQRKYKDFDPDEWE 709

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLY+GK+  IGW LHY PF IMGRVTY+HHY P L+FS+LM A ++DHF  + +    +
Sbjct: 710 HFLYVGKVAFIGWALHYFPFLIMGRVTYIHHYLPTLFFSVLMFAHLLDHFVFTNRRLADR 769

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           TK  +FG+    IV  FW+F+ +AFGI+ P  E     W  TWNI D
Sbjct: 770 TKWAVFGVTAFAIVANFWWFRGLAFGIDGPIKEHWGLLWRKTWNIYD 816



>gi|485925109|gb|EOD49758.1| putative dolichyl-phosphate-mannose-protein mannosyltransferase
           protein [Neofusicoccum parvum UCRNP2]
          Length = 740

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/402 (49%), Positives = 264/402 (65%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR TLKNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R +  Y     
Sbjct: 338 GSRATLKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRADPDYVVGED 397

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            + +  +G  +            SH+IAAPVT   +EVS+YGN T+GD  D+W IEVV+D
Sbjct: 398 PIRYPQDGSVVRLIHAQTGRNLHSHQIAAPVTKADWEVSSYGNVTIGDTKDHWKIEVVND 457

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             T                H  +GCYLR+ N  LP+WGF+QIEVTC K NN +D+YTHWN
Sbjct: 458 AATSDYSRIRTLTTSFRLKHIDLGCYLRAGNVNLPQWGFKQIEVTCTKTNNPRDVYTHWN 517

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE HWN++LP     ++KS F+ +F HLNV M T NNAL+P+PDK+D ++S P QWPIL 
Sbjct: 518 VESHWNDRLPASDPGSYKSPFIRDFLHLNVAMMTSNNALVPDPDKQDDLASAPWQWPILH 577

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D+ VK+FLLGNP V+W+ TASL     ++ WY +R +R Y+E  P+E    
Sbjct: 578 VGLRMCGWGDETVKYFLLGNPFVYWASTASLAGVALVIAWYLIRWQRGYVELKPSEIDQI 637

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   +IGW LHY PF  M RVTY+HHYFPALYF++L   FM+D FT + + + + ++
Sbjct: 638 HYAGIYPIIGWFLHYFPFVAMARVTYVHHYFPALYFAILSFTFMVDWFTRNARSQIRWVV 697

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y++ + +F YF+DI FG+  P ++ K  KW STW +VD
Sbjct: 698 YGVLYAITLGLFVYFRDITFGMVGPNAQWKHLKWFSTWRVVD 739



>gi|358058654|dbj|GAA95617.1| hypothetical protein E5Q_02273 [Mixia osmundae IAM 14324]
          Length = 1715

 Score =  423 bits (1088), Expect = e-116,   Method: Composition-based stats.
 Identities = 188/393 (47%), Positives = 258/393 (65%), Gaps = 7/393 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GSEQQQV+CYH+ D NN+W+I    +    +  ++
Sbjct: 454 GSKITLKNMGYGGGLLHSHVQTYPVGSEQQQVTCYHYKDSNNEWIITPTWESPAVDPNSD 513

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + ++   D +            SH + APV+ ++ EVS YGN T+GD ND+W IE+V D 
Sbjct: 514 LLYLKGTDVVRLVHEPTLRNLHSHNVPAPVSKLNMEVSCYGNATVGDSNDHWQIEIVDDF 573

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
               +                H   GCYLR+AN +LP+WGF+Q+EV+CDK NN KD +T+
Sbjct: 574 LRGGHDPQMRIHSLSTRMRFRHVNSGCYLRAANAILPQWGFKQVEVSCDKTNNKKDEHTY 633

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WN+E HWN++LP G    ++S F  +FWHLNV M T NNAL+P+PDKED I+S P+ WP 
Sbjct: 634 WNIEGHWNDRLPRGDMKLYRSPFFRDFWHLNVAMMTSNNALVPDPDKEDIIASKPMDWPF 693

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +G+RM+ W+D  VK++L+GNPIVWW G+ SL  F  LL +Y +RQ+RK  + SP +W 
Sbjct: 694 LHLGMRMNGWSDASVKYYLVGNPIVWWGGSISLFAFLGLLSFYILRQQRKINDLSPHQWA 753

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HF + G+I   GW LHY+PF IMGRVTYLHHY PAL+FS+LM   ++DHF    +   P 
Sbjct: 754 HFTHCGRIAFGGWALHYLPFLIMGRVTYLHHYLPALFFSVLMVGMLLDHFVFQSRRFAPN 813

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASE 386
            K  +F +  S IV  F +FK+ AFG+  P ++
Sbjct: 814 VKLAVFSLVASWIVGTFLWFKNTAFGLEGPITD 846



>gi|67537870|ref|XP_662709.1| hypothetical protein AN5105.2 [Aspergillus nidulans FGSC A4]
 gi|14625800|gb|AAK71510.1| dolichyl-phosphate-mannose:protein mannosyltransferase [Emericella
           nidulans]
 gi|40743096|gb|EAA62286.1| hypothetical protein AN5105.2 [Aspergillus nidulans FGSC A4]
 gi|259484550|tpe|CBF80869.1| TPA: Dolichyl-phosphate-mannose:protein mannosyltransferasePutative
           uncharacterized protein ;
           [Source:UniProtKB/TrEMBL;Acc:Q96WN5] [Aspergillus
           nidulans FGSC A4]
          Length = 740

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/401 (49%), Positives = 258/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   RKE  Y+    
Sbjct: 340 GSRVTLKNMGYGGGLLHSHVQTYPEGSSQQQVTCYHHKDANNDWFIYPNRKEPQYDAEAP 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + FV +GD I            SH I AP+T  H EVS YGN T+GDD D+W +EVV D 
Sbjct: 400 LRFVGDGDVIRLIHGQTGRNLHSHNIPAPITKNHHEVSCYGNLTIGDDKDHWKVEVVDDV 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIE TC K N  +D+YTHWN+
Sbjct: 460 ASRDRSRIRTLTTAFRLRHAVLGCYLRAGNTNLPQWGFKQIETTCVKENKPRDVYTHWNI 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H N++LP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S P QWPIL V
Sbjct: 520 ETHTNDRLPPGDPGSYKSPFFKDFVHLNVAMMTSNNALVPDPDKQDDLASKPWQWPILNV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W +  VK++LLGNP+V+W  T SL +F  L  WY VR +R Y E S A+  H  
Sbjct: 580 GLRMCSWDEKVVKYYLLGNPVVYWGSTLSLAVFGLLTLWYLVRWQRGYNELSQADIDHIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW LHY+PF  M RVTY+HHY+PALY+++L   F +D  T +   K + +++
Sbjct: 640 YAGLYPVLGWFLHYVPFIAMARVTYVHHYYPALYYAILTFGFCVDWLTKTLNTKVRFLVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+L+  VF YF+ I FGI  P+ + +   WLS W I +
Sbjct: 700 GLLYALVAGVFVYFRVIVFGIEGPSQQWRHLNWLSGWRIAN 740



>gi|242807915|ref|XP_002485056.1| protein O-mannosyl transferase [Talaromyces stipitatus ATCC 10500]
 gi|218715681|gb|EED15103.1| protein O-mannosyl transferase [Talaromyces stipitatus ATCC 10500]
          Length = 740

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/401 (50%), Positives = 263/401 (65%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+  T 
Sbjct: 340 GSRVTLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFMYPNRYQPEYDPETP 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH +AAP+T   +EVS YGN T+GD+ D+W IEVVSD 
Sbjct: 400 LRFIGDGDVIRLIHAQTGRNLHSHSVAAPITKADWEVSCYGNTTVGDEKDHWKIEVVSDA 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+ +GCYLR+    LP+WGF+QIE TC K N  +D+YTHWNV
Sbjct: 460 ASRDKSKIRTLTTAFRLRHESLGCYLRAGTVNLPQWGFKQIETTCVKENKPRDVYTHWNV 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 520 ETHVNERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP+V+W  TASLV F  +  WY +R +R Y++ SP+E     
Sbjct: 580 GLRMCSWDDNVVKYFLLGNPLVYWGSTASLVGFGLIFAWYLIRWQRGYVDLSPSEIDQIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW+LHY+PF +M RVTY+HHY+PALYF++L A F +D FT     K + +I+
Sbjct: 640 YAGVYPVIGWVLHYLPFVVMARVTYVHHYYPALYFAILTAGFCVDWFTRRLSTKVQWVIY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y  ++ +F+ FKDI FG+  P  +    KWLSTW I D
Sbjct: 700 IPLYIAVISLFFVFKDIVFGMEGPNRQWAYLKWLSTWRISD 740



>gi|482809248|gb|EOA86083.1| glycosyltransferase family 39 protein [Setosphaeria turcica Et28A]
          Length = 740

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/401 (50%), Positives = 261/401 (65%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y    E
Sbjct: 340 GSRATLKNMGYGGGLLHSHVQTYPEGSAQQQVTCYHHKDSNNDWFFYPNRHEAPYQPDEE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F  NGD I            SH++AAPVT   +EVS YGN T+GD  D+WVIEVV D 
Sbjct: 400 LRFPGNGDVIRLLHAQTGRNLHSHQVAAPVTKSDWEVSCYGNVTVGDTKDHWVIEVVRDA 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               HK +GCYLR+ N  LP+WGF+QIE TC K NN  D+YTHWN+
Sbjct: 460 ASRDYSRIRTLTTAFRLRHKDLGCYLRAGNVNLPQWGFKQIETTCVKANNPSDVYTHWNI 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G+  ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 520 ESHTNERLPPGNPGDYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP+V+W  TASL +F  ++ +Y VR +R Y +   +E     
Sbjct: 580 GLRMCGWNDDIVKYFLLGNPLVYWGSTASLGIFGLIVLFYLVRWQRGYDDLKQSEIDQIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF  MGRVTY+HHY+PAL+F++L+  F +D  T     + +  IF
Sbjct: 640 YAGLYPVIGWFLHYVPFVAMGRVTYVHHYYPALWFAILVMGFCLDFVTRKLNKQIQWGIF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y  +++++W F+ I+FG+  P+S+ K  KWL +W I D
Sbjct: 700 GVLYLAVIVLYWLFRAISFGMVGPSSQWKHLKWLESWRITD 740



>gi|169764100|ref|XP_001727950.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Aspergillus oryzae RIB40]
 gi|238490093|ref|XP_002376284.1| protein O-mannosyl transferase [Aspergillus flavus NRRL3357]
 gi|83770978|dbj|BAE61111.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220698672|gb|EED55012.1| protein O-mannosyl transferase [Aspergillus flavus NRRL3357]
 gi|391871204|gb|EIT80369.1| dolichyl-phosphate-mannose protein O-mannosyl transferase
           [Aspergillus oryzae 3.042]
          Length = 741

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/401 (49%), Positives = 265/401 (66%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSHI  YP GS QQQV+CYHH D NNDW I   R+E  Y+    
Sbjct: 341 GSRVTLKNMGYGGGLLHSHIQTYPEGSTQQQVTCYHHKDANNDWFIYPSRREPEYDPSAP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++FV +GD I            SH I+AP+T  H+EVS YGN T+GDD D+W++EVV D 
Sbjct: 401 LKFVGDGDVIRLIHGQTGRNLHSHAISAPITKSHYEVSCYGNVTIGDDKDHWLVEVVDDV 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +K               H V+GCYLR+ N  LP+WGF+QIE TC K N   D+YTHWNV
Sbjct: 461 ASKDRSKIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCVKENKPSDVYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H+N++LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 521 ESHFNDRLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ +K++LLGNP V+W  T SL +F  L+ WY VR +R Y E S A+  H  
Sbjct: 581 GLRMCSWDDNTIKYYLLGNPFVYWGSTFSLGIFGLLVIWYLVRWQRGYNELSQADINHIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW+LHY+PF +MGRVTY+HHY+PALY+++L   F +D  T +   K++ +I+
Sbjct: 641 YSGLYPVIGWILHYLPFIVMGRVTYVHHYYPALYYAILTFGFCVDWLTQTMDVKSRWVIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y++IV +F +F+ + FGI   + +     WLS W I +
Sbjct: 701 SLLYAIIVGMFVHFRVLVFGIEGSSQQWGHLDWLSGWRIAN 741



>gi|295658182|ref|XP_002789653.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226283138|gb|EEH38704.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 745

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 203/399 (50%), Positives = 257/399 (64%), Gaps = 1/399 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  YN    
Sbjct: 343 GSQATLKNMGYGGGLLHSHVQSYPEGSGQQQITCYHHKDANNDWFFYPSRDEPDYNPEAP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ + D I            SH IAAPVT   +EVS YGN T+GD  D+WVIEVV+D 
Sbjct: 403 LNFIGDKDVIRLVHAQTGRNLHSHPIAAPVTKSSYEVSGYGNTTIGDHKDHWVIEVVNDV 462

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +K               H V+GCYLR+ N  LP+WGF+QIE TC K+NN +DIYTHWNV
Sbjct: 463 ASKDRSKIRTLTTAFRLRHAVLGCYLRAGNVNLPQWGFKQIETTCVKQNNPRDIYTHWNV 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H N++LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D +SS   +WPIL V
Sbjct: 523 ESHINDRLPPGDPGSYKSPFLKDFLHLNVAMMTSNNALVPDPDKQDDLSSEFWEWPILHV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNPIV+W GTASLV+   +L WY VR +R Y E + AE  H  
Sbjct: 583 GLRMCSWEDNVVKYFLLGNPIVYWGGTASLVVLSMILLWYLVRWQRGYDELNMAEIDHIY 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    I W  HY PF  M RVTY+HHY+PALYFS+L  AF ++ FT     K +  I+
Sbjct: 643 YSGIYPAIAWFFHYFPFIAMARVTYVHHYYPALYFSILTLAFCVNWFTRKLPAKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            + Y+ ++ +F +F+DI FG+  P+S+ +   W S W I
Sbjct: 703 TVLYAAVIGLFLHFRDIVFGMEGPSSKWEHLSWFSVWRI 741



>gi|449300557|gb|EMC96569.1| glycosyltransferase family 39 protein [Baudoinia compniacensis UAMH
           10762]
          Length = 744

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/401 (48%), Positives = 259/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  ++    
Sbjct: 343 GSRATLKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDANNDWFFYPNRHEPEFDAEAP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++FV + DTI            SH++AAPVT   +EVS YGN T+GD  D+W++EVV D 
Sbjct: 403 LKFVGDKDTIRLIHAQTGRNLHSHQVAAPVTKADYEVSCYGNTTVGDTKDHWIVEVVDDA 462

Query: 121 -NTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H  + CYLR+ N  LP+WGF+QIE TC K N+ +D YTHWNV
Sbjct: 463 ASSDYSKLRTLTTAFRLKHADLNCYLRAGNVNLPQWGFKQIETTCVKENHPRDPYTHWNV 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWNEKLP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S P QWP+L V
Sbjct: 523 ESHWNEKLPPGDPGSYKSPFLRDFVHLNVAMMTSNNALVPDPDKQDDLASSPWQWPLLHV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNPIV+W  T SLV FF ++ WY++R +R + E +  +  HF 
Sbjct: 583 GLRMCGWDDHIVKYFLLGNPIVYWGSTFSLVFFFGMVAWYAIRWQRGFDELTWKQVDHFH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW LHY+PF  M RVTY+HHY+PALYF++L A F +D +T   +   +  I 
Sbjct: 643 YSGVYPVLGWFLHYLPFIAMARVTYVHHYYPALYFAILCAGFCVDWYTRDLRSGVQWGIH 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +++ +FW F+ I FG+  P  + +  +WLSTW + D
Sbjct: 703 MALYGVVIYLFWLFRAICFGMVGPNQQWQHLRWLSTWRMAD 743



>gi|393245706|gb|EJD53216.1| glycosyltransferase family 39 protein [Auricularia delicata
           TFB-10046 SS5]
          Length = 688

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/405 (47%), Positives = 265/405 (65%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  +P GS+QQQV+CYH+ D NN W IL P  E   +   E
Sbjct: 283 GSRVTLKNMGYGGGLLHSHVQSFPTGSKQQQVTCYHYKDDNNHWQILPPWGEPPVDPNGE 342

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           ++F+ + D +            SH + APVT +  EVS YGNET+GD+ND+WV+EVV D 
Sbjct: 343 IKFLQHNDVVRLQHVSTHRNLHSHAVPAPVTKLANEVSCYGNETIGDNNDHWVVEVVDDI 402

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
              +                 H+  GCYLR+AN +LP+WGF+Q+EV+CDK  +  D +T+
Sbjct: 403 KQGSRQHVKRIHSLTTRLRFKHRRFGCYLRAANVILPQWGFKQVEVSCDKDTSPSDTHTY 462

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WN+E HWN++LP      F+S F  +FWHLNV M T NNALIP+PDKED ++S P+ WP 
Sbjct: 463 WNIENHWNDRLPSADAKQFRSPFWRDFWHLNVAMMTSNNALIPDPDKEDILASKPLDWPF 522

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           + +GLRM  W D + K++LLGNP+VWW GT SL+L    L  Y++R +RKY++F PAE  
Sbjct: 523 MHLGLRMCGWGDHQTKYYLLGNPMVWWGGTVSLILAVVALGIYALRWQRKYVDFEPAELE 582

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
            +++  K+ ++GW LH++PF IMGRVTY+HHY PALYFS+L    ++D+F    +    +
Sbjct: 583 KYMFQNKVSLLGWTLHFLPFLIMGRVTYVHHYLPALYFSVLAFGMLVDNFVFQSRWLNRR 642

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            K  IF I    +V  FW+F+ +AFGI+ P  E K  +W  +WNI
Sbjct: 643 AKWTIFAIIVFAVVDTFWWFRGVAFGIDGPIGEHKGLQWRKSWNI 687



>gi|392577985|gb|EIW71113.1| hypothetical protein TREMEDRAFT_37568 [Tremella mesenterica DSM
           1558]
          Length = 823

 Score =  415 bits (1067), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/406 (47%), Positives = 268/406 (66%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN G+GGGLLHSH+   P GS QQQV+CYH+ D NN W+I    +E   +    
Sbjct: 416 GSKLTLKNYGYGGGLLHSHVQTLPVGSLQQQVTCYHYKDDNNHWVITPTWEEDPVDFDGP 475

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + ++ +GD +            SH IAAPVT  ++EVS YGN T+GDDND WV+EVV DT
Sbjct: 476 IRYLQHGDALRLVHSSTGRNLHSHSIAAPVTKENWEVSGYGNATIGDDNDIWVVEVVDDT 535

Query: 121 -----NTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYT 175
                + K              H+ + CYLR+AN VLP+WGF+Q+EV+C K NN +D++T
Sbjct: 536 HRSRKDQKDGRIHSLTTRMRFRHRTLDCYLRAANAVLPQWGFKQVEVSCVKENNPRDLHT 595

Query: 176 HWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           +WNVE HWN++LP G    +KS F  +F HLNV M+T NNAL+P+PDKED ++S P  WP
Sbjct: 596 YWNVESHWNDRLPPGDLKLYKSPFWRDFVHLNVAMWTSNNALVPDPDKEDILASKPGDWP 655

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
            L +GLRM  W D ++K++LLG PI+WW+ + SL +   L  WY +R +R+Y +++P +W
Sbjct: 656 FLRLGLRMCGWGDSQIKYYLLGTPIIWWASSVSLFVGLGLAGWYLLRMQRQYKDWAPGQW 715

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTK 355
            HFLY+GK+   GW LHY+PF IMGRVTYLHHY P L+F++LMA  ++DH   S   ++ 
Sbjct: 716 DHFLYVGKVAFFGWFLHYVPFLIMGRVTYLHHYLPTLWFAVLMAGQVLDHLIFSSPRRSH 775

Query: 356 NII---FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            +    F ++ S +V+ FW+FKD+A GI+ P  +    KW S+WNI
Sbjct: 776 TVKVTWFVLWASGVVLSFWWFKDLALGIHGPVGDHWGWKWRSSWNI 821



>gi|302510847|ref|XP_003017375.1| hypothetical protein ARB_04255 [Arthroderma benhamiae CBS 112371]
 gi|291180946|gb|EFE36730.1| hypothetical protein ARB_04255 [Arthroderma benhamiae CBS 112371]
          Length = 744

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/401 (50%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRSQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEVV D 
Sbjct: 403 ISFIGDGDVIRLIHAQTGRNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 NTK-XXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+    LP+WGF+QIE TC K N   D+YTHWN+
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP      +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 523 ESHVNERLPPSEPGTYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W  T SL +F  L+ WY +R +R Y E S AE  H  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFSLLVLWYLLRWQRGYAELSMAEIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW LHY+PF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPVVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y +I+ +F  FKDI FG+     + KS  WLS+W I +
Sbjct: 703 SVLYVIIIGLFIVFKDIVFGMEGSNQQWKSLNWLSSWKIAN 743



>gi|451846165|gb|EMD59476.1| glycosyltransferase family 39 protein [Bipolaris sorokiniana
           ND90Pr]
          Length = 740

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/401 (49%), Positives = 262/401 (65%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y    E
Sbjct: 340 GSRATLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHEVPYQPDEE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F  NGD I            SH++AAPVT   +EVS YGN T+GD  D+WV+EVV D 
Sbjct: 400 LRFPGNGDVIRLIHAQTGRNLHSHQVAAPVTKSDWEVSCYGNTTVGDTKDHWVVEVVRDA 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
           +++               HK +GCYLR+ N  LP+WGF+QIE TC K+N+ +D+YTHWN+
Sbjct: 460 SSRDYSKLRTLTTAFRLRHKDLGCYLRAGNVNLPQWGFKQIETTCTKQNSPRDVYTHWNI 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G+  ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 520 ESHTNERLPPGNPGDYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP ++W  TASL +F  ++F+Y VR +R Y +    E     
Sbjct: 580 GLRMCGWNDDIVKYFLLGNPAIYWGSTASLGIFVLIVFFYLVRWQRGYDDLKQWEIDQIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   +IGW LHY+PF  MGRVTY+HHY+PAL+F++L+  F +D  T     + +  IF
Sbjct: 640 YAGIYPIIGWFLHYVPFVAMGRVTYVHHYYPALWFAILVMGFCLDFSTRKLSKQVQWGIF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y L++ ++W+F+ I+FG+  P+S+ +  KWL +W + D
Sbjct: 700 TALYVLVIGLYWFFRAISFGMVGPSSQWRHLKWLDSWKVTD 740



>gi|451994859|gb|EMD87328.1| glycosyltransferase family 39 protein [Bipolaris maydis C5]
 gi|477589451|gb|ENI06527.1| glycosyltransferase family 39 protein [Bipolaris maydis ATCC 48331]
          Length = 740

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/401 (49%), Positives = 262/401 (65%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y    E
Sbjct: 340 GSRATLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHEVPYQPDEE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F  NGD I            SH++AAPVT   +EVS YGN T+GD  D+WV+EVV D 
Sbjct: 400 LRFPGNGDVIRLIHAQTGRNLHSHQVAAPVTKSDWEVSCYGNTTVGDTKDHWVVEVVRDA 459

Query: 121 NTKX-XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
           +++               HK +GCYLR+ N  LP+WGF+QIE TC K+N+ +D+YTHWN+
Sbjct: 460 SSRDHSRLRTLTTAFRLRHKDLGCYLRAGNVNLPQWGFKQIETTCTKQNSPRDVYTHWNI 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G+  ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 520 ESHTNERLPPGNPGDYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP ++W  TASL +F  ++F+Y VR +R Y +    E     
Sbjct: 580 GLRMCGWNDDIVKYFLLGNPAIYWGSTASLGIFVLIVFFYLVRWQRGYDDLKQWEIDQIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   +IGW LHY+PF  MGRVTY+HHY+PAL+F++L+  F +D  T     + +  IF
Sbjct: 640 YAGIYPIIGWFLHYMPFVAMGRVTYVHHYYPALWFAILVMGFCLDFSTRKLPKQVQWGIF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y L++ ++W+F+ I+FG+  P+S+ +  KWL +W + D
Sbjct: 700 TALYVLVIGLYWFFRAISFGMVGPSSQWRHLKWLDSWKVTD 740



>gi|15011522|gb|AAK77607.1|AF396953_1 protein O-mannosyl transferase [Aspergillus awamori]
 gi|358369006|dbj|GAA85622.1| protein O-mannosyl transferase [Aspergillus kawachii IFO 4308]
          Length = 741

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/401 (50%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSHI  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 341 GSRVTLKNMGYGGGLLHSHIQTYPEGSTQQQVTCYHHKDSNNDWFIYPNRYEPDYDPEDS 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + FV +GD I            SH I+APVT   FEVS YGN T+GDD D+W +EVV D 
Sbjct: 401 LRFVGDGDIIRLIHGQTGRNLHSHAISAPVTKSQFEVSCYGNITIGDDKDHWAVEVVDDV 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIE TC K N   D+YTHWNV
Sbjct: 461 ASRDRSRIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCVKENKPSDVYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H+NE+LP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 521 ESHYNERLPPGDPGSYKSPFWKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ +K++LLGNP V+W  T SL +F  L+ WY VR +R Y E + A+  H  
Sbjct: 581 GLRMCSWDDNTIKYYLLGNPFVYWGSTLSLGIFALLVLWYLVRWQRGYTELTQADIDHIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW+LHY+PF +M RVTY+HHY+PALY+++L   F +D FT     K +  I+
Sbjct: 641 YSGLYPVIGWVLHYLPFAVMARVTYVHHYYPALYYAILTFGFCVDWFTQQMSNKLRWAIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y  IV +F YF+ I FGI  P+ +     W S W I +
Sbjct: 701 TLLYCAIVGLFAYFRAIVFGIEGPSQQWSHLNWFSGWRIAN 741



>gi|471872537|emb|CCO36440.1| dolichyl-phosphate-mannose-proteinmannosyltransferase [Rhizoctonia
           solani AG-1 IB]
          Length = 407

 Score =  412 bits (1058), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/404 (48%), Positives = 264/404 (65%), Gaps = 6/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKN+G+GGGLLHSH+  YP GS+QQQV+CYH+ D NN W  + P      +   E
Sbjct: 3   GSKVTLKNVGYGGGLLHSHVQTYPVGSQQQQVTCYHYKDDNNHWAFIPPWGSPDIDPNGE 62

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +  + +G  +            SH + APVT  ++EVS YGN T+GD +D+WV+EVV D 
Sbjct: 63  LVPLQHGSVVRLQHTSTTRNLHSHTVVAPVTKSNYEVSCYGNTTVGDSHDHWVVEVVDDL 122

Query: 121 N----TKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
           +     K              H+ +GCYLR+AN VLP+WGF+QIEV+C K N+  D +T+
Sbjct: 123 HRGRREKVDRIHSLTTRLRFKHQTLGCYLRAANAVLPQWGFKQIEVSCIKENDESDAHTY 182

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN +LP G+   + S FL +FWHLN+ M T NNAL+P+PDKED ++S P +WP 
Sbjct: 183 WNVESHWNSRLPPGNAKLYSSPFLRDFWHLNIAMMTSNNALVPDPDKEDILASKPTEWPF 242

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L VGLRM  W D++VK++LLG+PIVWWSG+ +L L       Y +R +RKY++F P EW 
Sbjct: 243 LHVGLRMCGWGDEQVKYYLLGHPIVWWSGSIALGLSLFATGVYLLRAQRKYVDFGPGEWD 302

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK--PKT 354
            F Y+ K+   GW+ H+ PF IMGRVTY+HHY PAL+FS+LM   + +HF  + +   +T
Sbjct: 303 QFSYVTKLAFFGWVFHFAPFLIMGRVTYIHHYLPALWFSVLMVGHLFNHFVFAARIPERT 362

Query: 355 KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           K I+F I  S+IV VFW+F+ IAFGI  P  +     W +TWNI
Sbjct: 363 KWIVFSIAVSIIVGVFWWFRGIAFGITGPIKDYWGLGWRNTWNI 406



>gi|402218221|gb|EJT98298.1| glycosyltransferase family 39 protein [Dacryopinax sp. DJM-731 SS1]
          Length = 763

 Score =  412 bits (1058), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/406 (49%), Positives = 269/406 (66%), Gaps = 9/406 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH + YP GS+QQQV+CYH+ D NN W+++    E+ Y+   +
Sbjct: 358 GSKITLKNMGWGGGLLHSHPHSYPTGSQQQQVTCYHYKDDNNHWLVMPRWDEKEYDPNGD 417

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GDT+            SH + AP+T ++ EVS YGN T+GD  D+W +EVV D 
Sbjct: 418 LRFLQDGDTVRLIHASTGRNMHSHPLPAPITKLNNEVSCYGNATVGDHQDHWAVEVVDDL 477

Query: 121 NT----KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
           N     K              H   GCYLR+AN +LP+WG++Q+EV+C K NN +D +T+
Sbjct: 478 NMGSKDKVHRIHSLTTRLRLKHVAQGCYLRAANAILPQWGWKQVEVSCVKENNPRDAHTY 537

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN++LP G    ++S F  +FWHLNV M T NNALIP+PDKED ++S P QWP 
Sbjct: 538 WNVESHWNDRLPRGEVKLYRSPFFRDFWHLNVAMMTSNNALIPDPDKEDILASTPYQWPW 597

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L VGLRM  W D ++K++LLGNPIVWWSGTASL+L    L  Y +R +R+Y +F P +W 
Sbjct: 598 LNVGLRMCGWGDQQIKYYLLGNPIVWWSGTASLLLSLVALGVYLLRMQRRYNDFEPGQWD 657

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           H LY+GK+ +IGW LHY PF  MGRVTY+HHY PAL+FS+LM   ++DHF    K    +
Sbjct: 658 HVLYVGKVALIGWFLHYFPFLAMGRVTYIHHYLPALWFSVLMTGHLLDHFIFKSKRLSER 717

Query: 354 TKNIIFGIYYSLIVI-VFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK  +F I+ +L VI  F +F+ I FGI  P  + K   W  +WNI
Sbjct: 718 TKWTVF-IFCALAVIETFLWFRGIVFGIEGPIQDYKGLLWRKSWNI 762



>gi|401885936|gb|EJT50015.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Trichosporon asahii var. asahii CBS 2479]
          Length = 798

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/405 (47%), Positives = 266/405 (65%), Gaps = 9/405 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN G+GGGLLHSH+  +P GS+QQQV+CYH+ D NNDW++  P   +   +  E
Sbjct: 392 GSKLTLKNYGYGGGLLHSHVQTFPTGSQQQQVTCYHYKDNNNDWIVTPPWGGEF--DEEE 449

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + ++ +GD +            SH IAAPVT   +EVS YGN ++GD  D+WV+E+V DT
Sbjct: 450 LRYLKDGDVMRLVHASTGRNLHSHSIAAPVTKEAWEVSGYGNGSIGDTKDHWVVEIVDDT 509

Query: 121 NTKXXXXX----XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
           +                    HK +GCYLR+AN +LP+WGF+Q+EVTC K NN KD++T+
Sbjct: 510 SRSKKDSDGKVHALTTRMRLRHKDLGCYLRAANSILPQWGFKQVEVTCTKDNNPKDVHTY 569

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN++LP G+   +KS F  +F HLNV M+T NNALIP+PDKED ++S P  WP 
Sbjct: 570 WNVESHWNDRLPAGNAKFYKSPFWRDFSHLNVAMWTSNNALIPDPDKEDILASAPSDWPF 629

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLRM  W D ++KF+LLG PI+WW  +  +V    +  WY +R +R Y +++P EW 
Sbjct: 630 LHLGLRMCGWGDGQIKFYLLGTPIIWWFSSICVVGLLLVGLWYVLRMQRHYKDWAPGEWD 689

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC---KPK 353
           HFLY+GKI   GW  H+IPF IMGRVTYLHHY P LYF++LMA  +++ F         +
Sbjct: 690 HFLYVGKIAFGGWFFHFIPFLIMGRVTYLHHYLPTLYFAVLMAGQVLNTFIFGSPRWSER 749

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I F  + S + + FW+F+D+A GI+ P ++ K  +W  +WNI
Sbjct: 750 TKLIWFIFWTSAVFLNFWWFRDMALGIHGPINDHKGWQWRRSWNI 794



>gi|406697559|gb|EKD00818.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Trichosporon asahii var. asahii CBS 8904]
          Length = 798

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/405 (47%), Positives = 266/405 (65%), Gaps = 9/405 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN G+GGGLLHSH+  +P GS+QQQV+CYH+ D NNDW++  P   +   +  E
Sbjct: 392 GSKLTLKNYGYGGGLLHSHVQTFPTGSQQQQVTCYHYKDNNNDWIVTPPWGGEF--DEEE 449

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + ++ +GD +            SH IAAPVT   +EVS YGN ++GD  D+WV+E+V DT
Sbjct: 450 LRYLKDGDVMRLVHASTGRNLHSHSIAAPVTKEAWEVSGYGNGSIGDTKDHWVVEIVDDT 509

Query: 121 NTKXXXXX----XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
           +                    HK +GCYLR+AN +LP+WGF+Q+EVTC K NN KD++T+
Sbjct: 510 SRSKKDSDGKVHALTTRMRLRHKDLGCYLRAANSILPQWGFKQVEVTCTKDNNPKDVHTY 569

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN++LP G+   +KS F  +F HLNV M+T NNALIP+PDKED ++S P  WP 
Sbjct: 570 WNVESHWNDRLPAGNAKFYKSPFWRDFSHLNVAMWTSNNALIPDPDKEDILASAPSDWPF 629

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLRM  W D ++KF+LLG PI+WW  +  +V    +  WY +R +R Y +++P EW 
Sbjct: 630 LHLGLRMCGWGDGQIKFYLLGTPIIWWFSSICVVGLLLVGLWYVLRMQRHYKDWAPGEWD 689

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC---KPK 353
           HFLY+GKI   GW  H+IPF IMGRVTYLHHY P LYF++LMA  +++ F         +
Sbjct: 690 HFLYVGKIAFGGWFFHFIPFLIMGRVTYLHHYLPTLYFAVLMAGQVLNTFIFGSPRWSER 749

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I F  + S + + FW+F+D+A GI+ P ++ K  +W  +WNI
Sbjct: 750 TKLIWFIFWTSAVFLNFWWFRDMALGIHGPINDHKGWQWRRSWNI 794



>gi|327297568|ref|XP_003233478.1| O-mannosyl transferase [Trichophyton rubrum CBS 118892]
 gi|326464784|gb|EGD90237.1| O-mannosyl transferase [Trichophyton rubrum CBS 118892]
          Length = 744

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/401 (49%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEVV D 
Sbjct: 403 IAFIGDGDVIRLIHAQTGRNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 NTK-XXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+    LP+WGF+QIE TC K N   D+YTHWN+
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP      +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 523 ESHVNERLPPSEPGTYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W  T SL +F  L+ WY +R +R Y E S A+  H  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFSLLVLWYLLRWQRGYDELSMADIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW LHY+PF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y +I+ +F  FKDI FG+     + KS  WLS+W I +
Sbjct: 703 SVLYVVIIGLFVVFKDIVFGMEGSNQQWKSLNWLSSWKIAN 743



>gi|302657403|ref|XP_003020425.1| hypothetical protein TRV_05484 [Trichophyton verrucosum HKI 0517]
 gi|291184256|gb|EFE39807.1| hypothetical protein TRV_05484 [Trichophyton verrucosum HKI 0517]
          Length = 744

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/401 (49%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEVV D 
Sbjct: 403 ISFIGDGDVIRLIHAQTGRNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 NTK-XXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+    LP+WGF+QIE TC K N   D+YTHWN+
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP      +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 523 ESHVNERLPPSQPGTYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W  T SL +F  L+ WY +R +R Y E S A+  H  
Sbjct: 583 GLRMCSWDDNIVKYFLLGNPFVYWGSTLSLGVFSLLVLWYLLRWQRGYDELSMADIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW LHY+PF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y +I+ +F  FKDI FG+     + KS  WLS+W I +
Sbjct: 703 SVLYVVIIGLFVIFKDIVFGMEGSNQQWKSLNWLSSWKIAN 743



>gi|326472217|gb|EGD96226.1| O-mannosyl transferase [Trichophyton tonsurans CBS 112818]
          Length = 743

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/401 (49%), Positives = 256/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEVV D 
Sbjct: 403 IAFIGDGDVIRLIHAQTGRNLHSHAVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 NTK-XXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+    LP+WGF+QIE TC K N   D+YTHWN+
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP      +KS FL +F HLNV M T NNAL+P+P+K+D ++S   QWPIL V
Sbjct: 523 ESHVNERLPPSQPGTYKSPFLKDFIHLNVAMMTSNNALVPDPNKQDDLASKFWQWPILNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W  T SL +F  L+ WY +R +R Y E S A+  H  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFSLLVVWYLLRWQRGYDELSLADIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW LHY+PF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I Y++++ +F  FKDI FG+     + KS  WLSTW + +
Sbjct: 703 SILYAVVIGLFVVFKDIVFGMEGSNQQWKSLNWLSTWKVAN 743



>gi|512193004|gb|EPE08762.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ophiostoma piceae UAMH 11346]
          Length = 750

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 200/401 (49%), Positives = 252/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y +  E
Sbjct: 350 GSRVTLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDANNDWFFYPTRDEPAYESEEE 409

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             FV +   I            SHEI+APVT    EVS YGN T+GD  DYW IEV+ D 
Sbjct: 410 PTFVADNAVIRLIHAQTGRNLHSHEISAPVTKADKEVSCYGNLTVGDAKDYWKIEVLDDV 469

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGFRQIEVTC K NN +D YTHWNV
Sbjct: 470 ASRDRSRIRTLTTSFRIKHTVMGCYLRAGNVNLPQWGFRQIEVTCAKDNNPRDTYTHWNV 529

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NEKLP G+   +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 530 EAHTNEKLPAGNPGVYKSPFLRDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILNV 589

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TA L +F  L+ WY++R +R Y E S  E  H  
Sbjct: 590 GLRMCGWDDKIVKYFLLGNPLVYWGSTAGLGIFGALVAWYAIRWQRGYTELSQTEIDHIH 649

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   +IGW LHY+PF IM RVTY+HHY+PALYF++L   F+ D F  +     + + F
Sbjct: 650 YAGIYPIIGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLADWFLKARNAIIRIVAF 709

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G  Y++ + ++ YF  I +G+  P+++    KW   W I D
Sbjct: 710 GALYAVTIGLYVYFIPICWGMTGPSAQYSYMKWFENWRISD 750



>gi|326483272|gb|EGE07282.1| O-mannosyl transferase pmtA [Trichophyton equinum CBS 127.97]
          Length = 743

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/401 (49%), Positives = 256/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEVV D 
Sbjct: 403 IAFIGDGDVIRLIHAQTGRNLHSHAVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 NTK-XXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+    LP+WGF+QIE TC K N   D+YTHWN+
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP      +KS FL +F HLNV M T NNAL+P+P+K+D ++S   QWPIL V
Sbjct: 523 ESHVNERLPPSQPGTYKSPFLKDFIHLNVAMMTSNNALVPDPNKQDDLASKFWQWPILNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W  T SL +F  L+ WY +R +R Y E S A+  H  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFSLLVVWYLLRWQRGYDELSLADIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW LHY+PF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I Y++++ +F  FKDI FG+     + KS  WLSTW + +
Sbjct: 703 SILYAVVIGLFVVFKDIVFGMEGSNQQWKSLNWLSTWKVAN 743



>gi|471872546|emb|CCO36435.1| dolichyl-phosphate-mannose-proteinmannosyltransferase [Rhizoctonia
           solani AG-1 IB]
          Length = 407

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/404 (47%), Positives = 265/404 (65%), Gaps = 6/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKN+G+GGGLLHSH+  YP GS+QQQV+CYH+ D NN W+ + P      +   E
Sbjct: 3   GSKVTLKNVGYGGGLLHSHVQTYPVGSQQQQVTCYHYKDDNNHWVFIPPWGSPDIDPNGE 62

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +  + +G  +            SH + APVT  ++EVS YGN T+GD +D+WV+EVV D 
Sbjct: 63  LVPLQHGSVVRLQHTSTTRNLHSHTVVAPVTKSNYEVSCYGNTTVGDSHDHWVVEVVDDL 122

Query: 121 N----TKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
           +     K              H+ +GCYLR+AN VLP+WGF+QIEV+C K N+  D +T+
Sbjct: 123 HRGRREKVDRIHSLTTRLRFRHQSLGCYLRAANAVLPQWGFKQIEVSCIKENDESDTHTY 182

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN +LP G+   + S FL +FWHLN+ M T NNAL+P+PDKED ++S P +WP 
Sbjct: 183 WNVESHWNSRLPPGNAKLYSSPFLRDFWHLNIAMMTSNNALVPDPDKEDILASKPTEWPF 242

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L VGLRM  W D++VK++LLG+PIVWWSG+ +L L       Y +R +RKY++F P EW 
Sbjct: 243 LHVGLRMCGWGDEQVKYYLLGHPIVWWSGSIALGLSLFATGVYLLRAQRKYVDFGPGEWD 302

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK--PKT 354
            F Y+ K+   GW+ H+ PF IMGRVTY+HHY PAL+FS+LM   + +HF  + +   +T
Sbjct: 303 QFSYVTKLAFFGWVFHFAPFLIMGRVTYIHHYLPALWFSVLMVGHLFNHFVFAARIPERT 362

Query: 355 KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           K I+F +  S+IV VFW+F+ IAFGI  P  +     W +TWNI
Sbjct: 363 KWIVFSVAVSIIVGVFWWFRGIAFGITGPIKDYWGLGWRNTWNI 406



>gi|336367500|gb|EGN95845.1| glycosyltransferase family 39 protein [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 417

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/405 (49%), Positives = 259/405 (63%), Gaps = 21/405 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW++L    E  YN    
Sbjct: 24  GSKITLKNMGWGGGLLHSHVQTYPAGSTQQQVTCYHYKDDNNDWVVLPRWDESEYNPNDP 83

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + F+ +GD I            SH + APVT ++ EVS YGN T+GD +DYW +EVV D 
Sbjct: 84  LHFLQDGDVIRLQHAATTRNLHSHNVPAPVTKLNNEVSCYGNATIGDYHDYWKVEVVDDI 143

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
              +  K              H  +GCYLR+AN VLP+WG++QIEV+CDK NN  D +T+
Sbjct: 144 KQGSKDKVDRIHSLTTRLRFRHDTLGCYLRAANSVLPQWGYKQIEVSCDKENNPNDPHTY 203

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN++LP      FKS FL +FWHLNV M T NNALIP+PDK+D ++S P  WP 
Sbjct: 204 WNVESHWNDRLPPADTKFFKSPFLRDFWHLNVAMMTSNNALIPDPDKDDILASNPTDWPW 263

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           + +GLRM  W D + K++LLG PI+WW G+ASLV+ F +L  Y  R +RKYI+    EW 
Sbjct: 264 MHLGLRMCGWGDHQPKYYLLGTPIIWWGGSASLVVSFIVLGVYLFRHQRKYIDMDSREWD 323

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC---KPK 353
           HFLY+GKI   GW LHY PFFIMGRVTY+HHY P LYFS+LM + ++DHF  S    K K
Sbjct: 324 HFLYVGKIAFYGWFLHYAPFFIMGRVTYVHHYLPTLYFSVLMFSHLLDHFIFSSRRWKEK 383

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK                +F+ +A+GI+ P +E     W  +WNI
Sbjct: 384 TKKN--------------FFRGLAWGIDGPINEHWGLLWRKSWNI 414



>gi|145238926|ref|XP_001392110.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Aspergillus niger CBS 513.88]
 gi|134076611|emb|CAK45164.1| protein O-mannosyl transferase pmtA-Aspergillus niger
 gi|350636019|gb|EHA24380.1| hypothetical protein ASPNIDRAFT_53120 [Aspergillus niger ATCC 1015]
          Length = 741

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/401 (49%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSHI  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 341 GSRVTLKNMGYGGGLLHSHIQTYPEGSTQQQVTCYHHKDSNNDWFIYPNRYEPDYDPEGS 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + FV +GD I            SH I+APVT   FEVS YGN T+GDD D+W +EVV D 
Sbjct: 401 LRFVGDGDIIRLIHGQTGRNLHSHAISAPVTKSQFEVSCYGNITIGDDKDHWAVEVVDDV 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIE TC K N   D+YTHWNV
Sbjct: 461 ASRDRSKIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCVKENKPSDVYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H+NE+LP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 521 ESHYNERLPPGDPGSYKSPFWKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ +K++LLGNP V+W  T SL +F  L+ WY VR +R Y E + A+  H  
Sbjct: 581 GLRMCSWDDNTIKYYLLGNPFVYWGSTLSLGVFALLVLWYLVRWQRGYTELTQADIDHIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW+LHY+PF +M RVTY+HHY+PALY+++L   F +D FT     K +  I+
Sbjct: 641 YSGLYPVIGWVLHYLPFAVMARVTYVHHYYPALYYAILTFGFCVDWFTQRMSNKLRWAIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y  I+ +F YF+ I FGI  P+ +     W + W I +
Sbjct: 701 TLLYCAIISLFAYFRAIVFGIEGPSQQWSHLNWFNGWRIAN 741



>gi|164428088|ref|XP_956270.2| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Neurospora crassa OR74A]
 gi|157072006|gb|EAA27034.2| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Neurospora crassa OR74A]
          Length = 750

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/402 (49%), Positives = 258/402 (64%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+EQ Y+ N  
Sbjct: 349 GSRVTIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWFFYPNRREQAYDENSD 408

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           E+ ++ +G T+            SHEI AP+T    EVS YGN T+GD+ D+W IEVV D
Sbjct: 409 EIRYIGDGSTVRLIHAQTGRNLHSHEIPAPMTKSDKEVSCYGNLTVGDEKDHWKIEVVKD 468

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
           TN++               H+V+GCYLR+    LP+WGF+QIE TC K NN +D YTHWN
Sbjct: 469 TNSRDRSKIRTLTTAFRLKHEVLGCYLRAGTVNLPQWGFKQIETTCTKTNNPRDTYTHWN 528

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE H N KLP      +KS+FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 529 VESHTNPKLPPAEPGQYKSQFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 588

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D  VK+FLLGNP+V+W  TA+L +F  L+ WY++R +R Y E         
Sbjct: 589 VGLRMCSWDDKTVKYFLLGNPLVYWGSTAALGVFGLLVVWYTLRWQRGYKELGQDGIDQI 648

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   VIGW LHY+PF +MGRVTY+HHY+PALYF++L   F+ D F  +    T+ I 
Sbjct: 649 HYAGVYPVIGWFLHYLPFIVMGRVTYVHHYYPALYFAILCFGFLADWFLRAKSKLTQGIA 708

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +GI Y+ ++ ++ +F  I++G+  P  + K  KW   W I D
Sbjct: 709 YGILYATVIGLYIFFMPISWGMVGPNQQYKYMKWFDNWRISD 750



>gi|328858004|gb|EGG07118.1| family 39 glycosyltransferase [Melampsora larici-populina 98AG31]
          Length = 707

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/407 (47%), Positives = 266/407 (65%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T KNMG+GGGLLHSH+  +P GS+QQQV+CYH+ D NN+WMI     E+ Y+    
Sbjct: 296 GSRVTFKNMGYGGGLLHSHVQTFPVGSQQQQVTCYHYRDNNNEWMITPLLHEEPYSESQP 355

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + F+ +GD +            SHEI AP+T V+ EV+ YGN T+ D N YWVIEV+ D 
Sbjct: 356 IRFLKHGDVVRLVHIMTGRNLHSHEIPAPITKVNKEVACYGNATIDDSNSYWVIEVIDDI 415

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
                 +              H  +GCYL++ N+VLP+WGF+Q+EV+CDK+NN  D +T 
Sbjct: 416 LRGKKERFQHINTLSTRFRIRHLNLGCYLKADNKVLPQWGFKQVEVSCDKKNNPNDKHTF 475

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE H N +LP G     KS FLH+FWHLN+ M T NNALIP+PDK+D+I+S P +WP 
Sbjct: 476 WNVESHMNGRLPPGDMKVMKSPFLHDFWHLNIAMMTSNNALIPDPDKQDAIASHPFEWPF 535

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L  G+RM+ W ++ +KF+L+GNPI WW+ + SL+++   L WY  R KR++ + S A+W 
Sbjct: 536 LYTGMRMNGWFENGIKFYLIGNPITWWTSSFSLLVYSVGLVWYLARFKRQFNDLSLAQWD 595

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF---TVSCKPK 353
            F+++GK+ + GWLLHY+PF  MGRVTYLHHY P L+F+++      DHF   + + KP 
Sbjct: 596 QFIWVGKVGLGGWLLHYLPFLFMGRVTYLHHYLPTLWFAIITCGLCFDHFIFRSKTIKPI 655

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            K IIF +  SLI     +FKD A+GI  P ++ K R+W  +WNI D
Sbjct: 656 HKKIIFYLMASLITFTGIWFKDCAWGIEGPINQYKGRQWRKSWNIYD 702



>gi|336468287|gb|EGO56450.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Neurospora tetrasperma FGSC 2508]
 gi|350289460|gb|EGZ70685.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Neurospora tetrasperma FGSC 2509]
          Length = 750

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/402 (49%), Positives = 258/402 (64%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+EQ Y+ N  
Sbjct: 349 GSRVTIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWFFYPNRREQAYDENSD 408

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           E+ ++ +G T+            SHEI AP+T    EVS YGN T+GD+ D+W IEVV D
Sbjct: 409 EIRYIGDGSTVRLIHAQTGRNLHSHEIPAPMTKSDKEVSCYGNLTVGDEKDHWKIEVVKD 468

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
           TN++               H+V+GCYLR+    LP+WGF+QIE TC K NN +D YTHWN
Sbjct: 469 TNSRDRSKIRTLTTAFRLKHEVLGCYLRAGTVNLPQWGFKQIETTCTKTNNPRDTYTHWN 528

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE H N KLP      +KS+FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 529 VESHTNPKLPPAEPGQYKSQFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 588

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D  VK+FLLGNP+V+W  TA+L +F  L+ WY++R +R Y E         
Sbjct: 589 VGLRMCSWDDKTVKYFLLGNPLVYWGSTAALGVFGLLVVWYTLRWQRGYKELGQDGIDQI 648

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   VIGW LHY+PF +MGRVTY+HHY+PALYF++L   F+ D F  +    T+ I 
Sbjct: 649 HYAGVYPVIGWFLHYLPFIVMGRVTYVHHYYPALYFAILCFGFLADWFLRAKSKLTQGIA 708

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +GI Y+ ++ ++ +F  I++G+  P  + K  KW   W I D
Sbjct: 709 YGILYATVIGLYIFFMPISWGMVGPNQQYKYMKWFDNWRISD 750



>gi|9368945|emb|CAB99175.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Neurospora crassa]
          Length = 748

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/402 (49%), Positives = 258/402 (64%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+EQ Y+ N  
Sbjct: 347 GSRVTIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWFFYPNRREQAYDENSD 406

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           E+ ++ +G T+            SHEI AP+T    EVS YGN T+GD+ D+W IEVV D
Sbjct: 407 EIRYIGDGSTVRLIHAQTGRNLHSHEIPAPMTKSDKEVSCYGNLTVGDEKDHWKIEVVKD 466

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
           TN++               H+V+GCYLR+    LP+WGF+QIE TC K NN +D YTHWN
Sbjct: 467 TNSRDRSKIRTLTTAFRLKHEVLGCYLRAGTVNLPQWGFKQIETTCTKTNNPRDTYTHWN 526

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE H N KLP      +KS+FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 527 VESHTNPKLPPAEPGQYKSQFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 586

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D  VK+FLLGNP+V+W  TA+L +F  L+ WY++R +R Y E         
Sbjct: 587 VGLRMCSWDDKTVKYFLLGNPLVYWGSTAALGVFGLLVVWYTLRWQRGYKELGQDGIDQI 646

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   VIGW LHY+PF +MGRVTY+HHY+PALYF++L   F+ D F  +    T+ I 
Sbjct: 647 HYAGVYPVIGWFLHYLPFIVMGRVTYVHHYYPALYFAILCFGFLADWFLRAKSKLTQGIA 706

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +GI Y+ ++ ++ +F  I++G+  P  + K  KW   W I D
Sbjct: 707 YGILYATVIGLYIFFMPISWGMVGPNQQYKYMKWFDNWRISD 748



>gi|296810152|ref|XP_002845414.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Arthroderma otae CBS 113480]
 gi|238842802|gb|EEQ32464.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Arthroderma otae CBS 113480]
          Length = 744

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/401 (49%), Positives = 253/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R +  Y+    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDSNNDWFIYPNRTQPNYDPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ NGD I            SH +AAP+T  H+EVSAYGN T+GD  D+W IE+  D 
Sbjct: 403 ITFIGNGDVIRLIHAQTGRNLHSHAVAAPITKSHYEVSAYGNTTVGDSKDHWTIEIAKDV 462

Query: 121 NTK-XXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
           +++               H V+GCYLR+    LP+WGF+QIE TC K N   D+YTHWN+
Sbjct: 463 SSRDKSRVRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCVKENRPLDVYTHWNI 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NEKLP      +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 523 ESHVNEKLPPSEPGTYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W  T SL +F  L+ WY +R +R Y E S  +  H  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFGLLVLWYLLRWQRGYDELSMKDIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW LHY+PF IM RVTY+HHY+PALYF++L  AF +D FT     K +  ++
Sbjct: 643 YSGVYPVVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y  ++ +F  FKDI FG+     + KS  WLS W I +
Sbjct: 703 SVLYIAVIALFIVFKDIVFGMQGSNEQWKSLNWLSNWKIAN 743



>gi|121702259|ref|XP_001269394.1| protein O-mannosyl transferase [Aspergillus clavatus NRRL 1]
 gi|119397537|gb|EAW07968.1| protein O-mannosyl transferase [Aspergillus clavatus NRRL 1]
          Length = 740

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/401 (47%), Positives = 261/401 (65%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R+E  Y+    
Sbjct: 340 GSRVTLKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWFIYPNRQEPEYDPQGP 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH I APVT   +EVS YGN T+GD+ D+W +EVV D 
Sbjct: 400 LSFIGDGDIIRLIHGQTGRNLHSHTIPAPVTKSQYEVSCYGNVTIGDEKDHWAVEVVDDV 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H ++GCYLR+ N  LP+WGF+QIE TC K NN +D+YTHWN+
Sbjct: 460 ASRDRSRIRTLTTAFRLRHIILGCYLRAGNVNLPQWGFKQIETTCAKENNPRDVYTHWNI 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H+N++LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWP+L V
Sbjct: 520 ESHFNDRLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPVLNV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  +K++LLGNP+V+W  T SL +F  L+ W+  R +R Y + S A+  HF 
Sbjct: 580 GLRMCSWDDHIIKYYLLGNPVVYWGSTISLGVFGLLILWHLARWQRGYNDLSQADIDHFH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW+LHY+PF IM RVTY+HHY+PALY+++L   F +D  T    P+ + ++F
Sbjct: 640 YSGFYPLVGWVLHYLPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTRPMSPRVRGVLF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++++ +F +F+ I FG+     +     WLS W I +
Sbjct: 700 GLLYTVVIGLFVHFQAIVFGMEGSNQQWAHLNWLSGWRIAN 740



>gi|429863305|gb|ELA37779.1| protein o-mannosyl transferase [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 738

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/401 (48%), Positives = 254/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R ++ Y+    
Sbjct: 338 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHDEDYDAEGP 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           V F+ +G TI            SHEIAAP+T    EVS+YGN T+GDD D+W +EVV D 
Sbjct: 398 VRFIGDGSTIRLIHAQTGRNLHSHEIAAPITKADKEVSSYGNLTIGDDKDHWQVEVVRDV 457

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIEVTC K NN KD YTHWNV
Sbjct: 458 ASRDRSRIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIEVTCTKTNNPKDTYTHWNV 517

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP     ++KS FLH+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 518 EAHWNDKLPPADAGSYKSPFLHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 577

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TA L +F  ++ WY VR +R Y + +  E     
Sbjct: 578 GLRMCGWDDSIVKYFLLGNPLVYWGSTAGLGVFGLVVLWYLVRWQRGYSDLNEKELDQIH 637

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V GW+LHY+PF +M RVTY+HHY+PALYF++L   F+ D F  + +   +  ++
Sbjct: 638 YAGVYPVAGWVLHYLPFIVMARVTYVHHYYPALYFAILTFGFLADWFLRNKQQAIQYGVY 697

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G  Y+ ++ ++  F  I FG+  P  +    KW  TW + D
Sbjct: 698 GALYAAVIGLYILFSPICFGMTGPNKQYSYMKWFDTWRMSD 738



>gi|46109306|ref|XP_381711.1| hypothetical protein FG01535.1 [Fusarium graminearum PH-1]
          Length = 741

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 260/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ Y+   +
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYSPEGD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +   I            SH+IAAP+T  H EVS+YGN T+GD+ D+W +EV+ DT
Sbjct: 401 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPITRGHKEVSSYGNLTVGDEKDHWKVEVIRDT 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEVTC K NN +D YTHWNV
Sbjct: 461 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      +KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWP L V
Sbjct: 521 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP+++W  TASL +   ++ WY +R +R   + S  E  H  
Sbjct: 581 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIVWYILRWQRGVNDLSEKEIDHIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y     + GW LHY+PF IM RVTY+HHY+PALYF++L   F++D FT +     K+I++
Sbjct: 641 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLIDWFTRNRNNTIKSIVY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++I+ ++ YF  I +G+  P  E K  KW   W + D
Sbjct: 701 GVLYTVIIGLYIYFIPICWGMTGPHKEYKYMKWFDNWRVTD 741



>gi|408399963|gb|EKJ79052.1| hypothetical protein FPSE_00800 [Fusarium pseudograminearum CS3096]
          Length = 741

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 260/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ Y+   +
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYSPEGD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +   I            SH+IAAP+T  H EVS+YGN T+GD+ D+W +EV+ DT
Sbjct: 401 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPITRGHKEVSSYGNLTVGDEKDHWKVEVIRDT 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEVTC K NN +D YTHWNV
Sbjct: 461 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      +KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWP L V
Sbjct: 521 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP+++W  TASL +   ++ WY +R +R   + S  E  H  
Sbjct: 581 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIAWYILRWQRGVNDLSEKEIDHIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y     + GW LHY+PF IM RVTY+HHY+PALYF++L   F++D FT +     K+I++
Sbjct: 641 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLIDWFTRNRNNTIKSIVY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++I+ ++ YF  I +G+  P  E K  KW   W + D
Sbjct: 701 GVLYTVIIGLYIYFIPICWGMTGPHKEYKYMKWFDNWRVTD 741



>gi|500255999|gb|EON99317.1| putative dolichyl-phosphate-mannose-protein mannosyltransferase 2
           protein [Togninia minima UCRPA7]
          Length = 740

 Score =  409 bits (1050), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/401 (49%), Positives = 252/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R +  Y+   E
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFFYPNRGDADYDENAE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G+TI            SHEIAAPVT    EVS YGN T+GDD D+W IEVV D 
Sbjct: 400 PRFIGDGETIRLIHAQTGRNLHSHEIAAPVTKADKEVSCYGNLTVGDDKDHWKIEVVRDV 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGFRQIEVTC K NN +D YTHWNV
Sbjct: 460 ASRDRSKIRTLTTAFRLKHPVMGCYLRAGNVNLPQWGFRQIEVTCTKDNNPRDTYTHWNV 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP G    +KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 520 EAHWNDKLPAGDPGQYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W  TASL     L+ WY VR +R Y E S AE     
Sbjct: 580 GLRMCGWDDNIVKYFLLGNPFVYWVSTASLGALGLLVAWYLVRWQRGYKELSQAEIDQLH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y     +IGW LHY+P  IM RVTY+HHY+PALYF++L+  F+ D F  + +   +   +
Sbjct: 640 YSALYPIIGWGLHYLPSVIMARVTYVHHYYPALYFAILVLGFLADWFLRNQRKAVQYGAY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ ++ YF  I +G+  P  +    KW  TW + D
Sbjct: 700 AVLYATVIGLYIYFMPICWGMTGPNKQYSYMKWFDTWRMSD 740



>gi|380473873|emb|CCF46073.1| glycosyltransferase family 39 [Colletotrichum higginsianum]
          Length = 509

 Score =  409 bits (1050), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/401 (48%), Positives = 253/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R ++ Y+   E
Sbjct: 109 GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFFYPNRHDEDYDPEAE 168

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G TI            SHEIAAP+T    EVS YGN T+GDD D+W +EVV D 
Sbjct: 169 PRFIADGSTIRLIHAQTGRNLHSHEIAAPMTKADKEVSCYGNLTIGDDKDHWQVEVVRDV 228

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H  +GCYLR+ N  LP+WGF+QIEVTC K+NN KD YTHWNV
Sbjct: 229 ASRDRSRIRTLTTAFRLRHPTLGCYLRAGNVNLPQWGFKQIEVTCTKKNNPKDSYTHWNV 288

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NEKLP G   ++KS FLH+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 289 EAHTNEKLPPGDPGSYKSPFLHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILNV 348

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP+V+W  TA L +F  ++ WY +R +R Y + +  E     
Sbjct: 349 GLRMCGWDDNIVKYFLLGNPLVYWGSTAGLGIFALVVVWYVIRWQRGYADLNSKEIDQIH 408

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V GW LHY+PF +M RVTY+HHY+PALYF++L   F+ D F  +     +  I+
Sbjct: 409 YAGLYPVAGWFLHYLPFVVMARVTYVHHYYPALYFAILTFGFLADWFLRNKNQAVQYTIY 468

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+ I+ ++  F  I FG+  P  +    KW  +W I D
Sbjct: 469 GVLYATIIGLYILFSPICFGMTGPNKQYSYLKWFDSWRISD 509



>gi|310798070|gb|EFQ32963.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Glomerella
           graminicola M1.001]
          Length = 738

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 198/401 (49%), Positives = 254/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSHI  YP GS QQQV+CYHH D NNDW     R ++ YN   E
Sbjct: 338 GSRATIKNMGYGGGLLHSHIQTYPEGSTQQQVTCYHHKDANNDWFFYPNRHDEDYNPEAE 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G TI            SHEIAAP+T    EVS YGN T+GDD D+W +EVV D 
Sbjct: 398 PRFIADGSTIRLIHAQTGRNLHSHEIAAPITKADKEVSCYGNLTIGDDKDHWQVEVVRDV 457

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIEVTC K+NN KD YTHWNV
Sbjct: 458 ASRDRSRIRTLTTAFRLKHPVLGCYLRAGNVNLPQWGFKQIEVTCTKKNNPKDSYTHWNV 517

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H N+KLP G   ++KS FLH+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 518 EAHTNDKLPPGDPGSYKSPFLHDFIHLNVAMMTSNNALVPDPDKQDDLASHWWQWPILNV 577

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP+V+W  TA L +F  ++ WY VR +R Y + +  E     
Sbjct: 578 GLRMCGWDDNIVKYFLLGNPLVYWGSTAGLGIFALVVVWYIVRWQRGYNDLNTKEVDQIH 637

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V GW LHY+PF +M RVTY+HHY+PALYF++L   F+ D F  +     +  ++
Sbjct: 638 YAGLYPVAGWFLHYLPFVVMARVTYVHHYYPALYFAILTFGFLADWFLRNRNHIVQYTVY 697

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+ I+ ++  F  I FG+  P  +    KW  +W I D
Sbjct: 698 GVLYAAIIGLYILFSPICFGMTGPNKQYSYLKWFDSWRISD 738



>gi|302907392|ref|XP_003049636.1| glycosyltransferase family 39 [Nectria haematococca mpVI 77-13-4]
 gi|256730572|gb|EEU43923.1| glycosyltransferase family 39 [Nectria haematococca mpVI 77-13-4]
          Length = 740

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/401 (48%), Positives = 259/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R++  YN   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRRDDDYNPEAD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +G  I            SH+IAAP+T  H EVS+YGN T+GDD D+W IEVV D 
Sbjct: 400 LRFIGDGSVIRLIHAQTGRNLHSHDIAAPITRGHKEVSSYGNLTVGDDKDHWKIEVVRDA 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEVTC K NN +D YTHWNV
Sbjct: 460 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPRDTYTHWNV 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      ++S F H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 520 EAHWNDKLPPAEAGVYRSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  WADD VK+FLLGNP+V+W  TASL +   ++ WY +R +R + + +  E  H  
Sbjct: 580 GLRMCGWADDIVKYFLLGNPLVYWGSTASLGVAGLVVVWYILRWQRGFNDLNQDEIDHIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y     + GW LHY+PF IM RVTY+HHY+PALYF++L   F++D F  +     K I++
Sbjct: 640 YSALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLVDWFVRNRNNTLKAIVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++I+ ++ YF  I +G+     + K  KW   W + D
Sbjct: 700 GLLYTVIIGLYIYFLPICWGMTGNHRQYKYMKWFDNWRVTD 740



>gi|396458468|ref|XP_003833847.1| similar to dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase [Leptosphaeria maculans JN3]
 gi|312210395|emb|CBX90482.1| similar to dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase [Leptosphaeria maculans JN3]
          Length = 738

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/401 (47%), Positives = 258/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y+   E
Sbjct: 338 GSRATLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFFYPNRHEVEYHPDEE 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F  N D I            SH++AAPVT   +EVS YGN T+GD  D+W++EVV D 
Sbjct: 398 LRFPGNKDVIRLIHAQTGRNLHSHQVAAPVTKADWEVSCYGNVTVGDTKDHWIVEVVRDA 457

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               HK +GCYLR+ N  LP+WGF+QIE TC K NN +D+YTHWN+
Sbjct: 458 ASRDYSRLRTLTTAFRLKHKDLGCYLRAGNVNLPQWGFKQIETTCVKTNNPRDVYTHWNI 517

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G+  ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL  
Sbjct: 518 ESHTNERLPPGNPGDYKSPFFQDFIHLNVAMMTSNNALVPDPDKQDDLASAFWQWPILHT 577

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK++LLGNP V+W  TASLV+   ++ +Y++R +R Y +    E     
Sbjct: 578 GLRMCGWNDDIVKYYLLGNPAVYWGSTASLVVLLLIVAFYTIRWQRGYTDLKQDEIDQIH 637

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   +IGW+LHY+PF  MGRVTY+HHY+PAL+F++L+  F +D  T       +  ++
Sbjct: 638 YAGIYPLIGWVLHYLPFMAMGRVTYVHHYYPALWFAILVMGFCLDFSTRKLSKAAQWGVY 697

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G  Y LI+ ++W F+ I+FG+  P+S+ +  KW S+W + D
Sbjct: 698 GALYVLIIGLYWLFRAISFGMVGPSSQWRHLKWFSSWKMTD 738



>gi|58259910|ref|XP_567365.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Cryptococcus neoformans var. neoformans JEC21]
 gi|134116410|ref|XP_773159.1| hypothetical protein CNBJ1540 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255780|gb|EAL18512.1| hypothetical protein CNBJ1540 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229415|gb|AAW45848.1| dolichyl-phosphate-mannose-protein mannosyltransferase, putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 807

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/406 (48%), Positives = 262/406 (64%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +TLKN G+GGGLLHSH+   P GS QQQV+CYH+ D NN+W I+ P      +    
Sbjct: 400 GSTVTLKNYGYGGGLLHSHVQTLPVGSLQQQVTCYHYKDENNNWQIVPPWGADPVDPDGP 459

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH IAAPVT   +EVS YGN T+GD+ND W++EVV DT
Sbjct: 460 IRFLKDGDEIRLVHTQTGRNMHSHAIAAPVTKESWEVSGYGNLTIGDENDLWIVEVVDDT 519

Query: 121 NT-----KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYT 175
           +T     +              H+ + CYLR+AN VLP+WGF+Q+EV+C K NN KD++T
Sbjct: 520 HTSKKNNEDGRIHSLTTRMRLKHRQLNCYLRAANAVLPQWGFKQVEVSCTKENNPKDLHT 579

Query: 176 HWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           +WNVE HWN++LP G+   +KS F  +F HLNV M+T NNAL+P+PDKED ++S P  WP
Sbjct: 580 YWNVESHWNDRLPAGNAKLYKSPFWRDFVHLNVAMWTSNNALVPDPDKEDILASQPFDWP 639

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
            L +GLRM  W D ++KF+LLG PI+WW  T SL +   L  WY  R +R Y E+   EW
Sbjct: 640 FLHLGLRMCGWGDHQIKFYLLGTPIIWWFSTISLAIGLGLAAWYVARMQRGYKEWKAGEW 699

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH--FTVSCKPK 353
            H+L+ GK+   GW LH+ PF IMGRVTYLHHY P LYF++LMA  ++DH  F  S +  
Sbjct: 700 DHWLWAGKVAFGGWALHFFPFLIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASSTRSH 759

Query: 354 TKNII-FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK +I F ++  ++++ FW+FKD+A GI+   +      W S+WNI
Sbjct: 760 TKKLIWFAVWAGVVILSFWWFKDLALGISGNVNNHWGWGWRSSWNI 805



>gi|477520408|gb|ENH72534.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Fusarium
           oxysporum f. sp. cubense race 1]
          Length = 740

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/401 (48%), Positives = 258/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ YN   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYNPEGD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +   I            SH+IAAPVT  H EVS+YGN T+GDD D+W +EVV D+
Sbjct: 400 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPVTRGHKEVSSYGNLTVGDDKDHWKVEVVRDS 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEVTC K NN +D YTHWNV
Sbjct: 460 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      +KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWP L V
Sbjct: 520 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP+++W  TASL +   ++ WY +R +R   + S  E  H  
Sbjct: 580 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIVWYILRWQRGVNDLSENEIDHIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y     + GW LHY+PF IM RVTY+HHY+PALYF++L   F++D FT +     + I++
Sbjct: 640 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLVDWFTRNRNKTIQTIVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GI Y++I+ ++ YF  I +G+     + K  KW   W + D
Sbjct: 700 GILYTVIIGLYIYFIPICWGMTGNHKQYKYMKWFDNWRVTD 740



>gi|342878828|gb|EGU80117.1| hypothetical protein FOXB_09392 [Fusarium oxysporum Fo5176]
          Length = 740

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/401 (48%), Positives = 258/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ YN   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYNPEGD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +   I            SH+IAAPVT  H EVS+YGN T+GDD D+W +EVV D+
Sbjct: 400 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPVTRGHKEVSSYGNLTVGDDKDHWKVEVVRDS 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEVTC K NN +D YTHWNV
Sbjct: 460 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      +KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWP L V
Sbjct: 520 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP+++W  TASL +   ++ WY +R +R   + S  E  H  
Sbjct: 580 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIVWYILRWQRGVNDLSENEIDHIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y     + GW LHY+PF IM RVTY+HHY+PALYF++L   F++D FT +     + I++
Sbjct: 640 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLVDWFTRNRNKTIQTIVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GI Y++I+ ++ YF  I +G+     + K  KW   W + D
Sbjct: 700 GILYTVIIGLYIYFIPICWGMTGNHKQYKYMKWFDNWRVTD 740



>gi|475666795|gb|EMT64585.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Fusarium
           oxysporum f. sp. cubense race 4]
          Length = 740

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/401 (48%), Positives = 258/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ YN   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYNPEGD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +   I            SH+IAAPVT  H EVS+YGN T+GDD D+W +EVV D+
Sbjct: 400 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPVTRGHKEVSSYGNLTVGDDKDHWKVEVVRDS 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEVTC K NN +D YTHWNV
Sbjct: 460 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      +KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWP L V
Sbjct: 520 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP+++W  TASL +   ++ WY +R +R   + S  E  H  
Sbjct: 580 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIVWYILRWQRGVNDLSENEIDHIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y     + GW LHY+PF IM RVTY+HHY+PALYF++L   F++D FT +     + I++
Sbjct: 640 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLVDWFTRNRNKTIQTIVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GI Y++I+ ++ YF  I +G+     + K  KW   W + D
Sbjct: 700 GILYTVIIGLYIYFIPICWGMTGNHKQYKYMKWFDNWRVTD 740



>gi|400595792|gb|EJP63582.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Beauveria
           bassiana ARSEF 2860]
          Length = 739

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/402 (47%), Positives = 258/402 (64%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R E  Y+ N T
Sbjct: 338 GSRATIKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRSEADYDVNST 397

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++ ++++G  I            SHEIAAP+T    EVS+YGN T+GDD D+W +EVV D
Sbjct: 398 DIRYISDGSVIRLIHASTGRNLHSHEIAAPITKSDREVSSYGNLTIGDDKDHWQVEVVRD 457

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             ++               H V+GCYLR+ N  LP+WGF+QIEVTC  +NN +D YTHWN
Sbjct: 458 AASRDRSRIRTLATSFRLKHPVLGCYLRAGNTNLPQWGFKQIEVTCTPKNNPRDAYTHWN 517

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           +E HWNEKLP G   ++KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 518 IESHWNEKLPAGDPGSYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 577

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D+ VK+FLLGNP V+W+ T SL L   ++ WY +R +R + + +  E    
Sbjct: 578 VGLRMCGWDDNIVKYFLLGNPFVYWASTVSLGLVGLVVVWYILRWQRGFKDLNSEEVDQI 637

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   V+GW LHY+PF IM RVTY+HHY+PALYF++L   F +D    +     +  +
Sbjct: 638 HYAGIYPVLGWFLHYLPFVIMARVTYVHHYYPALYFAILALGFFVDWLVRNRSQVVQGAV 697

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y++I+ ++  F  I +G+  P  +    KW  TW + D
Sbjct: 698 YGVLYTVIIGLYILFMPICWGMTGPNQQYSYMKWFDTWRVSD 739



>gi|48479770|gb|AAT44966.1| protein O-mannosyltransferase 2 [Aspergillus fumigatus]
          Length = 741

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/401 (47%), Positives = 256/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 341 GSRVTLKNMGYGGGLLHSHVQTYPDGSNQQQVTCYHHKDANNDWFIYPNRHEPEYDASGP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + FV +GD I            SH I AP+T   +EVS YGN T+GD+ D+W +EVV D 
Sbjct: 401 LSFVGDGDVIRLIHGQTGRNLHSHAIPAPITKSQYEVSCYGNITIGDEKDHWAVEVVDDV 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIE TC K NN +D+YTHWNV
Sbjct: 461 ASRDRSRIRTLTTAFRLRHIVLGCYLRAGNVNLPQWGFKQIETTCVKENNPRDVYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H+N++LP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 521 ESHFNDRLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ +K++LLGNP V+W  T SL +F  L+FWY  R +R Y + + A+  H  
Sbjct: 581 GLRMCSWDDNTIKYYLLGNPFVYWGSTFSLGVFGLLIFWYLARWQRGYKDLNQADIDHIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW+LHY PF IM RVTY+HHY+PALY+++L   F +D  T    P  +  ++
Sbjct: 641 YSGFYPLLGWILHYFPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTQKMSPVARGSLY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +I+ +F +F+ I FGI  P+ +  +  WLS W I +
Sbjct: 701 AFLYVIIIGMFVHFRVIVFGIEGPSQQWANLNWLSGWRIAN 741



>gi|392595355|gb|EIW84678.1| glycosyltransferase family 39 protein [Coniophora puteana
           RWD-64-598 SS2]
          Length = 826

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/405 (47%), Positives = 261/405 (64%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GSEQQQV+CYH+ D NN+W IL    E  ++  ++
Sbjct: 419 GSRITLKNMGWGGGLLHSHVQTYPTGSEQQQVTCYHYKDNNNEWNILPRWDEPAFDPNSD 478

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SHE+A P+T V++EVS YGN T+GD +DYWV+EV+ D 
Sbjct: 479 MRFLKHGDIIRLQHGPSTRNLHSHEVAGPITKVNYEVSCYGNATVGDYHDYWVVEVLDDI 538

Query: 121 NTKXXXXX----XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
                                H  +GCYL +    LP+WGF+QIE TC K N+  D +T 
Sbjct: 539 KQGKREHVEKIHALTTRLRFRHSTLGCYLHAGTVPLPQWGFKQIETTCIKENDPSDAHTI 598

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN++LP       KS FL +FWHLNV M T NNAL+P+ DKED ++S+P  WP+
Sbjct: 599 WNVEGHWNDRLPPADATYHKSPFLRDFWHLNVAMMTSNNALMPDVDKEDILASVPTDWPL 658

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           + +GLRM  W D+  K++L+G PIVWW    ++++   +L  Y +R +RKY++    EW 
Sbjct: 659 MRLGLRMCGWGDEIPKYYLIGTPIVWWGSFVAIIISVFVLGAYLLRWQRKYVDMDAHEWG 718

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLY+GKI   GW LHYIPFFIMGRVTY+HHY P LYF++LM   + DHF  S +    K
Sbjct: 719 HFLYVGKIAFYGWFLHYIPFFIMGRVTYVHHYLPTLYFAVLMFGHVFDHFFFSSRRLSTK 778

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I+FG+   LIV  FW+F+ +A+G+  P ++    +W  +WNI
Sbjct: 779 TKRIVFGVVTFLIVANFWWFRGLAWGMEGPINDHWGLQWRKSWNI 823



>gi|119496253|ref|XP_001264900.1| protein O-mannosyl transferase [Neosartorya fischeri NRRL 181]
 gi|119413062|gb|EAW23003.1| protein O-mannosyl transferase [Neosartorya fischeri NRRL 181]
          Length = 748

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/401 (47%), Positives = 256/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 348 GSRVTLKNMGYGGGLLHSHVQTYPDGSNQQQVTCYHHKDANNDWFIYPNRHEPEYDANGP 407

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + FV +GD I            SH I AP+T   +EVS YGN T+GD+ D+W +EVV D 
Sbjct: 408 LSFVGDGDIIRLIHGQTGRNLHSHAIPAPITKSQYEVSCYGNITIGDEKDHWAVEVVDDV 467

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIE TC K NN +D+YTHWNV
Sbjct: 468 ASRDRSRIRTLTTAFRLRHIVLGCYLRAGNVNLPQWGFKQIETTCVKENNPRDVYTHWNV 527

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H+N++LP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 528 ESHFNDRLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 587

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ +K++LLGNP V+W  T SL +F  L+FWY  R +R Y + + A+  H  
Sbjct: 588 GLRMCSWDDNTIKYYLLGNPFVYWGSTVSLGVFGLLIFWYLARWQRGYKDLNQADIDHIH 647

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW+LHY PF IM RVTY+HHY+PALY+++L   F +D  T    P  +  ++
Sbjct: 648 YSGFYPLLGWILHYFPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTQKMSPVARGSLY 707

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +I+ +F +F+ I FGI  P+ +  +  WLS W I +
Sbjct: 708 AFLYMVIIGMFVHFRVIVFGIEGPSQQWANLNWLSGWRIAN 748



>gi|340992645|gb|EGS23200.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2-like
           protein [Chaetomium thermophilum var. thermophilum DSM
           1495]
          Length = 740

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/401 (48%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R +  Y+    
Sbjct: 340 GSLVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNNWFFYPNRHDVPYDPNAP 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ NGD +            SH I AP+T   +EVS YGN T+GDD D+W IEVV DT
Sbjct: 400 PRFIGNGDVVRLLHAQTGRNLHSHTIPAPITKSQWEVSGYGNLTVGDDKDHWQIEVVKDT 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               HKV+GCYLR+ N  LP+WGF+QIEVTC K NN +D YTHWN+
Sbjct: 460 ASRDYSRIRTLTTAFRLRHKVLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPRDKYTHWNI 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E+H NEKLP G+   +KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 520 EQHTNEKLPPGNPSLYKSPFFQDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP V+W  TASLV+F  L+ WY +R +R Y E S ++     
Sbjct: 580 GLRMCSWDDKVVKYFLLGNPAVYWGSTASLVVFGGLVAWYLIRWQRGYRELSASDLDQIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHY+PF IM RVTY+HHY+PALYF++L   F+ D F  +    T+  +F
Sbjct: 640 YAGVYPAVGWFLHYLPFIIMARVTYVHHYYPALYFAILTFGFLADWFLRNRGKVTQTAVF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++++ ++ YF  I FG+  P  + +  KW   W + D
Sbjct: 700 GVLYAVVIGLYIYFIPICFGMTGPNKKYRYMKWFDNWRMSD 740



>gi|353238988|emb|CCA70916.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Piriformospora indica DSM 11827]
          Length = 827

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/407 (46%), Positives = 257/407 (63%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T KNMG+GGGLLHSH   YP GS+QQQV+CYH+ D NN W + KP      ++  +
Sbjct: 419 GSKVTFKNMGYGGGLLHSHTQTYPVGSQQQQVTCYHYKDDNNHWRVEKPWTSAPVDDEGD 478

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           +EF+ + D +            SH +AAPVT ++ EVS YGN T GD  D+W++E+V D 
Sbjct: 479 IEFLKHNDVVRLVHTPTGRNLHSHTVAAPVTKLNNEVSCYGNTTTGDAGDHWIVEIVDDM 538

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
                                H+ +GCYL + N VLP WGF+QIEV+CDK NN  D +TH
Sbjct: 539 VLGKRQNVPHVRSLTTKLRFKHQQLGCYLVAPNTVLPPWGFKQIEVSCDKENNPNDPHTH 598

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWN +LP+G    +KS F  +FWHLNV M T NNAL+P+ DKED ++S P  WP 
Sbjct: 599 WNVESHWNGRLPVGETKFYKSPFFRDFWHLNVAMMTSNNALVPDADKEDILASSPTDWPW 658

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLRM  W D++ K++L+GNP VWWSGTASL +   ++  Y +R +R Y ++   EW 
Sbjct: 659 LHLGLRMCGWGDNQTKYYLIGNPAVWWSGTASLGICVLVICVYLIRNQRGYRDWGVGEWD 718

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLY+ KI  +GW+  Y+PF IMGRVTY+HHY P LYF++LM   + DH     +    +
Sbjct: 719 HFLYVCKIAGLGWVFQYVPFLIMGRVTYIHHYLPTLYFAVLMVGHLFDHLVFKSRRFSER 778

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           TK IIF I   +++ VFW+F+ +AFGI+ P  E     W  TWNI +
Sbjct: 779 TKWIIFAIASGIVIGVFWWFRGVAFGIDGPIKEHWGLLWRKTWNIYE 825



>gi|70991332|ref|XP_750515.1| protein O-mannosyl transferase [Aspergillus fumigatus Af293]
 gi|66848147|gb|EAL88477.1| protein O-mannosyl transferase [Aspergillus fumigatus Af293]
 gi|159130988|gb|EDP56101.1| protein O-mannosyl transferase [Aspergillus fumigatus A1163]
          Length = 759

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/401 (47%), Positives = 256/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 359 GSRVTLKNMGYGGGLLHSHVQTYPDGSNQQQVTCYHHKDANNDWFIYPNRHEPEYDASGP 418

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + FV +GD I            SH I AP+T   +EVS YGN T+GD+ D+W +EVV D 
Sbjct: 419 LSFVGDGDVIRLIHGQTGRNLHSHAIPAPITKSQYEVSCYGNITIGDEKDHWAVEVVDDV 478

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIE TC K NN +D+YTHWNV
Sbjct: 479 ASRDRSRIRTLTTAFRLRHIVLGCYLRAGNVNLPQWGFKQIETTCVKENNPRDVYTHWNV 538

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H+N++LP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 539 ESHFNDRLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 598

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ +K++LLGNP V+W  T SL +F  L+FWY  R +R Y + + A+  H  
Sbjct: 599 GLRMCSWDDNTIKYYLLGNPFVYWGSTFSLGVFGLLIFWYLARWQRGYKDLNQADIDHIH 658

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW+LHY PF IM RVTY+HHY+PALY+++L   F +D  T    P  +  ++
Sbjct: 659 YSGFYPLLGWILHYFPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTQKMSPVARGSLY 718

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +I+ +F +F+ I FGI  P+ +  +  WLS W I +
Sbjct: 719 AFLYVIIIGMFVHFRVIVFGIEGPSQQWANLNWLSGWRIAN 759



>gi|212537941|ref|XP_002149126.1| protein O-mannosyl transferase [Talaromyces marneffei ATCC 18224]
 gi|210068868|gb|EEA22959.1| protein O-mannosyl transferase [Talaromyces marneffei ATCC 18224]
          Length = 739

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/401 (48%), Positives = 259/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+    
Sbjct: 339 GSKVTLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFMYPNRYQPEYDPEAP 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH +AAP+T   +EVS YGN T+GD+ D+W IEVVSD 
Sbjct: 399 LRFLGDGDVIRLIHAQTGRNLHSHSVAAPITKSDWEVSCYGNTTIGDEKDHWKIEVVSDA 458

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+ +GCYLR+    LP+WGF+QIE TC K N  +D+YTHWNV
Sbjct: 459 ASRDRSKIRTLTTAFRLRHEALGCYLRAGTVNLPQWGFKQIETTCVKENKPRDVYTHWNV 518

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWP+L V
Sbjct: 519 ETHVNERLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPLLHV 578

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP+V+W  TASL+ F  ++ WY +R +R Y++ SP+E     
Sbjct: 579 GLRMCSWDDNIVKYFLLGNPLVYWGSTASLLGFGLIVAWYLIRWQRGYVDLSPSEIDQIH 638

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   +IGW+LHY+PF +M RVTY+HHY+PALYF++L A F +D  T     K +  I+
Sbjct: 639 YAGIYPLIGWVLHYLPFAVMARVTYVHHYYPALYFAILTAGFCVDWVTRKLGTKVQWAIY 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y  ++ +F  FKDI FG+     + +  KWLSTW I D
Sbjct: 699 IPLYIAVISLFVVFKDIVFGMEGSNRQWEYLKWLSTWRISD 739



>gi|336271891|ref|XP_003350703.1| hypothetical protein SMAC_02375 [Sordaria macrospora k-hell]
 gi|380094865|emb|CCC07367.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 750

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/402 (48%), Positives = 257/402 (63%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+EQ Y+  + 
Sbjct: 349 GSRVTIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDSNNDWFFYPNRREQAYDESSD 408

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           E+ ++ +G T+            SHEI AP+T    EVS YGN T+GD+ D+W IEVV D
Sbjct: 409 EIRYIGDGSTVRLIHAQTGRNLHSHEIPAPMTKADKEVSCYGNLTVGDEKDHWKIEVVKD 468

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
           TN++               H+V+GCYLR+    LP+WGF+QIE TC K NN +D YTHWN
Sbjct: 469 TNSRDRSKIRTLTTAFRLKHEVLGCYLRAGTVNLPQWGFKQIETTCTKTNNPRDTYTHWN 528

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE H N KLP      +K++F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 529 VESHTNPKLPPAEPGQYKNQFFQDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 588

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D  VK+FLLGNP+V+W  TA L +F  L+ WY++R +R Y E +       
Sbjct: 589 VGLRMCSWDDKTVKYFLLGNPLVYWGSTAGLGVFGLLVIWYTLRWQRGYNELNQDSIDQI 648

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   VIGW LHY+PF +MGRVTY+HHY+PALYF++L   F+ D F       T++I 
Sbjct: 649 HYAGIYPVIGWFLHYLPFIVMGRVTYVHHYYPALYFAILSFGFLADWFFRGKSKLTQSIG 708

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           FGI Y+ ++ ++ +F  I++G+  P  + K  KW   W I D
Sbjct: 709 FGILYATVIGLYIFFMPISWGMVGPNQQYKYMKWFDNWRISD 750



>gi|225684883|gb|EEH23167.1| O-mannosyl-transferase [Paracoccidioides brasiliensis Pb03]
          Length = 776

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/400 (48%), Positives = 255/400 (63%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y+    
Sbjct: 343 GSKATLKNMGYGGGLLHSHVQSYPEGSGQQQITCYHHKDANNDWFFYPNRDEPDYDPEAP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + F+ + D I            SH + APVT   +EVS YGN T+GD+ D+WVIEVVSD 
Sbjct: 403 LSFIGDKDVIRLVHAQTGRNLHSHPVPAPVTKSSYEVSGYGNTTIGDNKDHWVIEVVSDV 462

Query: 120 TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                H V+GCYLR+ N  LP+WGF+QIE TC K+NN +DIYTHWN+
Sbjct: 463 ASNDRSKIRTLTTAFRIRHAVLGCYLRAGNVNLPQWGFKQIETTCVKKNNPRDIYTHWNI 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H N++LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D +SS   +WPIL  
Sbjct: 523 ESHINDRLPPGDAGSYKSPFLKDFLHLNVAMMTSNNALVPDPDKQDDLSSEFWEWPILHT 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNPIV+W GTASL++   +L +Y VR +R Y E + AE  H  
Sbjct: 583 GLRMCSWEDNVVKYFLLGNPIVYWGGTASLLIISMILLFYLVRWQRGYDELNMAEIDHIY 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    I W  HY PF  M RVTY+HHY+PALYFSML  AF ++ FT     K +  I+
Sbjct: 643 YSGIYPAIAWFFHYFPFIAMARVTYVHHYYPALYFSMLTLAFCVNWFTRKLPAKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            + Y+ ++ +F +F+DI FG+  P+S+ +   W   +N+ 
Sbjct: 703 TVLYAAVIGLFLHFRDIVFGMEGPSSKWEHLSWFRIFNVA 742



>gi|477528421|gb|ENH80206.1| protein o-mannosyl transferase [Colletotrichum orbiculare MAFF
           240422]
          Length = 738

 Score =  405 bits (1041), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 253/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R +  Y+    
Sbjct: 338 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHDADYDAEAA 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G+TI            SHEI+AP+T    EVS+YGN T+GDD D+W +EVV D 
Sbjct: 398 PRFIGDGETIRLIHAQTGRNLHSHEISAPITKADKEVSSYGNLTIGDDKDHWKVEVVRDV 457

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIEVTC K NN KD YTHWNV
Sbjct: 458 ASRDRSRIRTLTTAFRLKHTVLGCYLRAGNVNLPQWGFKQIEVTCTKNNNPKDTYTHWNV 517

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWNEKLP     ++KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 518 EAHWNEKLPPADAGSYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 577

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TA L +F  ++ WY +R +R Y + S  E     
Sbjct: 578 GLRMCGWDDSIVKYFLLGNPLVYWGSTAGLGVFGLVVAWYLIRWQRGYDDLSDKEVDQIH 637

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           + G   V GW+LHY+PF +M RVTY+HHY+PALYF++L   F+ D F  +     +  ++
Sbjct: 638 FAGLYPVAGWVLHYLPFIVMARVTYVHHYYPALYFAILTFGFLADWFLRNKNQAIQYGVY 697

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+ I+ ++  F  I FG+  P  +    KW  TW + D
Sbjct: 698 GVLYATIIGLYILFSPICFGMTGPNRQYSYMKWFDTWRMSD 738



>gi|405122688|gb|AFR97454.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Cryptococcus neoformans var. grubii H99]
          Length = 810

 Score =  405 bits (1041), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/406 (48%), Positives = 260/406 (64%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +TLKN G+GGGLLHSH+   P GS QQQV+CYH+ D NN+W I+ P      +    
Sbjct: 403 GSTVTLKNYGYGGGLLHSHVQTLPVGSLQQQVTCYHYKDENNNWQIVPPWGADPVDPDGP 462

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH IAAPVT   +EVS YGN T+GD+ND W++EVV DT
Sbjct: 463 IRFLKDGDEIRLVHTQTGRNMHSHAIAAPVTKESWEVSGYGNLTIGDENDLWIVEVVDDT 522

Query: 121 NT-----KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYT 175
           +T     +              H+ + CYLR+AN VLP+WGF+Q+EV+C K NN KD++T
Sbjct: 523 HTSKKNNEDGRIHSLTTRMRFKHRQLKCYLRAANAVLPQWGFKQVEVSCTKENNPKDLHT 582

Query: 176 HWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           +WNVE HWNE+LP G+   +KS F  +F HLNV M+T NNAL+P+PDKED ++S P  WP
Sbjct: 583 YWNVESHWNERLPPGNAKLYKSPFWRDFVHLNVAMWTSNNALVPDPDKEDILASQPFDWP 642

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
            L +GLRM  W D ++KF+LLG PI+WW  T SL +   L  WY  R +R Y E+   EW
Sbjct: 643 FLHLGLRMCGWGDHQIKFYLLGTPIIWWFSTVSLAIGLGLAAWYVARMQRGYREWKAGEW 702

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT- 354
            H+L+ GK+   GW LH+ PF IMGRVTYLHHY P LYF++LMA  ++DHF  +   ++ 
Sbjct: 703 DHWLWAGKMAFGGWALHFFPFLIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASSTRSH 762

Query: 355 --KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
             K I F I+  ++++ FW+FKD+A GI    +      W S+WNI
Sbjct: 763 IKKLIWFAIWAGVVILSFWWFKDLALGIYGNVNNHWGWGWRSSWNI 808



>gi|452985856|gb|EME85612.1| glycosyltransferase family 39 protein [Pseudocercospora fijiensis
           CIRAD86]
          Length = 741

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/401 (47%), Positives = 251/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  +N    
Sbjct: 341 GSRATLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDANNDWFFYPNRNEPEFNPEAP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +++V NGD I            SH++AAPVT   +EVS YGN T+GD  D+W++EVV D 
Sbjct: 401 IKYVGNGDVIRLIHAQTGRNLHSHQVAAPVTKADYEVSCYGNVTIGDTKDHWIVEVVDDA 460

Query: 121 NTKX-XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               HK +GCYLR+ N  LP+WGF+QIE +C K N  +D +THWNV
Sbjct: 461 ASRDWSKVRTLTTSFRLKHKDLGCYLRAGNVNLPQWGFKQIETSCVKENRPRDKFTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWNEKLP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S P QWP+L V
Sbjct: 521 ESHWNEKLPAGDPGSYKSPFFRDFIHLNVAMMTSNNALVPDPDKQDDLASAPWQWPLLNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK++LLGNP V+W+ TASL  F  +  WY++R +R + E +  +   F 
Sbjct: 581 GLRMCGWDDKNVKYYLLGNPFVYWASTASLFFFIGMFAWYAIRWQRGFDELTWKDIDQFQ 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF  M RVTY+HHY+PALYF++L   F +D  T       +  ++
Sbjct: 641 YAGIYPVIGWFLHYLPFVAMARVTYVHHYYPALYFAILTFGFCIDWCTSRLPKPVEWGLY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +++ +FW F+ + FG+     + K  KWL  W + D
Sbjct: 701 TALYGVVIFMFWLFRALCFGMVGSNQQWKHLKWLPKWRMSD 741



>gi|320040582|gb|EFW22515.1| O-mannosyl transferase [Coccidioides posadasii str. Silveira]
          Length = 747

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 259/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+   E
Sbjct: 343 GSKVTIKNMGYGGGLLHSHVQTYPSGSSQQQVTCYHHKDSNNDWFVYPNRTQPDYDPEGE 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH I AP+T  ++EVS YGN T+GDD D+WV+EVV+D 
Sbjct: 403 LRFIGDGDIIRLIHAQTGRNLHSHAIPAPITKSNWEVSCYGNTTVGDDKDHWVVEVVNDV 462

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +K               H  +GCYLR+ N  LP+WGF+QIE TC K N   D++THWNV
Sbjct: 463 ASKDRSKIRTLTTAFRLRHSSLGCYLRAGNVNLPQWGFKQIETTCVKENKPYDVHTHWNV 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G    +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWP+L V
Sbjct: 523 ESHVNERLPKGDPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPVLNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W +D VK+FLLGNP V+W  TASL +F  ++ WY VR +R Y E S A+  H  
Sbjct: 583 GLRMCSWDNDTVKYFLLGNPFVYWGSTASLAVFGLVVAWYLVRWQRGYTELSQADIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW+LHY+PF IM RVTY+HHY+PALYF++L   F ++ FT +     +  ++
Sbjct: 643 YSGIYPLLGWVLHYLPFIIMARVTYVHHYYPALYFAILTMGFCVNWFTQNLSKPAEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ +F  FKDI FG+     + +   WLSTW I +
Sbjct: 703 FVLYAAVISLFVVFKDIVFGMQGSNEQWQYLNWLSTWRIAN 743



>gi|303322440|ref|XP_003071213.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240110912|gb|EER29068.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2, putative
           [Coccidioides posadasii C735 delta SOWgp]
          Length = 747

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 258/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+   E
Sbjct: 343 GSKVTIKNMGYGGGLLHSHVQTYPSGSSQQQVTCYHHKDSNNDWFVYPNRTQPDYDPEGE 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH I AP+T   +EVS YGN T+GDD D+WV+EVV+D 
Sbjct: 403 LRFIGDGDIIRLIHAQTGRNLHSHAIPAPITKSSWEVSCYGNTTVGDDKDHWVVEVVNDV 462

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +K               H  +GCYLR+ N  LP+WGF+QIE TC K N   D++THWNV
Sbjct: 463 ASKDRSKIRTLTTAFRLRHSSLGCYLRAGNVNLPQWGFKQIETTCVKENKPYDVHTHWNV 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G    +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWP+L V
Sbjct: 523 ESHVNERLPKGDPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPVLNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W +D VK+FLLGNP V+W  TASL +F  ++ WY VR +R Y E S A+  H  
Sbjct: 583 GLRMCSWDNDTVKYFLLGNPFVYWGSTASLAVFGLVVAWYLVRWQRGYTELSQADIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW+LHY+PF IM RVTY+HHY+PALYF++L   F ++ FT +     +  ++
Sbjct: 643 YSGIYPLLGWVLHYLPFIIMARVTYVHHYYPALYFAILTMGFCVNWFTQNLSKPAEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ +F  FKDI FG+     + +   WLSTW I +
Sbjct: 703 FVLYAAVISLFVVFKDIVFGMQGSNEQWQYLNWLSTWRIAN 743



>gi|315044835|ref|XP_003171793.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Arthroderma gypseum CBS 118893]
 gi|311344136|gb|EFR03339.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Arthroderma gypseum CBS 118893]
          Length = 744

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQ++CYHH D NN+W I   R +  YN    
Sbjct: 343 GSKITVKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNEWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++F+ +GD I            SH + APVT   +EVSAYGN T+GD  D+W +EVV D 
Sbjct: 403 IDFIGDGDVIRLIHAQTGRNLHSHTVPAPVTKSQYEVSAYGNTTVGDAKDHWTMEVVKDV 462

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+    LP+WGF+QIE TC K N   D+YTHWN+
Sbjct: 463 ASRDRSRIRTLTTAFRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPLDVYTHWNI 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP      +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 523 ESHVNERLPPSEPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP+V+W  T SL +F  ++ WY +R +R Y E S A+  H  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPLVYWGSTMSLGVFSLIVVWYVLRWQRGYNELSMADIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW LHY+PF IM RVTY+HHY+PALYF++L  AF +D FT     K +  ++
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y  ++ +F  FKDI FG+     + KS  WLSTW I +
Sbjct: 703 SVLYIAVIGLFVLFKDIVFGMEGSNQQWKSLNWLSTWKIAN 743



>gi|226287740|gb|EEH43253.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Paracoccidioides brasiliensis Pb18]
          Length = 736

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/394 (49%), Positives = 253/394 (64%), Gaps = 1/394 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y+    
Sbjct: 343 GSKATLKNMGYGGGLLHSHVQSYPEGSGQQQITCYHHKDANNDWFFYPNRDEPDYDPEAP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           + F+ + D I            SH + APVT   +EVS YGN T+GD+ D+WVIEVVSD 
Sbjct: 403 LSFIGDKDVIRLVHAQTGRNLHSHPVPAPVTKSSYEVSGYGNTTIGDNKDHWVIEVVSDV 462

Query: 120 TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                H V+GCYLR+ N  LP+WGF+QIE TC K+NN +DIYTHWN+
Sbjct: 463 ASNDRSKIRTLTTAFRIRHAVLGCYLRAGNVNLPQWGFKQIETTCVKKNNPRDIYTHWNI 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H N++LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D +SS   +WPIL  
Sbjct: 523 ESHINDRLPPGDAGSYKSPFLKDFLHLNVAMMTSNNALVPDPDKQDDLSSEFWEWPILHT 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNPIV+W GTASL++   +L +Y VR +R Y E + AE  H  
Sbjct: 583 GLRMCSWEDNVVKYFLLGNPIVYWGGTASLLIISMILLFYLVRWQRGYDELNMAEIDHIY 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    I W  HY PF  M RVTY+HHY+PALYFSML  AF ++ FT     K +  I+
Sbjct: 643 YSGIYPAIAWFFHYFPFIAMARVTYVHHYYPALYFSMLTLAFCVNWFTRKLPAKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWL 393
            + Y+ ++ +F +F+DI FG+  P+S+ +   W+
Sbjct: 703 TVLYAAVIGLFLHFRDIVFGMEGPSSKWEHLSWV 736



>gi|255931607|ref|XP_002557360.1| Pc12g05130 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211581979|emb|CAP80140.1| Pc12g05130 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 744

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/401 (48%), Positives = 253/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R+E  Y+   +
Sbjct: 342 GSRVTLKNMGYGGGLLHSHVQTYPEGSMQQQVTCYHHKDANNDWFIYPNRQEPDYDATAD 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + FV +GD I            SH I AP+T  H EVS+YGN T+GDD D+W +EVV D 
Sbjct: 402 LRFVGDGDVIRLIHGQTGRNLHSHAIPAPITKSHHEVSSYGNITIGDDKDHWKVEVVDDV 461

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIE TC K N   D+YTHWNV
Sbjct: 462 ASRDRSKIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCTKENKPSDVYTHWNV 521

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 522 ESHTNERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 581

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK++LLGNP+V+W  TA+L  F  L  WY +R +R Y + S  +  H  
Sbjct: 582 GLRMCSWDDSVVKYYLLGNPLVYWGSTAALGGFGLLFLWYLLRWQRGYNDLSNEDIRHIH 641

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW+LHY+PF IM RVTY+HHY+PALY+++L   F +D  T    P+    ++
Sbjct: 642 YSGLYPVIGWVLHYLPFIIMARVTYVHHYYPALYYAILNFGFCVDWVTRKMNPRLSAAVY 701

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +IV +F +F+ I FG+     +    +WL  W + +
Sbjct: 702 AFLYVIIVGLFIHFRAIVFGMEGSNQQWTHLRWLPGWKMAN 742



>gi|320586039|gb|EFW98718.1| protein O-mannosyl transferase [Grosmannia clavigera kw1407]
          Length = 741

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/401 (48%), Positives = 253/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R+E  Y+   E
Sbjct: 341 GSRVTLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNEWFFYPTREEPEYDENAE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             FV +  TI            SHE++APVT    EVS YGN T+GD  DYW IEV+ D 
Sbjct: 401 PRFVGDDSTIRLIHAQTGRNLHSHEVSAPVTKADREVSCYGNLTVGDAKDYWKIEVLDDV 460

Query: 121 NTKX-XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               + V+GCYLR+ N  LP+WGFRQIEVTC K NN +D YTHWN+
Sbjct: 461 ASRDHSRIRTLTTSFRLKNPVMGCYLRAGNVNLPQWGFRQIEVTCTKDNNPRDTYTHWNI 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H N+KLP G+  ++KS FL +F HLNV M T NNAL+P+PDK+D ++S+  QWPIL V
Sbjct: 521 EAHINKKLPEGNPGSYKSPFLRDFVHLNVAMMTSNNALVPDPDKQDDLASMWWQWPILNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNPIV+W  TASL +F  L+ WY +R +R Y E S  +     
Sbjct: 581 GLRMCGWDDKIVKYFLLGNPIVYWGSTASLGIFASLVAWYVIRWQRGYTELSQDDIDQIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF IM RVTY+HHY+PALYF++L   F+ D F        +  ++
Sbjct: 641 YAGIYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLADWFLKKRVKTIQAAVY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+ ++ ++ +F  I +G+  P  +    KW   W I D
Sbjct: 701 GLLYATVIGLYIFFIPICWGMTGPNKQYSYLKWFDGWRITD 741



>gi|340517873|gb|EGR48116.1| glycosyltransferase family 39 [Trichoderma reesei QM6a]
          Length = 740

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y+   E
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHEPDYDPEGE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +G  I            SH+I AP+T  H EVS+YGN T+GD+ D+W IEVV D 
Sbjct: 400 LRFIGDGSVIRLIHAQTGRNLHSHDIDAPITKSHREVSSYGNLTVGDEKDHWKIEVVRDA 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIEVTCDK+NN +D YTHWNV
Sbjct: 460 ASRDRSRIRTLTTAFRLKHTVLGCYLRAGNVNLPQWGFKQIEVTCDKQNNPRDTYTHWNV 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN++LP      +KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 520 EAHWNDRLPPSDPGVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W+ TASL     ++ WY VR +R + E S +E     
Sbjct: 580 GLRMCSWDDNIVKYFLLGNPFVYWASTASLGAVALVIAWYVVRWQRGFKELSNSEVDQIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF IM RVTY+HHY+PALYF++L   F++D    +     + + +
Sbjct: 640 YAGIYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILSLGFLVDWVLRNRAAVVQGVAY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GI Y++++ ++  F  I +G+   + +    KW   W I D
Sbjct: 700 GILYTVVIGLYILFMPICWGMTGSSKQYSYLKWFDNWRISD 740



>gi|403174471|ref|XP_003333435.2| dolichyl-phosphate-mannose-protein mannosyltransferase [Puccinia
           graminis f. sp. tritici CRL 75-36-700-3]
 gi|375170992|gb|EFP89016.2| dolichyl-phosphate-mannose-protein mannosyltransferase [Puccinia
           graminis f. sp. tritici CRL 75-36-700-3]
          Length = 778

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/412 (46%), Positives = 263/412 (63%), Gaps = 12/412 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMGFGGGLLHSH+  YP GS+QQQV+CYH+ D+NNDWM+     E  YN    
Sbjct: 362 GSRVTIKNMGFGGGLLHSHVQTYPTGSQQQQVTCYHYRDMNNDWMVTPLLHEPAYNESQP 421

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++F+ +G  I            +H I AP+T ++ EV+ YGN T+ D + YW+IEVV D 
Sbjct: 422 IKFLKHGSVIRLVHVLTGRNLHTHTIPAPITTLNHEVAGYGNATIDDSSSYWLIEVVDDM 481

Query: 121 NTKXXXXXXXXXXXXXXHKV----IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
                             ++    +GCYLR+AN VLP+WGF+Q+EV+CDK+N+  D +T+
Sbjct: 482 IRGKRKNFENINILSTRFRIRNLNLGCYLRAANAVLPQWGFKQVEVSCDKQNDPNDHHTY 541

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE H N +LP G     +S FL +FWHLNV M T NNALIP+PDKED+ +S P++WP 
Sbjct: 542 WNVESHINPRLPEGDMKLMRSPFLKDFWHLNVAMMTSNNALIPDPDKEDATASTPLEWPF 601

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           +  G+RM+ W D+ +KF+L+GNP+ WW  T++LV++   L WY  R KR+  + SP EW 
Sbjct: 602 VYTGMRMNAWIDNGIKFYLIGNPLTWWLSTSALVVYCLSLVWYLGRYKRQINDLSPIEWR 661

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPK--- 353
            F+Y GK+ + GW+LHY PF  MGRVTYLHHYFPAL+FS+LM   ++DHF    K     
Sbjct: 662 RFIYGGKVALGGWILHYAPFLFMGRVTYLHHYFPALWFSILMFGLIVDHFIFKAKTSRFI 721

Query: 354 --TKNIIFGIYYSLIVIVFW---YFKDIAFGINYPASELKSRKWLSTWNIVD 400
             TK     I  +L V +     +FKD A+GI+ P    K R+W  +W+I D
Sbjct: 722 RLTKLNKIAICSTLCVAIMLTGIWFKDCAWGISGPIHLYKYRQWRKSWSIYD 773



>gi|261192876|ref|XP_002622844.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ajellomyces dermatitidis SLH14081]
 gi|239588979|gb|EEQ71622.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ajellomyces dermatitidis SLH14081]
          Length = 745

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/400 (48%), Positives = 254/400 (63%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+ GGLLHSH+  YP GS QQQV+CYHH D NNDW I   R+E  Y+    
Sbjct: 346 GSKVTLKNMGYSGGLLHSHVQTYPEGSTQQQVTCYHHKDTNNDWFIYPNRQEPNYDPNDP 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +++V + D I            SH ++AP+T  H EVS YGN T+GD+ D+W IEV+ D 
Sbjct: 406 LKYVADKDVIRLIHAQTGRNLHSHTVSAPITKSHNEVSCYGNTTVGDEKDHWRIEVLGDV 465

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+    LP+WGF+QIE TC K NN +D YTHWNV
Sbjct: 466 ASRDRSKIRTLTTSFRLRHAVLGCYLRAGTVNLPQWGFKQIETTCIKENNPRDRYTHWNV 525

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G   ++KS FL +F HLNV M T NNALIP+PDK+D ++S   QWPIL V
Sbjct: 526 ESHVNERLPPGDPGSYKSPFLQDFIHLNVAMMTSNNALIPDPDKQDELASQFWQWPILHV 585

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ +K+FLLGNPIV+W GT SLVL   +L WY +R +R Y E S A+  H  
Sbjct: 586 GLRMCSWDDNVIKYFLLGNPIVYWGGTLSLVLLGAILAWYLIRWQRGYDELSLADMEHIY 645

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           + G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+ FT       +  ++
Sbjct: 646 HSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWFTQKLPRSVEWAVY 705

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            + Y+ ++ +F  F+DI FG+   +S+     WLSTW I 
Sbjct: 706 TVLYAAVIGLFVLFRDIVFGMEGSSSKWAHLGWLSTWRIA 745



>gi|240273718|gb|EER37237.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Ajellomyces
           capsulatus H143]
 gi|325094850|gb|EGC48160.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Ajellomyces
           capsulatus H88]
          Length = 744

 Score =  402 bits (1033), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/400 (47%), Positives = 253/400 (63%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  +N   +
Sbjct: 345 GSKATLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRQEPDFNPDGD 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++FV + D I            SH ++APVT   +EVS YGN T+GD+ D+W +EVV D 
Sbjct: 405 LKFVGDKDVIRLIHAQTGRNLHSHAVSAPVTKSDYEVSCYGNTTVGDEKDHWRVEVVDDV 464

Query: 121 NTKXXX-XXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +K               H V+GCYLR+    LP+WGF+QIE TC K+NN +D+YTHWNV
Sbjct: 465 ASKDRSNIRTLTTSFRLRHVVLGCYLRAGTVNLPQWGFKQIETTCVKQNNPRDVYTHWNV 524

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 525 ESHINERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPILHV 584

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W +D +K+FLLGNP V+W GT SL +   +L WY +R +R Y E S  +  H  
Sbjct: 585 GLRMCSWDNDTIKYFLLGNPFVYWGGTLSLCVLGVILAWYLIRWQRGYDELSLVDMDHIY 644

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+  T   +   +  I+
Sbjct: 645 YSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWLTQKLRRSVEWAIY 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            ++Y++++ +F  F+DI FG+  P+ +     W  TW I 
Sbjct: 705 AVFYAVVIGLFVLFRDIVFGMEGPSLKWAHLAWFKTWRIA 744



>gi|453087664|gb|EMF15705.1| glycosyltransferase family 39 protein [Mycosphaerella populorum
           SO2202]
          Length = 741

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/401 (47%), Positives = 252/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  ++   E
Sbjct: 341 GSRVTLKNMGYGGGLLHSHVQTYPEGSNQQQITCYHHKDANNDWFFYPNRNEPDFDPEAE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++FV +   I            SH++AAPVT   +EVS YGN T+GD  D+W++EVV+D 
Sbjct: 401 LKFVGDKAEIRLIHAQTGRNLHSHQVAAPVTKADYEVSCYGNVTVGDTKDHWIVEVVNDA 460

Query: 121 NT-KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                H+ +GCYLR+ N  LP+WGF+QIE TC K N  +D YTHWNV
Sbjct: 461 ASYDYSKIRTLTTAFRLKHRDLGCYLRAGNVNLPQWGFKQIETTCVKENKPRDPYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP     ++KS F  +F HLNV M T NNAL+P+PDK+D ++S P QWP+L V
Sbjct: 521 ESHVNERLPASQPGSYKSPFFRDFVHLNVAMMTSNNALVPDPDKQDDLASAPWQWPLLNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK++LLGNP V+W+ TASL  F  L  WY++R +R Y E + A+  HF 
Sbjct: 581 GLRMCGWDDHIVKYYLLGNPFVYWASTASLFFFIGLFGWYAIRWQRGYDELTWADLDHFQ 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF  M RVTY+HHY+PALYF++L   F +D  T S     +  IF
Sbjct: 641 YAGIYPVIGWFLHYLPFIAMARVTYVHHYYPALYFAILCFGFCIDWTTRSLHKGVQWGIF 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y+++  +FW F+   FG+     + K  KWL +W + D
Sbjct: 701 AGLYAVVFGMFWLFRAFCFGMEGSNQQWKHLKWLPSWKMAD 741



>gi|239613563|gb|EEQ90550.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ajellomyces dermatitidis ER-3]
 gi|327352671|gb|EGE81528.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ajellomyces dermatitidis ATCC 18188]
          Length = 745

 Score =  402 bits (1032), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/400 (48%), Positives = 254/400 (63%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+ GGLLHSH+  YP GS QQQV+CYHH D NNDW I   R+E  Y+    
Sbjct: 346 GSKVTLKNMGYSGGLLHSHVQTYPEGSTQQQVTCYHHKDTNNDWFIYPNRQEPNYDPNDP 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +++V + D I            SH ++AP+T  H EVS YGN T+GD+ D+W +EV+ D 
Sbjct: 406 LKYVADKDVIRLIHAQTGRNLHSHTVSAPITKSHNEVSCYGNTTVGDEKDHWRVEVLGDV 465

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+    LP+WGF+QIE TC K NN +D YTHWNV
Sbjct: 466 ASRDRSKIRTLTTSFRLRHAVLGCYLRAGTVNLPQWGFKQIETTCIKENNPRDRYTHWNV 525

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G   ++KS FL +F HLNV M T NNALIP+PDK+D ++S   QWPIL V
Sbjct: 526 ESHVNERLPPGDPGSYKSPFLQDFIHLNVAMMTSNNALIPDPDKQDELASQFWQWPILHV 585

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ +K+FLLGNPIV+W GT SLVL   +L WY +R +R Y E S A+  H  
Sbjct: 586 GLRMCSWDDNVIKYFLLGNPIVYWGGTLSLVLLGAILAWYLIRWQRGYDELSLADMEHIY 645

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           + G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+ FT       +  ++
Sbjct: 646 HSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWFTQKLPRSVEWAVY 705

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            + Y+ ++ +F  F+DI FG+   +S+     WLSTW I 
Sbjct: 706 TVLYAAVIGLFVLFRDIVFGMEGSSSKWAHLGWLSTWRIA 745



>gi|321262843|ref|XP_003196140.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Cryptococcus gattii WM276]
 gi|317462615|gb|ADV24353.1| Dolichyl-phosphate-mannose-protein mannosyltransferase, putative
           [Cryptococcus gattii WM276]
          Length = 807

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/406 (48%), Positives = 258/406 (63%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +TLKN G+GGGLLHSH+   P GS QQQ++CYH+ D NN+W I+ P      +    
Sbjct: 400 GSTVTLKNYGYGGGLLHSHVQTLPVGSLQQQITCYHYKDENNNWQIVPPWGADPVDPDGP 459

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH IAAPVT   +EVS YGN T+GD ND WVIEVV DT
Sbjct: 460 IRFLKDGDEIRLVHTQTGRNMHSHAIAAPVTKESWEVSGYGNLTIGDANDLWVIEVVDDT 519

Query: 121 NT-----KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYT 175
           +T     +              H+ + CYLR+AN VLP+WGF+Q+EV+C K NN KD++T
Sbjct: 520 HTSKKDNENGRIHSLTTRMRLKHRELNCYLRAANAVLPQWGFKQVEVSCTKENNPKDLHT 579

Query: 176 HWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           +WNVE HWN +LP G+   +KS F  +F HLNV M+T NNALIP+PDKED ++S P  WP
Sbjct: 580 YWNVESHWNGRLPPGNAKLYKSPFWRDFVHLNVAMWTSNNALIPDPDKEDILASEPFDWP 639

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
            L +GLRM  W D ++KF+LLG PI+WW  T SL +   L  WY  R +R Y E+   EW
Sbjct: 640 FLHLGLRMCGWGDHQIKFYLLGTPIIWWFSTVSLAIGLGLAAWYVARMQRGYKEWKAGEW 699

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH--FTVSCKPK 353
            H+L+ GK+   GW LH+ PF IMGRVTYLHHY P LYF++LMA  ++DH  F    +  
Sbjct: 700 DHWLWAGKVAFGGWALHFFPFLIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASPTRSH 759

Query: 354 TKNII-FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK +I F ++  ++++ FW+FKD+A GI    +      W S+WNI
Sbjct: 760 TKKLIWFTVWAGVVILSFWWFKDLALGIYGNVNNHWGWGWRSSWNI 805



>gi|358378327|gb|EHK16009.1| glycosyltransferase family 39 protein [Trichoderma virens Gv29-8]
          Length = 740

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/400 (49%), Positives = 255/400 (63%), Gaps = 2/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y+  + 
Sbjct: 339 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRFEADYDAESP 398

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++ F+ +G  I            SHEI APVT  H EVS+YGN T+GDD D+W IEVV D
Sbjct: 399 DLRFIGDGSVIRLIHAQTGRNLHSHEIDAPVTKSHREVSSYGNLTVGDDKDHWRIEVVRD 458

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
           T ++               H  +GCYLR+ N  LP+WGF+QIEVTCDK+NN +D YTHWN
Sbjct: 459 TASRDRSKIRTLTTAFRLKHTALGCYLRAGNVNLPQWGFKQIEVTCDKQNNPRDTYTHWN 518

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE HWNEKLP      +KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 519 VEAHWNEKLPASDPGVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASHWWQWPILH 578

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D+ VK+FLLGNP V+W  TASL L   ++ WY VR +R + E + AE    
Sbjct: 579 VGLRMCGWDDNIVKYFLLGNPFVYWVSTASLGLVALVVAWYIVRWQRGFKELNNAEIDQI 638

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   VIGW LHY+PF IM RVTY+HHY+PALYF++L   F++D    +     + +I
Sbjct: 639 HYAGIYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILSLGFLVDWVLRNRNAVVQGVI 698

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           +GI Y++I+ ++  F  I +G+     +    KW   W I
Sbjct: 699 YGILYTVIIGLYILFIPICWGMTGSNEQYSYLKWFDNWRI 738



>gi|119196351|ref|XP_001248779.1| hypothetical protein CIMG_02550 [Coccidioides immitis RS]
 gi|392862004|gb|EAS37392.2| O-mannosyl transferase pmtA [Coccidioides immitis RS]
          Length = 747

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/401 (47%), Positives = 257/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+   E
Sbjct: 343 GSKVTIKNMGYGGGLLHSHVQTYPSGSSQQQVTCYHHKDSNNDWFVYPNRTQPDYDPEGE 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH I AP+T  ++EVS YGN T+GDD D+WV+EVV+D 
Sbjct: 403 LRFIGDGDIIRLIHAQTGRNLHSHAIPAPITKSNWEVSCYGNTTVGDDKDHWVVEVVNDV 462

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +K               H  +GCYLR+ N  LP+WGF+QIE TC K N   D++THWNV
Sbjct: 463 ASKDRSKIRTLTTAFRLRHPSLGCYLRAGNVNLPQWGFKQIETTCVKENKPYDVHTHWNV 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+L  G    +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWP+L V
Sbjct: 523 ESHVNERLQKGDPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPVLNV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W +D VK+FLLGNP V+W  TASL +F  ++ WY VR +R Y E S A+  H  
Sbjct: 583 GLRMCSWDNDTVKYFLLGNPFVYWGSTASLAVFGLVVAWYLVRWQRGYTELSQADIDHIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW+LHY+PF IM RVTY+HHY+PALYF++L   F ++ FT       +  ++
Sbjct: 643 YSGIYPLLGWVLHYLPFIIMARVTYVHHYYPALYFAILTMGFCVNWFTQKLSKPVEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ +F  FKDI FG+     + +   WLSTW I +
Sbjct: 703 FVLYAAVISLFVVFKDIVFGMQGSNEQWQYLNWLSTWRIAN 743



>gi|156050067|ref|XP_001590995.1| hypothetical protein SS1G_07619 [Sclerotinia sclerotiorum 1980]
 gi|154692021|gb|EDN91759.1| hypothetical protein SS1G_07619 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 742

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/401 (46%), Positives = 252/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQ++CYHH D NN+W     R +  ++    
Sbjct: 342 GSRATIKNMGYGGGLLHSHVQTYPEGSNQQQITCYHHKDANNEWWFYPNRSQPEFDPEAP 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + +V NGD +            SH+++AP+T    EVS YGN T+GDD D+W +EVV D 
Sbjct: 402 LRYVANGDVLRLVHSQTGRNLHSHDVSAPITKADKEVSCYGNTTVGDDKDHWTMEVVKDV 461

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
           ++                H  +GCYLR+ N  LP+WGF+QIEVTC K NN KD+YTHWNV
Sbjct: 462 SSNDRSKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPKDVYTHWNV 521

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWNEKLP      +KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 522 EAHWNEKLPAADAGAYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASYFWQWPILNV 581

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP+V+W  TASL +   L+ WY +R +R Y E S  +     
Sbjct: 582 GLRMCGWDDNIVKYFLLGNPLVYWGSTASLGVLGVLVLWYLIRWQRGYGELSQTDIDQIH 641

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW+LHY+PF  M RVTY+HHY+PALYF++L   F  D    +     +  I+
Sbjct: 642 YAGLYPVLGWVLHYLPFVAMARVTYVHHYYPALYFAILTFGFCSDWMLRNQAKTLQYAIY 701

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y L + ++ +F  I++G++ P  +    KW  +W + D
Sbjct: 702 GVLYGLTIALYIFFIPISWGMSGPNQQYSRLKWFDSWRVTD 742



>gi|346319255|gb|EGX88857.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2 [Cordyceps
           militaris CM01]
          Length = 743

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/402 (48%), Positives = 255/402 (63%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR TLKNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R E  Y+ N T
Sbjct: 342 GSRATLKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRGEADYDANST 401

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++ ++ +G  I            SHEIAAP+T    EVS+YGN T+GDD D+W IEV+ D
Sbjct: 402 DIRYIADGSVIRLIHASTGRNLHSHEIAAPMTKSDREVSSYGNLTIGDDKDHWQIEVIRD 461

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             ++               H  +GCYLR+ N  LP+WGF+QIEVTC  +NN +D YTHWN
Sbjct: 462 AASRDRSRIRTLTTGFRLKHPTLGCYLRAGNTNLPQWGFKQIEVTCTPKNNPRDSYTHWN 521

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE HWNEKLP G   ++KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 522 VESHWNEKLPPGDPGSYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 581

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D+ VK+FLLGNP V+W+ TASL L   ++ WY +R +R + +    E    
Sbjct: 582 VGLRMCGWDDNIVKYFLLGNPFVYWASTASLGLVGLVVVWYILRWQRGFKDLDSEEVDQI 641

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   V+GW LHY+PF IM RVTY+HHY+PALYF++L   F +D    +     +  +
Sbjct: 642 HYAGIYPVLGWFLHYLPFVIMARVTYVHHYYPALYFAILALGFFVDWLLRNRSQAIQGAV 701

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ YS+IV ++  F  I +G+     +    +W  TW + D
Sbjct: 702 YGVLYSVIVGLYITFIPICWGMTGNNRQYSYMRWFETWRMSD 743



>gi|225555541|gb|EEH03833.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Ajellomyces
           capsulatus G186AR]
          Length = 744

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/400 (47%), Positives = 253/400 (63%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  +N   +
Sbjct: 345 GSKATLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRQEPDFNPDGD 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++FV + D I            SH ++APVT   +EVS YGN T+GD+ D+W +EVV D 
Sbjct: 405 LKFVGDKDVIRLIHAQTGRNLHSHAVSAPVTKSDYEVSCYGNTTVGDEKDHWRVEVVDDV 464

Query: 121 NTKXXX-XXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +K               H V+GCYLR+    LP+WGF+QIE TC K+NN +D+YTHWNV
Sbjct: 465 ASKDRSNIRTLTTSFRLRHVVLGCYLRAGTVNLPQWGFKQIETTCVKQNNPRDVYTHWNV 524

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 525 ESHINERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPILHV 584

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W +D +K+FLLGNP V+W GT SL +   +L WY +R +R Y E S  +  H  
Sbjct: 585 GLRMCSWDNDTIKYFLLGNPFVYWGGTLSLCVLGVILAWYLIRWQRGYDELSLVDMDHIY 644

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+  T   +   +  I+
Sbjct: 645 YSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWLTQKLRRSVEWAIY 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            ++Y++++ +F  F+DI FG+  P+ +     W  TW I 
Sbjct: 705 VVFYAVVIGLFVLFRDIVFGMEGPSLKWAHLAWFKTWRIA 744



>gi|425774255|gb|EKV12568.1| Protein O-mannosyl transferase [Penicillium digitatum PHI26]
 gi|425778534|gb|EKV16658.1| Protein O-mannosyl transferase [Penicillium digitatum Pd1]
          Length = 737

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/401 (47%), Positives = 253/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  +P GS QQQV+CYHH D NNDW I   R+E  Y+   +
Sbjct: 335 GSRVTLKNMGYGGGLLHSHVQTFPEGSMQQQVTCYHHKDANNDWFIYPNRQEPDYDATAD 394

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + FV +GD I            SH I AP+T  H EVS+YGN T+GDD D+W +EVV D 
Sbjct: 395 LRFVGDGDVIRLIHGQTGRNLHSHAIPAPITKSHHEVSSYGNITIGDDKDHWKVEVVDDV 454

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIE TC K N   D+YTHWNV
Sbjct: 455 ASRDRSRIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCTKENKPGDVYTHWNV 514

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H N++LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 515 ESHTNDRLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 574

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK++LLGNP+V+W  TA+L  F  L  W+ +R +R Y + S  E  H  
Sbjct: 575 GLRMCSWDDGVVKYYLLGNPLVYWGSTAALGGFGLLFLWHLLRWQRGYNDLSNEEISHIH 634

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW+LHY+PF IM RVTY+HHY+PALY+++L   F +D  T    P+    ++
Sbjct: 635 YSGLYPVIGWVLHYLPFIIMARVTYVHHYYPALYYAILNFGFCIDWVTRKMNPRLSAAVY 694

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +IV +F +F+ I FG+     +    +WL  W + +
Sbjct: 695 AFLYVIIVGLFIHFRAIVFGMEGSNQQWTHLRWLPGWKMAN 735



>gi|258569719|ref|XP_002543663.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Uncinocarpus reesii 1704]
 gi|237903933|gb|EEP78334.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Uncinocarpus reesii 1704]
          Length = 754

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 257/401 (64%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R +  Y+   E
Sbjct: 350 GSKVTIKNMGYGGGLLHSHVQTYPSGSSQQQVTCYHHKDTNNDWFIYPNRTQPEYDPEGE 409

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +GD I            SH I AP+T  ++EVS YGN T+GDD D+WV+EVV+D 
Sbjct: 410 LRFIGDGDIIRLIHAQTGRNLHSHTIPAPITKSNWEVSCYGNTTVGDDKDHWVVEVVNDV 469

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+ +GCYLR+AN  LP+WGF+QIE TC K +   D++THWNV
Sbjct: 470 ASRDRTKIRTLTTSFRLRHQSLGCYLRAANVNLPQWGFKQIETTCAKDSKPYDVHTHWNV 529

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP      +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 530 ESHVNERLPKSDPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILNV 589

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W +D VK+FLLGNP V+W  TASL +F  +  WY VR +R Y E S A+  H  
Sbjct: 590 GLRMCSWDNDTVKYFLLGNPFVYWCSTASLGVFGLIFAWYLVRWQRGYTELSQADIDHIH 649

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   ++GW+LHY+PF IM RVTY+HHY+PALYF++L   F ++ FT       +  ++
Sbjct: 650 YSGLYPLLGWVLHYLPFIIMARVTYVHHYYPALYFAILTMGFCVNWFTQKLNKPAEWAVY 709

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I Y+ ++ +F  FKDI FG+     + +   W STW I +
Sbjct: 710 FILYAAVISLFVVFKDIVFGMVGSNEQWQHLNWFSTWRIAN 750



>gi|452845997|gb|EME47930.1| glycosyltransferase family 39 protein [Dothistroma septosporum
           NZE10]
          Length = 745

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/401 (47%), Positives = 252/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  ++    
Sbjct: 345 GSRATLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHEADFDPEAP 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++FV + D I            SH++AAPVT   +EVS+YGN T+GD  D+W +E+++D 
Sbjct: 405 LKFVGDKDVIRLIHAQTGRNLHSHQVAAPVTKADWEVSSYGNVTIGDTKDHWQVEIINDA 464

Query: 121 NTKX-XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H  +GCYLR+ N  LP+WGF+QIEVTC K+N  +D YTHWNV
Sbjct: 465 ASRDHSKLRTLTTAFRLKHVDLGCYLRAGNVNLPQWGFKQIEVTCVKQNKPRDPYTHWNV 524

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NEKLP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S P QWP+L V
Sbjct: 525 ESHTNEKLPAGDPGSYKSPFFRDFIHLNVAMMTSNNALVPDPDKQDDLASKPWQWPLLNV 584

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W ++ +K+FLLGNP+V+W  + SL  F  ++ WY++R +R Y E +  +  HF 
Sbjct: 585 GLRMCGWDENIIKYFLLGNPLVYWGSSLSLGFFLAMVAWYAIRWQRGYDELTWKQIDHFQ 644

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF  M RVTY+HHY+PALYF++L   F  D  T     + +  IF
Sbjct: 645 YSGIYPVIGWFLHYLPFIAMARVTYVHHYYPALYFAILSFGFCADWLTRQLPSRVQWAIF 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y     +FW FKD  FG+     +    KWLSTW + D
Sbjct: 705 TVLYVATTGLFWLFKDFCFGMVGNNQQWSHLKWLSTWRMSD 745



>gi|402084072|gb|EJT79090.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 741

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 254/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  YN   E
Sbjct: 341 GSRVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRREPEYNETEE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +GD+             SHEI+APVT    EVS YGN T+GDD D+W +EVV D 
Sbjct: 401 PRFIGDGDSFRLIHAQTGRNMHSHEISAPVTKSDKEVSCYGNLTIGDDKDHWKVEVVRDV 460

Query: 121 NTK-XXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEV C  +NN +D YT WNV
Sbjct: 461 ASRNRSRIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVACTPKNNPRDTYTWWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H N+KLP G+   +KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 521 EAHTNDKLPKGNPAVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W+ TASL     L+ WY +R +R Y E S  E    L
Sbjct: 581 GLRMCGWDDNIVKYFLLGNPFVYWATTASLGFVGLLVVWYVLRWQRGYRELSKPEMEQIL 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   +IGW LHY+PF +M RVTY+HHY+PALYF++L   F++D    S +   +  ++
Sbjct: 641 YSGIYPIIGWFLHYLPFVVMARVTYVHHYYPALYFAILSFGFLIDWTLRSLQKPIQYGLY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I Y +++ ++  F  I +G+  P  +    KW  TW + D
Sbjct: 701 SILYVVVIGLYIMFMPICWGMTGPNKQYSYMKWFDTWRMSD 741



>gi|384488399|gb|EIE80579.1| hypothetical protein RO3G_05284 [Rhizopus delemar RA 99-880]
          Length = 748

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/406 (47%), Positives = 257/406 (63%), Gaps = 7/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK---EQMYN- 56
           GS LT+KN GFGGGLLHSHI  YP GS+QQQV+CYHH D NN W I  PR+   EQ Y+ 
Sbjct: 338 GSNLTIKNAGFGGGLLHSHIQTYPEGSKQQQVTCYHHKDENNHWTIRPPREQDDEQSYDQ 397

Query: 57  --NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
             N   + F+ +GD I            SH + AP+T   +EVS YG +T+GD  D W +
Sbjct: 398 PDNPDFIRFLKDGDLIRLTHISTNRNLHSHPVNAPITTGQWEVSCYGTDTVGDTQDNWKV 457

Query: 115 EVVSDTNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDI 173
           E+V D N +               H+ +GC L + N VLP+WGF+Q+EV CDKRN+ ++ 
Sbjct: 458 EIVDDFNYQNKDRIRSLTTRFRLRHERLGCLLTADNTVLPQWGFKQVEVYCDKRNDTENP 517

Query: 174 YTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQ 233
           ++ WNVE+HWN KLP   +  +KS FL +F  LNV M+T NNAL P+PDK D +SS P +
Sbjct: 518 HSMWNVEQHWNTKLPPAPRNAYKSPFLRDFITLNVAMWTSNNALTPDPDKVDILSSEPSE 577

Query: 234 WPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPA 293
           WP+  VGLRM  W D +VK++LLGNPIVWW    ++ +F      Y +R +RK  + + A
Sbjct: 578 WPLATVGLRMCGWGDKQVKYYLLGNPIVWWLSIGAIFVFCLTTGVYVIRMQRKIFDLTNA 637

Query: 294 EWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPK 353
           +W HF Y+GK   +GW  HYIPFFIMGRVTYLHHYFPALYFS+LM  F+MDHFT     +
Sbjct: 638 QWDHFFYVGKTLFLGWFFHYIPFFIMGRVTYLHHYFPALYFSILMVPFLMDHFTQHKSVR 697

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            +  +F   Y  ++  F +F  I+FG+  P ++    +WL TWN+V
Sbjct: 698 VQWAVFIPVYLAVIATFIHFAPISFGLEGPITDYTYLEWLKTWNLV 743



>gi|406865997|gb|EKD19037.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Marssonina
           brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 746

 Score =  399 bits (1024), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 251/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R +   +   E
Sbjct: 346 GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNEWWFFPNRAQPDLDPEAE 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
            +FV +GD +            SHE++APVT    EVS YGN T+GD+ D+W +EVV D 
Sbjct: 406 PKFVADGDVLRLLHSQTGRNLHSHEVSAPVTKNDREVSCYGNVTVGDEKDHWTMEVVRDV 465

Query: 121 NT-KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                H V+GCYLR+ N  LP+WGF+QIEVTCDK NN KD+YTHWNV
Sbjct: 466 GSGDKTKIRTLTTAFRLRHTVLGCYLRAGNVNLPQWGFKQIEVTCDKANNPKDVYTHWNV 525

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 526 EAHWNDKLPAADAGAYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASEFWQWPILNV 585

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK++LLGNP+V+W  TASL L   +  WY VR +R Y+E    +     
Sbjct: 586 GLRMCGWDDNIVKYYLLGNPLVYWGSTASLGLVALMFSWYLVRWQRGYMELREWDIDQIH 645

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW LHYIPF  MGRVTY+HHY+PALYF++L+  F+ D    S     +   +
Sbjct: 646 YAGLYPVLGWFLHYIPFVSMGRVTYVHHYYPALYFALLVFGFVTDWMLRSRGKTVQVAAY 705

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G  Y+L + ++ YF  I++G+  P    +  KW  +W + D
Sbjct: 706 GFLYALTIGLYIYFMPISWGMVGPNKNYRYMKWFDSWRVTD 746



>gi|115385953|ref|XP_001209523.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Aspergillus terreus NIH2624]
 gi|114187970|gb|EAU29670.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Aspergillus terreus NIH2624]
          Length = 739

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 254/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KN G+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 339 GSRVTIKNRGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRNEPDYDANAP 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++F  + D I            SH I+APVT  H+EVS YGN T+GD+ D+W IEVV D 
Sbjct: 399 LKFPGDRDVIRLIHGQTGRNLHSHAISAPVTKSHYEVSGYGNITIGDEKDHWEIEVVDDA 458

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N  LP+WGF+QIE TC K N  +D+YTHWN+
Sbjct: 459 ASRDRSRVRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCVKENKPRDVYTHWNI 518

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H+NE+LP G   ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 519 ESHFNERLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 578

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ +K++LLGNP V+W  TASL +F  L+ WY VR +R Y + +  E  H  
Sbjct: 579 GLRMCSWDDNTIKYYLLGNPFVYWGSTASLGVFGLLVLWYLVRWQRGYNDLTQGEIDHIH 638

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYIPF +M RVTY+HHY+PALY+++L   F  D  T +   K    I 
Sbjct: 639 YSGIYPAIGWVLHYIPFVVMARVTYVHHYYPALYYAILTFGFCTDWLTRNAHNKVYWAIH 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y++I+ +F YF+ I FGI   + +     WLS W I +
Sbjct: 699 IVLYAVIIGLFTYFRVIVFGIEGSSQQWAHLGWLSGWRIAN 739



>gi|171689102|ref|XP_001909491.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944513|emb|CAP70624.1| unnamed protein product [Podospora anserina S mat+]
          Length = 795

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/401 (47%), Positives = 253/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R++  Y+   E
Sbjct: 394 GSKVTIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRRDADYDAAAE 453

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G TI            SH+IAAP+T   +EVS+YGN T+GD+ D+W IEVVSD 
Sbjct: 454 PRFIADGQTIRLLHSQTGRNLHSHQIAAPITKADWEVSSYGNITVGDEKDHWKIEVVSDA 513

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEVTC K N  +D YTHWN+
Sbjct: 514 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKDNKPRDTYTHWNI 573

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NEKLP G    ++S F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 574 ESHINEKLPPGDPGQYRSPFFKDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 633

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TA L +F  L  WY +R +R Y E S  +     
Sbjct: 634 GLRMCGWDDKIVKYFLLGNPLVYWGSTAGLGVFGLLTVWYILRWQRGYRELSQFDIDQIH 693

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF IM RVTY+HHY+PALYF++L   F+ D FT + K   +   +
Sbjct: 694 YAGIYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLTDWFTRNQKKIIQYATY 753

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +  + ++ ++ YF  I +G+  P  +    KW  TW + D
Sbjct: 754 AVLDATVIGLYIYFIPICWGMTGPNRQYGYMKWFDTWRMSD 794



>gi|71022783|ref|XP_761621.1| hypothetical protein UM05474.1 [Ustilago maydis 521]
 gi|46101174|gb|EAK86407.1| hypothetical protein UM05474.1 [Ustilago maydis 521]
          Length = 866

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/425 (45%), Positives = 263/425 (61%), Gaps = 29/425 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM----YN 56
           GS++TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NN+++I  P  E+     Y+
Sbjct: 443 GSKITLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYRDNNNEFIITPPWNERALPANYS 502

Query: 57  NITE-VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           + TE V  + N D I            SH +AAPVT  + EVS YG++  GDDND+WV+E
Sbjct: 503 SSTEPVRMLKNNDVIRLVHDQTKRNIHSHHVAAPVTKENLEVSGYGDDQTGDDNDHWVVE 562

Query: 116 VVSD----TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
           VV D       +              HK +GCY+R+AN VLP+WG++Q+EV+CDK NN K
Sbjct: 563 VVDDMVHGKVARDAPVRSLTSRLRLRHKNLGCYMRAANAVLPQWGWKQVEVSCDKENNPK 622

Query: 172 DIYTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLP 231
           D +T WN+E HWNE+L  G    +KS FL +F HLNV M T NNALIP+ DKED ++S P
Sbjct: 623 DQHTWWNIENHWNERLAPGDSQLYKSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 682

Query: 232 IQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS 291
             WP L  GLRM+ W D+ +KF+LLGNP++WW+ ++SL+ F     WY +R++R+  + S
Sbjct: 683 FDWPWLWNGLRMNSWDDNSIKFYLLGNPVIWWASSSSLLAFGATWLWYMMRRQRRIHDLS 742

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK 351
           PA+W HFLY+ K+   GWLLHY+PF +M RV YLHHY P LYF++LM   ++DHF    +
Sbjct: 743 PADWAHFLYVAKLAAFGWLLHYLPFLVMARVCYLHHYLPILYFAVLMLVHLIDHFV--WR 800

Query: 352 PKT------------------KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWL 393
           P T                  KN +F +    I   FW+F+  ++G        K  KW 
Sbjct: 801 PSTAVYAFGASRRKQPLSEALKNAVFVVSVVAITAAFWWFRGNSYGFKGDIKSHKGLKWR 860

Query: 394 STWNI 398
            +WNI
Sbjct: 861 KSWNI 865



>gi|189195184|ref|XP_001933930.1| protein O-mannosyl-transferase 2 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187979809|gb|EDU46435.1| protein O-mannosyl-transferase 2 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 739

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y    E
Sbjct: 339 GSRVTLKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDANNDWFFYPNRHEVEYKPDEE 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + +  NGD I            SH +AAPVT   +EVS YGN T+GD  D+WV+EVV D 
Sbjct: 399 LRYPGNGDVIRLIHAQTGRNLHSHAVAAPVTKSDWEVSCYGNTTVGDTKDHWVVEVVRDA 458

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               HK +GCYLR+ N  LP+WGF+QIE TC K+NN +D+YTHWN+
Sbjct: 459 ASRDYSKLRTLTTSFRLKHKDLGCYLRAGNVNLPQWGFKQIETTCVKKNNPRDVYTHWNI 518

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G+  ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 519 ESHTNERLPPGNPGDYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILHV 578

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP+V+W  TASL +F  ++ +Y VR +R Y + +  E     
Sbjct: 579 GLRMCGWNDDIVKYFLLGNPLVYWGSTASLGIFGLIVLFYLVRWQRGYNDLNKFEIDQIH 638

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   +IGW+LHYIPF  MGRVTY+HHY+PAL+F++L+  F +D  T     + +  I 
Sbjct: 639 YAGIYPIIGWVLHYIPFVAMGRVTYVHHYYPALWFAILVMGFCLDFSTRKLSKQVQWGIC 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y+  + ++  F   +FG+  P S+ K  KW  +W + D
Sbjct: 699 AGLYAATIGLYILFAPTSFGMVGPNSQYKYLKWFDSWRVTD 739



>gi|330925781|ref|XP_003301191.1| hypothetical protein PTT_12634 [Pyrenophora teres f. teres 0-1]
 gi|311324296|gb|EFQ90718.1| hypothetical protein PTT_12634 [Pyrenophora teres f. teres 0-1]
          Length = 739

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/401 (47%), Positives = 255/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y    E
Sbjct: 339 GSRVTLKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDANNDWFFYPNRHEVDYKPDEE 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + +  NGD I            SH +AAPVT   +EVS YGN T+GD  D+WV+EVV D 
Sbjct: 399 LRYPGNGDVIRLIHAQTGRNLHSHTVAAPVTKSDWEVSCYGNTTVGDTKDHWVVEVVRDA 458

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               HK +GCYLR+ N  LP+WGF+QIE TC K+NN +D+YTHWN+
Sbjct: 459 ASRDYSKLRTLTTSFRLKHKDLGCYLRAGNVNLPQWGFKQIETTCVKKNNPRDVYTHWNI 518

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G+  ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 519 ESHTNERLPPGNPGDYKSPFFQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILNV 578

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W+DD VK+FLLGNP+V+W  TASL +F  ++ +Y VR +R Y + +  E     
Sbjct: 579 GLRMCGWSDDIVKYFLLGNPLVYWGSTASLGIFGLIVLFYLVRWQRGYTDLNKFEIDQIH 638

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW+LHYIPF  MGRVTY+HHY+PAL+F++L+  F +D        + +  I 
Sbjct: 639 YAGFYPVVGWVLHYIPFVAMGRVTYVHHYYPALWFAILVMGFCLDFSIRKLSKQVQWGIC 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y + + ++  F   +FG+  P S+ K  KW  +W + D
Sbjct: 699 AVLYVVTIGLYILFAPTSFGMVGPNSQYKYLKWFDSWKVTD 739



>gi|154288412|ref|XP_001545001.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Ajellomyces capsulatus NAm1]
 gi|150408642|gb|EDN04183.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Ajellomyces capsulatus NAm1]
          Length = 649

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/400 (47%), Positives = 252/400 (63%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  +N   +
Sbjct: 250 GSKATLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRQEPDFNPDGD 309

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++FV + D I            SH ++APVT   +EVS YGN T+GD+ D+W +EVV D 
Sbjct: 310 LKFVGDKDVIRLIHAQTGRNLHSHAVSAPVTKSDYEVSCYGNTTVGDEKDHWRVEVVDDV 369

Query: 121 NTKXXX-XXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +K               H V+GCYLR+    LP+WGF+QIE TC K+NN +D+YTHWNV
Sbjct: 370 ASKDRSNIRTLTTSFRLRHAVLGCYLRAGTVNLPQWGFKQIETTCVKQNNPRDVYTHWNV 429

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 430 ESHINERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPILHV 489

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W +D +K+FLLGNP V+W GT SL +   +L WY +R +R Y E S  +  H  
Sbjct: 490 GLRMCSWDNDTIKYFLLGNPFVYWGGTLSLCVLGVILAWYLIRWQRGYDELSLVDMDHIY 549

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+  T   +   +  I+
Sbjct: 550 YSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWLTQKLRRSVEWAIY 609

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            ++Y++++ +F  F+DI FG+   + +     W  TW I 
Sbjct: 610 VVFYAVVIGLFVLFRDIVFGMEGSSLKWAHLAWFKTWRIA 649



>gi|367035654|ref|XP_003667109.1| glycosyltransferase family 39 protein [Myceliophthora thermophila
           ATCC 42464]
 gi|347014382|gb|AEO61864.1| glycosyltransferase family 39 protein [Myceliophthora thermophila
           ATCC 42464]
          Length = 744

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/404 (48%), Positives = 258/404 (63%), Gaps = 7/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+KNMG+GGGLLHSHI  YP GS QQQV+CYHH D NN+W     R +  Y+   +
Sbjct: 344 GSLVTIKNMGYGGGLLHSHIQTYPEGSGQQQVTCYHHKDANNNWFFYPNRGDTPYDPEAD 403

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G+ I            SH+IAAP+T   +EVS YGN T+GD  D+W IEVVSD 
Sbjct: 404 PRFIADGEVIRLLHAQTGRNLHSHQIAAPITKSQWEVSCYGNATIGDTKDHWRIEVVSDA 463

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N+ LP+WGF+QIEVTC K NN +D YTHWN+
Sbjct: 464 ASRDRSRIRTLTTAFRLKHEVLGCYLRAGNKNLPQWGFKQIEVTCTKENNPRDTYTHWNI 523

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NEKLP G    +KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 524 ESHINEKLPPGDPGQYKSPFFKDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 583

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TA+L +F  L+ WY +R +R Y E S AE     
Sbjct: 584 GLRMCGWDDKIVKYFLLGNPMVYWGSTAALGVFALLVAWYVLRWRRGYRELSQAEIDQIH 643

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW LHY+PF IM RVTY+HHY+PALYF++L   F+ D F    + ++K + +
Sbjct: 644 YSGLYPVLGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLSDWF---LRNRSKAVQW 700

Query: 360 GIYYSL---IVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+Y  L   ++ ++ YF  I +G+  P  + +  KW  TW + D
Sbjct: 701 GVYALLDATVIGLYIYFIPICWGMTGPNRQYRYMKWFDTWRMSD 744



>gi|358397085|gb|EHK46460.1| glycosyltransferase family 39 protein [Trichoderma atroviride IMI
           206040]
          Length = 740

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 250/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y+   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRYEPDYDAEGD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ +G  I            SH+I APVT  H EVS+YGN T+GDD D+W IEVV D 
Sbjct: 400 LRFIGDGSVIRLIHAQTGRNLHSHDIDAPVTKSHREVSSYGNLTVGDDKDHWQIEVVRDA 459

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H  + CYLR+ N  LP+WGF+QIEVTCDK+NN +D YTHWNV
Sbjct: 460 ASRDRSKIRTLTTAFRLKHTALDCYLRAGNVNLPQWGFKQIEVTCDKQNNPRDTYTHWNV 519

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      +KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 520 EAHWNDKLPESDPNVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILNV 579

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP ++W  T SL L   ++ WY VR +R Y E    E     
Sbjct: 580 GLRMCGWDDNIVKYFLLGNPFIYWGSTVSLGLVGLVVVWYIVRWQRGYRELDNQEIDQIH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   +IGW LHY+PF IM RVTY+HHY+PALYF++L   F++D    +     + +I+
Sbjct: 640 YAGIYPIIGWFLHYLPFVIMARVTYVHHYYPALYFAILSLGFLVDWTMRNRAAVVQGVIY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ YS+I+ ++  F  I +G+     +    KW   W I D
Sbjct: 700 GVLYSVIIGLYILFMPICWGMTGNNQQYSYLKWFDNWRISD 740



>gi|398407257|ref|XP_003855094.1| Dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Zymoseptoria tritici IPO323]
 gi|339474978|gb|EGP90070.1| Dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Zymoseptoria tritici IPO323]
          Length = 746

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/402 (46%), Positives = 252/402 (62%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R +  Y+   +
Sbjct: 341 GSKATLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDANNDWFFYPNRHQPTYDPEAD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++FV NGD I            SH + APVT    EVS YGN T+GD  D+W++E VSD 
Sbjct: 401 LKFVGNGDIIRLIHAQTGRNLHSHTVPAPVTKADHEVSCYGNLTVGDTKDHWMVETVSDA 460

Query: 121 NTKX-XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                H  + CYLR+ N  LP+WGF+QIE TC K NN +D+YTHWNV
Sbjct: 461 ASNDWTKLRTLTTSFRLKHVDLNCYLRAGNVNLPQWGFKQIETTCVKANNPRDVYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP  +   +KS FL +F HLNV M T NNAL+P+PDK+D ++S P QWP+L V
Sbjct: 521 ESHVNERLPPSAPGAYKSPFLRDFIHLNVAMMTSNNALVPDPDKQDDLASAPWQWPLLHV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  T S+     ++ +Y++R +R Y E +  +   F 
Sbjct: 581 GLRMCGWDDAIVKYFLLGNPVVYWGSTFSVFFIMAMIAYYAIRWQRGYDELTWKDLEQFH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT-KNII 358
           Y G   ++GW LHY+PF  M RVTY+HHY+PALYF++L A F++D +T + +  + K  I
Sbjct: 641 YSGIYPLLGWFLHYMPFVAMARVTYVHHYYPALYFAILTAGFIVDWYTRNLRSTSVKVAI 700

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           FG+ Y L++ +FW F+   FG+     +    KW   W +VD
Sbjct: 701 FGVLYGLVIFMFWLFRAFCFGMEGSNRQWAHLKWFDQWRMVD 742



>gi|116204893|ref|XP_001228257.1| hypothetical protein CHGG_10330 [Chaetomium globosum CBS 148.51]
 gi|88176458|gb|EAQ83926.1| hypothetical protein CHGG_10330 [Chaetomium globosum CBS 148.51]
          Length = 727

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 253/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R +  Y+   +
Sbjct: 326 GSLVTIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNNWFFYPNRGDTPYDAEAD 385

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G+ +            SH+IAAP+T   +EVS+YGN T+GD  D+W IEVVSD 
Sbjct: 386 PRFIADGEVVRLLHAQTGRNLHSHQIAAPITKSQWEVSSYGNATIGDAKDHWRIEVVSDA 445

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEVTC K NN +D YTHWN+
Sbjct: 446 ASRDRSKVRTLTTGFRLKHEVMGCYLRAGNTNLPQWGFKQIEVTCTKENNPRDTYTHWNI 505

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NEKLP G    +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 506 ESHINEKLPPGDPGQYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 565

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TA L +F  L+ WY++R +R Y E S  E     
Sbjct: 566 GLRMCGWDDKIVKYFLLGNPLVYWGSTAGLGIFALLVVWYTLRWQRGYRELSQPEIDQIH 625

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF IM RVTY+HHY+PALYF++L   F+ D F  + K   +  ++
Sbjct: 626 YAGLYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLSDWFLRNRKAAVQWGVY 685

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +  + ++ ++ YF  I +G+     +    KW  TW + D
Sbjct: 686 ALLDATVIGLYIYFIPICWGMTGSNKQYGYMKWFDTWRMSD 726



>gi|367055346|ref|XP_003658051.1| glycosyltransferase family 39 protein [Thielavia terrestris NRRL
           8126]
 gi|347005317|gb|AEO71715.1| glycosyltransferase family 39 protein [Thielavia terrestris NRRL
           8126]
          Length = 743

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/401 (47%), Positives = 256/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R++  Y+   E
Sbjct: 342 GSMVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNNWFFYPNRRDIPYDPAAE 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G+ I            SH+IAAP+T   +EVS YGN T+GD+ D+W IEVVSD 
Sbjct: 402 PRFIGDGEVIRLLHAQTGRNLHSHQIAAPITKSQWEVSCYGNATIGDEKDHWKIEVVSDA 461

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+ +GCYLR+ N  LP+WGF+QIEVTC K NN +D YTHWN+
Sbjct: 462 ASRDRSRIRTLTTAFRLRHETLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNI 521

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NEKLP G+   +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 522 EAHVNEKLPPGNPGLYKSPFLKDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 581

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TA+L +F  L+ WY++R +R Y E SP E     
Sbjct: 582 GLRMCGWDDSIVKYFLLGNPLVYWGSTAALGVFAGLVAWYTIRWQRGYRELSPPELDQIH 641

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V GW LHY+PF IM RVTY+HHY+PALYF++L   F+ D F  + +   +   +
Sbjct: 642 YAGLYPVAGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLADWFLRNQRAVAQYAAY 701

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ ++ YF  I +G+  P  +    KW  +W + D
Sbjct: 702 ALLYAAVIGLYIYFIPICWGMTGPNRKYSYMKWFESWRMSD 742



>gi|494824411|gb|EON61702.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Coniosporium apollinis CBS 100218]
          Length = 745

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/401 (50%), Positives = 254/401 (63%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  +P GS QQQV+CYHH D NNDW     R E  Y+    
Sbjct: 345 GSRATIKNMGYGGGLLHSHVQTFPEGSGQQQVTCYHHKDANNDWFFYPNRGEVEYDPEEP 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F  NG+TI            SH+IAAP+T    EVS YGN T+GD  D+WVIEVV D 
Sbjct: 405 LRFPGNGNTIRLIHAQTGRNLHSHQIAAPITKADHEVSCYGNTTVGDTKDHWVIEVVRDA 464

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                H  +GCYLR+ N  LP+WGF+QIEVTC K N  +D+YTHWNV
Sbjct: 465 ASNDYSKIRTLTTAFRLKHADLGCYLRAGNVNLPQWGFKQIEVTCTKENKPRDVYTHWNV 524

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWNE LP G   ++KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 525 ESHWNENLPPGDPGSYKSPFLRDFLHLNVAMMTSNNALVPDPDKQDDLASQFWQWPILHV 584

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TASL +F  L+ WY +R +R Y E   A+  H  
Sbjct: 585 GLRMCGWDDHIVKYFLLGNPVVYWGSTASLGIFGLLILWYLIRWQRGYDELKQADIDHIH 644

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF  M RVTY+HHY+PALYF++L A F +D  T     + +  I+
Sbjct: 645 YSGLYPVIGWFLHYLPFVAMARVTYVHHYYPALYFAILTAGFCVDWATRRLSREVQWGIY 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y ++V +F  F+ I FG+    ++ +  KW STW I D
Sbjct: 705 GVLYVVVVGLFVLFRHICFGMVGSHTQWRHLKWFSTWRITD 745



>gi|169596911|ref|XP_001791879.1| hypothetical protein SNOG_01229 [Phaeosphaeria nodorum SN15]
 gi|111069758|gb|EAT90878.1| hypothetical protein SNOG_01229 [Phaeosphaeria nodorum SN15]
          Length = 739

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/401 (46%), Positives = 251/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y    E
Sbjct: 339 GSRVTLKNMGYGGGLLHSHVQTYPEGSMQQQITCYHHKDANNDWFFYPNRHEVDYQPDEE 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F  +   I            SH +AAPVT   +EVS YGN T+GD  D+W I++V D 
Sbjct: 399 LRFPKDKSVIRLIHAQTGRNLHSHAVAAPVTKADWEVSCYGNTTVGDTKDHWEIQIVRDA 458

Query: 121 NT-KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                H  +GCYLR+ N  LP+WGF+QIE TC K NN +D+YTHWN+
Sbjct: 459 ASNDRSKVRTLTTALRFKHVDLGCYLRAGNVNLPQWGFKQIETTCVKSNNPRDVYTHWNI 518

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H N++LP G+  ++KS F  +F HLNV M T NNAL+P+PDK+D ++S   +WP L V
Sbjct: 519 ESHVNDRLPAGNPGDYKSPFFQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWEWPFLHV 578

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W DD VK+FLLGNP V+W  TASL +F  ++ WY+VR +R Y +   A+     
Sbjct: 579 GLRMCGWNDDIVKYFLLGNPFVYWGSTASLGIFGLIVIWYTVRWQRGYNDLKQADIDQIH 638

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   +IGW LHY+PF  MGRVTY+HHY+PAL+F++++  F +D  T     K +  IF
Sbjct: 639 YSGLYPIIGWALHYVPFVAMGRVTYVHHYYPALWFAIIVMGFCVDWATRGLNKKVQWGIF 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +I+ ++W F+ I+FG+  P+S+    KW  +W I D
Sbjct: 699 SALYVIIIGLYWLFRAISFGMVGPSSQWSHLKWFDSWRITD 739



>gi|471561503|gb|EMR63260.1| putative dolichyl-phosphate-mannose-protein mannosyltransferase 2
           protein [Eutypa lata UCREL1]
          Length = 741

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/402 (47%), Positives = 254/402 (63%), Gaps = 3/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KN G+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R +  Y+   +
Sbjct: 341 GSRVTIKNQGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWWFYPNRFDADYDPEAD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G  I            SH+I APV+  H EVS+YGN T+GDD D+W IEVV D 
Sbjct: 401 PRFIGDGSVIRLIHSQTGRNLHSHDIPAPVSKSHKEVSSYGNLTVGDDKDHWKIEVVKDV 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H+V+GCYLR+ N  LP+WGF+QIEVTCDK NN +D +THWN+
Sbjct: 461 ASRDKSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCDKSNNPRDTFTHWNI 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NEKLP G    +KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 521 EGHTNEKLPPGDPGKYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP ++W  T SL +   +  WY +R +R + E S  +     
Sbjct: 581 GLRMCGWDDKIVKYFLLGNPFIYWVSTGSLGVVGLMTLWYILRWQRGFRELSQEDIDQIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT-KNII 358
           Y G   ++GW LHY+PF +M RVTY+HHY+PALYF++L   F++D F +  KPK  +  I
Sbjct: 641 YSGLYPILGWFLHYLPFVVMARVTYVHHYYPALYFAILSLGFLVD-FVLKEKPKVIQYAI 699

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y+++  ++ YF  I +G+     + K  KW  +W I D
Sbjct: 700 YGVLYTVVSGLYIYFIPICWGMTGSNQQYKYMKWFDSWRISD 741



>gi|440631744|gb|ELR01663.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Geomyces
           destructans 20631-21]
          Length = 746

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/402 (47%), Positives = 245/402 (60%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R E  Y+    
Sbjct: 345 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDSNNEWFFYPNRAEPEYDGEGP 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
            +FV +GD +            SH+++AP+T V  EVS YGN T+GD+ D++ IEVV D 
Sbjct: 405 PKFVAHGDVLRLIHAQTGRNLHSHDVSAPITKVDKEVSCYGNTTVGDEKDHFTIEVVKDV 464

Query: 120 -TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
            +NT               H  +GCYLR+ N  LP+WGF+QIEVTC K NN KD +THWN
Sbjct: 465 SSNTDKTKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKANNPKDTFTHWN 524

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE HWN KLP      +KS F  +F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 525 VEAHWNSKLPAADANAYKSPFFQDFIHLNVAMATSNNALVPDPDKQDDLASHFWQWPILN 584

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D  VK+FLLGNPIV+W  TASL L   ++ WY +R +R Y +   +E    
Sbjct: 585 VGLRMCGWDDSIVKYFLLGNPIVYWGSTASLALLGLIVLWYLIRWQRGYADLKQSEIDQI 644

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   VIGW LHY PF  M RVTY+HHY+PALYF++L   F  D          +  +
Sbjct: 645 HYAGIYPVIGWFLHYFPFVAMARVTYVHHYYPALYFAILTFGFCADWMLRRRAKAVQFAV 704

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G  Y+ ++ ++  F  I++G+  P S+ +  KW   W + D
Sbjct: 705 YGALYTAVIGLYILFMPISWGMVGPNSQYRYLKWFEKWRVSD 746



>gi|443920103|gb|ELU40091.1| protein O-mannosyl transferase [Rhizoctonia solani AG-1 IA]
          Length = 765

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/423 (45%), Positives = 261/423 (61%), Gaps = 25/423 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKN+G+GGGLLHSH+  YP GS+QQQV+CYH+ D NN W  L P      +   E
Sbjct: 342 GSKVTLKNVGYGGGLLHSHVQTYPVGSQQQQVTCYHYKDDNNHWTFLPPWGSPDIDPNGE 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           +  + +   +            SH + APVT  ++EVS YGN T+GD +D+WV+EVV D 
Sbjct: 402 LVPLKHAAVVRLQHTPTTRNLHSHTVTAPVTKSNYEVSCYGNTTVGDSHDHWVVEVVDDL 461

Query: 120 ---TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
                 K              H+ +GCYLR+AN VLP+WGF+QIEV+C K N+  D +T+
Sbjct: 462 HRGRREKVDRIHSLTTRLRFKHQSLGCYLRAANAVLPQWGFKQIEVSCVKENDESDTHTY 521

Query: 177 WNVERHWNEK-------------------LPLGSKVNFKSKFLHNFWHLNVGMYTVNNAL 217
           WNVE HWN +                   +P G+   + S FL +FWHLNV M T NNAL
Sbjct: 522 WNVESHWNSRRKSLHSPPKLGSTLTNRRIVPPGNAKLYSSPFLRDFWHLNVAMMTSNNAL 581

Query: 218 IPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLF 277
           +P+PDKED ++S P +WP L VGLRM  W DD+ K++LLG+PIVWWSG+ +L L      
Sbjct: 582 VPDPDKEDILASKPTEWPFLHVGLRMCGWGDDQAKYYLLGHPIVWWSGSLALGLSLLATG 641

Query: 278 WYSVRQKRKYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSML 337
            Y +R +RKY++F P EW  F Y+ K+   GW+ H++PF IMGRVTY+HHY PAL+FS+L
Sbjct: 642 VYLLRAQRKYVDFGPGEWDQFSYVTKLAFFGWVFHFMPFLIMGRVTYIHHYLPALWFSVL 701

Query: 338 MAAFMMDHFTVSCK--PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLST 395
           M   + +HF  + +   +TK I+FG   S+IV VFW+F+ IAFGI  P  +     W  T
Sbjct: 702 MVGHLFNHFVFAARIAERTKWIVFGAAVSVIVGVFWWFRGIAFGITGPIKDYWGLAWRKT 761

Query: 396 WNI 398
           WNI
Sbjct: 762 WNI 764



>gi|470316308|gb|EMR08070.1| hypothetical protein PNEG_03510 [Pneumocystis murina B123]
          Length = 740

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/398 (47%), Positives = 260/398 (65%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+ GGLLHSH+  +P GS QQQV+CYHH D NNDW I      +  ++   
Sbjct: 341 GSKVTIKNMGYSGGLLHSHVQTFPTGSNQQQVTCYHHRDENNDWRIHPSHNSEPVSSEDP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ N D +            SH+I+AP+T    EVS YGN T+GDDND+WVIEV+ D+
Sbjct: 401 LIFLRNNDVLRLIHNSTGCNLHSHDISAPITKTQNEVSCYGNLTIGDDNDHWVIEVIKDS 460

Query: 121 NTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVE 180
           N +              H +  CYLR+ N  LP+WGF+QIEVTCDK NN KD YTHWN+E
Sbjct: 461 NPRDTRIKTIKTAFRLRHIIHNCYLRAENVHLPQWGFKQIEVTCDKTNNPKDYYTHWNIE 520

Query: 181 RHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEVG 240
            HWN++LP G+   +KS F ++F+++N+ M   NNAL+ +  K+D + S P QWPI   G
Sbjct: 521 NHWNDRLPSGNIKFYKSSFWYDFFYINIAMMNTNNALLLDKGKKDDLISYPWQWPIAISG 580

Query: 241 LRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFLY 300
           +RM  W D+  KF+LLGNP V+W    S+ LFF L+ +Y++R KR YI+F+P ++ HF Y
Sbjct: 581 IRMCSWDDNVPKFYLLGNPAVYWISLGSIFLFFILILFYTIRWKRHYIDFTPDKFDHFHY 640

Query: 301 IGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIFG 360
           +G   ++GW+LHY PFFI+ RV YLHHYFPAL F++L   F+ DH T S     + IIF 
Sbjct: 641 VGLYPLLGWILHYFPFFIIKRVLYLHHYFPALLFAILTTGFVFDHLTGSIPVLFRKIIFS 700

Query: 361 IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           I Y  +++ F YFKDI FG+  P+++ K  +WL TW I
Sbjct: 701 IAYISVILTFIYFKDITFGMIGPSNQWKYLQWLPTWRI 738



>gi|443898178|dbj|GAC75515.1| dolichyl-phosphate-mannose:protein O-mannosyl transferase
           [Pseudozyma antarctica T-34]
          Length = 883

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/421 (45%), Positives = 256/421 (60%), Gaps = 23/421 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKP-RKEQMYNNIT 59
           GS++TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NN+++I  P  + Q+  N +
Sbjct: 462 GSKVTLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYRDNNNEFIITPPWNQPQLPANYS 521

Query: 60  EVE----FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
             E     V NGD I            SH  AAPVT  + EVS YG+E +GDDND+WV+E
Sbjct: 522 SSEEPIRMVKNGDIIRLVHDQTKRNIHSHNFAAPVTKENLEVSGYGDEKVGDDNDHWVVE 581

Query: 116 VVSDTNTKX----XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
           VV D                      H  + CYLR+AN VLP+WG++Q+EV+CDK NN K
Sbjct: 582 VVDDMVLGKVKLGAPVRSLTTRMRLRHHNLNCYLRAANAVLPQWGWKQVEVSCDKENNPK 641

Query: 172 DIYTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLP 231
           D +T WN+E HWN++LP G +  ++S FL +F HLNV M T NNALIP+ DKED ++S P
Sbjct: 642 DEHTWWNIENHWNDRLPPGDEKLYRSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 701

Query: 232 IQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS 291
             WP L  GLRM+ W D  +K++L+GNP+VWW  +ASLV+F     WY +R++R+  + S
Sbjct: 702 FDWPWLWNGLRMNSWDDSSIKYYLIGNPVVWWGSSASLVVFAGTWLWYMMRRQRRIHDLS 761

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFT---- 347
           P++W HFLY+ KI   GW LHY+PF IM RV YLHHY P LYF++LM A ++DHF     
Sbjct: 762 PSDWAHFLYVSKIAAFGWALHYVPFLIMARVCYLHHYLPILYFAVLMLAHLLDHFVWRPT 821

Query: 348 ----------VSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
                     V      KN +F      +   FW+F   ++G        K  KW  +WN
Sbjct: 822 TAVYARGGRRVPLSQTVKNAVFVGAVLAVGGAFWWFSGNSYGYTGDIKRHKGLKWRKSWN 881

Query: 398 I 398
           I
Sbjct: 882 I 882



>gi|346979040|gb|EGY22492.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Verticillium dahliae VdLs.17]
          Length = 744

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 249/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E+ Y+   E
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDTNNDWFFYPNRDEEPYDAEAE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             ++ +G TI            SHEIAAP+T    EVS YGN T+GD  D+W IEVV D 
Sbjct: 401 PRYIADGTTIRLIHAQTGRNLHSHEIAAPMTKSDKEVSCYGNLTVGDAKDHWKIEVVRDA 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+ N+ LP+WGF+QIEVTC K NN +D YTHWNV
Sbjct: 461 ASRDRSRVRTLTTAFRLKHPVLGCYLRAGNKNLPQWGFKQIEVTCTKTNNPRDTYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+K+P      +KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL+V
Sbjct: 521 EAHWNDKIPKSDPGVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASHWWQWPILDV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP V+W  T  L +F  ++ WY +R +R + + +  E     
Sbjct: 581 GLRMCSWDDSVVKYFLLGNPFVYWGTTLGLGVFGLVIAWYVLRWQRGFGDLNYKEVDQIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW+LHY+PF  M RVTY+HHY+PALYF++L   F+ D F  +     +  I+
Sbjct: 641 YAGVYPVIGWVLHYLPFVAMARVTYVHHYYPALYFAILTFGFLADWFLRNKNKTIQYAIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y +I+ ++  F  I FG+     +    +W   W I D
Sbjct: 701 GVLYLVIIGLYINFIPICFGMVGSNKQFSYLRWSDKWRISD 741



>gi|345560349|gb|EGX43474.1| hypothetical protein AOL_s00215g210 [Arthrobotrys oligospora ATCC
           24927]
          Length = 735

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/399 (47%), Positives = 246/399 (61%), Gaps = 1/399 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS+QQQ++CYHH D NNDW I   R ++ Y    +
Sbjct: 335 GSRATLKNMGYGGGLLHSHVQTYPEGSQQQQITCYHHKDANNDWFIYPNRSQKDYEVGED 394

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+ N D I            SH IAAPVT   +EVS YGN T+GD+ D+W IEVV D 
Sbjct: 395 LRFIKNNDVIRLIHAQTGRNLHSHTIAAPVTKADYEVSCYGNTTVGDEKDHWKIEVVRDA 454

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+ CYLR+ N  LP+WGF+QIE +C K NN +D YTHWN+
Sbjct: 455 ASRDYSKIRTLTTAFRLKHPVLNCYLRAGNVNLPQWGFKQIETSCVKENNPRDQYTHWNI 514

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWNEKLP   K  FKS F ++F HLNV M T NNAL+P+PDK+D ++S P QWPIL V
Sbjct: 515 ESHWNEKLPPAKKDAFKSPFWNDFVHLNVAMMTSNNALVPDPDKQDDLASQPWQWPILHV 574

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W +  VK+FLLGNP V+W   ASL +   ++  Y VR +R + + +  +  H  
Sbjct: 575 GLRMCGWDNHIVKYFLLGNPAVYWGAFASLFVLGFMILTYLVRFQRGFPDLTQDQIDHIK 634

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
             G    IGW+LH+IPF IM RVTY+HHY+PALYF +L+  F  D  T       +   F
Sbjct: 635 LAGLYPAIGWVLHFIPFVIMARVTYVHHYYPALYFGILVFGFCFDWLTNLLPTNARLASF 694

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           G+ Y+++  ++ YF  I FG+   A++    KW   W I
Sbjct: 695 GVAYTIVTGLYIYFIPICFGMVGDAADYAYLKWFDRWRI 733



>gi|501308867|dbj|GAC97757.1| glycosyltransferase [Pseudozyma hubeiensis SY62]
          Length = 861

 Score =  389 bits (998), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 263/424 (62%), Gaps = 26/424 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM----YN 56
           GS++TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NN+++I  P  EQ     Y+
Sbjct: 437 GSKITLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYRDNNNEFIITPPWGEQQLPANYS 496

Query: 57  NITE-VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           +  E +  + N D I            SH +AAPVT  + EVS YG+  +GDDND+WV+E
Sbjct: 497 SSEEPIRMLKNNDIIRIVHDQTKRNIHSHNVAAPVTKENLEVSGYGDAEVGDDNDHWVVE 556

Query: 116 VVSD----TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
           VV D       +              HK + CY+R+AN VLP+WG++Q+EV+CDK NN K
Sbjct: 557 VVDDMVHGKVPRGGPVRSLTTRLRLRHKNLNCYMRAANAVLPQWGWKQVEVSCDKENNPK 616

Query: 172 DIYTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLP 231
           D +T WN+E HWN++LP G    +KS FL +F HLNV M T NNALIP+ DKED ++S P
Sbjct: 617 DQHTWWNIENHWNDRLPPGDSQLYKSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 676

Query: 232 IQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS 291
             WP L  GLRM+ W D+ +KF+LLGNP++WWS + SL+ F     WY +R++R+  + S
Sbjct: 677 FDWPFLWNGLRMNSWDDNSIKFYLLGNPVIWWSSSFSLLAFAGTWLWYMMRRQRRIQDLS 736

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF----T 347
           P +W HFLY+ K+   GW+LHY+PF IM RV YLHHY P LYF++LM   +MDHF    T
Sbjct: 737 PTDWSHFLYVAKLAGFGWILHYLPFLIMARVCYLHHYLPILYFAVLMLVHLMDHFFWRRT 796

Query: 348 VSC----------KPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLS 394
            +           +P  + +   ++   +V V   FW+F+  ++G     S  K  KW  
Sbjct: 797 TAVYSFGGKKGRREPLGEGVKNAVFVGSVVAVAGAFWWFRGNSYGFKGDISGYKGLKWRK 856

Query: 395 TWNI 398
           +WNI
Sbjct: 857 SWNI 860



>gi|388856084|emb|CCF50264.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Ustilago hordei]
          Length = 788

 Score =  389 bits (998), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/422 (46%), Positives = 269/422 (63%), Gaps = 24/422 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKP-RKEQMYNNIT 59
           GS++TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NN+++I  P  +EQ+  N +
Sbjct: 366 GSKITLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYRDNNNEFIITPPWNEEQLPANYS 425

Query: 60  ----EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
                +  + + D I            SH IAAPVT  + EVS YG+E  GDDND+W++E
Sbjct: 426 GSDQPLRMLKDNDIIRLVHDQTKRNIHSHHIAAPVTKENLEVSCYGDENTGDDNDHWIVE 485

Query: 116 VVSDTNT----KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
           VV D       +              HK IGCYLR+AN VLP+WG++Q+EV+CDK NNAK
Sbjct: 486 VVDDMVHGKVYRGGPVRSLTTRIRLRHKNIGCYLRAANAVLPQWGWKQVEVSCDKENNAK 545

Query: 172 DIYTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLP 231
           D +T WN+E HWN++LP G +  ++S FL +F HLNV M T NNALIP+ DKED ++S P
Sbjct: 546 DEHTWWNIENHWNDRLPPGDEKLYRSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 605

Query: 232 IQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS 291
             WP L  GLRM+ W D+ +K++LLGNP++WWS + SLV+F     +Y +R++R+  + S
Sbjct: 606 FDWPFLWNGLRMNSWDDNTIKYYLLGNPVIWWSSSISLVVFGATWLYYMMRRQRRIQDLS 665

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF----T 347
           P +W HFLY+GKI   GW LHY+PF IM RV YLHHY P LYF++LM A +MDHF    T
Sbjct: 666 PNDWAHFLYVGKIAAFGWALHYLPFLIMARVCYLHHYLPILYFAVLMLAHLMDHFLWRPT 725

Query: 348 VSC--------KP---KTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTW 396
            +         KP     KN+ F    + +   FW+F++ ++G     ++ K  KW  +W
Sbjct: 726 TAVYYFGGRQRKPLGQGVKNVAFATAVAAVATAFWWFRNNSYGFQGDINKHKGLKWRKSW 785

Query: 397 NI 398
           NI
Sbjct: 786 NI 787



>gi|154317996|ref|XP_001558317.1| hypothetical protein BC1G_02981 [Botryotinia fuckeliana B05.10]
          Length = 702

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 252/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSHI  YP GS QQQ++CYHH D NN+W     R +  ++    
Sbjct: 302 GSRATIKNMGYGGGLLHSHIQTYPEGSNQQQITCYHHKDANNEWWFYPNRSQPEFDPEAP 361

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + +V +GD +            SH+++AP+T    EVS YGN T+GDD D+W +EVV D 
Sbjct: 362 LRYVADGDVLRFVHSQTGRNLHSHDVSAPITKADKEVSCYGNTTVGDDKDHWTMEVVKDV 421

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
           ++                H  +GCYLR+ N  LP+WGF+QIEVTC K NN KD+YTHWNV
Sbjct: 422 SSNDRSKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPKDVYTHWNV 481

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWNEKLP      +KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 482 EAHWNEKLPAADAGAYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASYFWQWPILNV 541

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP+V+W  TASL L   L+ WY VR +R Y E   +E     
Sbjct: 542 GLRMCGWDDNIVKYFLLGNPLVYWGSTASLGLLGLLVLWYLVRWQRGYDELKQSEIDQIH 601

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW LHY+PF  M RVTY+HHY+PALYF++L+  F  D    +     +  I+
Sbjct: 602 YAGLYPVLGWFLHYVPFVAMARVTYVHHYYPALYFAILVFGFCADWMLRNQVKTLQYAIY 661

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+L + ++ +F  I++G+  P  E    KW  +W + D
Sbjct: 662 GVLYALTIALYIFFMPISWGMEGPNREYSRLKWFDSWRVTD 702



>gi|347831485|emb|CCD47182.1| glycosyltransferase family 39 protein [Botryotinia fuckeliana T4]
 gi|472237169|gb|EMR82080.1| putative dolichyl-phosphate-mannose-protein mannosyltransferase 2
           protein [Botryotinia fuckeliana BcDW1]
          Length = 741

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/401 (47%), Positives = 252/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSHI  YP GS QQQ++CYHH D NN+W     R +  ++    
Sbjct: 341 GSRATIKNMGYGGGLLHSHIQTYPEGSNQQQITCYHHKDANNEWWFYPNRSQPEFDPEAP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + +V +GD +            SH+++AP+T    EVS YGN T+GDD D+W +EVV D 
Sbjct: 401 LRYVADGDVLRFVHSQTGRNLHSHDVSAPITKADKEVSCYGNTTVGDDKDHWTMEVVKDV 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
           ++                H  +GCYLR+ N  LP+WGF+QIEVTC K NN KD+YTHWNV
Sbjct: 461 SSNDRSKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPKDVYTHWNV 520

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWNEKLP      +KS F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 521 EAHWNEKLPAADAGAYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASYFWQWPILNV 580

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP+V+W  TASL L   L+ WY VR +R Y E   +E     
Sbjct: 581 GLRMCGWDDNIVKYFLLGNPLVYWGSTASLGLLGLLVLWYLVRWQRGYDELKQSEIDQIH 640

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW LHY+PF  M RVTY+HHY+PALYF++L+  F  D    +     +  I+
Sbjct: 641 YAGLYPVLGWFLHYVPFVAMARVTYVHHYYPALYFAILVFGFCADWMLRNQVKTLQYAIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+L + ++ +F  I++G+  P  E    KW  +W + D
Sbjct: 701 GVLYALTIALYIFFMPISWGMEGPNREYSRLKWFDSWRVTD 741



>gi|511007747|gb|EPB89028.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Mucor
           circinelloides f. circinelloides 1006PhL]
          Length = 754

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/406 (45%), Positives = 245/406 (60%), Gaps = 6/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---- 56
           GS+LT KN G+GGGLLHSH+  YP GS+QQQV+CYHH D NN W I  PR    +     
Sbjct: 345 GSKLTFKNTGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDDNNHWEIRPPRNSNAHEYEQP 404

Query: 57  -NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
            N   + FV +GD +            SH + APVT   +EVS YGNET+GD  D W +E
Sbjct: 405 ENEEFIRFVKDGDIVRLQHSSTGRNLHSHPVNAPVTASQWEVSCYGNETIGDIQDNWKVE 464

Query: 116 VVSD-TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIY 174
           +V D                   H   GC L +    LP+WGF+Q EV CDK N   D Y
Sbjct: 465 IVDDFIYHDKERIRSLTTRFRLRHVKQGCLLTADGTSLPQWGFKQSEVFCDKNNKTNDPY 524

Query: 175 THWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           + WNVE+HWNEKLP      +K+ FL +F  LN+ M+T NNAL P+PDK D +SS P +W
Sbjct: 525 SMWNVEQHWNEKLPAAPPNAYKTHFLRDFITLNIAMWTSNNALTPDPDKYDILSSTPTEW 584

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAE 294
           P + VGLRM  W D+ +K++LLGNP VWW   AS+  F     +Y +R +RK  + + A+
Sbjct: 585 PFVTVGLRMCGWGDNDIKYYLLGNPAVWWLSIASIFAFCLTTAYYLIRMQRKINDLTLAQ 644

Query: 295 WIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT 354
           W H+ Y GK   +GW  HYIPFFIMGRVTYLHHYFPALYFS+LM  F+MDH+T +C    
Sbjct: 645 WDHYFYAGKTLFLGWFFHYIPFFIMGRVTYLHHYFPALYFSILMVPFLMDHYTRNCSKAV 704

Query: 355 KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +  +F   Y +++ VF +F  ++FG+  P  +     W +TWN+++
Sbjct: 705 QWAVFIPVYVIVIGVFIHFAPVSFGLTGPIKDYSHLVWRNTWNLIE 750



>gi|512202057|gb|EPE30885.1| MIR [Glarea lozoyensis ATCC 20868]
          Length = 744

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/404 (45%), Positives = 251/404 (62%), Gaps = 7/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQ++CYHH D NN+W     R +  +N   +
Sbjct: 344 GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDSNNEWWFYPNRDQPEFNAEAD 403

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
            +FV +GD +            SH+++APVT    EVS YGN T+GD+ D+W +EVV D 
Sbjct: 404 PKFVADGDVLRLIHSQTGRNLHSHDVSAPVTKADKEVSCYGNTTVGDEKDHWTMEVVRDV 463

Query: 120 TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                H  +GCYLR+ N  LP+WGF+QIEVTC K N  KD+YTHWNV
Sbjct: 464 ASNDRSKVRTLTTAFRLKHTALGCYLRAGNVNLPQWGFKQIEVTCTKENKPKDVYTHWNV 523

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWP+L V
Sbjct: 524 EAHWNDKLPAADAGAYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPLLHV 583

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TA+L +   ++ WY +R +R Y E   A+     
Sbjct: 584 GLRMCGWDDSIVKYFLLGNPLVYWGSTATLGVTALMVVWYLIRWQRGYTELKQADIDQIH 643

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI-- 357
           Y     ++GW LHY+PF  M RVTY+HHY+PALYF++L   F++D      KP++K I  
Sbjct: 644 YAALYPILGWFLHYLPFVAMARVTYVHHYYPALYFAILNFGFVVDWV---LKPQSKAIQY 700

Query: 358 -IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            ++GI Y+  + ++ +F  I++G+  P  +    KW   W + D
Sbjct: 701 LLYGILYATTIGLYIFFMPISWGMVGPNKQYSYMKWFDNWRVTD 744



>gi|343426349|emb|CBQ69879.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Sporisorium reilianum SRZ2]
          Length = 790

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/424 (45%), Positives = 261/424 (61%), Gaps = 28/424 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM----YN 56
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NN+++I  P  E      Y+
Sbjct: 368 GSKITLKNMGYGGGLLHSHVQTYPVGSGQQQVTCYHYRDNNNEFIITPPWNEPQLPANYS 427

Query: 57  NITE-VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           + TE +  + N D I            SH +AAPVT  + E+S YG+E  GDDND+WV+E
Sbjct: 428 SSTEPIRMLKNNDVIRIVHDQTKRNIHSHNVAAPVTKENLEISGYGDEATGDDNDHWVVE 487

Query: 116 VVSD----TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
           VV D       +              HK +GCY+R+AN VLP+WG++Q+EV+CDK NN +
Sbjct: 488 VVDDMVHGKVPRGGPVRSLTTRLRLRHKNLGCYMRAANAVLPQWGWKQVEVSCDKENNPR 547

Query: 172 DIYTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLP 231
           D +T WN+E HWN++LP G    ++S FL +F HLNV M T NNALIP+ DKED ++S P
Sbjct: 548 DQHTWWNIENHWNDRLPPGDSQLYRSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 607

Query: 232 IQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS 291
             WP L  GLRM+ W D  +KF+LLGNP++WWS + SL+ F     WY +R++R+  + S
Sbjct: 608 FDWPFLWNGLRMNSWDDSSIKFYLLGNPVIWWSSSLSLLAFAATWLWYMMRRQRRIQDLS 667

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK 351
           PA+W HFLY+GKI   GWLLHY+PF +M RV YLHHY P LYF++LM   ++DHF    +
Sbjct: 668 PADWSHFLYVGKIAGFGWLLHYLPFLVMARVCYLHHYLPILYFAVLMLVHLIDHFV--WR 725

Query: 352 PKT-----------------KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLS 394
           P T                 K+ +F      +V  FW+FK  ++G        K  KW  
Sbjct: 726 PTTAVYYMGRKQRKPLSEAVKDAVFVGSVVAVVGGFWWFKGNSYGFKGDIKGYKGLKWRK 785

Query: 395 TWNI 398
           +WNI
Sbjct: 786 SWNI 789



>gi|378728657|gb|EHY55116.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Exophiala
           dermatitidis NIH/UT8656]
          Length = 751

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/401 (46%), Positives = 249/401 (62%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R +  ++    
Sbjct: 345 GSRVTIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFWPNRSQPEFDPEGP 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           + F+++   +            SH + APVT   +EVS YGN T+GD+ D+W +EVVSD 
Sbjct: 405 LSFISDKQVLRLIHAQTGRNLHSHTVPAPVTKSDWEVSCYGNTTVGDEKDHWQVEVVSDA 464

Query: 121 -NTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H  +GCYLR+    LP+WGF+QIEVTC K NN +D+YTHWNV
Sbjct: 465 ASSDRSRIRTLTTAFRLKHVELGCYLRAGTVNLPQWGFKQIEVTCTKANNPRDVYTHWNV 524

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E H NE+LP G   +++S FL +F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 525 ESHVNERLPPGDAKSYRSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILHV 584

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D   K+FLLGNPIV+W  TASL +   ++ WY +R +R Y E S A+     
Sbjct: 585 GLRMCSWDDHITKYFLLGNPIVYWGSTASLGVAALIVVWYLIRWQRGYNELSRADIDQIH 644

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF +MGRVTY+HHY+PALYF++L+A F +D  T     K +  I+
Sbjct: 645 YSGIYPVIGWFLHYLPFVVMGRVTYVHHYYPALYFAILVAGFCLDWTTQRLNKKVRWGIY 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y++++ +F  F  I FG+          +W   W I D
Sbjct: 705 IALYAVVIGLFVLFSPIVFGMQGSNRNYAYLRWFDRWRISD 745



>gi|399166390|emb|CCE32809.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Claviceps purpurea 20.1]
          Length = 744

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/402 (45%), Positives = 248/402 (61%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  Y+    
Sbjct: 342 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRREPDYDPESP 401

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++ F+ +G T+            SH+IAAP++    EVS+YGN T+GD+ D+W +EVV D
Sbjct: 402 DLRFIADGTTLRLIHAQTGRNLHSHDIAAPLSKADKEVSSYGNLTVGDEKDHWKVEVVRD 461

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             ++               H+V+GCYLR  N+ LP+WGF+QIEV+C K NN +D YTHWN
Sbjct: 462 VASRDRSRIRTLTTAFRLKHEVLGCYLRGTNKNLPQWGFKQIEVSCTKENNPRDAYTHWN 521

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE HWN+KLP G    +KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWP L 
Sbjct: 522 VEAHWNDKLPAGDPGVYKSPFFHDFLHLNVAMMTSNNALVPDPDKQDDLASQWWQWPFLH 581

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D  VK+FLLGNP V+W  T  L L   ++ WY +R +R   + S  E    
Sbjct: 582 VGLRMCGWDDTIVKYFLLGNPFVYWGSTVGLGLIGLIVVWYLLRWQRGCKDLSEEEIDQI 641

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   V GW LHY+PF +M RVTY+HHY+PALYF++L   F++D    +     + I 
Sbjct: 642 HYSGIYPVAGWFLHYLPFVVMARVTYVHHYYPALYFAILAFGFLIDWTARNRNTTVQGIT 701

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G  Y++I+ ++  F  I +G+  P  +    +W   W + D
Sbjct: 702 YGTLYTVIIGLYILFIPICWGMTGPNKQYSYLRWFDNWKMSD 743



>gi|322710683|gb|EFZ02257.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Metarhizium anisopliae ARSEF 23]
          Length = 750

 Score =  382 bits (981), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/402 (45%), Positives = 253/402 (62%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E  Y+  + 
Sbjct: 349 GSRATIKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFFYPNRREPDYDAESP 408

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++ F+ +G  I            SH+IAAP++    EVS+YGN T+GD+ D+W +EVV D
Sbjct: 409 DLRFIGDGTIIRLIHAQTGRNLHSHDIAAPMSKSDKEVSSYGNLTVGDEKDHWKVEVVRD 468

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             ++               H+V+GCYL+  N+ LP+WGF+QIEV+C K NN +D YTHWN
Sbjct: 469 VASRDRSRIRTLTTAFRLKHEVLGCYLKGTNKNLPQWGFKQIEVSCTKENNPRDAYTHWN 528

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE HWN+KLP G    +KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 529 VEAHWNDKLPAGDPGVYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILH 588

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D+ VK+FLLGNP+V+W  T  + +   ++ WY +R +R + + +  E    
Sbjct: 589 VGLRMCGWDDNIVKYFLLGNPLVYWGSTIGIGIVGLVVVWYILRWQRGFTDLNNKEIDQI 648

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   V GW LHY+PF IM RVTY+HHY+PALYF++L   F++D    +     +   
Sbjct: 649 HYSGIYPVAGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLVDWTVRNRNTIIQGAT 708

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y++I+ ++  F  I +G+  P  +    +W   W I D
Sbjct: 709 YGVLYAVIIGLYVLFMPICWGMVGPNQQYSYMRWFDNWRISD 750



>gi|511010539|gb|EPB91760.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Mucor
           circinelloides f. circinelloides 1006PhL]
          Length = 754

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/405 (45%), Positives = 246/405 (60%), Gaps = 5/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GS +TLKN G+GGGLLHSH +QYP GS+QQQ++CY   D NN W I +PR        T 
Sbjct: 347 GSNITLKNFGYGGGLLHSHPHQYPDGSKQQQITCYSFKDSNNQWQIRQPRTMSNVPAPTH 406

Query: 60  ---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEV 116
              E+++V +GD I            SH I APV++ H+EVSAYGNE +GD  D W +E+
Sbjct: 407 VDGEIQYVKHGDVIRLQHIMTKRNLHSHPINAPVSSKHWEVSAYGNEEIGDVQDNWRVEI 466

Query: 117 VSDTNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYT 175
           V D   K               H  + C L S N VLP+WGF+Q EV CD++    D +T
Sbjct: 467 VQDIFDKDTTQVKALTTRFRLRHVYLDCLLTSRNVVLPQWGFKQQEVYCDRKAKPNDHHT 526

Query: 176 HWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
            WNVE H NE LP   K ++KS FL +FWHLNV M+  NNALIP+PDK D +SS P +WP
Sbjct: 527 WWNVEDHRNEALPPAPKNSYKSNFLEDFWHLNVAMWNTNNALIPDPDKNDILSSGPTEWP 586

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
           ++  GLRM  W    VKF+LLGNP VWW    S++ F      Y VRQ+R+ I+ +P  W
Sbjct: 587 MVTTGLRMCGWDSKTVKFYLLGNPSVWWPSFLSIITFMVATASYIVRQRRQIIDMTPDRW 646

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTK 355
             F  +GK+  +GW  HYIPFF+MGRVTY+HHYFPALYFS+ M  F+++HF  +   + +
Sbjct: 647 SRFTSVGKLFFLGWFFHYIPFFMMGRVTYIHHYFPALYFSVFMVPFLLEHFFANTSSRAR 706

Query: 356 NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             ++ I   L+   F YF   +FG+        +R WL++WN+++
Sbjct: 707 LTVYAIVLGLVFANFAYFAPFSFGMTGDIKNYSNRLWLNSWNLIE 751



>gi|430811869|emb|CCJ30725.1| unnamed protein product, partial [Pneumocystis jirovecii]
          Length = 740

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 250/399 (62%), Gaps = 3/399 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNM + GGLLHSH+  +P GS QQQV+CYHH D NNDW +      +  ++   
Sbjct: 342 GSRVTIKNMAYAGGLLHSHVQTFPEGSTQQQVTCYHHRDGNNDWYVHPIHGMKPVSDEDP 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           ++++ N D +            SH I APVT  + EVS YGN T+GD ND+WVIEV+ D 
Sbjct: 402 IQYLQNNDALRLIHKSTGCNLHSHNIPAPVTKKNSEVSCYGNLTIGDTNDHWVIEVIKDP 461

Query: 121 NTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVE 180
           + +              H  + CYLR++   LP+WGF+QIEVTCDK NN KD +THWN+E
Sbjct: 462 DWQDTRIKTIKTAFRLRHTSLNCYLRASRTHLPQWGFKQIEVTCDKSNNPKDYFTHWNIE 521

Query: 181 RHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEVG 240
            HWN++LP G+   +K  F H+F H N+GM   NNALIP   K+D ++S   QWP   VG
Sbjct: 522 HHWNDRLPAGNVNFYKPSFWHDFVHANIGMMNTNNALIPEKGKKDELASYAWQWPTAIVG 581

Query: 241 LRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCL-LFWYSVRQKRKYIEFSPAEWIHFL 299
           +RM  W D  VKF++LGNPIV+W  TAS+++FF L +F+ ++     Y      +  HF 
Sbjct: 582 IRMCSWDDQVVKFYMLGNPIVYWISTASILIFFVLAIFYTTLITSNTYRALDSFD--HFH 639

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   V+GW L+Y+PFFIM RV YLHHYFPAL F++L   F+ DHFT S     ++IIF
Sbjct: 640 YSGVYPVLGWALYYLPFFIMKRVLYLHHYFPALLFAILTTGFIFDHFTRSASTIVRSIIF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            + Y  IV  F +FKDI FG+  P+++    +WLS+W I
Sbjct: 700 TVAYIAIVATFIHFKDITFGMLGPSTQWAHLQWLSSWKI 738



>gi|322692625|gb|EFY84523.1| putative dolichyl-phosphate-mannose--protein mannosyltransferase
           [Metarhizium acridum CQMa 102]
          Length = 742

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/402 (44%), Positives = 253/402 (62%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E  Y+  + 
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFFYPNRREPDYDAESP 400

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++ F+ +G  I            SH+IAAP++    EVS+YGN T+GD+ D+W +EV+ D
Sbjct: 401 DLRFIGDGSIIRLIHAQTGRNLHSHDIAAPMSKSDKEVSSYGNLTVGDEKDHWKVEVIRD 460

Query: 120 TNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             ++               H+V+GCYL+  N+ LP+WGF+QIEV+C   NN +D YTHWN
Sbjct: 461 VASRDRSRIRTLTTAFRLKHEVLGCYLKGTNKNLPQWGFKQIEVSCTTENNPQDAYTHWN 520

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE HWN+KLP G    +KS F H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL 
Sbjct: 521 VEAHWNDKLPAGDPGVYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILH 580

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
           VGLRM  W D+ VK+FLLGNP+V+W  T  + +   ++ WY +R +R + + +  E    
Sbjct: 581 VGLRMCGWDDNIVKYFLLGNPLVYWGSTIGIGIVGLVVVWYILRWQRGFTDLNNKEIDQI 640

Query: 299 LYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G   V GW LHY+PF IM RVTY+HHY+PALYF++L   F++D    +     + + 
Sbjct: 641 HYSGIYPVAGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLVDWTVRNRNTTIQCVT 700

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y++I+ ++  F  I +G+  P  +    +W   W I D
Sbjct: 701 YGVLYAVIIGLYVLFMPICWGMVGPNQQYSYLRWFDNWRISD 742



>gi|388579301|gb|EIM19626.1| glycosyltransferase family 39 protein [Wallemia sebi CBS 633.66]
          Length = 704

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/413 (43%), Positives = 261/413 (63%), Gaps = 15/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---- 56
           GS++TLK MG+ GGLLHSH+  +P GS + QV+CYH+ D NN + +L   +E+  N    
Sbjct: 290 GSKITLKQMGYAGGLLHSHVQNFPLGSLEGQVTCYHYQDDNNQFNVLPTLQEEKANELKV 349

Query: 57  -----NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDY 111
                N   V F+++GD I            +H+I AP++ + +EV+A+G  T  D ND 
Sbjct: 350 LNEGDNADNVTFLHDGDVIRLEHVPYSRYIHAHDIPAPLSKLDYEVAAFGQSTEDDTNDN 409

Query: 112 WVIEVVSDTN----TKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           W++EVV D      +K              +K +GCYLR+AN+ LPEWGF+QIEVTC K 
Sbjct: 410 WIVEVVDDVYRGRLSKEDKIHSLTTRLRFKNKNLGCYLRAANKNLPEWGFKQIEVTCTKE 469

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSI 227
           N+ +D +T+WNVE HWN+KLP G K  +K+ FL +FWHLN+ M   NNALIPNPDK+D +
Sbjct: 470 NDPRDDHTYWNVESHWNDKLPAGKKSLYKTSFLKDFWHLNIAMMMSNNALIPNPDKQDIL 529

Query: 228 SSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKY 287
           +S P  WP L +GLRM+ W D   K++L+GNP+VWW+ + +L +F  +  ++++R++R+ 
Sbjct: 530 ASKPTDWPFLRLGLRMNGWGDHNTKYYLIGNPVVWWTSSLALFVFVAISLYHTIRERRRV 589

Query: 288 IEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-- 345
            + +  E  +F Y+G I   GW+ HYIPF IMGRVTYLHHY PALYF++L+   ++DH  
Sbjct: 590 RDVTKNEIDYFTYVGMIAFGGWVFHYIPFLIMGRVTYLHHYLPALYFAILVMGLVLDHLI 649

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           F      + K  +FG+     ++ F++F  + FG+  P S+ K  KW ++WNI
Sbjct: 650 FKRQIPERFKWFVFGLLAVNTIVTFYHFNGVVFGMVGPISKHKHLKWRNSWNI 702



>gi|501756504|emb|CCG80557.1| Protein O-mannosyl transferase [Taphrina deformans PYCC 5710]
          Length = 743

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 247/403 (61%), Gaps = 6/403 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---N 57
           GSR T+KNMG+GGGLLHSH+  +P GS+QQQ++CYHH D NNDW     R E  ++   N
Sbjct: 279 GSRATIKNMGYGGGLLHSHVQSFPEGSQQQQITCYHHKDTNNDWFFYPNRFEPSFDPADN 338

Query: 58  ITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVV 117
              ++F+ + D +            SH IAAPVT   FEVS YGN T+GD+ D+W IEVV
Sbjct: 339 DAPLQFLKDRDVVRLIHAQTGRNLHSHAIAAPVTKSDFEVSCYGNLTVGDEKDHWQIEVV 398

Query: 118 SDTNTKXXXXXXXXXXXXX-XHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
            D  ++               H    CYLR+AN  LP+WGF+QIEVTCDK +   D ++H
Sbjct: 399 DDIRSRDRSRVRTLTSAIRFRHVSQDCYLRAANVNLPQWGFKQIEVTCDKDSKPNDQFSH 458

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE HWNE+LP  S  +FKS F  +F HLNV M T NNAL+P+PDK D ++S   QWPI
Sbjct: 459 WNVESHWNERLPPASAKDFKSPFWRDFLHLNVAMMTSNNALVPDPDKADELASQAWQWPI 518

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
             VGLRM  W     K+FLLGNP+V+W  T SLV F  L+ ++ +R +R     +P +  
Sbjct: 519 AWVGLRMCGWDAKTTKYFLLGNPLVYWYSTFSLVAFGALVVYHVLRWQRSSQVLTPKQVD 578

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
           H +Y G    IGW  HYIPFFIMGRV Y+HHYFPAL+F++L+  F+ D F V+  PK+  
Sbjct: 579 HMIYAGIYPAIGWFFHYIPFFIMGRVLYVHHYFPALWFAILVGGFVFD-FAVAGLPKSVR 637

Query: 357 I-IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           I +F + Y +I   F  F    FG++  A      KWL +W I
Sbjct: 638 IAMFVLAYVVITATFLNFSAFTFGMDGEAGLWHRLKWLDSWKI 680



>gi|440469185|gb|ELQ38305.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Magnaporthe oryzae Y34]
 gi|440485776|gb|ELQ65698.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Magnaporthe oryzae P131]
          Length = 736

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/404 (46%), Positives = 253/404 (62%), Gaps = 7/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R ++ Y    E
Sbjct: 336 GSRVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRNDREYKEEEE 395

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G+ +            SH+IAAP+T    EVS YGN T+GDD D+W +EVV D 
Sbjct: 396 PRFIADGEVLRLIHVQTGRNLHSHDIAAPMTKSDKEVSCYGNLTVGDDKDHWKVEVVRDV 455

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H  +GCYLR+ N  LP+WGF+QIEV C  +NN +D YT WNV
Sbjct: 456 ASRDRSRVRTLTTAFRLKHASLGCYLRAGNVNLPQWGFKQIEVACTPKNNPRDTYTWWNV 515

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP G+   ++S F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 516 EAHWNDKLPKGNPGVYRSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 575

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W  TA + +   ++ WY +R +R + + S  E     
Sbjct: 576 GLRMCGWDDNIVKYFLLGNPFVYWGTTAGVGVIGLVVVWYLLRWQRGFQDLSMPEVDQIH 635

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF +M RVTY+HHY+PALYF++L   F++D FT   +   K+I +
Sbjct: 636 YSGVYPVIGWFLHYLPFVVMARVTYVHHYYPALYFAILTFGFLVDWFT---RDMHKSIQY 692

Query: 360 GIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GIY   Y++I+ ++  F  I +G+          KW  TW + D
Sbjct: 693 GIYTALYTIIIGLYILFMPICWGMVGSNKTYSYLKWFDTWRMSD 736



>gi|389635487|ref|XP_003715396.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Magnaporthe oryzae 70-15]
 gi|351647729|gb|EHA55589.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Magnaporthe oryzae 70-15]
          Length = 743

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/404 (46%), Positives = 253/404 (62%), Gaps = 7/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R ++ Y    E
Sbjct: 343 GSRVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRNDREYKEEEE 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             F+ +G+ +            SH+IAAP+T    EVS YGN T+GDD D+W +EVV D 
Sbjct: 403 PRFIADGEVLRLIHVQTGRNLHSHDIAAPMTKSDKEVSCYGNLTVGDDKDHWKVEVVRDV 462

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H  +GCYLR+ N  LP+WGF+QIEV C  +NN +D YT WNV
Sbjct: 463 ASRDRSRVRTLTTAFRLKHASLGCYLRAGNVNLPQWGFKQIEVACTPKNNPRDTYTWWNV 522

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP G+   ++S F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL V
Sbjct: 523 EAHWNDKLPKGNPGVYRSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 582

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D+ VK+FLLGNP V+W  TA + +   ++ WY +R +R + + S  E     
Sbjct: 583 GLRMCGWDDNIVKYFLLGNPFVYWGTTAGVGVIGLVVVWYLLRWQRGFQDLSMPEVDQIH 642

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G   VIGW LHY+PF +M RVTY+HHY+PALYF++L   F++D FT   +   K+I +
Sbjct: 643 YSGVYPVIGWFLHYLPFVVMARVTYVHHYYPALYFAILTFGFLVDWFT---RDMHKSIQY 699

Query: 360 GIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GIY   Y++I+ ++  F  I +G+          KW  TW + D
Sbjct: 700 GIYTALYTIIIGLYILFMPICWGMVGSNKTYSYLKWFDTWRMSD 743



>gi|361131365|gb|EHL03063.1| putative Dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Glarea lozoyensis 74030]
          Length = 431

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/404 (44%), Positives = 243/404 (60%), Gaps = 21/404 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQ++CYHH D NN+W     R +  +N   +
Sbjct: 45  GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDSNNEWWFYPNRDQPEFNAEAD 104

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
            +FV +GD +            SH+++APVT    EVS YGN T+GD+ D+W +EVV D 
Sbjct: 105 PKFVADGDVLRLIHSQTGRNLHSHDVSAPVTKADKEVSCYGNTTVGDEKDHWTMEVVRDV 164

Query: 120 TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                H  +GCYLR+ N  LP+WGF+QIEVTC K N  KD+YTHWNV
Sbjct: 165 ASNDRSKVRTLTTAFRLKHTALGCYLRAGNVNLPQWGFKQIEVTCTKENKPKDVYTHWNV 224

Query: 180 ERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEV 239
           E HWN+KLP      +KS FL +F HLNV M T NNAL+P+PDK+D ++S   QWP+L V
Sbjct: 225 EAHWNDKLPAADAGAYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPLLHV 284

Query: 240 GLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFL 299
           GLRM  W D  VK+FLLGNP+V+W  TA+L               R Y E   A+     
Sbjct: 285 GLRMCGWDDSIVKYFLLGNPLVYWGSTATL--------------GRGYTELKQADIDQIH 330

Query: 300 YIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI-- 357
           Y     ++GW LHY+PF  M RVTY+HHY+PALYF++L   F++D      KP++K I  
Sbjct: 331 YAALYPILGWFLHYLPFVAMARVTYVHHYYPALYFAILNFGFVVDWV---LKPQSKAIQY 387

Query: 358 -IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            ++GI Y+  + ++ +F  I++G+  P  +    KW   W + D
Sbjct: 388 LLYGILYATTIGLYIFFMPISWGMVGPNKQYSYMKWFDNWRVTD 431



>gi|505755843|gb|EOR00037.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Wallemia
           ichthyophaga EXF-994]
          Length = 800

 Score =  365 bits (936), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 174/439 (39%), Positives = 256/439 (58%), Gaps = 41/439 (9%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GS++TLK MG+GGGLLHSH+  +P GS + QV+CYH+ D NN + +L    +Q  +  T 
Sbjct: 361 GSKVTLKQMGYGGGLLHSHVQNFPLGSLEGQVTCYHYQDDNNQFNVLPSLAQQKVDEATR 420

Query: 60  ----------------------------------EVEFVNNGDTIXXXXXXXXXXXXSHE 85
                                             E+ F+++GD I            +H+
Sbjct: 421 NAERGELSAGEVGELGERGEQSEDLSQDEGSDKDEIRFLHSGDIIRLQHVPYSRYIHAHD 480

Query: 86  IAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT----NTKXXXXXXXXXXXXXXHKVI 141
           + AP++ + +EV+A+      D ND W++E V D      T               H+ +
Sbjct: 481 LPAPLSRLDYEVAAFSASREDDTNDNWIVEPVDDVFRGKLTPHDRIHSLTTRLRFRHRNL 540

Query: 142 GCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVERHWNEKLPLGSKVNFKSKFLH 201
           GCYLR+ANR LPEWGF+Q+EVTC K N+ +D YTHWNVE HWN++LP G K  +++ FL 
Sbjct: 541 GCYLRAANRNLPEWGFKQVEVTCTKENDVRDDYTHWNVESHWNDRLPRGKKSLYRTNFLK 600

Query: 202 NFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIV 261
           +FWHLN+ M   NNALIPNPDK D ++S P  WP L +GLRM+ W+D   K++L+GNP+V
Sbjct: 601 DFWHLNIAMMMSNNALIPNPDKADILASKPTDWPFLRLGLRMNGWSDHNTKYYLIGNPVV 660

Query: 262 WWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGR 321
           WW  + +++LF  +  ++ V ++R+  + +  E  HF+Y+G +   GW+ HYIPF IMGR
Sbjct: 661 WWCSSVAVMLFVLISGYHVVCERRRVRDVTKRELDHFIYVGMVAFGGWVFHYIPFLIMGR 720

Query: 322 VTYLHHYFPALYFSMLMAAFMMDH--FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFG 379
           VTYLHHY PALYF++L+ A ++DH  F  +     K  +F +     ++ F++F+ + FG
Sbjct: 721 VTYLHHYLPALYFAVLVLALVLDHVVFKRNVSEGVKWFVFAVLALNTLLTFYHFRGVVFG 780

Query: 380 INYPASELKSRKWLSTWNI 398
           +  P S  K   W S+WNI
Sbjct: 781 MEGPMSRHKHLGWRSSWNI 799



>gi|384483971|gb|EIE76151.1| hypothetical protein RO3G_00855 [Rhizopus delemar RA 99-880]
          Length = 405

 Score =  356 bits (914), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 176/402 (43%), Positives = 244/402 (60%), Gaps = 14/402 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM--YNNI 58
           GS +T++N G+GGGLLHSH++ YP GSEQQQ++CYHH D NN W I  PR++     ++ 
Sbjct: 11  GSNVTIRNAGYGGGLLHSHVHTYPEGSEQQQITCYHHKDENNHWTIRPPRQDTFDPLDSP 70

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
             + F+ +GD +            SH I AP++   +EVS YGN+T+GD  D W +EVV 
Sbjct: 71  DLIHFLKDGDLVRLVHIPTGRNLHSHRIDAPISP-GWEVSGYGNDTIGDIQDNWKVEVVH 129

Query: 119 DTNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
           D   K               H+ +GC L + N VLP+WGF+Q EV CD R    D Y  W
Sbjct: 130 DMVHKNKDRVHSLTTRFRLRHQTLGCLLTADNTVLPDWGFKQAEVFCDPRETG-DSYAMW 188

Query: 178 NVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           NVE+HWN++LP      +++ F  NF  LNV M+T NNALIP+ DK D ++S P++WP++
Sbjct: 189 NVEQHWNDRLPPAPPNAYRAPFWRNFIDLNVAMWTANNALIPDVDKVDLLASSPLEWPMV 248

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
            VGLRM  W D +VK++LLGNPIVWW   +++  F      Y VR +R  I+ +      
Sbjct: 249 TVGLRMCGWGDKEVKYYLLGNPIVWWLSISAIFTFCLTTGIYMVRMQRSIIDMTQ----- 303

Query: 298 FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI 357
               G+   +GW LHYIPFFIMGRVTYLHHYFPALYFS+LM  F++DHFT     + +  
Sbjct: 304 ----GRTLFLGWFLHYIPFFIMGRVTYLHHYFPALYFSILMVPFLIDHFTQRKSQRVQWA 359

Query: 358 IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           +F   Y+ ++I F +F  I+FG+  P +     +W  +W I+
Sbjct: 360 VFAPIYAAVIITFIHFAPISFGLEGPITNYMHLEWRKSWGII 401



>gi|465795908|emb|CCV00340.1| Protein O-mannosyltransferase-like protein [Malassezia sympodialis
           ATCC 42132]
          Length = 516

 Score =  352 bits (902), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/447 (40%), Positives = 258/447 (57%), Gaps = 49/447 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMIL----KPRKEQMYN 56
           GS++TLKNMGFGGGLLHSHI  YP GS++QQV+CYH+ D NN +++     +P      +
Sbjct: 69  GSKVTLKNMGFGGGLLHSHIQTYPEGSQEQQVTCYHYKDTNNHFVLAPLFDEPPLPGPND 128

Query: 57  NITEVEFV-NNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
            +TE   +  +G               +H+  APVT  H+EVS +G+ T G+ +DYWVIE
Sbjct: 129 TVTEPPMIIRHGSVFRLSHVETSKSLRAHKSPAPVTKEHYEVSGHGDGTTGNSHDYWVIE 188

Query: 116 VVSDTNTKXXXXXXXXXXXXXXHKV----IGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
           ++ D                   ++    +GCY+R+AN VLP+WG++Q EVTC   +   
Sbjct: 189 IIDDLQMGKVRPEMPVHTLTTRFRLRNVQLGCYMRAANVVLPDWGWKQTEVTCVPDDQPY 248

Query: 172 DIYTHWNVERHWNEKLPLG-SKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSL 230
           D +THWNVE HWN +LP+  SK  ++S FL +F HLNV M   NNAL+P+ DK D ++S 
Sbjct: 249 DTFTHWNVENHWNPRLPISTSKQRYRSPFLKDFLHLNVAMMVSNNALVPDEDKFDILASK 308

Query: 231 PIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF 290
           P++WP +  GLRM+ W  D+ K++L+GNP+VWW  TASL +   LL WY +R++R  I+ 
Sbjct: 309 PLEWPWMWNGLRMNGWGADQDKYYLIGNPVVWWGSTASLYVAVVLLAWYILRRQRHIIDM 368

Query: 291 SPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF---- 346
            P  W  FL+  K+  +GW LHY PF +MGRVTY+HHY P LYF++++   ++DHF    
Sbjct: 369 DPKTWADFLFGLKVGGLGWFLHYFPFLMMGRVTYIHHYLPTLYFAVIVFVHLLDHFLWNE 428

Query: 347 --------------------------------TVSCKP---KTKNIIFGIYYSLIVIVFW 371
                                            V  KP   +TKNI FG+  +L++ VF 
Sbjct: 429 GTARYRIDWRLFLQTGRLQAGKLNPLVQDTSAPVLGKPLSQRTKNISFGVCAALVICVFL 488

Query: 372 YFKDIAFGINYPASELKSRKWLSTWNI 398
           +FK ++FG+    S+    KW  TWNI
Sbjct: 489 WFKGVSFGLYGDISDWHYLKWRKTWNI 515



>gi|328768324|gb|EGF78371.1| hypothetical protein BATDEDRAFT_20500 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 691

 Score =  344 bits (882), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 175/404 (43%), Positives = 238/404 (58%), Gaps = 5/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++++KN   GGGLLHSH+ +YP GS QQQV+CYHH D NN+++I+KP  +   + +TE
Sbjct: 287 GSKVSIKNNARGGGLLHSHVQRYPSGSTQQQVTCYHHKDSNNEFLIMKPWGDTT-DLMTE 345

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
             FV +GD I            SH + AP+T   +EVS YGN T GD ND W IE V D 
Sbjct: 346 PIFVEDGDKIRLVHISTFKNIHSHYVDAPITTTDYEVSGYGNATFGDQNDLWKIEKVDDW 405

Query: 120 -TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
                              H   GC LR+    LP+WGF+QIEV C K+    ++  +WN
Sbjct: 406 TVGKNIKRIRSLTTRFRLRHVTSGCLLRADGVTLPQWGFKQIEVVCQKKPKDDEVANYWN 465

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKE-DSISSLPIQWPIL 237
           +E H N  LP G K  +KS F  +F  LNV M++ NNAL P+ DKE D + S P  WP++
Sbjct: 466 IELHVNSNLPPGGKNAYKSSFFRDFIDLNVAMWSSNNALTPDADKEPDQLVSQPYHWPLM 525

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPA-EWI 296
             GLRM  W+D  +K++LLGNPIVWW  T SL+    L   Y +R +R   +FS   EW 
Sbjct: 526 TRGLRMCGWSDSDIKYYLLGNPIVWWGSTVSLLGLIGLTLIYVIRWRRGCRDFSSLDEWD 585

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
           +F    K+ V+GW LHY PF+IMGRV Y+HHYFP+LYF+++  AF++DH +         
Sbjct: 586 NFYMAAKVGVLGWFLHYFPFYIMGRVMYVHHYFPSLYFAIIAFAFLVDHLSGKFSKLFHF 645

Query: 357 IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I  +   ++  VF +F D+ FG++   +   +RKWL TWNI D
Sbjct: 646 AIVTLIGLIVFRVFLFFADLTFGMSGSPNAYANRKWLKTWNIND 689



>gi|50549415|ref|XP_502178.1| YALI0C23364p [Yarrowia lipolytica]
 gi|49648045|emb|CAG82498.1| YALI0C23364p [Yarrowia lipolytica CLIB122]
          Length = 742

 Score =  334 bits (856), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 165/401 (41%), Positives = 230/401 (57%), Gaps = 3/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR TLKN G+ GGLLHSH+  YP GSEQQQ++ YHH D NN+W +  PR  + YN N +
Sbjct: 342 GSRFTLKNQGYNGGLLHSHVQTYPEGSEQQQITTYHHKDANNEWRVETPRDREAYNANTS 401

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           E+E + +GD I            SH+I AP+T    EVS YGN T+GD+ D+W++E+  +
Sbjct: 402 EIELLKHGDVIRFIHLNTGRNLHSHQIPAPLTKGDHEVSCYGNLTIGDNKDHWIVEIYDN 461

Query: 120 TNT-KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
                              H+V+GCYL      LP WGF+Q EVTC  +   KD  THWN
Sbjct: 462 FGPGDNKVVHPLTTTVRFKHEVLGCYLSGKGNHLPPWGFKQGEVTCSNKVGKKDKSTHWN 521

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
            E+HWNE++P  +     K+ F+ +F  LNV M   NNAL+P+PDK D ++S    WP+ 
Sbjct: 522 FEQHWNERMPDANNTKPPKTSFIRDFVQLNVAMMASNNALVPDPDKHDELASEAWMWPLN 581

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
            VGLR+  W+   +K++LLGNP+  W  T SL +F  +   Y +R +R+  +FS A+   
Sbjct: 582 WVGLRLCGWSSTIIKYYLLGNPVNMWGTTFSLFVFGIMTLVYLIRWQRQIPDFSDAQIEK 641

Query: 298 FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI 357
           ++  G I  +GW  HY+PF IMGRV Y+HHY PA YF+ L+  F++DHFT       K  
Sbjct: 642 YMVSGIIPALGWFFHYLPFIIMGRVKYVHHYLPAFYFATLVFGFVVDHFTSRAPASVKWG 701

Query: 358 IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           +  ++ S +  +F  F  I+FG+           WL  W I
Sbjct: 702 VNILFISAVTGMFVLFSPISFGMEGEPGAYSYLNWLKGWKI 742



>gi|302418096|ref|XP_003006879.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Verticillium albo-atrum VaMs.102]
 gi|261354481|gb|EEY16909.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Verticillium albo-atrum VaMs.102]
          Length = 745

 Score =  330 bits (846), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 170/403 (42%), Positives = 228/403 (56%), Gaps = 4/403 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E+ Y+   E
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDTNNDWFFYPNRDEEPYDAEAE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
             ++ +G TI            SHEIAAP+T    EVS YGN T+GD  D+W IEVV D 
Sbjct: 401 PRYIADGTTIRLIHAQTGRNLHSHEIAAPMTKSDKEVSCYGNLTVGDAKDHWKIEVVRDA 460

Query: 121 NTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYLR+     P  GF+     C K        +HWN 
Sbjct: 461 ASRDRSRVRTLTTAFRLKHPVLGCYLRAGTES-PSMGFQTDRSGCTKPTTPAIRSSHWNA 519

Query: 180 E--RHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
              +    + P  + V+    F+H+F HLNV M T NNAL+P+PDK+D ++S   QWPIL
Sbjct: 520 REIKLITSQSPRATLVSTSPSFIHDFIHLNVAMMTSNNALVPDPDKQDDLASHWWQWPIL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
           +VGLRM  W D  VK+FLLGNP V+W  T  L +F  ++ WY +R +R + + +  E   
Sbjct: 580 DVGLRMCSWDDSVVKYFLLGNPFVYWGTTLGLGVFGLVIAWYVLRWQRGFGDLNYKEVDQ 639

Query: 298 FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI 357
             Y G   VIGW+LHY+PF  M RVTY+HHY+PALYF++L   F+ D F  +     +  
Sbjct: 640 IHYAGVYPVIGWVLHYLPFVAMARVTYVHHYYPALYFAILTFGFLADWFLRNKNKTIQYA 699

Query: 358 IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           I+G+ Y +I+ ++  F  I FG+     +    +W   W I D
Sbjct: 700 IYGVLYLVIIGLYINFIPICFGMVGSNKQFSYLRWSDKWRISD 742



>gi|164657398|ref|XP_001729825.1| hypothetical protein MGL_2811 [Malassezia globosa CBS 7966]
 gi|159103719|gb|EDP42611.1| hypothetical protein MGL_2811 [Malassezia globosa CBS 7966]
          Length = 856

 Score =  328 bits (842), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 173/447 (38%), Positives = 244/447 (54%), Gaps = 49/447 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILK----PRKEQMYN 56
           GS+LTLKNM +GGGLLHSHI  YP GS   QV+CYHH D NN ++I      P       
Sbjct: 409 GSKLTLKNMAYGGGLLHSHIQTYPEGSHDHQVTCYHHKDENNHFIISPTYEDPPLPAADE 468

Query: 57  NITEV-EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           NI E    + +GD +            S  I AP+T    EV    +E   D ++YW++E
Sbjct: 469 NIDEPPRMLKSGDVLRLVHQQLQTNLRSEAIPAPITKEAHEVGCRASEKGADSSEYWIVE 528

Query: 116 VVSDTN----TKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
           V+ D +                    HK +GCYLRS + VLP+WG++Q+EVTCD RNN K
Sbjct: 529 VLRDVHLGPGRPGMPIRTLSSTLRLRHKELGCYLRSGSAVLPDWGWKQMEVTCDPRNNPK 588

Query: 172 DIYTHWNVERHWNEKLP-LGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSL 230
           DI THWNVE HWN++LP + ++   +S FL +F HLNV M   NNAL+P+ DK D ++S 
Sbjct: 589 DIGTHWNVESHWNDRLPNVETRQRTRSPFLKDFVHLNVAMMISNNALVPDQDKFDHLASA 648

Query: 231 PIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF 290
           P +WP L  G+RM+ W  D  K++L+GNP++WW  + SL++   +L WY +R++R+  + 
Sbjct: 649 PSEWPFLYRGMRMNGWGADNYKYYLVGNPVIWWGSSLSLIVALPVLAWYIMRRQRRIHDM 708

Query: 291 SPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF---- 346
            P  W  FL+  K+  IGW L Y PF +MGRVTYLHHY P LYF++++   ++DH+    
Sbjct: 709 PPKVWDDFLFGLKVGWIGWFLQYFPFLMMGRVTYLHHYLPTLYFAVIVLVHLLDHYLWND 768

Query: 347 --------------------------------TVSCKPKT---KNIIFGIYYSLIVIVFW 371
                                            V  +P +   KN+ F     L+V VF+
Sbjct: 769 ATARTSIDWPTLLRSGRIASTKLNPFVHDTAAAVPGRPLSQHFKNMSFAAVTGLVVGVFF 828

Query: 372 YFKDIAFGINYPASELKSRKWLSTWNI 398
           +F  ++FG+    S+    KW   W+I
Sbjct: 829 WFCGVSFGMYGDISKWPYLKWRKNWDI 855



>gi|406602575|emb|CCH45891.1| dolichyl-phosphate-mannose-proteinmannosyltransferase
           [Wickerhamomyces ciferrii]
          Length = 748

 Score =  313 bits (803), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 157/404 (38%), Positives = 236/404 (58%), Gaps = 7/404 (1%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT-E 60
           S +T+KN G GGGLLHSHI  +P GS QQQV+ Y H D NN+W+  + R  + +N+   +
Sbjct: 346 STVTIKNQGLGGGLLHSHIQTFPEGSNQQQVTTYGHKDANNEWIFHRERSREQFNSTRDQ 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
            E++ +G ++            SHEI AP++   +EV+ YG+   GD+ D W+IEV    
Sbjct: 406 REYLVDGMSVRLWHRLTTRNLHSHEIPAPISRQDYEVAGYGDFDQGDEKDDWIIEVAHQY 465

Query: 121 NTKXXXXXX-XXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               HKV+GCYL      LP WGFRQ EVTC K   ++D  T WN+
Sbjct: 466 GSEDKLRIHPLTTSFRLKHKVLGCYLSQTGNHLPAWGFRQGEVTCVKNPFSRDKRTWWNI 525

Query: 180 ERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H N  LP   + +FK   + F  +F  LN+ M   NNAL+P+PDK+D ++S   QWP 
Sbjct: 526 EHHANPSLP-DPEPDFKLPKTNFFKDFIQLNLAMMATNNALVPDPDKQDDLASEAWQWPT 584

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L VG+R+  W     K+FL+G+P   W+ +  ++LF  L+ +Y +R +R++ +F   + +
Sbjct: 585 LNVGIRLCGWGAGNPKYFLIGSPATTWTSSIGVILFALLVLYYLIRWQRQFRDFKDDKKL 644

Query: 297 HFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTK 355
           +   +G I  + GW LHY+PF IM RVTY+HHY PALYF+ML+  ++++    S +   K
Sbjct: 645 NLFLLGGIYPMFGWGLHYVPFIIMARVTYVHHYLPALYFAMLIFTYLIELGFASSRTPIK 704

Query: 356 NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            II+   Y LI+ +FW+F  I+FG++    + +   WLS+W I 
Sbjct: 705 FIIYSSLYVLIIGIFWHFSPISFGMDGDPEQYRYLNWLSSWRIA 748



>gi|444314239|ref|XP_004177777.1| hypothetical protein TBLA_0A04640 [Tetrapisispora blattae CBS 6284]
 gi|387510816|emb|CCH58258.1| hypothetical protein TBLA_0A04640 [Tetrapisispora blattae CBS 6284]
          Length = 753

 Score =  313 bits (802), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 165/409 (40%), Positives = 233/409 (56%), Gaps = 11/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S ++LKN   GG LLHSH+  +P GS+QQQ++CY H D NN+W+  +   +  Y+   E 
Sbjct: 343 SIVSLKNQALGGSLLHSHVQTFPEGSKQQQITCYGHKDSNNNWLFKRVWDQPDYSEEEEN 402

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDTN 121
           EFV +G T             SH+I A V+   FEVS YGN T+GD+ DYWV+EVV+   
Sbjct: 403 EFVVDGATYRVVHLNTGRNLHSHQIPAAVSQTSFEVSGYGNSTIGDEKDYWVVEVVNQKG 462

Query: 122 TKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVE 180
            +               HK +GCYL      LPEWGFRQ EV C      +D  T WN+E
Sbjct: 463 KEDKTRLHPLTTSFRLRHKQLGCYLSQTGANLPEWGFRQSEVACVPSPFKRDKRTWWNIE 522

Query: 181 RHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
            H NEKLP  ++  F   K+ F  +F +LN+ M   NNAL+P  DK D +SS   QWP L
Sbjct: 523 THENEKLPESTE-GFKYPKTNFFTDFVYLNLAMMATNNALVPESDKFDRLSSAAWQWPTL 581

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
            +GLR+  W DD  K+FLLG+P   W  TA++  F       ++R +R+Y ++S A+ ++
Sbjct: 582 NIGLRLCGWGDDNPKYFLLGSPATTWPSTAAVFGFMAFFIILTLRWQRQYKDYSDAKNVN 641

Query: 298 FLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFT--VSCKPK- 353
              +G I  + GW LH++PF IM RVTY+HHY PALYF++++  +  +  T  VS +   
Sbjct: 642 TFLMGGIYPMFGWGLHFMPFIIMARVTYVHHYLPALYFALIVLVYFFEIGTQWVSHRKNG 701

Query: 354 --TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              +  IFG YY+ I+ +F+ F  I+FG+  PA E     WL  W++ +
Sbjct: 702 CLIRAAIFGAYYAAIMYIFYLFSPISFGMEGPAKEYSYLAWLPKWDMAE 750



>gi|513032850|gb|AGO12842.1| AaceriACR290Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 756

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/410 (40%), Positives = 236/410 (57%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSH+  YPGGS QQQV+ Y HND NN+W+  + R    ++ N TE
Sbjct: 347 SLVSIKNQALGGTLLHSHVQTYPGGSNQQQVTTYGHNDTNNNWVFDRIRGLPAWDANETE 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
            EFV +G               SH I AP++  H+EVS YGN  +GD  D WVIE VS  
Sbjct: 407 HEFVKDGHQYRLVHSNTGRNLHSHPIPAPLSKTHWEVSGYGNAEIGDPKDNWVIEFVSQP 466

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
           + +                V +GCYL      LPEWGF+Q EV C      +D  T WNV
Sbjct: 467 SDEDKSVLHTISTSFRIRNVEMGCYLAQTGYSLPEWGFKQGEVACLINPFKRDKRTWWNV 526

Query: 180 ERHWNEKLP-LGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           E + NEKLP +     + K+ F  +F HLN+ M   NNAL+P+PDK D ++S   QWP L
Sbjct: 527 ETNVNEKLPPMPEDFKYPKTNFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTL 586

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
            VG+R+  WADD  K+FL+G+P   W  TA++ +F  L+ +Y +R +R+ + F  A+  +
Sbjct: 587 NVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFSLLVVYYLLRWQRQLVLFRSADDAN 646

Query: 298 FLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
              +G I  ++GW LHY+PF +MGRVTY+HHY PALYF++LM A++ +    + +   K+
Sbjct: 647 VFLMGGIYPLLGWCLHYLPFAVMGRVTYVHHYLPALYFALLMLAYVFEATLRAARHSQKS 706

Query: 357 -------IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                  +++  YY  ++  F+YF  I+ G+  P++  K   WL TW+I 
Sbjct: 707 YLKILVYVVYAAYYCTVIYGFYYFYPISVGMEGPSTNYKHLNWLKTWSIA 756



>gi|50291311|ref|XP_448088.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527399|emb|CAG61039.1| unnamed protein product [Candida glabrata]
          Length = 742

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 162/409 (39%), Positives = 236/409 (57%), Gaps = 9/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GS +++KN    G LLHSH+  YP GS QQQV+ Y + D NN+W+  + R+E +++ N T
Sbjct: 334 GSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINET 393

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++E+V +G               +H IAAPV   ++EVS YGN T+GD  DYWV+E+V  
Sbjct: 394 DIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQ 453

Query: 120 TNTKXXXXXX-XXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             ++               +K + CYL      LPEWGFRQ E++C K    +D  T WN
Sbjct: 454 KGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWN 513

Query: 179 VERHWNEKLPLGSKVNFK-SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           VE H NEKLP   +  +  S FL +F HLN+ M   NNAL+P  DK D ++S   +WP L
Sbjct: 514 VESHENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTL 573

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
            VGLR+  W D+  K+FLLG P+  W+ + +++ F  L     +R +R+Y +FS  +  +
Sbjct: 574 HVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFN 633

Query: 298 -FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFT-----VSCK 351
            FL  G   ++GW LH++PF IM RVTY+HHY PALYF++++  +++D  T       C 
Sbjct: 634 LFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCG 693

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + ++F I  + +V  FWYF  I+FG+  PA      KW+ TW+I D
Sbjct: 694 SIMRLVVFAISIASVVGCFWYFSPISFGMTGPAINYHYLKWVKTWHIHD 742



>gi|354545592|emb|CCE42320.1| hypothetical protein CPAR2_808690 [Candida parapsilosis]
          Length = 767

 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 163/417 (39%), Positives = 241/417 (57%), Gaps = 19/417 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  +PR +  Y+   N 
Sbjct: 348 SIVTLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRPRGQPSYDTSGNN 407

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
           T++E+V +G  I            +HEI APV+    EV+ YGN T+GD  D W++EVV 
Sbjct: 408 TDIEYVFDGMPIRIMHPQTGRNLHTHEIPAPVSKTELEVACYGNLTIGDAKDNWIVEVVD 467

Query: 119 D-TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
             +N                ++V+ CYL  +   LP+WGFRQ EV C K    KD  T W
Sbjct: 468 QASNEDKMRLHPLTTSFRLKNEVMNCYLGVSGSTLPQWGFRQGEVVCFKNPFKKDKRTWW 527

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           N+E H NE LP   + +FK   ++F+ +F  LN+ M   NNAL+P+PDK+D ++S   QW
Sbjct: 528 NIEDHRNEHLPPAPE-DFKLPKTRFIRDFIQLNLAMMATNNALLPDPDKQDDLASSFWQW 586

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---S 291
           P L VG+RM  W  DK K+F++G+P   W+ +  +V+F  +  +Y +R +R+ ++F    
Sbjct: 587 PTLNVGIRMCGWGADKPKYFMIGSPATTWTSSVGVVVFALITLYYLIRWQRQIVDFPSDQ 646

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK 351
           PA    F+  G   ++GW LH++PF IMGRVTY+HHY PALYF+M++  F ++ +T    
Sbjct: 647 PARLQKFIMGGIYPMLGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCFEIELWTSKLN 706

Query: 352 PKTKNII-----FGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            K  + +       +Y +L  IV   F+Y +  +FG+  P    K  +WL +W + D
Sbjct: 707 KKGASAVSKVAYVALYLALYFIVGFTFYYLRFFSFGMEGPKENWKHTQWLQSWRVSD 763



>gi|156839943|ref|XP_001643657.1| hypothetical protein Kpol_1040p12 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114277|gb|EDO15799.1| hypothetical protein Kpol_1040p12 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 753

 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 160/409 (39%), Positives = 239/409 (58%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S ++++N   GG LLHSH+  YP GS+QQQV+ Y H D NNDW+  + R+  +YN N T+
Sbjct: 344 STVSIRNQALGGALLHSHVQGYPAGSKQQQVTGYGHQDANNDWIFHRIRQLPLYNANETD 403

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++ +G+T             SH++AAPV++  +EVS YG+   GD+ D W++EVV   
Sbjct: 404 IEYILDGETYRLVHKNTNKNLHSHQVAAPVSSTQWEVSGYGDHNTGDNKDNWIVEVVDQK 463

Query: 121 NTKXXXXXX-XXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H V+GCYL  ++  LPEWGF Q EV C K    +D  T WN+
Sbjct: 464 GSEDKSKLHPLTTSFRLKHAVLGCYLAQSSNRLPEWGFSQSEVICLKNPFKRDKRTWWNI 523

Query: 180 ERHWNEKLP-LGSKVNFKSK-FLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           E H NEKLP +G    F    FL +F +LN+ M + NNAL+ +PDK D ++S   QWP L
Sbjct: 524 ELHVNEKLPTIGEDYKFPGNGFLKDFVYLNLAMMSTNNALVTDPDKLDRLASSAWQWPTL 583

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
             GLR++ W DD VK++L+G P   W+ TA+++ F  L+    +R +R+Y ++  ++ ++
Sbjct: 584 NTGLRLNGWHDDNVKYYLMGTPASTWASTAAVLGFMVLVIILVLRWQRQYNDYQNSDKVN 643

Query: 298 -FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFT-VSCKPKTK 355
            FL  G   + GW LH+ PF IM RVTY+HHY PALYF++++  +  +  T +  K KT 
Sbjct: 644 LFLMAGVYPMFGWGLHFCPFVIMARVTYVHHYLPALYFALIVLVYFFEAGTQLLTKTKTG 703

Query: 356 NI----IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +    IF  Y + ++  FWYF  I FG++ P        WL  W+I +
Sbjct: 704 RMIRIGIFATYITAVIACFWYFSPITFGMDGPNKNYSYLAWLPGWDISE 752



>gi|349576230|dbj|GAA21402.1| K7_Pmt2p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 759

 Score =  310 bits (794), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 158/410 (38%), Positives = 233/410 (56%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++   
Sbjct: 407 IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                + +GCYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE+LP   + +F   K+ FL +F HLN+ M   NNAL+P+PDK D ++S   QWP 
Sbjct: 527 ETHENERLPPRPE-DFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPT 585

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF-SPAEW 295
           L VGLR+  W DD  K+FLLG P   W+ + +++ F   +    +R +R+Y++  +P+ W
Sbjct: 586 LNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNW 645

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSC 350
             FL  G   ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C
Sbjct: 646 NVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKC 705

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 706 GRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|27469358|ref|NP_009379.2| Pmt2p [Saccharomyces cerevisiae S288c]
 gi|32130430|sp|P31382.2|PMT2_YEAST RecName: Full=Dolichyl-phosphate-mannose--protein
           mannosyltransferase 2
 gi|27316977|gb|AAC04934.2| Pmt2p: protein O-D-mannosyltransferase [Saccharomyces cerevisiae]
 gi|190406671|gb|EDV09938.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Saccharomyces cerevisiae RM11-1a]
 gi|256272298|gb|EEU07283.1| Pmt2p [Saccharomyces cerevisiae JAY291]
 gi|259144687|emb|CAY77628.1| Pmt2p [Saccharomyces cerevisiae EC1118]
 gi|285810179|tpg|DAA06965.1| TPA: Pmt2p [Saccharomyces cerevisiae S288c]
 gi|323349894|gb|EGA84105.1| Pmt2p [Saccharomyces cerevisiae Lalvin QA23]
 gi|365767215|gb|EHN08700.1| Pmt2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392301252|gb|EIW12340.1| Pmt2p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 759

 Score =  310 bits (794), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 158/410 (38%), Positives = 233/410 (56%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++   
Sbjct: 407 IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                + +GCYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE+LP   + +F   K+ FL +F HLN+ M   NNAL+P+PDK D ++S   QWP 
Sbjct: 527 ETHENERLPPRPE-DFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPT 585

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF-SPAEW 295
           L VGLR+  W DD  K+FLLG P   W+ + +++ F   +    +R +R+Y++  +P+ W
Sbjct: 586 LNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNW 645

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSC 350
             FL  G   ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C
Sbjct: 646 NVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKC 705

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 706 GRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|323334791|gb|EGA76163.1| Pmt2p [Saccharomyces cerevisiae AWRI796]
          Length = 759

 Score =  310 bits (793), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 158/410 (38%), Positives = 233/410 (56%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++   
Sbjct: 407 IEYLTPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                + +GCYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE+LP   + +F   K+ FL +F HLN+ M   NNAL+P+PDK D ++S   QWP 
Sbjct: 527 ETHENERLPPRPE-DFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPT 585

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF-SPAEW 295
           L VGLR+  W DD  K+FLLG P   W+ + +++ F   +    +R +R+Y++  +P+ W
Sbjct: 586 LNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNW 645

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSC 350
             FL  G   ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C
Sbjct: 646 NVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKC 705

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 706 GRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|151941369|gb|EDN59740.1| dolichyl phosphate-D-mannose:protein O-D-mannosyltransferase
           [Saccharomyces cerevisiae YJM789]
          Length = 759

 Score =  310 bits (793), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 158/410 (38%), Positives = 233/410 (56%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++   
Sbjct: 407 IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                + +GCYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE+LP   + +F   K+ FL +F HLN+ M   NNAL+P+PDK D ++S   QWP 
Sbjct: 527 ETHENERLPPRPE-DFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPT 585

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF-SPAEW 295
           L VGLR+  W DD  K+FLLG P   W+ + +++ F   +    +R +R+Y++  +P+ W
Sbjct: 586 LNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNW 645

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSC 350
             FL  G   ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C
Sbjct: 646 NVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKC 705

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 706 GRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|207348012|gb|EDZ73997.1| YAL023Cp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 554

 Score =  309 bits (792), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 158/410 (38%), Positives = 233/410 (56%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 142 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 201

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++   
Sbjct: 202 IEYLTPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 261

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                + +GCYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 262 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 321

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE+LP   + +F   K+ FL +F HLN+ M   NNAL+P+PDK D ++S   QWP 
Sbjct: 322 ETHENERLPPRPE-DFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPT 380

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF-SPAEW 295
           L VGLR+  W DD  K+FLLG P   W+ + +++ F   +    +R +R+Y++  +P+ W
Sbjct: 381 LNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNW 440

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSC 350
             FL  G   ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C
Sbjct: 441 NVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKC 500

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 501 GRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 550



>gi|255732894|ref|XP_002551370.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Candida
           tropicalis MYA-3404]
 gi|240131111|gb|EER30672.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Candida
           tropicalis MYA-3404]
          Length = 765

 Score =  309 bits (792), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 164/417 (39%), Positives = 241/417 (57%), Gaps = 19/417 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NNI 58
           S +TLKN G  GGLLHSH+  YP GS+QQQV+ Y H D NN+W+  +PR +  Y   NN 
Sbjct: 346 SFVTLKNQGLSGGLLHSHVQTYPEGSKQQQVTTYGHKDSNNNWIFQRPRGQPPYDPSNNN 405

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
           T +E++ +G  +            +H++ APVT    EV+ YGN T+GD  D W++E+V 
Sbjct: 406 TAIEYIIDGMHVRLMHPQSGRNLHTHDVQAPVTKGELEVACYGNLTIGDAKDNWIVEIVD 465

Query: 119 DTNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
               +               ++V+ CYL ++   LP+WGFRQ EV C K    KD  T W
Sbjct: 466 QAGDEDKMRLHPLTTSFRLKNEVMNCYLGTSGSTLPQWGFRQGEVVCYKNPFKKDKRTWW 525

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           N+E H N  LP   + +FK   ++F+ +F  LN+ M   NNAL+P+ DK+D ++S   QW
Sbjct: 526 NLEDHRNAILPPAPE-SFKLPKTRFIRDFIQLNLAMMATNNALLPDNDKQDDLASSFWQW 584

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---S 291
           P L VG+RM  W+ DK K+F++G+P   W+ TA ++LF  ++ +Y +R +R+Y++F    
Sbjct: 585 PTLNVGIRMCRWSPDKPKYFMIGSPATTWTSTAGVILFAFIVLFYLIRWQRQYVDFPTTQ 644

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--- 348
           P +   FL  G   + GW LH++PF IMGRVTY+HHY PALYF+M++  + +D FT    
Sbjct: 645 PNKLRKFLMGGIYPMFGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCYEVDAFTSRFN 704

Query: 349 --SCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             +     K    GIY+ L   V   FWYF+ +++G+  P    K  K L +W + D
Sbjct: 705 RPNATQAQKLTYAGIYFVLYFFVGYTFWYFRYLSWGMEGPKENWKHLKLLESWRVSD 761



>gi|448520650|ref|XP_003868329.1| Pmt2 hypothetical protein mannosyltransferase (PMT) [Candida
           orthopsilosis Co 90-125]
 gi|380352669|emb|CCG25425.1| Pmt2 hypothetical protein mannosyltransferase (PMT) [Candida
           orthopsilosis]
          Length = 763

 Score =  309 bits (791), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 163/417 (39%), Positives = 240/417 (57%), Gaps = 19/417 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  +PR +  Y+   N 
Sbjct: 344 SVVTLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRPRGQPSYDPSGNN 403

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
           T++E+V +G  I            +HEI APVT    EV+ YGN T+GD  D W++EV  
Sbjct: 404 TDIEYVFDGMPIRIMHPQTGRNLHTHEIPAPVTKTELEVACYGNLTVGDAKDNWIVEVAD 463

Query: 119 D-TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
             +N                ++V+ CYL  +   LP+WGFRQ EV C K    KD  T W
Sbjct: 464 QASNEDKMRLHPLTTSFRLKNEVMDCYLGVSGSTLPQWGFRQGEVVCFKNPFKKDKRTWW 523

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           N+E H NE LP   + +FK   ++F+ +F  LN+ M   NNAL+P+PDK+D ++S   QW
Sbjct: 524 NIEDHRNELLPPAPE-DFKLPKTRFIRDFIQLNLAMMATNNALLPDPDKQDDLASSFWQW 582

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---S 291
           P L VG+RM  W  DK K+F++G+P   WS +  +++F  +  +Y VR +R+ +++    
Sbjct: 583 PTLNVGIRMCGWGADKPKYFMIGSPATTWSSSIGIIVFALITLYYLVRWQRQIVDYPSDQ 642

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK 351
           PA    F+  G   ++GW LH++PF IMGRVTY+HHY PALYF+M++  F ++ +T    
Sbjct: 643 PARLQKFIMGGIYPMLGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCFEVELWTSKLN 702

Query: 352 PKTKNII-----FGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +  + +       IY +L  IV   F+Y +  +FG+  P    K  +WL +W + D
Sbjct: 703 YRGASAVSKIAYIAIYLALYFIVGFTFYYLRYFSFGMEGPKENWKHTQWLQSWRVSD 759



>gi|150863992|ref|XP_001382657.2| Phospho Mannno Transferase; dolichyl-P-mannose-protein
           mannosyltransferase [Scheffersomyces stipitis CBS 6054]
 gi|149385248|gb|ABN64628.2| Phospho Mannno Transferase; dolichyl-P-mannose-protein
           mannosyltransferase [Scheffersomyces stipitis CBS 6054]
          Length = 759

 Score =  308 bits (789), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/415 (40%), Positives = 240/415 (57%), Gaps = 17/415 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NNI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R E  Y   NN 
Sbjct: 342 SVITLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWVFQRSRGETPYDTSNNN 401

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVV- 117
           TE+E+V +G  I            +H+I APVT  H EV+ YGN T+GD  D W +E+V 
Sbjct: 402 TEIEYVLDGMKIRVMHPQTGRNLHTHDIPAPVTKGHHEVACYGNMTIGDLKDNWFVEIVE 461

Query: 118 SDTNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
             ++                ++V+ CYL      LP+WGFRQ EV C K    KD  T W
Sbjct: 462 QQSDEDKLRLHPLTTSFRLKNEVMNCYLGVTGVSLPQWGFRQGEVACFKNPFKKDKRTWW 521

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           N+E + NE LP  +  +FK   +KFL +F  LNV M   NNAL+P+ DK+D ++S   QW
Sbjct: 522 NIENNRNEILP-PAPADFKLPKTKFLKDFIQLNVAMMATNNALVPDSDKQDDLASEAWQW 580

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---S 291
           P L VG+RM  WA DKVK+FL+G+ +  W+ +  +VLF  L  +Y +R +R+ ++F    
Sbjct: 581 PTLNVGIRMCSWAKDKVKYFLIGSTVNTWASSVGVVLFAFLTLYYLIRWQRQIVDFPASE 640

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--- 348
           P +   FL  G   + GW LH++PF IMGRVTY+HHY PALYF++++  + ++ FT    
Sbjct: 641 PNKLKLFLMGGIYPMFGWGLHFMPFVIMGRVTYVHHYVPALYFALIVLCYEIESFTSPLN 700

Query: 349 ---SCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              S K   +  I+  +Y+ ++  FWY++ I++G+     + K    L TW I D
Sbjct: 701 KGGSVKKYIRGAIYIAWYAAVIGAFWYWRYISWGLEGAKEDWKHLDLLPTWRISD 755



>gi|323306152|gb|EGA59884.1| Pmt2p [Saccharomyces cerevisiae FostersB]
          Length = 759

 Score =  307 bits (786), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 157/410 (38%), Positives = 232/410 (56%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++   
Sbjct: 407 IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                + + CYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMXCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE+LP   + +F   K+ FL +F HLN+ M   NNAL+P+PDK D ++S   QWP 
Sbjct: 527 ETHENERLPPRPE-DFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPT 585

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF-SPAEW 295
           L VGLR+  W DD  K+FLLG P   W+ + +++ F   +    +R +R+Y++  +P+ W
Sbjct: 586 LNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNW 645

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSC 350
             FL  G   ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C
Sbjct: 646 NVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKC 705

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 706 GRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|459365940|gb|EMG45430.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Candida
           maltosa Xu316]
          Length = 766

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 163/417 (39%), Positives = 243/417 (58%), Gaps = 19/417 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NNI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R +  Y   NN 
Sbjct: 347 SVVTLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGKVPYDASNNN 406

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
           TE+E++ +G  +            +HE+ AP+T   +EVS YGN T+GD  D W++E+  
Sbjct: 407 TEIEYIIDGMHVRLMHSQTGRNLHTHEVQAPLTKSEYEVSCYGNLTIGDPKDNWIVEIAE 466

Query: 119 DTNTKXXXXXX-XXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
               +               ++++ CYL  +   LP+WGFRQ EV C K    KD  T W
Sbjct: 467 QAGDEDKMRLHPLTSSFRLKNELMNCYLGVSGNSLPQWGFRQGEVVCYKNPFKKDKRTWW 526

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           N+E + NE LP  +  +FK   ++FL +F  +N+ M   NNAL+P+PDK+D ++S   QW
Sbjct: 527 NLENNRNEILP-PAPADFKLPKTRFLRDFIQINLAMMATNNALVPDPDKQDDLASSFWQW 585

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---S 291
           P L VG+RM  W+ DK K+F++G+P   W+ TA + LF  ++ +Y VR +R+Y++F   +
Sbjct: 586 PTLNVGIRMCGWSADKAKYFMIGSPATTWTSTAGVFLFAFIVIFYLVRWQRQYVDFPSTN 645

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--- 348
           P +   FL  G   + GW LH++PF IMGRVTY+HHY PALYF+M++  + ++ FT    
Sbjct: 646 PQKLKLFLMGGIYPMFGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCYEVESFTACLN 705

Query: 349 --SCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             +   K+K I   I+  L  +V   FWYF+ +++G+       K  K L +W I D
Sbjct: 706 RPNASQKSKLIYLAIFIGLYFMVGYTFWYFRYLSWGMEGKKENWKHLKLLKSWRISD 762



>gi|401626946|gb|EJS44859.1| pmt2p [Saccharomyces arboricola H-6]
          Length = 760

 Score =  303 bits (775), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 156/410 (38%), Positives = 231/410 (56%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N TE
Sbjct: 348 SIVSIKNQALGGSLLHSHIQTYPEGSNQQQVTCYGYKDANNEWFFNRERGLPSWSANETE 407

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++  G +             +H +AA V+   +EVS YG++ +GD+ D W IE++   
Sbjct: 408 LEYLKPGASYRLIHKSTGRNLHTHPVAAAVSKTQWEVSGYGDDFVGDNKDNWAIEIMDQR 467

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                + +GCYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 468 GDEDPDKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 527

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE+LP   + +F   K+ FL +F HLN+ M   NNAL+P+PDK D ++S   QWP 
Sbjct: 528 ETHENERLPPRPE-DFQYPKTNFLKDFIHLNLAMMATNNALLPDPDKFDYLASSAWQWPT 586

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF-SPAEW 295
           L VGLR+  W D+  K+FLLG P   W+ T +++ F   +    +R +R+Y++  SP++W
Sbjct: 587 LNVGLRLCGWGDENPKYFLLGTPASTWASTIAVLAFMATIVILVIRWQRQYVDLTSPSDW 646

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSC 350
             FL  G   ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C
Sbjct: 647 NIFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSKSKC 706

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               + +++  +  L++  FWYF  I+FG+  P+   +   W S+W+I D
Sbjct: 707 GRIMRFVLYAGFMFLVIGCFWYFSPISFGMEGPSGNFRYLSWFSSWDIAD 756



>gi|344232248|gb|EGV64127.1| PMT-domain-containing protein [Candida tenuis ATCC 10573]
          Length = 763

 Score =  302 bits (774), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 162/414 (39%), Positives = 241/414 (58%), Gaps = 16/414 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN--NIT 59
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R    ++     
Sbjct: 347 SVITLKNQGLTGGLLHSHVQAFPEGSKQQQVTTYSHKDSNNNWVFQRARGLDHFDPQENK 406

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++E+V  G  +            SH + APVT  H+EV+ YGN+T+GD+ D WVIE+V  
Sbjct: 407 DLEYVVEGMVVRLLHPMTGRNLHSHNVQAPVTKNHYEVAGYGNQTIGDNKDNWVIEIVEQ 466

Query: 120 TNTKXXXXXX-XXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
           +  +               + V+ CYL      LP WGFRQ EV C K    KD  T WN
Sbjct: 467 SGDEDKDKLHPLTSSVRFKNTVMNCYLGVTGASLPAWGFRQGEVACFKDPFKKDKRTWWN 526

Query: 179 VERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           +E H N  LP   + +FK   ++F+ +F  LN+ M   NNAL+P+ +K+D ++S   +WP
Sbjct: 527 IESHVNTLLPPPPE-DFKLPKTRFIRDFIQLNLAMMATNNALVPDYEKQDDLASSAWEWP 585

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
            L VG+R+  WA+DKVK+FL+G+P   W  TA +V F  L+ WY +R +R++ +F     
Sbjct: 586 TLHVGIRLCSWANDKVKYFLIGSPATTWPSTAGVVFFAGLVLWYLLRWQRQFNDFDGQSH 645

Query: 296 IHFLYI--GKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPK 353
              L+I  G   + GW LH++PF IMGRVTY+HHY PALYF+M++  F+++H T   +  
Sbjct: 646 KLKLFIMGGIYPMFGWGLHFVPFVIMGRVTYVHHYLPALYFAMMILCFLIEHLTTPLRKS 705

Query: 354 TK---NIIF-GIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +    N+I+ G+Y   + ++V  FW+++ +A+G+  P S       LSTW I +
Sbjct: 706 SSRALNLIYVGVYSSFFGVVVGCFWHWRYVAWGMEGPKSNWAYLDLLSTWRIAN 759



>gi|320581398|gb|EFW95619.1| Protein O-mannosyltransferase [Ogataea parapolymorpha DL-1]
          Length = 736

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 159/405 (39%), Positives = 231/405 (57%), Gaps = 8/405 (1%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S +T+KN G  GGLLHSHI  YP GS QQQV+ Y H D NNDW + +  +E   N  TE 
Sbjct: 333 SVVTIKNQGLTGGLLHSHIQTYPEGSNQQQVTTYSHKDSNNDW-VFELVREDPRNEFTEP 391

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDTN 121
            +V +G ++            +HEI APV++ H+EVS YGN T+GD  D WV+EVV    
Sbjct: 392 HYVVDGMSVRLIHKSTGRNLHTHEIPAPVSSSHYEVSGYGNLTVGDFKDNWVVEVVDQYG 451

Query: 122 TKXXXXXXXXXXXXXXH-KVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVE 180
           T+                + +GCYL S+   LP+WGFRQ EV C K    +D  T WN+E
Sbjct: 452 TEDKLRLHPLTTSFRLRSEALGCYLASSGIALPQWGFRQGEVMCMKNPFKRDKRTWWNIE 511

Query: 181 RHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
            H N +LP     +FK   + FL +F  LN+ M   NNAL+P+P+K+D ++S   QWP L
Sbjct: 512 NHSNPELP-NPPEDFKLPKTSFLKDFIQLNIAMMATNNALVPDPEKQDDLASNAWQWPTL 570

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF--SPAEW 295
            VG+R+  W DD VK+FL+G+P   W+ + ++V+F  ++  Y +R +R+  +F   P + 
Sbjct: 571 HVGIRLCGWGDDNVKYFLIGSPATTWTSSIAIVVFVIMVVRYLLRWQRQINDFEGQPKKA 630

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTK 355
             F+  G    +GWLLHY+PF IMGRVTY+HHY PALYF+M++  + +            
Sbjct: 631 DLFVMGGLYPFLGWLLHYLPFCIMGRVTYVHHYLPALYFAMIVYCYTVYRLAEKLNRWAA 690

Query: 356 NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             ++   Y+L++  F +   + FG++ P +  K    L +W + D
Sbjct: 691 AALYIFLYALVIGWFIFLLPLTFGMDGPNANYKYLNVLKSWRVAD 735



>gi|365762199|gb|EHN03800.1| Pmt2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 759

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 156/410 (38%), Positives = 231/410 (56%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SLVSIKNQALGGSLLHSHIQTYPEGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENDTD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++  G               +H +AA V+   +EVS YG++ +GD+ D WVIE+++  
Sbjct: 407 IEYLKAGAPYRLVHKSTGRNLHTHPVAAAVSKTQWEVSGYGDDFVGDNKDNWVIEIMNQR 466

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                + + CYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 467 GDEDPEKLHTLTTSFRIKNMEMDCYLAQTGSSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE LP   + +F   K+ F  +F HLN+ M   NNAL+P+PDK D ++S   QWP 
Sbjct: 527 ETHENENLPPRPE-DFQYPKTNFFKDFIHLNLAMMATNNALLPDPDKFDYLASSAWQWPS 585

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF-SPAEW 295
           L VGLR+  W DD  K+FLLG P   W+ + +++ F  ++    +R +R+Y++  SP+ W
Sbjct: 586 LNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMAIIVILLIRWQRQYVDLTSPSNW 645

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSC 350
             FL  G   ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C
Sbjct: 646 NVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQRWSRSKC 705

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               + +++  + +L++  FWYF  I+FG+  P+   +   WLSTW+I D
Sbjct: 706 GRIMRFVLYTGFMALVIGCFWYFSPISFGMEGPSDNFRYLNWLSTWDIAD 755



>gi|260943918|ref|XP_002616257.1| hypothetical protein CLUG_03498 [Clavispora lusitaniae ATCC 42720]
 gi|238849906|gb|EEQ39370.1| hypothetical protein CLUG_03498 [Clavispora lusitaniae ATCC 42720]
          Length = 753

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 160/411 (38%), Positives = 240/411 (58%), Gaps = 15/411 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT-- 59
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  +PR +  Y+  T  
Sbjct: 338 SFVTLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYSHKDSNNNWIFQRPRPQPFYDTETNS 397

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           E E+V +G T+            +H+I+APV    +EV+ YGN T+GD  D W++EV+  
Sbjct: 398 EAEYVLDGMTVRLIHPQTGRNLHTHDISAPVQKSEYEVACYGNMTVGDLKDNWIVEVMES 457

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +                +V+ CYL      LP+WGFRQ EV C K    KD  T WN
Sbjct: 458 YGKEDALKLHPLTTSFRLKSEVMNCYLGVTGNSLPQWGFRQGEVVCFKNPFKKDKRTWWN 517

Query: 179 VERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           +E + N  LP   + +F   K+ F  +F  +N+ M   NNAL+P+ DK+D ++S   QWP
Sbjct: 518 IENNRNAILPDAPE-DFQLPKTNFFKDFIQINLAMMATNNALVPDDDKQDDLASKFWQWP 576

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
            L  G+RM  WADDKVK+FL+G+P   W+ +  +VLF  +  ++ +R +R+  +F  A  
Sbjct: 577 TLHSGIRMCSWADDKVKYFLIGSPATTWTSSVGVVLFCFITLYHLIRWQRQINDFETASK 636

Query: 296 IHFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV----SC 350
           +    +G I  + GW LH++PF IMGRVTY+HHY PALYF+ML+  + ++ FT     S 
Sbjct: 637 LKKFVMGGIYPMFGWGLHFMPFVIMGRVTYVHHYLPALYFAMLVFTYEVEAFTQPLARSQ 696

Query: 351 KPKTKNIIFGIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           KP  K + +GI+   Y+L+++ FW+F+ I++G+  P ++      L +W +
Sbjct: 697 KPAMKVLYWGIFIALYALMILTFWHFRWISWGMEGPKTDWSHLDLLPSWRV 747



>gi|367006206|ref|XP_003687834.1| hypothetical protein TPHA_0L00440 [Tetrapisispora phaffii CBS 4417]
 gi|357526140|emb|CCE65400.1| hypothetical protein TPHA_0L00440 [Tetrapisispora phaffii CBS 4417]
          Length = 754

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 162/405 (40%), Positives = 231/405 (57%), Gaps = 11/405 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S +TLK    GG +LHSH N YP GS QQQV+ Y + D NNDW+  K R+EQ + +  + 
Sbjct: 349 SIVTLKAQTLGGAILHSHQNLYPSGSGQQQVTGYGYGDENNDWIFQKAREEQPWLDGQDT 408

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDTN 121
           EFV +G T+            SH I APVTN++ EV+ YG    GD  D W++E+VS   
Sbjct: 409 EFVKDGQTVRLVHKLTGRNLHSHAIPAPVTNIYKEVACYGTLEQGDVFDDWIVEIVSQMG 468

Query: 122 TKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVE 180
           ++               H  +GCYL    + LPEWGF+QIE+ C       D    WN+E
Sbjct: 469 SEDKTLLHPLTSTFRLKHAQLGCYLGQTGQFLPEWGFKQIEIACMSNVKLSDKRIIWNIE 528

Query: 181 RHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
            H NE LP  S+ +FK     FL NF +LN+ M + NNAL+P+ +K D ISS   +WPIL
Sbjct: 529 SHINEGLPPVSE-DFKYPQDSFLRNFIYLNLAMMSTNNALVPDSEKLDRISSSWWEWPIL 587

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
             GLR+  WADD VK++LL  P+  W  TA++++F  L+   +++ +R+   F     + 
Sbjct: 588 YRGLRLGGWADDNVKYYLLATPLTTWLSTAAVLIFMALVIVLAIKWQRQLDNFQDNASVS 647

Query: 298 FLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
              I  I  ++GW LHY PF IMGRVTYLHHY PALYF++++  + ++  T++ K K   
Sbjct: 648 LFTIAGIYPMLGWGLHYTPFIIMGRVTYLHHYLPALYFALIVLTYFVE--TITSKCKNSL 705

Query: 357 IIFGIYYSL---IVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           + + I Y L    +  F YF  ++FG+  P+++ +    L TWNI
Sbjct: 706 LRYSISYGLSIATIACFAYFSPVSFGMEGPSTDYQYLNQLPTWNI 750



>gi|50311535|ref|XP_455792.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644928|emb|CAG98500.1| KLLA0F15829p [Kluyveromyces lactis]
          Length = 741

 Score =  300 bits (769), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 161/413 (38%), Positives = 232/413 (56%), Gaps = 18/413 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +T+KN   GGGLLHSHI  YP GS+QQQV+ Y H D NN W   + R    Y+ N TE
Sbjct: 333 SEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETE 392

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
            EFV +G               +H   APV    +EVS YG+  +GD  D W+IE+V   
Sbjct: 393 TEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIVDQK 452

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                  +GCYL      LP+WGFRQ EV C K    +D  T WN+
Sbjct: 453 GPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNI 512

Query: 180 ERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E + NEKLP   + NFK   + F+ +F HLN+ M   NNAL+PN +K D ++S   QWP 
Sbjct: 513 ETNVNEKLPPRPE-NFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPT 571

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L VG+R+  W +  +K+FL+G+P   W  T +++ F  L+  Y +R +R+Y + +  E I
Sbjct: 572 LNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDI 631

Query: 297 HFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS------ 349
           +   +G I  ++ W LH++PF IM RVTY+HHY PALYF++L+ A++   F +S      
Sbjct: 632 NLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHYLPALYFALLVLAYL---FEISMKKWNK 688

Query: 350 --CKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             C    +  I+G Y ++++  F+YF  I+FG++ P+++ +   WLSTW I D
Sbjct: 689 SKCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYEYLNWLSTWTISD 741



>gi|344301487|gb|EGW31799.1| hypothetical protein SPAPADRAFT_62391 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 517

 Score =  300 bits (767), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 163/418 (38%), Positives = 239/418 (57%), Gaps = 21/418 (5%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NNI 58
           S +T+KN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R    Y   NN 
Sbjct: 98  SSVTIKNQGLSGGLLHSHVQTFPSGSKQQQVTTYGHKDSNNNWVFQRARGVPHYDTANNN 157

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVV- 117
           T++E++ +G TI            SHE+ APV+   +EV+AYGN TLGD  D WV+E++ 
Sbjct: 158 TDIEYIIDGMTIRLMHKNTGRNLHSHEVDAPVSKAQWEVAAYGNLTLGDVKDNWVVEIME 217

Query: 118 SDTNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
            ++N                H  +GCYL ++   LP+WGFRQ EV C K    KD  T W
Sbjct: 218 QNSNEDKMRIHPLTTSFRLRHAYLGCYLATSGSNLPQWGFRQGEVVCHKDPFKKDKRTWW 277

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
            +E + N  LP  S+ +FK   +KF+ +F  LN+ M   NNAL+P+ +K+D ++S   QW
Sbjct: 278 IIEDNENPILPPPSE-DFKLPKTKFIKDFIQLNLAMMATNNALVPDEEKQDDLASDFWQW 336

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---S 291
           P L VG+RM  W     K+F++G+P   W+ T  +  F  L+ +Y VR +R+ I+F   +
Sbjct: 337 PSLNVGIRMCGWGSKNPKYFMIGSPATTWTSTVGVFAFALLVIYYLVRWQRQIIDFPSTN 396

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF----- 346
           P +   FL  G   + GW LHY+PF IMGRV Y+HHY PALYF+ML+  + +D F     
Sbjct: 397 PDKLKRFLMGGIYPMFGWGLHYVPFVIMGRVKYVHHYMPALYFAMLVFCYEVDSFSRRLN 456

Query: 347 ----TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               +V+ K     +  G+ Y+L+   F+YF+  +FG+  P  + K  + L +W + D
Sbjct: 457 DRNASVASKLSYAALYLGL-YALVGGTFYYFRYFSFGMEGPKEDWKHLQLLRSWRVAD 513



>gi|149242363|ref|XP_001526455.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Lodderomyces elongisporus NRRL YB-4239]
 gi|146450578|gb|EDK44834.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Lodderomyces elongisporus NRRL YB-4239]
          Length = 796

 Score =  299 bits (766), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 240/417 (57%), Gaps = 19/417 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R    Y+   N 
Sbjct: 377 SVVTLKNQGLSGGLLHSHVQTFPEGSKQQQVTTYSHKDSNNNWIFQRARPLPSYDPSANK 436

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
           T++E+V +G  +            +HEI AP T   +EV+ YGN T+GD  D W++E++ 
Sbjct: 437 TDIEYVIDGMHVRLMHPQTGRNLHTHEIPAPSTKSEWEVACYGNLTIGDAKDNWIVEIMD 496

Query: 119 DTNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
               +               ++V+GCYL      LP+WGFRQ EV C K    KD  T W
Sbjct: 497 QQGDEDKLKLHPLTSSFRLKNEVLGCYLGVTGTSLPQWGFRQGEVVCYKNPFKKDKRTWW 556

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           N+E + NE LP   + NFK   ++F+ +F  LN+ M   NNAL+P+PDK+D ++S   QW
Sbjct: 557 NIENNRNEILPPAPE-NFKLPKTRFIRDFIQLNLAMMATNNALLPDPDKQDDLASSFWQW 615

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS--- 291
           P L VG+RM  W+ DK K+F++G+P   W+ T  + +F  +  +Y VR +R++++F    
Sbjct: 616 PTLNVGIRMCGWSPDKAKYFMIGSPATTWTSTVGVFIFAFITLYYIVRWQRQFVDFPSNH 675

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF-TVSC 350
           P +   F+  G   + GW LH++PF IMGRVTY+HHY PALYF+M++  + +D F ++  
Sbjct: 676 PQKLQKFIMGGIYPMFGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCYEVDAFASIFN 735

Query: 351 KPKTKNI-------IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +P+   +       I+   Y+L+   FWY +  ++G+     E K  + +++W + D
Sbjct: 736 RPRASAVSKIVYAAIYVTLYALVAGTFWYLRYFSWGMEGDKKEWKHLQLINSWRVSD 792



>gi|241953727|ref|XP_002419585.1| dolichyl-phosphate-D-mannose:protein O-D-mannosyltransferase,
           putative; protein O-mannosyltransferase, putative
           [Candida dubliniensis CD36]
 gi|223642925|emb|CAX43180.1| dolichyl-phosphate-D-mannose:protein O-D-mannosyltransferase,
           putative [Candida dubliniensis CD36]
          Length = 767

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 244/417 (58%), Gaps = 19/417 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R +  Y+   N 
Sbjct: 348 SVITLKNQGLSGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGQPYYDTSGNT 407

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
           T+VE++ +G  +            +H+I APV+   +EV+ YGN T+GD  D W++E++ 
Sbjct: 408 TDVEYIFDGMHVRLMHPQTGRNLHTHDIPAPVSKSEYEVACYGNLTIGDPKDNWIVEIME 467

Query: 119 D-TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
             ++                ++V+ CYL      LP+WGFRQ EV C K    KD  T W
Sbjct: 468 QASDEDKMRLHPLTSSFRLKNEVMNCYLGVTGTTLPQWGFRQGEVVCYKNPFKKDKRTWW 527

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           N+E + N  LP   + +FK   +KF+ +F  LN+ M   NNAL+P+ +K+D ++S   QW
Sbjct: 528 NIENNRNAILPPAPE-DFKLPKTKFIRDFIQLNLAMMATNNALVPDTEKQDDLASSFWQW 586

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---S 291
           P L VG+RM  W  +  K++++G+P   W+ T  ++LF  ++ +Y +R +R+Y++F   +
Sbjct: 587 PTLNVGIRMCGWGPENPKYYMIGSPATTWTSTFGVILFAFIVLYYLIRWQRQYVDFPSTN 646

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF----- 346
           P +   F+  G   + GW LH++PF IMGRVTY+HHY PALYF+ML+  + ++ F     
Sbjct: 647 PHKLKLFVMGGIYPMFGWGLHFLPFAIMGRVTYVHHYVPALYFAMLVFCYEVESFASRLN 706

Query: 347 TVSCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           T +  P +K +   IY SL+ +V   FWYF+ +++G+  P  + K  K L +W + D
Sbjct: 707 TPNASPVSKLLYLAIYISLLSLVAGTFWYFRYLSWGMEGPKEDWKHLKLLESWRVSD 763



>gi|255713082|ref|XP_002552823.1| KLTH0D02266p [Lachancea thermotolerans]
 gi|238934203|emb|CAR22385.1| KLTH0D02266p [Lachancea thermotolerans CBS 6340]
          Length = 740

 Score =  299 bits (765), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 156/408 (38%), Positives = 234/408 (57%), Gaps = 12/408 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-TE 60
           S +++KN   GG LLHSH+  +P GS QQQV+CY H D NN+W+  + R    +    TE
Sbjct: 333 SHVSIKNQALGGSLLHSHVQGFPEGSNQQQVTCYGHKDSNNNWIFDRIRPLPFWTEEETE 392

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E+V  G++             +H I AP++   +EVS YG+ T+GD  D+WV+EVV+  
Sbjct: 393 IEYVVPGESYRLVHPNTGKNLHTHPIPAPISKSAWEVSGYGSATVGDPKDHWVLEVVAQY 452

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++                  +GCYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 453 GSENQSRVHPLTSSFRIKNAELGCYLAQTGESLPEWGFRQSEVACLKNPFKRDKRTWWNI 512

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE+LP     +F   K  F+ NF HLN+ M   NNAL+P+PDK D+++S   QWP 
Sbjct: 513 ESHTNERLP-DRPADFQYPKLNFIKNFIHLNLAMMATNNALVPDPDKLDTLASSAWQWPT 571

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF-SPAEW 295
           L VG+R+  W D+ VK+FL+G+P   W  TA ++ F  L+    +R +R+Y +F SP ++
Sbjct: 572 LNVGIRLCGWGDETVKYFLMGSPASTWPSTAGVLAFMVLVVVLLLRWQRQYADFSSPRDF 631

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPK-- 353
             F+  G   ++GW LH++PF IM RVTY+HHY PALYF++L+  ++ +    + +    
Sbjct: 632 NLFMMGGFYPLLGWGLHFMPFVIMSRVTYVHHYLPALYFALLILCYLFEAGLKNLQKHKG 691

Query: 354 ---TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
               + +I+  Y ++++  F+YF  I+FG+  P+S      W+ TW I
Sbjct: 692 GRLARTLIYFTYGAIVICGFYYFSPISFGLVGPSSNYAYLNWIKTWTI 739



>gi|367017894|ref|XP_003683445.1| hypothetical protein TDEL_0H03750 [Torulaspora delbrueckii]
 gi|359751109|emb|CCE94234.1| hypothetical protein TDEL_0H03750 [Torulaspora delbrueckii]
          Length = 750

 Score =  298 bits (764), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 161/410 (39%), Positives = 232/410 (56%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-TE 60
           S +++KN   GG LLHSH+  YP GS QQQV+ Y   D NN W   + R    YN+  T+
Sbjct: 338 SYVSIKNQALGGSLLHSHVQTYPEGSSQQQVTGYGFKDSNNLWFFDRQRAMPYYNDSETD 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD- 119
           VE++  G               +H IAAPV+   +EVS YG+  LGD+ D+WVIEVV+  
Sbjct: 398 VEYIVAGMAYRLVHNSTQRNLHTHPIAAPVSKSAWEVSGYGDHLLGDEKDHWVIEVVAQY 457

Query: 120 TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            +                + V+ CYL      LPEWGFRQ E+ C K    +D  T WN+
Sbjct: 458 GDEDKSRIHPLTTSFRLKNIVMDCYLAQTGHHLPEWGFRQSEMACVKSPFKRDKRTWWNI 517

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H N+ LP   + NF   K+ F+ +F HLN+ M   NNALIP  DK D+++S   QWP 
Sbjct: 518 ESHENDVLPPRPE-NFRYPKTNFIKDFIHLNLAMMATNNALIPESDKLDNLASAAWQWPT 576

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS-PAEW 295
           L++GLR+  W DD +++FLLGNP+  W  TA++V F  L+    +R +R+Y++ + P + 
Sbjct: 577 LDLGLRLCGWGDDNIRYFLLGNPLSTWPSTAAVVAFGALVVVLLLRWQRQYVDLANPQDA 636

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSC 350
             FL  G   ++ W LH++PF IM RVTY+HHY PALYF++L+  ++ +          C
Sbjct: 637 SVFLIGGIFPMLAWGLHFMPFVIMSRVTYVHHYLPALYFALLVMCYLFEAGLKGWTKSKC 696

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               +  I+G YY++++  F+YF  I+FG+  P S+ +   WL  W I D
Sbjct: 697 GNVMRVCIYGSYYAIVIGCFFYFSPISFGMEGPVSKYEYLDWLPGWFISD 746



>gi|238881078|gb|EEQ44716.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2 [Candida
           albicans WO-1]
          Length = 769

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/417 (36%), Positives = 243/417 (58%), Gaps = 19/417 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R +  Y+   N 
Sbjct: 350 SVITLKNQGLSGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGQPYYDTSGNT 409

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
           T++E++ +G  +            +H+I APV+   +EV+ YGN T+GD  D W++E++ 
Sbjct: 410 TDIEYIFDGMHVRLMHPQTGRNLHTHDIPAPVSKSEYEVACYGNLTIGDPKDNWIVEIME 469

Query: 119 D-TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
             ++                ++V+ CYL      LP+WGFRQ EV C K    KD  T W
Sbjct: 470 QASDEDKMRLHPLTSSFRLKNEVMNCYLGVTGTTLPQWGFRQGEVVCYKNPFKKDKRTWW 529

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           N+E + N  LP   + +FK   +KF+ +F  LN+ M   NNAL+P+ +K+D ++S   QW
Sbjct: 530 NIENNRNAVLPPAPE-DFKLPKTKFIRDFIQLNLAMMATNNALVPDTEKQDDLASSFWQW 588

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---S 291
           P L VG+RM  W  +  K++++G+P   W+ T  ++LF  ++ +Y +R +R+Y++F   +
Sbjct: 589 PTLNVGIRMCGWGPENPKYYMIGSPATTWTSTVGVILFAFIVLYYLIRWQRQYVDFPSTN 648

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--- 348
           P +   FL  G   + GW LH++PF IMGRVTY+HHY PALYF+ML+  + ++ F+    
Sbjct: 649 PHKLKLFLMGGIYPMFGWGLHFLPFAIMGRVTYVHHYVPALYFAMLVFCYEVESFSSRLN 708

Query: 349 --SCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             +  P +K +   IY  L+ +V   FWYF+ +++G+  P  + K  K L +W + D
Sbjct: 709 KPNASPVSKLLYLAIYIGLLSLVAGTFWYFRYLSWGMEGPKEDWKHLKLLESWRVSD 765



>gi|68472223|ref|XP_719907.1| hypothetical protein CaO19.6812 [Candida albicans SC5314]
 gi|68472458|ref|XP_719790.1| hypothetical protein CaO19.14104 [Candida albicans SC5314]
 gi|46441623|gb|EAL00919.1| hypothetical protein CaO19.14104 [Candida albicans SC5314]
 gi|46441749|gb|EAL01044.1| hypothetical protein CaO19.6812 [Candida albicans SC5314]
          Length = 769

 Score =  297 bits (761), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 154/417 (36%), Positives = 242/417 (58%), Gaps = 19/417 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R +  Y+   N 
Sbjct: 350 SVITLKNQGLSGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGQPYYDTSGNT 409

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
           T++E++ +G  +            +H+I APV+   +EV+ YGN T+GD  D W +E++ 
Sbjct: 410 TDIEYIFDGMHVRLMHPQTGRNLHTHDIPAPVSKSEYEVACYGNLTIGDPKDNWTVEIME 469

Query: 119 D-TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
             ++                ++V+ CYL      LP+WGFRQ EV C K    KD  T W
Sbjct: 470 QASDEDKMRLHPLTSSFRLKNEVMNCYLGVTGTTLPQWGFRQGEVVCYKNPFKKDKRTWW 529

Query: 178 NVERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQW 234
           N+E + N  LP   + +FK   +KF+ +F  LN+ M   NNAL+P+ +K+D ++S   QW
Sbjct: 530 NIENNRNAVLPPAPE-DFKLPKTKFIRDFIQLNLAMMATNNALVPDTEKQDDLASSFWQW 588

Query: 235 PILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---S 291
           P L VG+RM  W  +  K++++G+P   W+ T  ++LF  ++ +Y +R +R+Y++F   +
Sbjct: 589 PTLNVGIRMCGWGPENPKYYMIGSPATTWTSTVGVILFAFIVLYYLIRWQRQYVDFPSTN 648

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--- 348
           P +   FL  G   + GW LH++PF IMGRVTY+HHY PALYF+ML+  + ++ F+    
Sbjct: 649 PHKLKLFLMGGIYPMFGWGLHFLPFAIMGRVTYVHHYVPALYFAMLVFCYEVESFSSRLN 708

Query: 349 --SCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             +  P +K +   IY  L+ +V   FWYF+ +++G+  P  + K  K L +W + D
Sbjct: 709 KPNASPVSKLLYLAIYIGLLSLVAGTFWYFRYLSWGMEGPKEDWKHLKLLESWRVSD 765



>gi|294658242|ref|XP_460573.2| DEHA2F04840p [Debaryomyces hansenii CBS767]
 gi|202952983|emb|CAG88897.2| DEHA2F04840p [Debaryomyces hansenii CBS767]
          Length = 765

 Score =  296 bits (759), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 153/413 (37%), Positives = 236/413 (57%), Gaps = 15/413 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNN--IT 59
           S +TLKN G  GGLLHSHI  +P GS+QQQV+ Y H D NN+W+  + R  + Y+     
Sbjct: 351 SVVTLKNQGLTGGLLHSHIQTFPEGSKQQQVTTYTHKDTNNNWVFQRARGMEPYDTEKSQ 410

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++++V +G  +            +H I AP++   +EV+ YGN TLGD  D WV+E++  
Sbjct: 411 DIDYVLDGMVVRLVHPMTGRNLHTHNIPAPISKSEWEVAGYGNLTLGDYKDNWVVEIMEQ 470

Query: 120 TNTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +                  + CYL  +   LP WGFRQ EV C +    KD  T WN
Sbjct: 471 NGEEDKLRLHPLTSSFRLRNTELDCYLGVSGNNLPAWGFRQGEVACYQNPFKKDKRTWWN 530

Query: 179 VERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           +E + N+ LP  S  +FK   ++FL +F  LN+ M   NNAL+P+ DK+D ++S   QWP
Sbjct: 531 IENNANKLLP-PSPPDFKLPKTRFLKDFIQLNLAMMATNNALVPDHDKQDDLASSAWQWP 589

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
            L  G+RM  WADDK+K+FL+G+P   W  +  ++LF  ++ +Y +R +R+Y +F   + 
Sbjct: 590 TLHTGIRMCSWADDKIKYFLIGSPATTWPSSIGVILFAFIVLFYLIRWQRQYNDFPDQQK 649

Query: 296 IHFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT 354
           +    +G I  + GW LH++PF IMGRVTY+HHY PALYF+M++  + ++ FT+  +  +
Sbjct: 650 LKLFTMGGIYPMFGWGLHFMPFIIMGRVTYVHHYVPALYFAMMIFCYELELFTLPLRNSS 709

Query: 355 KNI-------IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             I       IF  +Y++++  FWY++ ++FGI  P  +      L +W I +
Sbjct: 710 SAISKLAYALIFAAWYAIVIGTFWYWRHVSFGIEGPKEDWTHLDLLPSWRIAN 762



>gi|238597974|ref|XP_002394480.1| hypothetical protein MPER_05625 [Moniliophthora perniciosa FA553]
 gi|215463566|gb|EEB95410.1| hypothetical protein MPER_05625 [Moniliophthora perniciosa FA553]
          Length = 364

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 147/333 (44%), Positives = 195/333 (58%), Gaps = 41/333 (12%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM------ 54
           GS++TLKN G+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW ++   +E M      
Sbjct: 4   GSKITLKNTGWGGGLLHSHVQTYPTGSTQQQVTCYHYKDENNDWYVMPTWEEYMPAPSSH 63

Query: 55  ------YNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDD 108
                     + + F+ + D I            SH + APV+   +EV+ YGN T+GD 
Sbjct: 64  TPVFDPLAPESPLRFLKHNDVIRLRHAPTTRNLHSHPVPAPVSKQFWEVAGYGNATIGDV 123

Query: 109 NDYWVIEVVSDTN---------------------------TKXXXXXXXXXXXXXXHKVI 141
            DYWV+EVV D                              K              H+V+
Sbjct: 124 QDYWVVEVVDDVMRGDITKKPKHPTYDEDDERVGSQDKRVAKENRIHSLTTKLRFRHQVL 183

Query: 142 GCYLRSANRVLPEWGFRQIEVTC--DKRNNAKDIYTHWNVERHWNEKLPLGSKVNFKSKF 199
           GCYLR+AN VLP+WGF+QIEVTC  + R + KD  T+WNVE H NE+LP   +    S F
Sbjct: 184 GCYLRAANAVLPQWGFKQIEVTCVPNDRTSRKDKTTYWNVESHSNERLPAADRSRRSSPF 243

Query: 200 LHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNP 259
           L++FWHLNV M T NNALIP+PDKED ++S P  WP + +GLRM  W+D ++K++LLGNP
Sbjct: 244 LYDFWHLNVAMMTSNNALIPDPDKEDILASKPFDWPFMHLGLRMCGWSDQQIKYYLLGNP 303

Query: 260 IVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSP 292
           IVWW GT SL+ F  +  WY+VR++R+Y +F P
Sbjct: 304 IVWWGGTCSLIAFLVVSAWYTVRRQRQYRDFDP 336



>gi|259149797|emb|CAY86601.1| Pmt3p [Saccharomyces cerevisiae EC1118]
          Length = 753

 Score =  294 bits (753), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 154/409 (37%), Positives = 227/409 (55%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+V  
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +               + ++GCYL  + + LPEWGFRQ EV C K  + +D  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE+LP G    + K+ F  NF HLN  M   NNAL+PNP+K D I+S   QWP L
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMHLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E  
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+      ++ WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|19115047|ref|NP_594135.1| protein O-mannosyltransferase Ogm2 [Schizosaccharomyces pombe
           972h-]
 gi|74638359|sp|Q9C100.1|PMT2_SCHPO RecName: Full=Dolichyl-phosphate-mannose--protein
           mannosyltransferase 2
 gi|13624764|emb|CAC36926.1| protein O-mannosyltransferase Ogm2 [Schizosaccharomyces pombe]
          Length = 739

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 158/404 (39%), Positives = 230/404 (56%), Gaps = 6/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLK+    G LLHSH+  YP GSEQQQV+ YHH D NN+WM + P     YN   E
Sbjct: 338 GSKFTLKSRNPTGALLHSHVQTYPEGSEQQQVTGYHHKDGNNEWMFV-PTHGVAYN-YEE 395

Query: 61  VEFVN---NGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVV 117
            + +N   NG  +            +H+I AP+    +EVS YG   +GD+ DYW++ ++
Sbjct: 396 NDPMNPILNGSVVRLIHPFTNRNLHTHKIPAPLNKRMYEVSGYGLGDVGDEKDYWIVNIL 455

Query: 118 SDTNTKXXXXXXXXXXXXXXHK-VIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTH 176
            DT  +              +  V+GCYL S++  LP WGF QIE+ CD   +  +  T 
Sbjct: 456 YDTAHRDAYNVRSLSTVFQLYNPVVGCYLSSSSSSLPSWGFGQIEMYCDPDPDPSNTDTQ 515

Query: 177 WNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           WNVE H N +LP GS  ++ S F  +F HLN  M   NN LIP+ DK D++ S   QWP 
Sbjct: 516 WNVEEHINPRLPEGSINDYPSSFWSDFLHLNRAMLRANNGLIPDEDKLDALRSEAYQWPF 575

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L   LRM  W D+++K+ L+GNP+ +W  T+SL++F   +    +  +R+ + +S     
Sbjct: 576 LLATLRMCGWGDNQIKYLLVGNPVAYWFATSSLIVFALFVVGAVLAWRRRVLRWSQEACD 635

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            F Y G    +GW  +Y+P++IMGRV Y+HHY P+   S   AAF++D FT       + 
Sbjct: 636 TFHYAGIYPFLGWFFNYLPYYIMGRVLYVHHYEPSYALSTFTAAFVVDWFTKKMPKIVRV 695

Query: 357 IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           ++F   Y++I  VF YFKD+ FG++ PAS+    +WL++WN+ D
Sbjct: 696 VVFISLYAIIAGVFIYFKDVTFGMHGPASDFHRLRWLNSWNVHD 739



>gi|45185976|ref|NP_983692.1| ACR290Wp [Ashbya gossypii ATCC 10895]
 gi|44981766|gb|AAS51516.1| ACR290Wp [Ashbya gossypii ATCC 10895]
 gi|374106899|gb|AEY95808.1| FACR290Wp [Ashbya gossypii FDAG1]
          Length = 755

 Score =  293 bits (751), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 159/410 (38%), Positives = 234/410 (57%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSH+  YP GS QQQV+ Y HND NN+W+  + R    ++ N TE
Sbjct: 346 SLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETE 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
            EFV +G               +H I APV+  H+EVS YG+  +GD  D W+IE VS  
Sbjct: 406 HEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQP 465

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
           + +                V +GCYL      LPEWGFRQ EV C      +D  T WN+
Sbjct: 466 SDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNI 525

Query: 180 ERHWNEKLP-LGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           E + NE+LP +     + K+ F  +F HLN+ M   NNAL+P+PDK D ++S   QWP L
Sbjct: 526 ETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTL 585

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
            VG+R+  WADD  K+FL+G+P   W  TA++ +F  +  +Y ++ +R+ + F  ++  +
Sbjct: 586 NVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDAN 645

Query: 298 FLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
              +G I  ++GW LHY+PF +MGRVTY+HHY PALYF++L+ A++ +    + +   K+
Sbjct: 646 IFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKS 705

Query: 357 -------IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                  +++ +YY  I+  F+YF  I  G+  P+S  K   WL TW+I 
Sbjct: 706 YWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPSSNYKHLNWLKTWSIA 755



>gi|363755572|ref|XP_003648001.1| hypothetical protein Ecym_7356 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356892037|gb|AET41184.1| hypothetical protein Ecym_7356 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 751

 Score =  293 bits (750), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 154/409 (37%), Positives = 231/409 (56%), Gaps = 11/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GS QQQ++CY H D NN+W   + R    +N    T
Sbjct: 343 SVVSIKNQALGGSLLHSHVQTFPEGSNQQQITCYGHKDSNNNWKFDRMRGLDPWNESVDT 402

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           + EFV +                SH+I AP+TN ++EVS YGN  +GD  D WVIE V  
Sbjct: 403 DPEFVQDNHVYRLVHINTLRNLHSHQIRAPITNSYWEVSGYGNNEIGDPKDNWVIEFVDQ 462

Query: 120 -TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
            T                 H  + CYL      LPEWGFRQ EV C      +D  T WN
Sbjct: 463 PTEENKTVLHTLSTSFRIRHSEMNCYLAQTGAHLPEWGFRQAEVACVPNPFKRDKRTWWN 522

Query: 179 VERHWNEKLPLGSK-VNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           VE H N+KLP   +   F K+KF+ +F HLN+ M   NNAL+P+PDK D ++S   QWP 
Sbjct: 523 VETHENDKLPARPEGFRFPKTKFIKDFIHLNLAMMATNNALVPDPDKLDVLASSAWQWPS 582

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L VG+R+  W+D+ V++FL+G+P   W  T ++++   ++ +Y +R +R+ + F   +  
Sbjct: 583 LNVGIRLCGWSDELVRYFLMGSPASTWPSTFAVIILISMVIYYLLRWQRQCVIFQSHQDA 642

Query: 297 HFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT- 354
           +   +G +  ++GW LH++PF IMGRVTY+HHY PALYF++L  +++ +    S K  + 
Sbjct: 643 NLFLVGALYPLLGWALHFLPFVIMGRVTYVHHYLPALYFALLGLSYLFEAGMQSWKKSSY 702

Query: 355 ----KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
               +  ++G+YY +++  F+YF  I+ G++ P  + +    L TW I 
Sbjct: 703 GRLARIGVYGLYYFIVIYGFYYFFPISAGMSGPVKDFEYLNLLKTWTIA 751



>gi|448099446|ref|XP_004199151.1| Piso0_002564 [Millerozyma farinosa CBS 7064]
 gi|359380573|emb|CCE82814.1| Piso0_002564 [Millerozyma farinosa CBS 7064]
          Length = 765

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/415 (36%), Positives = 236/415 (56%), Gaps = 17/415 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT-- 59
           S +TLK+ G  GGLLHSHI  +P GS+QQQV+ Y H D NN W+  + R    Y+  T  
Sbjct: 348 SVVTLKSQGLTGGLLHSHIQTFPDGSKQQQVTTYSHKDANNHWIFQRARGLPNYDAETSQ 407

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++E++ +G  +            +H IAAP++   +EV+ YGN T+GD  D W++EV+  
Sbjct: 408 DIEYIIDGMEVRLVHPLTGRNLHTHTIAAPLSKSEYEVACYGNLTIGDYKDNWIVEVLDQ 467

Query: 120 TNTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +                  +GCYL  + + LP WGFRQ EV C K    KD  T WN
Sbjct: 468 QGDEDKLRLHPLTTSFRLKNAELGCYLGVSGQALPPWGFRQGEVVCYKDPFRKDKRTWWN 527

Query: 179 VERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           VE + N+ LP  +  +FK   ++F  +F  +N+ M   NNAL+P  DK+D ++S   QWP
Sbjct: 528 VENNENKILP-PAPADFKLPKTRFWKDFIQINLAMMATNNALLPETDKQDDLASSAWQWP 586

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---SP 292
            L  G+RM  WADD  K+FL+G+    W+ + +L++F  ++ +Y +R +R++ +F    P
Sbjct: 587 TLHSGIRMCTWADDTPKYFLIGSISTTWTSSVALIIFMFVVLYYLIRWQRQFNDFPASDP 646

Query: 293 AEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV---- 348
            ++  F+  G   ++GW LH+ PF IMGR+TY+HHY PALYF+M +  ++++ FT     
Sbjct: 647 KKFDLFIIGGVYPLLGWFLHFFPFVIMGRITYVHHYLPALYFAMFVLCYLLELFTSPLTK 706

Query: 349 SCKPKTK---NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           S KP  K    +I+ ++Y+ ++ VFW ++ IAFG+  P         L +W I +
Sbjct: 707 STKPSAKLTYALIYAVWYAFVIGVFWRWRHIAFGLIGPKENYAHLDLLPSWRIAN 761



>gi|6324897|ref|NP_014966.1| Pmt3p [Saccharomyces cerevisiae S288c]
 gi|308153474|sp|P47190.2|PMT3_YEAST RecName: Full=Dolichyl-phosphate-mannose--protein
           mannosyltransferase 3
 gi|940852|emb|CAA62176.1| orf 06148 [Saccharomyces cerevisiae]
 gi|1420704|emb|CAA99641.1| PMT3 [Saccharomyces cerevisiae]
 gi|285815192|tpg|DAA11085.1| TPA: Pmt3p [Saccharomyces cerevisiae S288c]
 gi|392296650|gb|EIW07752.1| Pmt3p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 753

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 226/409 (55%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+V  
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +               + ++GCYL  + + LPEWGFRQ EV C K  + +D  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE+LP G    + K+ F  NF  LN  M   NNAL+PNP+K D I+S   QWP L
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E  
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+      ++ WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|349581471|dbj|GAA26629.1| K7_Pmt3p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 753

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 226/409 (55%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+V  
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +               + ++GCYL  + + LPEWGFRQ EV C K  + +D  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE+LP G    + K+ F  NF  LN  M   NNAL+PNP+K D I+S   QWP L
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E  
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+      ++ WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVEDYAYLAWLPTWQIVE 748



>gi|256272582|gb|EEU07561.1| Pmt3p [Saccharomyces cerevisiae JAY291]
          Length = 753

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 226/409 (55%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+V  
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +               + ++GCYL  + + LPEWGFRQ EV C K  + +D  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE+LP G    + K+ F  NF  LN  M   NNAL+PNP+K D I+S   QWP L
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E  
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+      ++ WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|151945401|gb|EDN63644.1| dolichyl phosphate-D-mannose:protein O-D-mannosyltransferase
           [Saccharomyces cerevisiae YJM789]
 gi|323303015|gb|EGA56819.1| Pmt3p [Saccharomyces cerevisiae FostersB]
          Length = 753

 Score =  291 bits (746), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 226/409 (55%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+V  
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +               + ++GCYL  + + LPEWGFRQ EV C K  + +D  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE+LP G    + K+ F  NF  LN  M   NNAL+PNP+K D I+S   QWP L
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E  
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+      ++ WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|323346365|gb|EGA80654.1| Pmt3p [Saccharomyces cerevisiae Lalvin QA23]
 gi|365762978|gb|EHN04510.1| Pmt3p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 753

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 226/409 (55%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+V  
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +               + ++GCYL  + + LPEWGFRQ EV C K  + +D  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE+LP G    + K+ F  NF  LN  M   NNAL+PNP+K D I+S   QWP L
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMXLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E  
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+      ++ WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|633652|emb|CAA58728.1| PMT3 [Saccharomyces cerevisiae]
          Length = 753

 Score =  290 bits (741), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 152/409 (37%), Positives = 226/409 (55%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAHNK 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+V  
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +               + ++GCYL  + + LPEWGFRQ EV C K  + +D  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE+LP G    + K+ F  NF  LN  M   NNAL+PNP+K + I+S   QWP L
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFNGIASSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E  
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+      ++ WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|323307268|gb|EGA60549.1| Pmt3p [Saccharomyces cerevisiae FostersO]
          Length = 753

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 152/409 (37%), Positives = 225/409 (55%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQSFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            +EFV  G+              +HE+ A ++   +EVSAYG+  LGD  D W+IE+V  
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPASISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +               + ++GCYL  + + LPEWGFRQ EV C K  + +D  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE+LP G    + K+ F  NF  LN  M   NNAL+PNP+K D I+S   QWP L
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E  
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+      ++ WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVEDYAYLAWLPTWQIVE 748



>gi|448103305|ref|XP_004200004.1| Piso0_002564 [Millerozyma farinosa CBS 7064]
 gi|359381426|emb|CCE81885.1| Piso0_002564 [Millerozyma farinosa CBS 7064]
          Length = 765

 Score =  288 bits (736), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 151/415 (36%), Positives = 234/415 (56%), Gaps = 17/415 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT-- 59
           S +TLK+ G  GGLLHSH+  +P GS+QQQV+ Y H D NN W+  + R    Y+  T  
Sbjct: 348 SVVTLKSQGLTGGLLHSHVQTFPEGSKQQQVTTYSHKDANNHWIFQRARGLPNYDTETSQ 407

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           ++E++ +G  +            +H IAAP++   +EV+ YGN T+GD  D W++EVV  
Sbjct: 408 DIEYIIDGMEVRLVHPLTGRNLHTHSIAAPLSKSEYEVACYGNLTIGDYKDNWIVEVVDQ 467

Query: 120 TNTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +                  +GCYL  +   LP WGFRQ EV C K    KD  T WN
Sbjct: 468 QGDEDKLRLHPLTTSFRLKNAELGCYLGVSGHALPPWGFRQGEVVCYKDPFRKDKRTWWN 527

Query: 179 VERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWP 235
           +E + N+ LP  +  +FK   ++F  +F  +N+ M   NNAL+P  DK+D ++S   QWP
Sbjct: 528 IENNENKILP-PAPADFKLPKTRFWKDFIQINLAMMATNNALLPETDKQDDLASSAWQWP 586

Query: 236 ILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF---SP 292
            L  G+RM  WADD  K+FL+G+    W+ + +L++F  ++ +Y +R +R++ +F    P
Sbjct: 587 TLHSGIRMCTWADDIPKYFLIGSISTTWTSSVALIIFMFVVLYYLIRWQRQFNDFPASEP 646

Query: 293 AEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV---- 348
            ++  F+  G   ++GW LH+ PF IMGR+TY+HHY PALYF+M +  ++++ FT     
Sbjct: 647 KKFDLFIIGGVYPLLGWFLHFFPFVIMGRITYVHHYLPALYFAMFVLCYLLELFTSPLTK 706

Query: 349 SCKPKTK---NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           S KP  K    +I+  +Y+ ++ VFW ++ I+FG+  P         L +W I +
Sbjct: 707 STKPSAKLTYALIYAAWYAFVIGVFWRWRHISFGLIGPKENYSHLDLLPSWRIAN 761



>gi|410078638|ref|XP_003956900.1| hypothetical protein KAFR_0D01190 [Kazachstania africana CBS 2517]
 gi|372463485|emb|CCF57765.1| hypothetical protein KAFR_0D01190 [Kazachstania africana CBS 2517]
          Length = 753

 Score =  287 bits (735), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 159/410 (38%), Positives = 228/410 (55%), Gaps = 13/410 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK--EQMYN--- 56
           S L++KN   GG LLHSH+  +P GS+QQQV+CY ++D NNDW    PR   E+ Y    
Sbjct: 339 SILSIKNQALGGSLLHSHVQTFPEGSKQQQVTCYGYSDSNNDWFFDLPRALTEKGYRKEE 398

Query: 57  NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEV 116
           N T +E++                  +H + APVT   +EVSAYG+  +GD +D W+IE+
Sbjct: 399 NDTNIEYIEADGIYRLVHKNTGRNLHTHPVQAPVTKSEWEVSAYGDANIGDAHDDWLIEI 458

Query: 117 VSDTNTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYT 175
           V    ++                V +GCYL      LPEWGFRQ EV C K    +D  T
Sbjct: 459 VDQRGSENKTRLHPLTSSFRIKSVQLGCYLAQTGNHLPEWGFRQSEVACLKNPFKRDKRT 518

Query: 176 HWNVERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPI 232
            WN+E H N  LP     +F   K+ FL +F HLN+ M   NNALIP+ +K D++ S   
Sbjct: 519 WWNIETHENSLLPPRPD-DFEYPKTNFLKDFIHLNLAMMATNNALIPDSEKFDTLGSSAW 577

Query: 233 QWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSP 292
           +WP L VGLRM  W D+ +K++LLG P   W+ T +++     +    +R  R+ I F  
Sbjct: 578 EWPSLHVGLRMCGWGDENIKYYLLGTPASTWASTIAVLGCMVTVVVLFLRWNRQMINFKS 637

Query: 293 AEWIHFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC- 350
            + ++   +G    ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D F   C 
Sbjct: 638 NKDLNTFMMGAFYPLLCWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYAFDAFLQLCN 697

Query: 351 -KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            +   K +IF  Y++ +V  F+YF  I+FG+  P S+ +   WLS+W IV
Sbjct: 698 MRAPIKWLIFISYFAAVVACFYYFSPISFGMVGPISDYEYLNWLSSWTIV 747



>gi|254581354|ref|XP_002496662.1| ZYRO0D05258p [Zygosaccharomyces rouxii]
 gi|238939554|emb|CAR27729.1| ZYRO0D05258p [Zygosaccharomyces rouxii]
          Length = 750

 Score =  286 bits (732), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 160/410 (39%), Positives = 223/410 (54%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           SR+ +KN   GG LLHSHI  +P GS QQQV+CY   D NN W   +PR    YN N T+
Sbjct: 337 SRVAIKNQALGGSLLHSHIQAFPEGSNQQQVTCYGFKDANNLWQFDRPRGLPGYNENETD 396

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +EF+                  +H I AP++   +EVS YGN  +GD  D WVIEV+   
Sbjct: 397 IEFITQDTEYRLVHISTGRNLHTHPIPAPISRQAWEVSGYGNAEIGDVKDNWVIEVMDQR 456

Query: 121 NTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +               + V+ CYL    + LPEWGFRQ EV C K    +D  T WNV
Sbjct: 457 GPEDTSKIHPLTTSFRIKNAVLNCYLAQTGQHLPEWGFRQSEVACVKDPFRRDKRTWWNV 516

Query: 180 ERHWNEKLPL---GSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE LP    G K   K+ F  +F HLN+ M   NNALIP  DK D ++S   QWP 
Sbjct: 517 ETHENELLPPRPEGFKFP-KTNFFKDFIHLNLAMMATNNALIPENDKLDYLTSAAWQWPS 575

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS-PAEW 295
           L +GLR+  W+DD +++FLLG PI  W+ TA++ +F  L     +R +R+Y + + P ++
Sbjct: 576 LNIGLRLCGWSDDNIRYFLLGTPISTWASTAAVGIFAVLFVLLVLRWQRQYNDLNKPGDF 635

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS-CKPKT 354
             FL  G   ++ W  H++PF IM RVTY HHY PALYF++++ +++ D    S    KT
Sbjct: 636 NLFLIGGVFPMLAWGTHFVPFLIMSRVTYAHHYLPALYFALIVLSYIFDAGLKSWSVTKT 695

Query: 355 KNIIFGIYYSL----IVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             ++    Y+L    ++  F+Y+  I+FG+    S+ +   WL  W I D
Sbjct: 696 NQVLRLAIYALFGISVIACFFYYGPISFGMEGAISDFQYLDWLPRWYISD 745



>gi|365989682|ref|XP_003671671.1| hypothetical protein NDAI_0H02540 [Naumovozyma dairenensis CBS 421]
 gi|343770444|emb|CCD26428.1| hypothetical protein NDAI_0H02540 [Naumovozyma dairenensis CBS 421]
          Length = 757

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 154/411 (37%), Positives = 223/411 (54%), Gaps = 16/411 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSH+  YP GS QQQV+ Y + D NN+W   + R    +N N T+
Sbjct: 346 STVSIKNQALGGALLHSHVQGYPEGSHQQQVTAYSYKDPNNEWFFDRARGLPNWNENETD 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           VEFV    T             SH +AAP++   +EVS YG+  +GD  D W+IEVV   
Sbjct: 406 VEFVLAESTYRLVHKSTGKSLHSHPVAAPISKTQWEVSGYGDAEIGDQRDNWIIEVVDQR 465

Query: 121 NTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
            ++               H  + CYL      LPEWGF+Q+EV C K    +D  T WN+
Sbjct: 466 GSENTTKLHPLTTSFRLYHPDMDCYLAQTGSQLPEWGFKQLEVACMKNPFKRDKRTWWNI 525

Query: 180 ERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H N  LP   + +FK   + F  +F HLN+ M   NNAL+P+ DK D ++S   QWP 
Sbjct: 526 ETHENSVLPPRPE-DFKYPRTNFFKDFIHLNLAMMATNNALVPDADKYDLLASSAWQWPT 584

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLR+  W +D VK+FLLG P+  W+ + +++     +    +R +R+Y +   A  +
Sbjct: 585 LYLGLRICGWGNDTVKYFLLGTPVSTWASSVAIIGLMAFIVILLLRWQRQYTDLRNANDL 644

Query: 297 H-FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-------FTV 348
           + FL  G   ++GW LHY PF IM RVTY+HHY PALYF++++  +++D          +
Sbjct: 645 NTFLMGGFYPLLGWGLHYTPFVIMSRVTYVHHYLPALYFALIILTYVLDASLKRVSGSKL 704

Query: 349 SCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            C  KT  + +   ++ ++  FWYF  I+FG+  P        WL TWNI 
Sbjct: 705 GCLVKT--VAYLTAFTSVIGCFWYFSPISFGMEGPKENYAYLNWLPTWNIA 753



>gi|365758212|gb|EHN00065.1| Pmt3p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 753

 Score =  283 bits (723), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 152/409 (37%), Positives = 222/409 (54%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GS QQQV+ Y ++D NN+W   + R  + + +   +
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSGQQQVTGYGYSDANNEWFFQRIRGVEPWTDAENS 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
             EFV  G+T             +HE+ APV+   +EVSAYG+  +GD  D W+IE+V  
Sbjct: 400 TFEFVKGGETYRLMHRLTGKNLHTHEVPAPVSKSEYEVSAYGDVDVGDHKDNWIIEIVEQ 459

Query: 120 TNTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
              +               + ++GCYL  + + LPEWGFRQ E+ C K  + +D  T WN
Sbjct: 460 VGKEDPKLLHPLSTSFRIRNSMLGCYLAQSGKRLPEWGFRQGEMICLKHASKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE LP      + K+ FL NF  LN  M   NNAL+PNP+K D I+S   QWP L
Sbjct: 520 IETHENEGLPEADDFVYPKASFLRNFIQLNSAMMATNNALVPNPEKVDGIASSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  VK+FLLG+P  VW S  A   L   ++F     Q++  +   PAE  
Sbjct: 580 NVGVRLCEWSEKSVKYFLLGSPASVWPSSIAVCALIIHVIFLILKWQRQCVVLPEPAERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F       ++ W+LHY+PF IM RV Y HHY P L+F++++ ++  D  T   + +   
Sbjct: 640 EFFMAAFYPLLAWVLHYLPFVIMSRVVYAHHYLPTLFFALMILSYYFDLITKRWASRNTG 699

Query: 355 KNIIFGIYY---SLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K + F  Y    SL++  F+YF   +FG+  P  +     WL TW I +
Sbjct: 700 KLLRFSAYIAYGSLVIAGFFYFSPFSFGMEGPIEDYSYLGWLPTWKIAE 748



>gi|403218180|emb|CCK72671.1| hypothetical protein KNAG_0L00480 [Kazachstania naganishii CBS
           8797]
          Length = 749

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/412 (38%), Positives = 226/412 (54%), Gaps = 14/412 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-TE 60
           S +++KN   GG LLHSH+  YP GS QQQV+CY ++D NNDW+  + R    +NN  T+
Sbjct: 334 STISIKNQALGGALLHSHVQTYPEGSTQQQVTCYSYSDANNDWIFQRTRDLPAWNNEETD 393

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E+V N  T             +H ++APV+   +EVSAYG + +GD  DYWVIE++   
Sbjct: 394 IEYVQNEQTYRLVHKNTGKNLHTHPVSAPVSKNDYEVSAYGTDEIGDPFDYWVIEIMDQV 453

Query: 121 NTKXXXXXXXXXXXXXXH-KVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                K IGCYL      LPEWGFRQ EV C K    +D  T WN+
Sbjct: 454 GDEDKNKLHPLTTSFRIRSKEIGCYLAQTGSSLPEWGFRQSEVACVKNPFRRDKRTWWNI 513

Query: 180 ERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E + N+ LP   + NF   ++ FL +F HLN+ M   NNALIP+ +K D ++S   QWP 
Sbjct: 514 ETNENDILPPRPE-NFEYPRTGFLKDFVHLNLAMMATNNALIPDEEKFDHLASSAWQWPT 572

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLR+  W DD VK++LLG P   W  T +++     +    +R  R+   F   +  
Sbjct: 573 LNIGLRLCGWDDDFVKYYLLGLPFSTWPSTVAVLAMMVTVVVLFLRWMRQLPVFHTNDDE 632

Query: 297 H-FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFT---VSC-- 350
           + FL  G   ++ W LHY+PF IM RVTY+HHY PALYF++++ A+  D      V C  
Sbjct: 633 NVFLMGGLYPLLAWGLHYVPFVIMSRVTYVHHYLPALYFALIILAYYFDVLLKAHVQCVA 692

Query: 351 --KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               K +  I+  Y+ + +  F++F  I+FG++ P S      WL  W+I D
Sbjct: 693 RIPSKLRVAIYVSYFVIFLAGFYWFSPISFGMDGPNSNYAYLNWLPKWSIAD 744



>gi|254574224|ref|XP_002494221.1| Protein O-mannosyltransferase, transfers mannose from dolichyl
           phosphate-D-mannose [Komagataella pastoris GS115]
 gi|238034020|emb|CAY72042.1| Protein O-mannosyltransferase, transfers mannose from dolichyl
           phosphate-D-mannose [Komagataella pastoris GS115]
 gi|328353958|emb|CCA40355.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Komagataella pastoris CBS 7435]
          Length = 752

 Score =  282 bits (721), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 149/418 (35%), Positives = 221/418 (52%), Gaps = 19/418 (4%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI----LKPRKEQMYN 56
           GS LT+++ G    LLHSH + YP GS QQQV+ Y H D NN W++    L  ++ +  +
Sbjct: 335 GSELTIRSQGLSQNLLHSHGSIYPEGSNQQQVTTYGHRDNNNQWIVHYPVLSKKQVKEND 394

Query: 57  NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEV 116
           N T  E + +GDTI            SH I A V+  ++EVS YGN  + D ND WV+EV
Sbjct: 395 NSTVPEMMKDGDTIRLRHQHTGANLHSHRIQAHVSKQYYEVSCYGNAKVSDGNDEWVVEV 454

Query: 117 VSDTNTKXXXXXXX--------------XXXXXXXHKVIGCYLRSANRVLPEWGFRQIEV 162
               ++                             HK IGCYL +     P WGF+Q EV
Sbjct: 455 AEQIHSDDPKYAAANESDLKFQELLHPISTSFRLRHKRIGCYLATTGMAYPSWGFKQGEV 514

Query: 163 TCDKRNNAKDIYTHWNVERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNP 221
            C     ++D  T WN+E H N+KLP  +     KS F  +F  LN  M   NNAL+P+P
Sbjct: 515 VCRPSWTSRDKSTWWNIEDHKNKKLPNATSYKAPKSYFWRDFVMLNYAMLASNNALVPDP 574

Query: 222 DKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSV 281
           DK D ++S   QWPI+ VGLRM  W+  + ++FL+ +P   W  TASL +F  ++    +
Sbjct: 575 DKFDKLASQWWQWPIINVGLRMCGWSASQSRYFLMSSPFNTWLSTASLAVFCLIVLILVL 634

Query: 282 RQKRKYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAF 341
           + +R+ +  S  ++   +  G +   GW LH+ PF +M RVTY+HHY PALYF+M +  F
Sbjct: 635 QWQRQRLNLSSRQYWELVIKGFVPFFGWALHFAPFIVMQRVTYVHHYVPALYFAMFLLGF 694

Query: 342 MMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            +D+ T       K +I+ ++Y+  +  F+YF  ++FG++ P       +W  +W +V
Sbjct: 695 TVDYLTAKRNCYIKTLIYFVFYAGTIYSFYYFSPLSFGMDGPLKNYAYLQWFKSWTMV 752



>gi|344305369|gb|EGW35601.1| hypothetical protein SPAPADRAFT_131790 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 777

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 160/425 (37%), Positives = 216/425 (50%), Gaps = 27/425 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI----------LKPR 50
           GS +TL++ G    LLHSH + YP G ++QQV+ Y + D NN ++I           +  
Sbjct: 353 GSFVTLRSQGLSQNLLHSHPHNYPEGLQEQQVTTYAYKDENNVFLIEFDINAAISGKRAL 412

Query: 51  KEQMYNNITEVE-------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNE 103
            E   NN TE E        + NGD I            ++ I A V   HFEVS +G  
Sbjct: 413 PETSGNNGTETETTIESQQLLQNGDAIRLFHNSTGRYMHANAIPAAVAKTHFEVSCFGTI 472

Query: 104 TLGDDNDYWVIEVVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEW 155
              +  D W++E+ +          N                +K +GCYL +     P W
Sbjct: 473 DTTEIKDEWILEIQTQEESPSQFFANESGHELHPISTNFRLRNKELGCYLATTGYAYPSW 532

Query: 156 GFRQIEVTCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTV 213
           GF Q EV C      +D  T WNVE H N+KLPL S+  V  K KF   F  LN  M T 
Sbjct: 533 GFSQGEVVCKYSYFNRDKSTWWNVEEHVNDKLPLPSETYVPPKPKFWREFVLLNFAMMTS 592

Query: 214 NNALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFF 273
           NNALIP+PD+ D +SS   +WPIL+ GLRM  W  D +KFFL+GNP V W  + SL+LF 
Sbjct: 593 NNALIPDPDRFDKLSSEWWEWPILKTGLRMCSWGADDIKFFLIGNPFVTWFSSLSLILFL 652

Query: 274 CLLFWYSVRQKRKYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALY 333
             L     + +R+ + +    W   L  G +  IGW LHY PF IMGRVTYLHHY PALY
Sbjct: 653 FYLLSVGFKYQRQTVRYEVDSWESLLSQGILPFIGWFLHYFPFIIMGRVTYLHHYVPALY 712

Query: 334 FSMLMAAFMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWL 393
           F++    F++D F      K   +I+G+ Y  ++  FWY + +AFG+   + + K  K L
Sbjct: 713 FAIFTMGFVVDRFATVVPKKISYVIYGLLYIAVIGSFWYLRVLAFGMEQSSKQYKHLKIL 772

Query: 394 STWNI 398
            +W I
Sbjct: 773 DSWMI 777



>gi|254568076|ref|XP_002491148.1| Protein O-mannosyltransferase, transfers mannose residues from
           dolichyl phosphate-D-mannose to prote [Komagataella
           pastoris GS115]
 gi|238030945|emb|CAY68868.1| Protein O-mannosyltransferase, transfers mannose residues from
           dolichyl phosphate-D-mannose to prote [Komagataella
           pastoris GS115]
 gi|328352327|emb|CCA38726.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Komagataella pastoris CBS 7435]
          Length = 750

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 154/423 (36%), Positives = 230/423 (54%), Gaps = 26/423 (6%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S++T+K+ G G GLLHSH+  YP GS QQQ++ Y H D NNDW + +  +E   N   E 
Sbjct: 329 SKVTIKSQGLGSGLLHSHVQTYPQGSSQQQITTYSHKDANNDW-VFQLTREDSRNAFKEA 387

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD-T 120
            +V +G ++            +H++AAPV++  +EVS YGNET+GD  D W++E+V    
Sbjct: 388 HYVVDGMSVRLVHSNTGRNLHTHQVAAPVSSSEWEVSCYGNETIGDPKDNWIVEIVDQYG 447

Query: 121 NTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVE 180
           +                   +GCYL ++   LP+WGFRQ EV C K    +D  T WN+E
Sbjct: 448 DEDKLRLHPLTSSFRLKSATLGCYLGTSGASLPQWGFRQGEVVCYKNPFRRDKRTWWNIE 507

Query: 181 RHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
            H N  LP     NF   ++ FL +F  LN+ M   NNAL+P+PDKED+++S   +WP L
Sbjct: 508 DHNNPDLP-NPPENFVLPRTHFLKDFVQLNLAMMATNNALVPDPDKEDNLASSAWEWPTL 566

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF----SPA 293
            VG+R+  W DD VK+FL+G+P   W+ +  +V+F  LL  Y ++ +R+Y+ F    +P 
Sbjct: 567 HVGIRLCGWGDDNVKYFLIGSPATTWTSSVGIVVFLFLLLIYLIKWQRQYVIFPSVQTPL 626

Query: 294 EWIH---------------FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLM 338
           E                  FL  G   ++GW LH+ PF IM RVTY+HHY PALYF+M++
Sbjct: 627 ESADTKTVALFDKSDSFNVFLMGGLYPLLGWGLHFAPFVIMSRVTYVHHYLPALYFAMIV 686

Query: 339 AAFMMDHFTVSCK-PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
             +++         P    +I+   YSL++  F +   + FG++ P         L +W 
Sbjct: 687 FCYLVSLLDKKLGHPALGLLIYVALYSLVIGTFIWLSPVVFGMDGPNRNYSYLNLLPSWR 746

Query: 398 IVD 400
           + D
Sbjct: 747 VSD 749



>gi|401623527|gb|EJS41624.1| pmt3p [Saccharomyces arboricola H-6]
          Length = 753

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 150/408 (36%), Positives = 214/408 (52%), Gaps = 10/408 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + +      
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGAEPWTEAENA 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
            +E+V  G               +HEI AP++   +EVSAYG+  LGD  D W+IE+   
Sbjct: 400 TLEYVKGGQMYRLMHRLTGKNLHTHEIPAPISKSEYEVSAYGDVKLGDIKDNWIIEITEQ 459

Query: 120 T-NTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             N                + ++GCYL  + + LP+WGFRQ EV C K  + +D  T WN
Sbjct: 460 VGNEDPTLLHPLSTSFRIRNSILGCYLAQSGKHLPDWGFRQGEVACLKHVSKRDKRTWWN 519

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           +E H NE LP  +   + K  F  NF  LN+ M   NNAL+PNP+K D I+S   QWP L
Sbjct: 520 IETHDNELLPQANDFVYPKLSFFRNFVQLNIAMMATNNALVPNPEKFDGITSSAWQWPTL 579

Query: 238 EVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
            VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E  
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVVFLILKWQRQCVILPDPVERD 639

Query: 297 HFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            F       +  W LH++PF IM RV Y HHY P LYF++++  +  D  T     +   
Sbjct: 640 EFSMAACYPLFAWGLHFLPFLIMSRVVYAHHYLPTLYFALMILTYYFDIITKRWASRNAG 699

Query: 357 IIFGI-----YYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            +  I     Y SL++  F+YF   +FG++ P  +     WL TW IV
Sbjct: 700 KLLRISAYVAYGSLVIAGFFYFSPFSFGMDGPVEDYAYLAWLPTWQIV 747



>gi|156837076|ref|XP_001642573.1| hypothetical protein Kpol_316p8 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156113118|gb|EDO14715.1| hypothetical protein Kpol_316p8 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 388

 Score =  276 bits (706), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 216/384 (56%), Gaps = 8/384 (2%)

Query: 23  YPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NITEVEFVNNGDTIXXXXXXXXX 79
           YP GS QQQ++ Y + D NN+W   K R+   YN     +E+EFV +G T          
Sbjct: 1   YPEGSNQQQITGYGYQDDNNNWYFDKVREFPSYNFENPSSEIEFVEDGATYRLVHLLSGK 60

Query: 80  XXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDTNTKXXXXXXXXXXX-XXXH 138
              SH+I APVT + +EV+ YG    GD  DYWV+E+     ++               H
Sbjct: 61  NLHSHQIPAPVTKLDYEVAGYGQLDQGDHFDYWVLEIAEQVGSENATRIHPLTTSFRLRH 120

Query: 139 KVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVERHWNEKLP-LGSKVNF-K 196
           K +GCYL  + + LPEWGFRQ+E+TC K  + KD    WNVE H N++LP +     F +
Sbjct: 121 KELGCYLAQSGQHLPEWGFRQLEMTCMKNVSKKDKRILWNVESHSNDQLPPVPEDFKFPR 180

Query: 197 SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLL 256
            +FL NF HLN+ M   NNALIP+P+K D ISS   +WP L  GLR+  W+D+  K++LL
Sbjct: 181 PRFLTNFIHLNLAMMATNNALIPDPEKHDHISSSWWEWPTLYTGLRLGGWSDEFAKYYLL 240

Query: 257 GNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFLYIGKI-CVIGWLLHYIP 315
           G PI  W+ T +++ F       ++R +R+Y +       +   IG I  ++GW LHY P
Sbjct: 241 GTPITTWASTLAVLAFMLTFVILAIRWQRQYEDLQDKTSRNNFIIGGIYPMLGWGLHYTP 300

Query: 316 FFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK-PKTKNIIFGIYYSLIVIVFWYFK 374
           F IMGRVTYLHHY PALYF++L+  + ++  T   K  K + I++ I  + ++  F  F 
Sbjct: 301 FIIMGRVTYLHHYLPALYFALLVLTYFIETGTSYIKNQKVRWILYIIMMASVIGCFALFS 360

Query: 375 DIAFGINYPASELKSRKWLSTWNI 398
            I+FG+  P+   K   WL TW +
Sbjct: 361 PISFGMVGPSENFKYLDWLPTWKV 384



>gi|255721445|ref|XP_002545657.1| hypothetical protein CTRG_00438 [Candida tropicalis MYA-3404]
 gi|240136146|gb|EER35699.1| hypothetical protein CTRG_00438 [Candida tropicalis MYA-3404]
          Length = 766

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 157/418 (37%), Positives = 221/418 (52%), Gaps = 28/418 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    LLHSH ++YPGGS++QQV+ Y   D NND++I     E + +    
Sbjct: 357 GSLVTMRSQGLSPNLLHSHDHKYPGGSQEQQVTTYGFKDENNDFLIEFDVSEGLKDKHAT 416

Query: 61  VEFVN----------NGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDND 110
           +E  N          NG TI            ++ I AP+T+ +FEVS  G     D  D
Sbjct: 417 LENENGVDYYSIPVPNGATIRINHKKTGCYLRANSITAPITSSNFEVSCSGEVESNDYAD 476

Query: 111 YWVIEVVSDTNTKXXXXXXX--------XXXXXXXHKVIGCYLRSANRVLPEWGFRQIEV 162
            W++E+ +   +                       HK +GCYL +  +  P WG+ Q EV
Sbjct: 477 EWILEIQTQEQSPSEKFHSEDANVLHPISTNFRLKHKQLGCYLATTGKSYPSWGYGQGEV 536

Query: 163 TCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTVNNALIPN 220
            C     ++D  T WNVE+H N+KLP  ++  V  K KF   F  LN GM   N ALIP+
Sbjct: 537 ACKFSFFSRDKNTWWNVEKHVNDKLPTPNEKYVPPKPKFWKEFVLLNYGMMAANGALIPD 596

Query: 221 PDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYS 280
           PDK D +SS   +WP+L  GLRM  W  D +K+FLLGNP++ W  TA + LF    F   
Sbjct: 597 PDKFDKLSSEWWEWPVLHTGLRMCGWGADDIKYFLLGNPLITWLSTAGVALFLVYTFVQG 656

Query: 281 VRQKRKYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAA 340
            R +R+    S AE       G +  +GWL HY+PF  MGRV YLHHY PA YF++ +  
Sbjct: 657 FRYQRQVTSNSLAE-------GGLLFLGWLFHYVPFIFMGRVKYLHHYLPAHYFAIFLFG 709

Query: 341 FMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           F++D  T+S     +  I+ ++Y  I+  FWYFKD++FG+  P+S  K  K L +W I
Sbjct: 710 FVVDK-TISKNIGVRWTIYSLFYIAILASFWYFKDLSFGMEGPSSNYKHLKLLGSWMI 766



>gi|366996587|ref|XP_003678056.1| hypothetical protein NCAS_0I00420 [Naumovozyma castellii CBS 4309]
 gi|342303927|emb|CCC71710.1| hypothetical protein NCAS_0I00420 [Naumovozyma castellii CBS 4309]
          Length = 769

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 155/415 (37%), Positives = 229/415 (55%), Gaps = 19/415 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPR--KEQMYNNIT 59
           S +++KN   GG LLHSH+  +P GS QQQV+ Y +ND NN W   + R    Q ++N T
Sbjct: 355 SFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNET 414

Query: 60  E--VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYG-NETLGDDNDYWVIEV 116
           E  +E+V  G+              + +I APV+   +EV+ +G    +GDD D W+IEV
Sbjct: 415 ETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEV 474

Query: 117 VSDTNTKXXXXXXXXXXXX-XXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYT 175
           +     +               H V+GCYL    + LPEWGFRQ E+TC  + +  D  T
Sbjct: 475 IEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRT 534

Query: 176 HWNVERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPI 232
            WNVE H NEKLP     +F   K+ F  +F  LN  M   NNAL+P+ DK DS++S   
Sbjct: 535 WWNVESHENEKLP-DPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAW 593

Query: 233 QWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSP 292
           QWP L VGLR+  W DD VK+FLLG+P   W  T S+++    +   + R +R+   F+ 
Sbjct: 594 QWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFAN 653

Query: 293 AEWIHFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK 351
            + ++   +G    ++ W LH++PF IM RVTY+HHY PALYF++L+ A+  +   +  +
Sbjct: 654 DKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHYLPALYFALLVLAYFFE--AIIRR 711

Query: 352 PK------TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           PK         I   +Y+++++  F+YF  I+FG++ P+   +   WLS W I D
Sbjct: 712 PKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKISD 766



>gi|367004348|ref|XP_003686907.1| hypothetical protein TPHA_0H02700 [Tetrapisispora phaffii CBS 4417]
 gi|357525209|emb|CCE64473.1| hypothetical protein TPHA_0H02700 [Tetrapisispora phaffii CBS 4417]
          Length = 760

 Score =  273 bits (698), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 144/408 (35%), Positives = 230/408 (56%), Gaps = 12/408 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S ++++N   GG LLHSH   YP GS+QQQ++ Y H D NN+++  + R++ +Y+ N T+
Sbjct: 348 STISIRNQALGGALLHSHQQLYPVGSKQQQITGYGHKDANNEFIFHRIREKPLYSTNETD 407

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E++ +G+T             +H++AAP++   +EVS YG+   GD  D W++E+V+  
Sbjct: 408 IEYIKDGETYRLIHRLTNKNLHTHQVAAPISKTEWEVSGYGDLEGGDSKDNWIVEIVNQL 467

Query: 121 NTKXXXXX-XXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +               + V+GCYL   +   PEWGF Q E+ C +    +D  T WN+
Sbjct: 468 GDEDKTKLHTLTTSFRLKNAVLGCYLAQTSNRYPEWGFSQSEIACLRSPFKRDKRTWWNI 527

Query: 180 ERHWNEKLP-LGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           E H NEKLP +     F ++ F  +F +LN+ M   NNAL+ +PDK D ++S   +WP L
Sbjct: 528 ETHVNEKLPNIDENFEFPRASFFKDFIYLNLAMMATNNALVTDPDKLDRLASSAWEWPTL 587

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
             GLR++ W D+ VK++L+G P   W+ T ++  F  L+    +R  R+Y ++   + + 
Sbjct: 588 HKGLRLNGWHDENVKYYLMGTPASTWASTLAVFSFMVLVIVLFLRWLRQYNDYKDEKKLD 647

Query: 298 -FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            FL  G   + GW LH+ PF IM RVTY+HHY PALYF++++  +  +  T    PKTK+
Sbjct: 648 LFLMSGVYPMFGWGLHFCPFVIMARVTYVHHYLPALYFALVVLVYFFEAGT-QLLPKTKS 706

Query: 357 ------IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
                  I+ +Y  L++  F  F  I+FG+   +++ K   WL  WNI
Sbjct: 707 GQMLRIGIYTVYILLVIGCFCCFAPISFGMEGKSTDYKYLAWLPEWNI 754



>gi|367014887|ref|XP_003681943.1| hypothetical protein TDEL_0E04890 [Torulaspora delbrueckii]
 gi|359749604|emb|CCE92732.1| hypothetical protein TDEL_0E04890 [Torulaspora delbrueckii]
          Length = 733

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 152/415 (36%), Positives = 220/415 (53%), Gaps = 18/415 (4%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK---EQMYNN 57
           GS +T+++ G    LLHSH+  YPGGS Q+QV+ Y   D NN W I  PR    +  +NN
Sbjct: 320 GSDVTIRSHGLSPNLLHSHVQTYPGGSNQKQVTGYGFADGNNIWQIKFPRSSANQLDFNN 379

Query: 58  IT--EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
               ++  V +GD I            SHEIAA V+   +EVS YG+E +GD  D W+IE
Sbjct: 380 TLNGQILTVRDGDEIRLQHKETKTNLHSHEIAAHVSRGCYEVSGYGSEEIGDGKDDWIIE 439

Query: 116 VVSDTNTK--------XXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V    +                       HK +GCYL S     P WGF+Q E+ C   
Sbjct: 440 IVEQRKSSNPEFPTEDQTTLHPVSTFFRLRHKELGCYLTSTGLSYPPWGFKQAEIVCKYS 499

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKE 224
            +  D  T WNVE HWN+ L   S  N+   KSKF  +F  +N  M + NNALIP+ DK 
Sbjct: 500 WSKMDKSTWWNVEEHWNDHLE--SSPNYLPPKSKFWTDFVLINFAMASSNNALIPDEDKY 557

Query: 225 DSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQK 284
           D+++S   +WP L  GLRM  W+ D  +++LLG+P   W  TASLVLF  +L     + +
Sbjct: 558 DNLASKAWEWPTLHTGLRMCSWSRDLYRYYLLGSPFNTWLSTASLVLFIFILIKLLFQWR 617

Query: 285 RKYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMD 344
           R+ +  +  ++ +    G    I WL HY+PF  MGRVTY+HHY PALYF+ML+  F+++
Sbjct: 618 RQSVNITEDQFWNLAIQGGFPFIAWLAHYLPFVTMGRVTYVHHYVPALYFAMLVCGFVLE 677

Query: 345 HFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           +   + K   +  ++ + ++     + YF  +  G++ P       +WL  W+IV
Sbjct: 678 YCFKNTKSYVRYSVYALLFAGCTYTYIYFSPLCQGMHGPGVRYSKLQWLPGWDIV 732



>gi|403215726|emb|CCK70225.1| hypothetical protein KNAG_0D04860 [Kazachstania naganishii CBS
           8797]
          Length = 754

 Score =  270 bits (690), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 151/408 (37%), Positives = 222/408 (54%), Gaps = 12/408 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +T KN   GG LLHSH+  YP GS QQQV+ Y +ND NN W   + R+   ++ N TE
Sbjct: 346 SFVTFKNQALGGQLLHSHVQLYPEGSGQQQVTGYGYNDSNNVWYFDRVRESTPWSRNETE 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           VE V  G+              SHE+ A V++  +EVS YG++T+GD  DYWV+E ++  
Sbjct: 406 VELVTVGEQYRIVHNLTHRNLHSHEVHAAVSSTEWEVSGYGDDTIGDFKDYWVLEFMNQP 465

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +                  + CYL   N   PEWGFRQ+E+ C +    KD  T WNV
Sbjct: 466 GKENKTVLHPLTTSFRIKNTYMNCYLAQTNEHYPEWGFRQMEIACLRNPFKKDKRTWWNV 525

Query: 180 ERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E + +E+LP     NF+   + F  +F  LN+ M   NNALIP  DK D ++S   QWP 
Sbjct: 526 ETNEDERLP-DRPDNFRFPGTNFFKDFVRLNLAMMASNNALIPEEDKLDVLASSAWQWPT 584

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L +GLR+  W D  +K+FLLG P+  W+ + ++V     +    +R +R+Y        +
Sbjct: 585 LYLGLRICSWGDQYIKYFLLGTPVSTWASSLAVVGLCVAIAVLVLRWQRQYKSLKSERSL 644

Query: 297 HFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAF----MMDHFTVSCK 351
           +   +G +  ++ W LHY PF IM RVTY+HHY PALYF++++ A+     MD    S  
Sbjct: 645 NLFLMGGLYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYSLQVAMDRLNRSTL 704

Query: 352 PKT-KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            +T    +F +  + +V+ F +F  ++FG+  PA +    KW+STW+I
Sbjct: 705 GRTMAKALFLLASASVVLCFIHFSPMSFGMEGPARDYSYLKWVSTWDI 752



>gi|384496594|gb|EIE87085.1| hypothetical protein RO3G_11796 [Rhizopus delemar RA 99-880]
          Length = 524

 Score =  270 bits (690), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 137/327 (41%), Positives = 198/327 (60%), Gaps = 11/327 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK---EQMYN- 56
           GS +T+K+ G+ GGLLHSH + YP GS+QQQ++CY   D+NN W +  PR    E   N 
Sbjct: 173 GSNITIKSFGYSGGLLHSHPHYYPDGSKQQQITCYSFKDVNNIWQVRFPRSVGDEGQPNP 232

Query: 57  --NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
             N T +++V +GD I            SH I AP+++ ++EVS YG++ +GD  D W I
Sbjct: 233 KVNNTFIKYVKDGDIIRLFHLYTMRNLHSHPINAPISSKNWEVSGYGDDEIGDVQDNWRI 292

Query: 115 EVVSDTNTKXXX-XXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDI 173
           E+V D N +               H  + C L S +  LPEWG++Q EV C + ++ +D 
Sbjct: 293 EIVKDVNERNTKHVRALTTLFRLRHVYLNCLLASRHETLPEWGYKQQEVYCSRDDDLEDS 352

Query: 174 YTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQ 233
            T W++E H NEKLP      +KS F  NF HLN+ M+  NNALIP+PDK+D ++S P +
Sbjct: 353 STFWSIEEHHNEKLPPAPDNAYKSSFFQNFAHLNIVMWYSNNALIPDPDKDDILASKPTE 412

Query: 234 WPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPA 293
           WP++ VGLRM  W ++ +KF+L+GNP VWW   AS+V F  L+  Y++R KR+ I+ SPA
Sbjct: 413 WPMVSVGLRMCSWDNENIKFYLMGNPSVWWPSFASIVTFSLLIIIYTIRLKRQVIDMSPA 472

Query: 294 EWIHFLYI--GKICVIGWL--LHYIPF 316
            W++F  +  G I ++  L  LH+ PF
Sbjct: 473 RWMYFTSVVYGIIFIVMALNFLHFAPF 499



>gi|366994482|ref|XP_003677005.1| hypothetical protein NCAS_0F01660 [Naumovozyma castellii CBS 4309]
 gi|342302873|emb|CCC70650.1| hypothetical protein NCAS_0F01660 [Naumovozyma castellii CBS 4309]
          Length = 752

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 147/409 (35%), Positives = 214/409 (52%), Gaps = 12/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSH N YP GS QQQV+ Y + D NN+W   +PR E  Y+ N T+
Sbjct: 341 SIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
           +E+V                  +H + AP+++  +EVS YG+   GD  D W+IE+V   
Sbjct: 401 IEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQR 460

Query: 121 NTKXXXXXXXXXXXXXXHKV-IGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
             +              +   + CYL      LPEWGF+Q EV C +    +D  T WN+
Sbjct: 461 GDEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNI 520

Query: 180 ERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E + N+ LP     +FK   + F  +F  LN+ M   NNAL+P+P+K D ++S   QWP 
Sbjct: 521 ETNENDVLP-PRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPT 579

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS-PAEW 295
           L  GLR+  W +D VK+FLLG P   W  + ++V     +    +R +R+Y +   P + 
Sbjct: 580 LYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDL 639

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMD---HFTVSCKP 352
             F+      ++ W LHY PF IM RVTY+HHY PALYF++++ A++ D    F    K 
Sbjct: 640 NTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKS 699

Query: 353 KT--KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
               + +I+   Y  ++  FWYF  I+FG+  P        W STWNI 
Sbjct: 700 TQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748



>gi|406606320|emb|CCH42311.1| dolichyl-phosphate-mannose-proteinmannosyltransferase
           [Wickerhamomyces ciferrii]
          Length = 755

 Score =  267 bits (683), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 144/410 (35%), Positives = 220/410 (53%), Gaps = 11/410 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK--EQMYNNI 58
           GS +T+++ G    LLHSH+  YP GS QQQ++ Y H+D NN+W+    R+  E +  N 
Sbjct: 346 GSEVTIRSQGSSPNLLHSHVQIYPDGSNQQQITGYGHSDGNNNWVFKYSRRSNETLDENS 405

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
            ++  V +GD +            SH I A V+  H+EV  YGNE +GD  D WV+E+V 
Sbjct: 406 DDLVKVQDGDVVRLVHKWTGVNLHSHTIPAHVSKKHWEVGGYGNEKIGDSKDDWVVEIVE 465

Query: 119 DTNTKXXXXXXXXXXX--------XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNA 170
              +                       H  +GCYL       P WGF+Q EV C      
Sbjct: 466 QLTSANKSFPKEDKSILHPLSTNFRLRHADLGCYLSMTGAAYPAWGFKQSEVVCKDSWTW 525

Query: 171 KDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISS 229
           +D  T WNVE H ++KL +    +  KS F  +F  +N  M + NNAL+P+ DK D ++S
Sbjct: 526 RDKSTWWNVEDHMHKKLEIDDGFIAPKSNFWSDFIQINFAMASSNNALVPDYDKFDHLAS 585

Query: 230 LPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIE 289
              +WP L VGLRM  W  + V++FL+GNP   W  T SL +F  L+  Y ++ +R+ +E
Sbjct: 586 KAWEWPTLHVGLRMCGWGTNDVRYFLIGNPFNTWLSTISLPIFIYLVLLYVIKYQRQTLE 645

Query: 290 FSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS 349
           ++  ++  F+  G    IGWLLH+ PF IMGRVTY+HHY PALYF++ +  F+++H    
Sbjct: 646 WNDEDYWKFIVGGVYPFIGWLLHFAPFAIMGRVTYVHHYVPALYFAIYVFGFLVEHAVGK 705

Query: 350 CKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            K   K  ++ + +  ++  +++F     G+  P ++ K  + L +W +V
Sbjct: 706 TKLFVKIPVYSLLFGTLIFTYFHFAPFYDGMTGPHNDFKYLEILPSWKVV 755



>gi|365982845|ref|XP_003668256.1| hypothetical protein NDAI_0A08600 [Naumovozyma dairenensis CBS 421]
 gi|343767022|emb|CCD23013.1| hypothetical protein NDAI_0A08600 [Naumovozyma dairenensis CBS 421]
          Length = 788

 Score =  267 bits (683), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 221/414 (53%), Gaps = 15/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-- 58
            S +++KN   GG LLHSH+  YP GS  QQV+CY ++D NNDW     R    YN    
Sbjct: 374 SSTVSIKNQALGGALLHSHVQTYPEGSNLQQVTCYSYSDSNNDWFFDNIRSRTPYNESDP 433

Query: 59  -TEVEFVN-NGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSA--YGNETLGDDNDYWVI 114
              +EF+  N                S  + A V+    EV+   YG E  GD+ D W+I
Sbjct: 434 NQPLEFIEPNKPYRLVHKQTRKNLHVSPNVHAHVSKNDLEVAGNGYGFEQ-GDNGDNWII 492

Query: 115 EVVSDTNTKXXXXXX---XXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
           E++   ++K                 + V  CYL      LP+WG+RQ EVTC K+ +  
Sbjct: 493 EIIDQKSSKSENTSQIHPLTTTFRIKNIVSDCYLIQTEHNLPDWGYRQSEVTCSKKVSKT 552

Query: 172 DIYTHWNVERHWNEKLPLGSKVNF---KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSIS 228
           D+  +WNVE H N  LP  ++  F   K+ FL +F +LN  M   NNAL+P+ DK DS++
Sbjct: 553 DLRAYWNVETHENANLPTPTEDEFHYPKTNFLSDFIYLNKIMMRTNNALVPDYDKYDSLA 612

Query: 229 SLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYI 288
           S   QWP L VGLR+  W DD+V++FLLG+P   W  T ++V+   L+  +  R +R+  
Sbjct: 613 SDAWQWPTLNVGLRLCGWGDDQVRYFLLGSPFSTWPSTITVVMLMILIVIFIFRWQRQLH 672

Query: 289 EFSPAEWIHFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFT 347
            F+    +    +G    ++GW LHY+PF IM RVTY+HHY PALYF++++ A+  D   
Sbjct: 673 NFANETAMDTFMMGAFYPLLGWGLHYMPFVIMARVTYVHHYLPALYFALIILAYFFDAML 732

Query: 348 VSCKPK-TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              +       IF IY+  ++  F YF  I+FG+  P S+ K   WLSTW I++
Sbjct: 733 KRFRFNWLVMSIFTIYFVAMIAGFVYFSPISFGMTGPVSDYKYLNWLSTWKIIN 786



>gi|320582731|gb|EFW96948.1| Protein O-mannosyltransferase [Ogataea parapolymorpha DL-1]
          Length = 733

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/413 (36%), Positives = 221/413 (53%), Gaps = 22/413 (5%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S++T+++ G    LLHSH ++YP GSEQ QV+ Y   D NN++++   R ++ Y      
Sbjct: 327 SKITIRSQGKSPNLLHSHPSKYPAGSEQHQVTTYGFKDANNNFIVRPARTQRNYG----- 381

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDTN 121
            F+ NGD I            SH I A V+  ++EVS YG+ET+GD  D WV+E+V   +
Sbjct: 382 PFIQNGDAIRLQHELTKANLHSHAIHAHVSERYWEVSGYGDETVGDAKDDWVVEIVEQLH 441

Query: 122 TKXXXXXXX-------------XXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRN 168
           +                            HKV+GCYL +     P WGF+Q EV C    
Sbjct: 442 SGNKSYAATENGPDFYSTVHPLTTTFKLRHKVLGCYLATTGESYPTWGFKQGEVVCRPDT 501

Query: 169 NAK-DIYTHWNVERHWNEKLPLGSKVNFKS-KFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
               D  T WNVE H N+ L + S   + S +FL +F+ +  GM   NNAL+P+  K D 
Sbjct: 502 RLPFDRSTLWNVEMHENDDLAVESDYVYPSPRFLVDFFMVQHGMLASNNALVPDVHKHDE 561

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           I+S   QWP   VGLRM  W     K++LL +P   W  TA L +F  L     +  +R+
Sbjct: 562 IASFWWQWPFALVGLRMCSWGPHVTKYYLLSHPFTTWFSTACLGVFVLLAVRLLLLWQRQ 621

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +   F   G +  +GWLLHY+PF +MGRVTY+HHY PALYF+M +A F++++ 
Sbjct: 622 QLAVSADQLWKFTICGLVPFVGWLLHYLPFIVMGRVTYVHHYMPALYFAMYVAGFVVEYV 681

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           T S   + + +++G+ Y+L+  +FWYF  +  G++  AS+     WL  WNI 
Sbjct: 682 TGSS--RIRYVVYGVLYALVGYLFWYFSPLCLGMSGRASDYAYLNWLPGWNIA 732



>gi|470308139|ref|XP_004363760.1| protein-O-mannosyltransferase 2 [Capsaspora owczarzaki ATCC 30864]
 gi|320168016|gb|EFW44915.1| protein-O-mannosyltransferase 2 [Capsaspora owczarzaki ATCC 30864]
          Length = 793

 Score =  263 bits (672), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 142/418 (33%), Positives = 216/418 (51%), Gaps = 31/418 (7%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPG--GSEQQQVSCYHHNDINNDWMILKPRKEQM---- 54
           GS ++LKN   GG LLHSH + YP   G +QQQV+CY H D NN W+I  P    +    
Sbjct: 382 GSIVSLKNHRSGGALLHSHTHTYPEAHGPQQQQVTCYSHKDSNNHWLIKHPGTPDLNAES 441

Query: 55  ------YNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDD 108
                   N+  +E++ +G  +            SH   AP+T  HF+VS YG + +GD 
Sbjct: 442 EKAMVEKTNVAPLEYIKHGSIVRLEHINTKRNIHSHREKAPLTTRHFQVSGYGADGVGDA 501

Query: 109 NDYWVIEVVSDTNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRN 168
           ND+W +EV+ D   +              H  +GC L S  + LP+WG+ Q+EVTC+   
Sbjct: 502 NDHWRVEVL-DGGGEDNRVQTLITRFRLIHVSVGCALHSHGKNLPKWGWEQLEVTCNP-- 558

Query: 169 NAKDIYTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSIS 228
           N  D    WN+E H N++LP    V+++  F+ N   ++V M  VNN L P   KE+ I+
Sbjct: 559 NVNDADNMWNIEMHQNDRLPKVEGVSYRPSFISNLIEIHVAMAQVNNGLKP---KENEIT 615

Query: 229 SLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYI 288
           S P QWPI   G R + W D+  + +LLGNP+++W     LV+    + +Y+V       
Sbjct: 616 SRPWQWPINYRGQRFTGWGDNDTRIYLLGNPVIFW---GCLVMTVVFILFYAVDAGISQR 672

Query: 289 EFSPAEW-----IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMM 343
            +    W        L      +IGW +HY PFF+MGR+ Y HHYFPAL FS + +A ++
Sbjct: 673 GYREPPWNRERKAKLLATCAWLLIGWAMHYFPFFVMGRILYFHHYFPALLFSCMYSALLL 732

Query: 344 DHFTVSCK-----PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTW 396
           D+F +  +     P+   I   I   ++   F +F  +++G+  P +   +R+W+ +W
Sbjct: 733 DYFIMRLRMWTMSPRVTIIGTSILLLIMFASFLFFAPVSYGMTGPVNSFFNRRWMESW 790



>gi|308198020|ref|XP_001387014.2| protein mannosyltransferase [Scheffersomyces stipitis CBS 6054]
 gi|149388990|gb|EAZ62991.2| protein mannosyltransferase [Scheffersomyces stipitis CBS 6054]
          Length = 745

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 152/412 (36%), Positives = 217/412 (52%), Gaps = 19/412 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S +TL++ G    LLHSH + YP GS+ QQ++ Y   D NND++I   +  +  + + E 
Sbjct: 334 SLVTLRSQGLSPNLLHSHDHSYPEGSQLQQITTYGFKDDNNDFVIKADKFLERSSGVVET 393

Query: 62  E--FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
               + +GDTI            S  I+AP+++ H+EVS      + D  + W +EV   
Sbjct: 394 SDTLLKHGDTIRLMHNKTRCFLHSQPISAPISDNHYEVSCISELEVNDFRNSWTVEVQGQ 453

Query: 120 TNTKXXXXXXXX--------XXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
             ++                      HK +GCYL +     P WGF+Q EV C     ++
Sbjct: 454 EKSESPFFQSESEDEVHPISTNFRLKHKQLGCYLATTGYSYPSWGFQQGEVVCKYAILSR 513

Query: 172 DIYTHWNVERHWNEKL--PLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISS 229
           D  T WN+E H N K   P  S V  K KF   F  LN GM   NNALIP+PDK D +SS
Sbjct: 514 DKTTWWNIEDHSNNKFETPSESYVPPKPKFWKEFVLLNYGMLASNNALIPDPDKFDRLSS 573

Query: 230 LPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIE 289
              +WP+L  G+R+  W  D VK+FL+GNP + W  T SL++F   +   +V  +R+ + 
Sbjct: 574 EWWEWPLLLSGIRLGSWGADDVKYFLMGNPFITWFSTFSLLIFILYVAACAVMHQRQILS 633

Query: 290 FS--PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFT 347
           +S     W   L  G    + W LHY PF +MGRV YLHHY PALYF++L++AF+M+ F 
Sbjct: 634 YSVLGENWNELLIQGIFPFLAWFLHYFPFVVMGRVKYLHHYVPALYFAILVSAFVMETFI 693

Query: 348 VSCKPKTKNIIFGIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTW 396
              K   + I+  IY   Y +I+  FWY KD + G+  P S+ K  K+LS+W
Sbjct: 694 R--KRLNRVIVCTIYLIAYIMIIASFWYLKDFSLGMEGPPSKFKKLKFLSSW 743



>gi|255711158|ref|XP_002551862.1| KLTH0B01650p [Lachancea thermotolerans]
 gi|238933240|emb|CAR21424.1| KLTH0B01650p [Lachancea thermotolerans CBS 6340]
          Length = 754

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 148/416 (35%), Positives = 219/416 (52%), Gaps = 21/416 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM-YNNIT 59
           GS LT+++ G    LLHSH+  YP GS Q QV+ Y H+D NN W++   R+  +  +N T
Sbjct: 342 GSELTIRSHGLSPNLLHSHVQLYPLGSGQHQVTGYGHSDDNNRWVVKFSRESGLSLDNST 401

Query: 60  EVE----FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
            ++     + +   I            SHEI A V+   +EVS YG+E +GD  D WV+E
Sbjct: 402 ILDSKHLLLRDNSEIRLVHKNTQANLHSHEIPAHVSKNSYEVSGYGDEVIGDTKDDWVVE 461

Query: 116 VVSDTNTKXXXXXXX--------XXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V   ++                       HK +GCYL +     P WGF+Q E+ C   
Sbjct: 462 IVEQLDSSNSSLPQEDPSVLHPISTSFRLRHKELGCYLATTGLAYPAWGFKQAEIVCKHS 521

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
              +D  T WNVE HWN  +      +  KSKF  +F  +N  M + NNAL+P+ DK DS
Sbjct: 522 WTKRDKSTWWNVEDHWNPAMEKTEGYIPPKSKFWADFVLINFAMASSNNALVPDEDKYDS 581

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           ++S   +WPIL VGLRM  W    VK+FL+G+P   W  T SLV F  ++   + + +R+
Sbjct: 582 LASEAWEWPILHVGLRMCGWGHHTVKYFLMGSPFQTWLSTGSLVAFVFIILRLAYKWRRQ 641

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  +          G +  + WLLHY+PF  MGRVTY+HHY PALYF++L+  F+++  
Sbjct: 642 SVLVTSDFLSKVGMQGILPFLAWLLHYLPFVAMGRVTYVHHYVPALYFALLVLGFVLE-- 699

Query: 347 TVSCKPKT---KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
             +C PK      II+ + Y+  + ++  F  IA G+   A + +  +W +TWNI 
Sbjct: 700 --TCVPKRFYLNYIIYALLYAGCIYIYNLFSPIAQGMQGSAIDFRYLQWFNTWNIA 753



>gi|294656631|ref|XP_458928.2| DEHA2D10648p [Debaryomyces hansenii CBS767]
 gi|199431620|emb|CAG87084.2| DEHA2D10648p [Debaryomyces hansenii CBS767]
          Length = 779

 Score =  260 bits (665), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 154/427 (36%), Positives = 224/427 (52%), Gaps = 32/427 (7%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-----------LKP 49
           GS +TL++ G    LLHSH + YP GS QQQ++ Y   D NN++++              
Sbjct: 356 GSLITLRSQGLSPNLLHSHPHVYPEGSHQQQITTYGFKDENNEFLVEFDLEAGLRGEFAT 415

Query: 50  RKEQMYNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDN 109
            +++  ++ +  + + +GD +            SH+I + +++ H+EVS Y N    D  
Sbjct: 416 YEQEGNDSYSLDKIIKDGDVMRLVHKNSGCLLHSHQIMSSISSSHYEVSCYANLDESDLK 475

Query: 110 DYWVIEVVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIE 161
           D WV+E+ S          N                HKV+GCYL +     P WGF+Q E
Sbjct: 476 DEWVVELQSQELSPSEDFQNEDPKELHPISTNFRLRHKVLGCYLATTGFSYPPWGFQQGE 535

Query: 162 VTCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTVNNALIP 219
           V C     + +  T WN+E H N+KLP      V    KF   F  LN GM   NNAL+P
Sbjct: 536 VVCKSSLFSTEKSTWWNIEDHINDKLPAPESLYVPPPPKFWKEFILLNYGMMASNNALVP 595

Query: 220 NPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLF---FCLL 276
           + DK D +SS   +WPIL+ GLRM  W  ++VK+FL+G+P + W  T +LVLF     + 
Sbjct: 596 DSDKFDRLSSEWWEWPILKSGLRMCGWTSNEVKYFLIGHPFITWFSTFNLVLFVIYIVIK 655

Query: 277 FWYSVRQKRKYIEFSPA----EWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPAL 332
            W   RQK   I F       EW   +  G    +GW+LHY+PF +MGRVTYLHHY PAL
Sbjct: 656 LWMWQRQK---IHFRKGVFDLEWETLIIQGVTPFVGWVLHYVPFILMGRVTYLHHYVPAL 712

Query: 333 YFSMLMAAFMMDHFTVSCKPK-TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRK 391
           YF++ ++ +MM+        K    +++GI Y LI+ +FWY KD+A G+   +S+ K  +
Sbjct: 713 YFAIFISGYMMESIIHRHTHKYISYLLYGISYLLIIGIFWYLKDLALGMEGSSSKFKHLR 772

Query: 392 WLSTWNI 398
            LS+W I
Sbjct: 773 LLSSWMI 779



>gi|410083956|ref|XP_003959555.1| hypothetical protein KAFR_0K00650 [Kazachstania africana CBS 2517]
 gi|372466147|emb|CCF60420.1| hypothetical protein KAFR_0K00650 [Kazachstania africana CBS 2517]
          Length = 750

 Score =  259 bits (663), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 145/412 (35%), Positives = 222/412 (53%), Gaps = 20/412 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-TE 60
           S +T+KN   GG LLHSH   YP GS+QQQ++ Y   D NN+W   + R    +N   T+
Sbjct: 338 SIITIKNQKLGGALLHSHYQLYPTGSQQQQITAYGFKDNNNEWFFDRARGLVNWNETETD 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
            EFV NG++             +H + A +T   +EV+ YG+  +GD  D WVIEV+   
Sbjct: 398 DEFVKNGNSYRLVHRGTGRNLHTHPVLAAMTKSEWEVAGYGDHEIGDLKDNWVIEVIEQK 457

Query: 121 NTKXXXXXXXXXXXXXXHK-VIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNV 179
           N +                 V+ C+L   ++ LPEWGFRQ E+ C +  +  D  T WN+
Sbjct: 458 NDEDPDKIHPLTTLFRIRSDVMDCHLAQTDKSLPEWGFRQGEIVCLRNAHKNDKRTWWNI 517

Query: 180 ERHWNEKLPLGSKVNFK---SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           E H NE+LP   + +FK     FL +F HLN  M   NNAL+   DK D ++S   +WP 
Sbjct: 518 ETHENERLPEAPE-DFKFPKPGFLESFIHLNRAMMASNNALVTADDKYDPLASSAWEWPT 576

Query: 237 LEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWI 296
           L  GLR++ W D+ VK++LLG P+  W  + +++ F   +    +R +R+Y + + +  +
Sbjct: 577 LHTGLRLNHWGDENVKYYLLGTPVSTWGSSIAVLGFMIYVAILILRWQRQYSDLTDSTDL 636

Query: 297 HFLYIGKI-CVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTK 355
           +   IG    ++GW LH++PF IM RVTY+HHY PALYF++++  ++++    +C  +  
Sbjct: 637 NLFLIGGFYPLLGWGLHFMPFVIMSRVTYVHHYLPALYFALIIFTYVLE----ACTKRLL 692

Query: 356 NIIFG------IYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNI 398
              FG      I+ +L + V   F YF  I+FG++ P  +     W S W I
Sbjct: 693 KTKFGRVSRLMIFTTLTLSVTACFAYFAPISFGMDGPKEQYAYLGWFSNWII 744



>gi|50287155|ref|XP_446007.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525314|emb|CAG58931.1| unnamed protein product [Candida glabrata]
          Length = 734

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 147/409 (35%), Positives = 217/409 (53%), Gaps = 11/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GS +TL+NM   G  LHSH   YP GS+Q+QV+CY++ D NNDW++ +P  + +++ N T
Sbjct: 327 GSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVNDT 386

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           E E + NGDTI            SH++ AP+  + +EVS YGN T+GD  D+WV+E++ D
Sbjct: 387 EHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIKD 446

Query: 120 T-NTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
             N                H V+ CYL  +N  LPEWGF Q EV C +     DI T W 
Sbjct: 447 DGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMWI 506

Query: 179 VERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPIL 237
           V+ H +  L       + +  F  +F+ LN  M   NNAL  + DK D + S   +WP L
Sbjct: 507 VDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTL 566

Query: 238 EVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIH 297
              LR++ W ++  ++ LLG+P   W  T + VLF      Y V +  + ++    E   
Sbjct: 567 YRSLRINSWNENDTRYLLLGSPASTWPSTVA-VLFLVFALLYKVLKWNRQMQIFQNEHDE 625

Query: 298 --FLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH-FTVSCKPKT 354
             F+Y G   ++GW LH+ PF IMGRV Y+HHY PALYF++ + A++ D       K KT
Sbjct: 626 ELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTKT 685

Query: 355 KNI----IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           + I    I+  Y S+++  F  F   ++G+       K   W+  W++V
Sbjct: 686 QRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENYKHLNWMKNWDVV 734



>gi|207340887|gb|EDZ69098.1| YOR321Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 344

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 187/337 (55%), Gaps = 5/337 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
            S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +   
Sbjct: 5   SSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAEN 64

Query: 61  --VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
             +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+V 
Sbjct: 65  KTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVE 124

Query: 119 DTNTKXXXXXXXXXXX-XXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHW 177
               +               + ++GCYL  + + LPEWGFRQ EV C K  + +D  T W
Sbjct: 125 QVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWW 184

Query: 178 NVERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPI 236
           N+E H NE+LP G    + K+ F  NF  LN  M   NNAL+PNP+K D I+S   QWP 
Sbjct: 185 NIETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPT 244

Query: 237 LEVGLRMSEWADDKVKFFLLGNPI-VWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEW 295
           L VG+R+ EW++  +K+FLLG+P  VW S  A   L   ++F     Q++  I   P E 
Sbjct: 245 LNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVER 304

Query: 296 IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPAL 332
             F+      ++ WLLHY+PF +M RV Y HHY P L
Sbjct: 305 DVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTL 341



>gi|50312059|ref|XP_456061.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645197|emb|CAG98769.1| KLLA0F21978p [Kluyveromyces lactis]
          Length = 757

 Score =  256 bits (655), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 143/414 (34%), Positives = 219/414 (52%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPR-------KEQ 53
           GS ++L++ G   GLLHSH   YP GS Q+QV+ Y + D NN+W++   R       +E+
Sbjct: 342 GSCISLRSHGLSPGLLHSHPQTYPDGSNQRQVTGYSYRDGNNNWIVKYSRSSGKASAEER 401

Query: 54  MYNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWV 113
           +Y++   + F+ +GD +            +H+I + V+  H+EVS YGN+ +GD  D W+
Sbjct: 402 VYSD--NILFLKDGDLLRLVHEKTKNNLHTHQIPSHVSKGHYEVSGYGNDAVGDLKDDWI 459

Query: 114 IEVV------SDTNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           IEVV      ++T                 +K +GCYL +     P WG+ Q E+ C   
Sbjct: 460 IEVVEQLPTGNNTMENKALIHPLTTSFRLRNKELGCYLAATGLSYPGWGYNQAEIVCKYP 519

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSKVNFK-SKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            N +D  T WNVE H N  L +        +KF  +F  +N  M   NNALIP+ DK D 
Sbjct: 520 WNQRDKSTWWNVEDHINSNLHIDQTFTPPPTKFWTDFVVINFAMAASNNALIPDLDKYDR 579

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           I+S P +WPIL  GLRM  W D  VK++LLG+P   W  TA+L +   L+     R +R+
Sbjct: 580 IASEPWEWPILYKGLRMCNWNDKTVKYYLLGSPFNTWLSTAALPILLILVSMELFRYQRQ 639

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            ++ +  +  +      +  IGWLLHY PFFIMGRVTY+HHY PAL+F+++  A+++D  
Sbjct: 640 SLQLNEKKAWNLFACAGLSFIGWLLHYAPFFIMGRVTYIHHYVPALFFAIMTFAYVVDFA 699

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             +     K + +   Y+     +WYF     G+  P     + + L +W++ +
Sbjct: 700 LANSNRYLKVVAYSSLYAGCTFTYWYFAPFCQGMPEPNLTYVNLELLPSWDVTN 753



>gi|448088827|ref|XP_004196644.1| Piso0_003868 [Millerozyma farinosa CBS 7064]
 gi|448092994|ref|XP_004197675.1| Piso0_003868 [Millerozyma farinosa CBS 7064]
 gi|359378066|emb|CCE84325.1| Piso0_003868 [Millerozyma farinosa CBS 7064]
 gi|359379097|emb|CCE83294.1| Piso0_003868 [Millerozyma farinosa CBS 7064]
          Length = 784

 Score =  254 bits (649), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 151/423 (35%), Positives = 215/423 (50%), Gaps = 25/423 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-------LKPRKEQ 53
           GS +TL++ G    LLHSH + YP GS+QQQ++ Y + D NN+++I       L+     
Sbjct: 362 GSMVTLRSQGLSPNLLHSHPHLYPEGSQQQQITTYGYKDENNNFLIEFDLESGLRGEYAT 421

Query: 54  MYNN----ITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDN 109
             N+    +     V +GD +            SH I APV    +EVS Y +    D+ 
Sbjct: 422 YENDENSTVDHTRPVKDGDVVRLVHNDSGCLLHSHPIKAPVLKSAYEVSCYSDLEHSDEK 481

Query: 110 DYWVIEVVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIE 161
           D W++E+            +                HKV+GCYL +    LP WG++Q E
Sbjct: 482 DEWIVEISKQEVSPDPFFQSEAQDELHPISTNFRLKHKVLGCYLTTTGYALPSWGYKQGE 541

Query: 162 VTCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTVNNALIP 219
           V C     ++D  T WNVE H N  LPL  K  V  K +F   F  LN  M   NNAL+P
Sbjct: 542 VVCKYAVFSQDKSTWWNVEDHINSALPLPEKEYVPPKPRFWKEFILLNYAMMASNNALLP 601

Query: 220 NPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWY 279
           + DK D +SS   +WPIL  GLRM  WA  +VKFFL+GNP V W  T +LV+F       
Sbjct: 602 DYDKFDRLSSEWWEWPILHSGLRMCGWAASEVKFFLIGNPPVTWFSTLALVVFAIYSLVL 661

Query: 280 SVRQKRKYIEFSPA----EWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFS 335
            +  +R+ + F       EW  F+  G    +GWLLH++PF +MGRV YLHHY PA YF+
Sbjct: 662 LLCYRRQTLVFPGGVFDEEWNKFILQGIFPFLGWLLHFLPFVVMGRVKYLHHYVPAQYFA 721

Query: 336 MLMAAFMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLST 395
           + ++ F+M+           ++I+ + Y +I+ VFW  K + FG+N  +S     + L T
Sbjct: 722 IFVSGFIMEVSLRRINRHLSHLIYFVSYVMIIGVFWKLKPLCFGMNLHSSNYGHLRVLET 781

Query: 396 WNI 398
           W +
Sbjct: 782 WMV 784



>gi|365985898|ref|XP_003669781.1| hypothetical protein NDAI_0D02240 [Naumovozyma dairenensis CBS 421]
 gi|343768550|emb|CCD24538.1| hypothetical protein NDAI_0D02240 [Naumovozyma dairenensis CBS 421]
          Length = 748

 Score =  253 bits (645), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 143/409 (34%), Positives = 215/409 (52%), Gaps = 11/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    LLHSH+  YP GS+Q+QV+ Y H+D NN+W            N T 
Sbjct: 340 GSEVTIRSHGLSPNLLHSHVQLYPDGSKQRQVTGYAHSDANNNWE-FHFADHNYSPNDTI 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNET-LGDDNDYWVIEVVSD 119
           +  V +G  I            SH+I + V+  +FEVS YGN+    D ND W IE+V  
Sbjct: 399 IRDVMDGMDIRLVHKNTRNNLHSHKIPSHVSRGNFEVSGYGNDDDFVDSNDIWTIELVDQ 458

Query: 120 TNTKX--------XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
            ++                       HK +GCYL S     P+WGF+Q E+ C    + +
Sbjct: 459 LDSSNPNYPKEDPTILHPVSTFFRLRHKKLGCYLASTGLTYPQWGFQQAEIVCKNSWSKR 518

Query: 172 DIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSL 230
           D  T WNVE HWN +L +  + +  KSKF  +F  +N  M + N+ALIP+ DK D ++S 
Sbjct: 519 DKATWWNVEDHWNSRLTVAEEYLPPKSKFWTDFVLINFAMASSNSALIPDQDKFDPLASE 578

Query: 231 PIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF 290
           P +WP L  GLRM  W+ D  +++L+G+P   W  T SL  F  L+     +  R+ I  
Sbjct: 579 PWEWPTLHKGLRMCSWSRDSYRYYLMGSPFNTWISTLSLFGFVLLMLRIIFKWGRQTINL 638

Query: 291 SPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC 350
           +  +    L  G      W++H++PF +MGRVTY+HHY PALYF++L+  F+++   VS 
Sbjct: 639 TEDQIWKLLITGVFPFFSWIMHFLPFVMMGRVTYVHHYVPALYFAILVFGFVIEQLFVSA 698

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            P  K   F I  +  + V+  F  I  G++ P ++    +WL +W+I+
Sbjct: 699 HPIIKYPAFIILATGCIWVYIIFAPICQGLHGPLTQYLRLQWLPSWDII 747



>gi|260947120|ref|XP_002617857.1| hypothetical protein CLUG_01316 [Clavispora lusitaniae ATCC 42720]
 gi|238847729|gb|EEQ37193.1| hypothetical protein CLUG_01316 [Clavispora lusitaniae ATCC 42720]
          Length = 777

 Score =  253 bits (645), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 151/426 (35%), Positives = 222/426 (52%), Gaps = 28/426 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-------LKPRK-- 51
           GS +TL++ G    LLHSH ++YP GS+QQQV+ Y + D NN+++I       L  +K  
Sbjct: 351 GSLVTLRSQGLSPNLLHSHNHRYPEGSQQQQVTTYGYKDNNNEFLIEFDLQTSLTEKKFA 410

Query: 52  -----EQMYNNITEVE-FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETL 105
                E+  + +++ E  V +GDTI            SH I A ++  H+EVS YG   +
Sbjct: 411 TLEDEEKQSDFVSDFETLVKDGDTIRLRHAVTGCFLHSHSIPAHISTGHYEVSCYGGVDI 470

Query: 106 GDDNDYWVIEVVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGF 157
            DD D WV+E+ +          +                HKV+GCYL +     P WGF
Sbjct: 471 PDDKDDWVVEIEAQYESPSPAFADEDPELLHPISSNFRLRHKVLGCYLATTGYAYPAWGF 530

Query: 158 RQIEVTCDKRNNAKDIYTHWNVERHWNEKL--PLGSKVNFKSKFLHNFWHLNVGMYTVNN 215
           +Q EV C     A+D  + WN+E H N+KL  P    V  K +F   F  +N GM   NN
Sbjct: 531 QQGEVICKNTFLAQDKSSWWNIEDHVNDKLEMPKDQYVAPKPRFWKEFILINYGMMASNN 590

Query: 216 ALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCL 275
           AL+P+PD  D + S   +WPIL  GLRM+ W+    ++ L+GN  V +  T  + L   L
Sbjct: 591 ALVPDPDHYDKLESQWWEWPILRKGLRMNAWSLSGYRYLLMGNIFVTYFTTVCIPLVCLL 650

Query: 276 LFWYSVRQKRKYIEF--SPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALY 333
           + +  ++ +R+ I    +  EW   L  G + ++GW+LHY PF  MGRVTYLHHY PALY
Sbjct: 651 IGFIFIQGQRQAINLNVTGPEWNFLLSAGILPLLGWVLHYWPFIAMGRVTYLHHYVPALY 710

Query: 334 FSMLMAAFMMDHFTVSCKPK-TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKW 392
           F++ +A F M++       K  K +I+ + Y  I+  F Y+KD  +G+  P  + K    
Sbjct: 711 FAIFVAGFFMEYLVARRANKYLKYVIYLVTYVGIIGSFLYYKDFCWGMTGPLEQYKHLSL 770

Query: 393 LSTWNI 398
           L TW +
Sbjct: 771 LRTWQV 776



>gi|366987797|ref|XP_003673665.1| hypothetical protein NCAS_0A07260 [Naumovozyma castellii CBS 4309]
 gi|342299528|emb|CCC67284.1| hypothetical protein NCAS_0A07260 [Naumovozyma castellii CBS 4309]
          Length = 752

 Score =  252 bits (644), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 140/408 (34%), Positives = 211/408 (51%), Gaps = 9/408 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    LLHSH+  YP GS Q+Q++ Y H+D NN W     R++        
Sbjct: 344 GSEVTIRSHGLSPNLLHSHVQLYPDGSRQRQITGYGHSDSNNVWEFQFAREDTRSLTDNL 403

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
              + +G  I            SHEI + V+  +FEVS Y  E  GD  D W++E+V   
Sbjct: 404 KTPITDGAEIRLVHNNTRANLHSHEILSHVSKGNFEVSGYSTEFNGDVYDDWILEIVDQM 463

Query: 121 NT--------KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKD 172
           ++                       HKV+GCYL S     P WGF+Q E+ C K  + +D
Sbjct: 464 DSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGFQQAEIVCKKSWSHRD 523

Query: 173 IYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLP 231
             T WNVE HWN++LP+    V  KSKF  +F  +N  M + N+AL+P+ DK D ++S P
Sbjct: 524 KATWWNVEDHWNDQLPIEEDYVPPKSKFWTDFILINFAMASSNSALVPDADKFDPLASKP 583

Query: 232 IQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS 291
            +WP L  GLR+  W+ D  K++LLG+P   W  T SL LF  ++   + + +R+++   
Sbjct: 584 WEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFIISKIAYQWRRQHLNLQ 643

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK 351
             +       G    + W+ H+ PF +MGRVTY+HHY PALYF++L   F++D+      
Sbjct: 644 EDQLWRLGIQGIFPFLAWITHFFPFVMMGRVTYVHHYLPALYFAILTFGFVLDYSIGRAN 703

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           P  K  I+   +     ++  F  I  G++   ++    +WL TWNIV
Sbjct: 704 PFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAKYLRLEWLPTWNIV 751



>gi|344233863|gb|EGV65733.1| PMT-domain-containing protein [Candida tenuis ATCC 10573]
          Length = 784

 Score =  251 bits (640), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 152/427 (35%), Positives = 220/427 (51%), Gaps = 31/427 (7%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +TL++ G    LLHSH + YP GS+QQQV+ Y   D NN+++     +  + N+   
Sbjct: 360 GSLVTLRSQGLSPNLLHSHPHNYPEGSQQQQVTTYGFKDNNNEFVFEFDLQNGLNNHFAT 419

Query: 61  VE-----------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDN 109
           +E            V +G+T+            SH +AA +T  HFEVS Y N    D  
Sbjct: 420 LEADENTTVEYDRLVKDGNTVRLVHSNRGCLLHSHRVAAAITKSHFEVSCYANLANSDSK 479

Query: 110 DYWVIEVVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIE 161
           D WVIE+            N                HKV+GCYL +  +  P WGF+Q E
Sbjct: 480 DDWVIEIQGHEKSPSPDFQNEATDELHPISTNFRLRHKVLGCYLATTGKAYPAWGFQQGE 539

Query: 162 VTCDKRNNAKDIYTHWNVERHWNEKLP-LGSK-VNFKSKFLHNFWHLNVGMYTVNNALIP 219
           V C      +D  T WN+E H NE LP + +K V  K +F   F  +N GM   NNAL+P
Sbjct: 540 VICKNTVLKQDKNTWWNIEDHVNEYLPNITTKYVPPKPRFWKEFILINYGMMASNNALVP 599

Query: 220 NPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTAS---LVLFFCLL 276
           +P+K D+++S   +WPIL  GLRM  W+ ++ K+FL+GNP V    T S   L +++ ++
Sbjct: 600 DPNKYDNLASEWWEWPILRAGLRMGSWSANQAKYFLIGNPAVTLFSTFSLGVLAIYYVVV 659

Query: 277 FWYSVRQKRKYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSM 336
            W   RQK  Y           +    + V GW+LHY+PF +MGRVTYLHHY PA YF+ 
Sbjct: 660 LWRWQRQKLVYQNVFDTNLNQLIAQSILPVSGWILHYLPFILMGRVTYLHHYVPAQYFAT 719

Query: 337 LMAAFMMDHFTVSCKP-KTKNII----FGIYYSLIVIVFWYFKDIAFGINYPASELKSRK 391
            +A  +++  T+  KP K   ++    FGI Y++ V +F Y   ++ G+   A +    K
Sbjct: 720 FVAGCILE--TLIYKPFKNHRVVVWVAFGISYTITVGLFLYLSPLSLGMTTSAKDYNHLK 777

Query: 392 WLSTWNI 398
           + S+W I
Sbjct: 778 FFSSWMI 784



>gi|241954746|ref|XP_002420094.1| dolichyl-phosphate-mannose-protein mannosyltransferase, putative;
           protein mannosyltransferase, putative [Candida
           dubliniensis CD36]
 gi|223643435|emb|CAX42314.1| dolichyl-phosphate-mannose-protein mannosyltransferase, putative
           [Candida dubliniensis CD36]
          Length = 839

 Score =  250 bits (639), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 146/446 (32%), Positives = 224/446 (50%), Gaps = 48/446 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    L+HSH + YP GS++QQV+ Y   D NN+++        + N    
Sbjct: 394 GSLVTIRSQGLSPNLIHSHPHNYPQGSQEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHAT 453

Query: 61  VE-------------------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYG 101
           +E                    +++GDT+            ++ + APVT+  +EVS +G
Sbjct: 454 LENGNSTASGGEDDDDDYYHVIIHDGDTVRINHKNTGCYLRANAVGAPVTSSSYEVSCFG 513

Query: 102 NETLGDDNDYWVIEVVSDTNT--------KXXXXXXXXXXXXXXHKVIGCYLRSANRVLP 153
           +    D  D WVIE+ +   +                       HK +GCYL +  +  P
Sbjct: 514 DVESNDWADEWVIEIQTQDQSPDPIFQDEDRSEIHSVSTSFRLKHKQLGCYLATTGKSYP 573

Query: 154 EWGFRQIEVTCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMY 211
            WG++Q EV C     ++D  T WN+E+H N+KLPL     V  K KF   F  LN  M 
Sbjct: 574 AWGYQQGEVVCKYSVFSRDKNTWWNIEKHVNDKLPLPPTEYVPPKPKFWKEFILLNYAMM 633

Query: 212 TVNNALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVL 271
             NNALIP+PD+ D +SS   +WPIL  GLRM+ W D  +K+FLLGNP++ W  T +L+ 
Sbjct: 634 ASNNALIPDPDRFDKLSSEWWEWPILNTGLRMNSWGDADIKYFLLGNPLITWLSTMALIA 693

Query: 272 FFCLLFWYSVRQKRKYIEFSPAEWIHFLYIGKIC-----------VIGWLLHYIPFFIMG 320
               L    ++ +R++I  S  +  +   + K             + GW+LHY+PF +MG
Sbjct: 694 CPVYLLIVGIKYQRQWISLSATDASNTNSVNKQTLSLLSARALLPLAGWVLHYVPFILMG 753

Query: 321 RVTYLHHYFPALYFSMLMAAFMMD--------HFTVSCKPKTKNIIFGIYYSLIVIVFWY 372
           RV YLHHY PALYF++ +A F++D        +     +   K +I+   Y +I I FWY
Sbjct: 754 RVKYLHHYVPALYFAIFIAGFIVDAIVNLDFSYHNNKFQYIFKVVIYSTLYLVICISFWY 813

Query: 373 FKDIAFGINYPASELKSRKWLSTWNI 398
           FKD++FG+   +   +  + L +W I
Sbjct: 814 FKDLSFGMEGSSVAFRHLRLLGSWMI 839



>gi|403216641|emb|CCK71137.1| hypothetical protein KNAG_0G00810 [Kazachstania naganishii CBS
           8797]
          Length = 749

 Score =  249 bits (637), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 145/414 (35%), Positives = 221/414 (53%), Gaps = 15/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NN 57
           GS +T+++ G    LLHSHI  YP GS Q QV+ Y H+D NN+W     R   ++   N 
Sbjct: 335 GSVVTIRSHGLSPNLLHSHIQSYPDGSRQGQVTGYGHSDSNNNWQFQFARTSGIHLDENG 394

Query: 58  IT---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
            T   E+  V +G T+            SHEI + V+  +FEVS YG+ET GD+ D WVI
Sbjct: 395 KTPNGELIPVVDGLTVRLVHNNTRSNLHSHEIPSHVSRGNFEVSRYGSETKGDEKDDWVI 454

Query: 115 EVVSDTNTKX--------XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDK 166
           E+V    +                       HK +GCYL S     P+WGF Q E+ C  
Sbjct: 455 EIVDQLRSSNYDFPEEDPSMLHPISTFFRLRHKELGCYLSSTGMAYPQWGFSQAEIVCKY 514

Query: 167 RNNAKDIYTHWNVERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKED 225
             + +D  T WNVE HWN++L      +   SKF  +F  +N  M + NNALIP+PDK D
Sbjct: 515 SWSKRDKSTWWNVEDHWNDQLEADEDYSPPASKFWTDFILINFAMASSNNALIPDPDKYD 574

Query: 226 SISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKR 285
           +++S   +WPIL  GLR+  W     +++LLG+P   W+ T +++L   LLF    + +R
Sbjct: 575 NLASEAWEWPILYTGLRLCGWDLSNTRYYLLGSPFNTWASTLTIILLPLLLFSIFYQWRR 634

Query: 286 KYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           + I+ +   W   +      ++GWL HY+PF +MGRVTY+HHY PALYF++++  F M++
Sbjct: 635 QTIQITEPHWWTLIMQCGFPLVGWLSHYLPFVVMGRVTYVHHYVPALYFAIMVFGFAMNY 694

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           +     P     ++   +S  + +++YF  +  G++    +    +W  +W+IV
Sbjct: 695 WVYPKHPLISIPVYLAMFSGCIYIYYYFSPLCQGMDGAPMKYLYLEWFRSWDIV 748



>gi|238881391|gb|EEQ45029.1| dolichyl-phosphate-mannose-protein mannosyltransferase 6 [Candida
           albicans WO-1]
          Length = 832

 Score =  249 bits (636), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 145/444 (32%), Positives = 225/444 (50%), Gaps = 46/444 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    L+HSH + YP GS++QQV+ Y   D NN+++        + N    
Sbjct: 389 GSLVTIRSQGLSPNLIHSHPHNYPQGSQEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHAT 448

Query: 61  VE-----------------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNE 103
           +E                  +++GDT+            ++ + AP+T+  +EVS +G+ 
Sbjct: 449 LENENSTRNGGNDDDYYHVIIHDGDTVRINHKNTGSYLRANAVGAPITSSSYEVSCFGDV 508

Query: 104 TLGDDNDYWVIEVVSDTNT--------KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEW 155
              D  D WVIE+ S   +                       HK +GCYL +  +  P W
Sbjct: 509 ESNDWADEWVIEIQSQDQSPDPMFQDEDPSEIHSVSTSFRLKHKQLGCYLATTGKSYPAW 568

Query: 156 GFRQIEVTCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTV 213
           G++Q EV C     ++D  T WN+E+H N+KLPL +   V  K KF   F  LN  M   
Sbjct: 569 GYQQGEVVCKYSVFSRDKNTWWNIEKHVNDKLPLPATEYVPPKPKFWKEFILLNYAMMAS 628

Query: 214 NNALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFF 273
           NNALIP+PD+ D +SS   +WPIL  GLRM+ W D  +K+FLLGNP++ W  T +L++  
Sbjct: 629 NNALIPDPDRFDKLSSEWWEWPILNTGLRMNSWGDADIKYFLLGNPLITWMSTIALIVCP 688

Query: 274 CLLFWYSVRQKRKYIEFSPAE-----------WIHFLYIGKICVIGWLLHYIPFFIMGRV 322
             L    ++ +R++I  S  +                    + + GW+LHY+PF +MGRV
Sbjct: 689 LYLLVVGIKYQRQWILLSATDTSNANPANSQSLSLLAARALLPLAGWVLHYVPFILMGRV 748

Query: 323 TYLHHYFPALYFSMLMAAFMMD--------HFTVSCKPKTKNIIFGIYYSLIVIVFWYFK 374
            YLHHY PALYF++ +A F++D        +     +   K +I+   Y +I I FWYFK
Sbjct: 749 KYLHHYVPALYFAIFVAGFIVDAILNLDFSYHNNKFQYIFKVVIYSTLYLVICISFWYFK 808

Query: 375 DIAFGINYPASELKSRKWLSTWNI 398
           D++FG+   + + +  + L +W I
Sbjct: 809 DLSFGMEGSSVDYRHLRLLGSWMI 832



>gi|410081413|ref|XP_003958286.1| hypothetical protein KAFR_0G01180 [Kazachstania africana CBS 2517]
 gi|372464874|emb|CCF59151.1| hypothetical protein KAFR_0G01180 [Kazachstania africana CBS 2517]
          Length = 756

 Score =  248 bits (634), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 147/410 (35%), Positives = 215/410 (52%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S +TL++ G    LLHSH   YP GS Q+Q++ Y  +D NN+W+I   R + +Y +  E 
Sbjct: 343 SEVTLRSHGLSPNLLHSHAQVYPDGSHQRQITGYGFSDTNNNWIIKFARTKMVYFD-PER 401

Query: 62  EF--VNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSD 119
           +F  V +GD I            SHE+ + V+  ++EVS YG++ +GD  D WV+E+V  
Sbjct: 402 DFISVRDGDEIRLLHKNTNSNLHSHEVPSHVSRGNWEVSGYGSDDVGDQKDDWVVEIVKQ 461

Query: 120 TNTKX--------XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
            ++                       HKV+GCYL S     P WGF Q E+ C    +  
Sbjct: 462 MDSANPNFPKEDPEILHPVSTFFRLRHKVLGCYLTSTGLSYPSWGFSQAEIVCKNSWSKH 521

Query: 172 DIYTHWNVERHWNEKLPLG-SKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSL 230
           D  T WN+E HWNE L +  S V  KS F  +F  +N  M + NNAL+P+ DK D ++S 
Sbjct: 522 DKSTWWNIEGHWNEHLSIDESYVPPKSNFWTDFVLINFAMASSNNALVPDEDKYDPLASD 581

Query: 231 PIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF 290
             +WPIL  GLRM  W     K++L+G+P   W  T SL +F  ++     + KR+ +  
Sbjct: 582 FWEWPILYRGLRMCNWVTTSYKYYLMGSPFNTWISTLSLFIFCGIVSSIVYKYKRQSLVM 641

Query: 291 SPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC 350
           S   +      G    + W+ HY+PF +MGRVTY+HHY PALYF++L+  F+  +   + 
Sbjct: 642 STDLFWKLSIQGGFPFVAWIAHYLPFVVMGRVTYVHHYVPALYFAILVFGFVTHYLLHTR 701

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               K  ++ + YS  V V+  F  I  GI    +   + KWL +WNIVD
Sbjct: 702 HFLIKLPVYVLLYSGCVYVYILFSPICQGIVGRNANYTNLKWLPSWNIVD 751



>gi|68477313|ref|XP_717283.1| hypothetical protein CaO19.11283 [Candida albicans SC5314]
 gi|68477472|ref|XP_717207.1| hypothetical protein CaO19.3802 [Candida albicans SC5314]
 gi|46438909|gb|EAK98233.1| hypothetical protein CaO19.3802 [Candida albicans SC5314]
 gi|46438987|gb|EAK98310.1| hypothetical protein CaO19.11283 [Candida albicans SC5314]
          Length = 832

 Score =  248 bits (633), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/444 (32%), Positives = 224/444 (50%), Gaps = 46/444 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    L+HSH + YP GS++QQV+ Y   D NN+++        + N    
Sbjct: 389 GSLVTIRSQGLSPNLIHSHPHNYPQGSQEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHAT 448

Query: 61  VE-----------------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNE 103
           +E                  +++GDT+            ++ + AP+T+  +EVS +G+ 
Sbjct: 449 LENENSTRNGGNDDDYYHVIIHDGDTVRINHKNTGSYLRANAVGAPITSSSYEVSCFGDV 508

Query: 104 TLGDDNDYWVIEVVSDTNT--------KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEW 155
              D  D WVIE+ S   +                       HK +GCYL +  +  P W
Sbjct: 509 ESNDWADEWVIEIQSQDQSPDPMFQDEDPSEIHSVSTSFRLKHKQLGCYLATTGKSYPAW 568

Query: 156 GFRQIEVTCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTV 213
           G++Q EV C     ++D  T WN+E+H N KLPL +   V  K KF   F  LN  M   
Sbjct: 569 GYQQGEVVCKYSVFSRDKNTWWNIEKHVNNKLPLPATEYVPPKPKFWKEFILLNYAMMAS 628

Query: 214 NNALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFF 273
           NNALIP+PD+ D +SS   +WPIL  GLRM+ W D  +K+FLLGNP++ W  T +L++  
Sbjct: 629 NNALIPDPDRFDKLSSEWWEWPILNTGLRMNSWGDADIKYFLLGNPLITWISTIALIVCP 688

Query: 274 CLLFWYSVRQKRKYIEFSPAE-----------WIHFLYIGKICVIGWLLHYIPFFIMGRV 322
             L    ++ +R++I  S  +                    + + GW+LHY+PF +MGRV
Sbjct: 689 LYLLVVGIKYQRQWILLSATDTSNANPANSQSLSLLAARALLPLAGWVLHYVPFILMGRV 748

Query: 323 TYLHHYFPALYFSMLMAAFMMD--------HFTVSCKPKTKNIIFGIYYSLIVIVFWYFK 374
            YLHHY PALYF++ +A F++D        +     +   K +I+   Y +I I FWYFK
Sbjct: 749 KYLHHYVPALYFAIFVAGFIVDAILNLDFSYHNNKFQYIFKVVIYSTLYLVICISFWYFK 808

Query: 375 DIAFGINYPASELKSRKWLSTWNI 398
           D++FG+   + + +  + L +W I
Sbjct: 809 DLSFGMEGSSVDYRHLRLLGSWMI 832



>gi|366998505|ref|XP_003683989.1| hypothetical protein TPHA_0A04800 [Tetrapisispora phaffii CBS 4417]
 gi|357522284|emb|CCE61555.1| hypothetical protein TPHA_0A04800 [Tetrapisispora phaffii CBS 4417]
          Length = 760

 Score =  247 bits (631), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 149/417 (35%), Positives = 218/417 (52%), Gaps = 24/417 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NN 57
           GS +T+++ G    LLHSHI  YP GS Q Q++ Y  +D NN W     R++ ++   NN
Sbjct: 345 GSDVTIRSHGLSPNLLHSHIQTYPVGSLQNQITGYGFSDENNKWTFKFAREDGIFFDSNN 404

Query: 58  IT---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
            T   E+  V +GDT+            SH +A+ V+  +FEVS YG +  GD  D W+I
Sbjct: 405 KTVNGELIAVKDGDTVRLNHKSTMRNLHSHYVASHVSQGNFEVSGYGTDEGGDAKDNWII 464

Query: 115 EVVSDTNT--------KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDK 166
           E+V    +                       H+ +GCYL S     P WGF+Q E+ C  
Sbjct: 465 EIVQQLKSNNPDFHQEDSENIHPVSTFFRLRHQELGCYLASTGFSYPGWGFKQSEIVCKN 524

Query: 167 RNNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKED 225
             + +D  T WNVE HWN+ L +    V  KSKF  +F  +N  M   NNALIP+ DK D
Sbjct: 525 SWSKRDKSTWWNVEDHWNDMLEIEDDYVPPKSKFWTDFILINFAMAASNNALIPDDDKYD 584

Query: 226 SISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKR 285
           +++S P +WP L +GLRM  WA D  +++L+G+P   W  TASL +   +L +     +R
Sbjct: 585 NLASEPWEWPTLHIGLRMCTWAHDVYRYYLIGSPFNTWLSTASLFVCIIILAYTLYEWRR 644

Query: 286 KYIEFSPAE-W---IHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAF 341
           + I  +    W   I F++      I W+ H++PF IMGRVTY+HHY PALYFSML+ A 
Sbjct: 645 QKIHLNENNIWKLSIQFVF----PFIAWVTHFVPFLIMGRVTYVHHYLPALYFSMLVFAS 700

Query: 342 MMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGIN-YPASELKSRKWLSTWN 397
            +D+     K   K   + I +   + ++  F  +  G+  +   +LK   WLS+W+
Sbjct: 701 TVDYLLSGSKTYIKYPSYLILFGSCIYIYIIFAPLCQGMTGFNNEDLKKISWLSSWD 757



>gi|296413150|ref|XP_002836279.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630092|emb|CAZ80470.1| unnamed protein product [Tuber melanosporum]
          Length = 594

 Score =  246 bits (627), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 161/251 (64%)

Query: 148 ANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVERHWNEKLPLGSKVNFKSKFLHNFWHLN 207
            N  LP+WGF+QIEVTC K+NN +D++THWNVE HWNEKLP      F+S FL +F HLN
Sbjct: 344 GNVNLPQWGFKQIEVTCTKKNNPRDVFTHWNVESHWNEKLPNADVKAFRSPFLRDFIHLN 403

Query: 208 VGMYTVNNALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTA 267
           V M T NNAL+P+PDK+D ++S   QWPIL VGLRM  W D  VK+FLLGNP+V+W  T 
Sbjct: 404 VAMMTSNNALVPDPDKQDDLASAYWQWPILHVGLRMCSWDDGIVKYFLLGNPMVYWGSTL 463

Query: 268 SLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHH 327
           +L LF  L+  Y +R +R Y +       H    G   +IGW+ HY+PF  M RVTY+HH
Sbjct: 464 ALPLFSLLVLLYLIRWQRGYNDLDGEGIDHIRAAGIYPLIGWVFHYVPFIAMARVTYVHH 523

Query: 328 YFPALYFSMLMAAFMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASEL 387
           Y+PALYF++L+  F+ +H T       K  ++G+ Y  I  VF  F  I+FG+   + + 
Sbjct: 524 YYPALYFAILVFGFLFNHLTNKLPKTAKLAVYGVAYVAITGVFVLFIPISFGMTGSSEQY 583

Query: 388 KSRKWLSTWNI 398
           K   WL TW I
Sbjct: 584 KYLNWLPTWRI 594



>gi|156848302|ref|XP_001647033.1| hypothetical protein Kpol_1050p32 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117716|gb|EDO19175.1| hypothetical protein Kpol_1050p32 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 750

 Score =  244 bits (622), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 139/412 (33%), Positives = 217/412 (52%), Gaps = 15/412 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NN 57
           GS +++++ G    LLHSH+ +YP GS+Q Q++ Y ++D NN W+    R+  +    NN
Sbjct: 336 GSEVSIRSNGLSPNLLHSHVQKYPDGSKQNQITGYGYSDSNNGWIFKFTRESGIQFDSNN 395

Query: 58  ITEVEF---VNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
            T  E    + +GD +            SHE+ + V+  ++EVS YG++  GD  D WVI
Sbjct: 396 QTVNEDLIPIRDGDEVRLLHKNTGKNLHSHEVPSHVSRGNWEVSGYGSDHRGDQKDNWVI 455

Query: 115 EVVSDTNTKX--------XXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDK 166
           E+V    +                       HKV+GCYL S     P WGF+Q EV C  
Sbjct: 456 EIVDQLKSSNPDFHDEDNDSVHPVSTFFRLKHKVLGCYLTSTGFSYPAWGFKQSEVVCKY 515

Query: 167 RNNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKED 225
             + +D  T WNVE H N+ L +    +  KSKF  +F  +N  M   NNAL+P+ DK D
Sbjct: 516 SWSTRDKSTWWNVEDHTNDMLEVEDDYIPPKSKFWTDFILINFAMAASNNALVPDGDKYD 575

Query: 226 SISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKR 285
           +++S   +WP L VGLRM  WA +  +++L+G+P   W  + SL++   +L   S + +R
Sbjct: 576 NLASDAWEWPTLHVGLRMCNWAFNTYRYYLMGSPFNTWLSSLSLIVMLLILAKLSYQWRR 635

Query: 286 KYIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           + I  +  +   F        I WL H++PF IMGRVTY+HHY PALYF++L+ AF +D+
Sbjct: 636 QQINITEDQLWSFAIQAVFPFIAWLTHFLPFVIMGRVTYVHHYLPALYFAILVFAFTVDY 695

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
                 P T+++ + + ++  +  +  F  +  G+       +  KWL TW+
Sbjct: 696 TLNKVHPITRHLGYLVLFAGCIYTYILFAPLCQGMIRRDISYEKMKWLPTWD 747



>gi|365760510|gb|EHN02225.1| Pmt6p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 759

 Score =  243 bits (620), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 139/413 (33%), Positives = 211/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNN- 57
           GS LT+++ G    LLHSH+  YP GS Q+QV+ Y   D NN W     R    Q++ N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHVQLYPDGSGQRQVTGYGFADSNNIWKFEFSRSSGLQLHQNG 405

Query: 58  --ITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
                +  + +G  +            SH++ + V+  +FEVS YG++++GD+ D W++E
Sbjct: 406 NLSDRIIPITDGVEVRLRHKNTESSLHSHDVPSHVSRGNFEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VVSDTNTKXXXXXX--------XXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V   N+                       HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 466 IVKQVNSPNPVYANEDPDILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      +  KS F  +F   N  M + N+AL+P+ DK DS
Sbjct: 526 WSHRDKSTWWNVEDHWNSYLETADDYIPPKSNFWTDFILTNFAMASSNSALVPDEDKYDS 585

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W+ TASL++F  ++     R +R+
Sbjct: 586 LSSNAWEWPTLHKGLRMCSWAGYTTRYYLMGSPFNTWASTASLIIFPFIILSLLYRWRRQ 645

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF++L+  F++D  
Sbjct: 646 KLHLSEDQIWRVAIQGVFPFISWMSHYLPFVMMGRVTYVHHYVPALYFAILVFGFVVDFA 705

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K   +   +   + ++  F  I  G+N   +E    +WLSTW++ 
Sbjct: 706 LSRVHWIIKYPAYLSLFGSCIYIYNLFAPICQGMNGDKAEYLPLEWLSTWDMA 758



>gi|354544485|emb|CCE41209.1| hypothetical protein CPAR2_301980 [Candida parapsilosis]
          Length = 766

 Score =  242 bits (617), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 142/411 (34%), Positives = 209/411 (50%), Gaps = 20/411 (4%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    LLHSH + YP GS  QQ++ Y   D NN++ +      ++ +    
Sbjct: 363 GSIVTIRSQGLSPNLLHSHPHSYPEGSGDQQITTYGFKDENNEFEV------ELASGSKL 416

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDT 120
            EF+    +I            +  IAAP+T  +FEVS      +      WV+++ S  
Sbjct: 417 GEFITQDSSIRIKHVKTGYYLGAQPIAAPITKKYFEVSCSPLSNVSFTAHDWVLDIQSQE 476

Query: 121 NTKXXXXXXX--------XXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKD 172
            ++                      HK +GC+L +    LP WG++Q EV C     ++D
Sbjct: 477 ISRSKHFQDENELELHPISTAFRLKHKELGCFLATTGNSLPSWGYQQGEVVCKYPFFSQD 536

Query: 173 IYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSL 230
             T WNVE H NE LP      V    KF   F  LN GM   NNAL+P+PDK D +SS 
Sbjct: 537 KTTWWNVEEHRNEHLPTPETEYVPPNPKFWKEFVLLNYGMMASNNALVPDPDKFDKLSSE 596

Query: 231 PIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEF 290
             +WPIL  GLRM  W DD  KFFL+GNP+V W     +V F  +   +++ + ++  E 
Sbjct: 597 WWEWPILNTGLRMCGWGDDDTKFFLMGNPVVTWLSNIGIV-FGAIYMLFTLFKYQRQCEN 655

Query: 291 SPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC 350
           +       +    + ++GW+LHY+PF +MGRV YLHHY PALYF++    F MD      
Sbjct: 656 TGILTDTLIAQCILPILGWVLHYLPFIVMGRVKYLHHYVPALYFAIFSTGFFMDKLAGRN 715

Query: 351 K--PKT-KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           +  P+  K +I+ + Y+ IV  FWY KD+AFG+   +   +  K L++W I
Sbjct: 716 RYVPRVFKLVIYIVVYASIVFAFWYLKDLAFGMEGSSKHYRKLKLLNSWMI 766



>gi|190344842|gb|EDK36600.2| hypothetical protein PGUG_00698 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 767

 Score =  241 bits (616), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 150/428 (35%), Positives = 217/428 (50%), Gaps = 34/428 (7%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-------------- 46
           GS +TL++ G    LLHSH + YP GS+QQQ++ Y   D NN ++I              
Sbjct: 344 GSLVTLRSQGLSPNLLHSHPHVYPQGSQQQQITTYGFKDDNNQFIIEFDLEAGARGEFAS 403

Query: 47  LKPRKEQMYNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLG 106
           ++P   Q Y+  T    V NGDTI            SH I + ++    EVS Y +    
Sbjct: 404 MEPLDNQSYSFTT---LVKNGDTIRLLHKLSGCLLHSHMIPSFISTSQKEVSCYSDLEGS 460

Query: 107 DDNDYWVIEVVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFR 158
           D+ D WV+E+            N                HKV+GCYL +     P WG++
Sbjct: 461 DEKDEWVVEIQEQDQPLSPEHQNEAPDEVHPITTNFRLRHKVLGCYLATTGYSYPAWGYQ 520

Query: 159 QIEVTCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTVNNA 216
           Q EV C     ++D  T WNVE H N+ LP      +  K KF   F  +N GM   N+A
Sbjct: 521 QGEVVCKHTLLSRDKSTWWNVEDHKNDALPQPEAEFIPPKPKFWKEFVLINYGMMASNSA 580

Query: 217 LIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASL---VLFF 273
           L+P+PDK D +SS   +WPI   GLRM  W     K+FL+G+P++ W  T  L   +++F
Sbjct: 581 LVPDPDKFDKLSSEWWEWPITRSGLRMCGWGMSVTKYFLVGHPLINWFSTFCLLVSLIYF 640

Query: 274 CLLFWYSVRQKRKYIE--FSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPA 331
            +  W   RQ+  Y    FS  +W   +  G + ++GW+LHY+PF  M RVTY+HHY PA
Sbjct: 641 SVKLWRWQRQRDYYPNGVFS-VQWDSLIVQGILPILGWILHYLPFVAMSRVTYVHHYAPA 699

Query: 332 LYFSMLMAAFMMDHFTVSCKPKT-KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSR 390
           LYF++ +  F+++    +   +T     + I Y  I++ F Y KD+AFG+  P++  +  
Sbjct: 700 LYFAIFVTGFVVERVVYNHLNRTIARGFYIILYLAIILGFIYLKDLAFGMEGPSNAYRHL 759

Query: 391 KWLSTWNI 398
           K LSTW I
Sbjct: 760 KVLSTWMI 767



>gi|146422773|ref|XP_001487321.1| hypothetical protein PGUG_00698 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 767

 Score =  240 bits (613), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 150/428 (35%), Positives = 216/428 (50%), Gaps = 34/428 (7%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-------------- 46
           GS +TL++ G    LLHSH + YP GS+QQQ++ Y   D NN ++I              
Sbjct: 344 GSLVTLRSQGLSPNLLHSHPHVYPQGSQQQQITTYGFKDDNNQFIIEFDLEAGARGEFAS 403

Query: 47  LKPRKEQMYNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLG 106
           ++P   Q Y+  T    V NGDTI            SH I + +     EVS Y +    
Sbjct: 404 MEPLDNQSYSFTT---LVKNGDTIRLLHKLSGCLLHSHMIPSFILTSQKEVSCYSDLEGS 460

Query: 107 DDNDYWVIEVVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFR 158
           D+ D WV+E+            N                HKV+GCYL +     P WG++
Sbjct: 461 DEKDEWVVEIQEQDQPLSPEHQNEAPDEVHPITTNFRLRHKVLGCYLATTGYSYPAWGYQ 520

Query: 159 QIEVTCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTVNNA 216
           Q EV C     ++D  T WNVE H N+ LP      +  K KF   F  +N GM   N+A
Sbjct: 521 QGEVVCKHTLLSRDKSTWWNVEDHKNDALPQPEAEFIPPKPKFWKEFVLINYGMMASNSA 580

Query: 217 LIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASL---VLFF 273
           L+P+PDK D +SS   +WPI   GLRM  W     K+FL+G+P++ W  T  L   +++F
Sbjct: 581 LVPDPDKFDKLSSEWWEWPITRSGLRMCGWGMSVTKYFLVGHPLINWFSTFCLLVSLIYF 640

Query: 274 CLLFWYSVRQKRKYIE--FSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPA 331
            +  W   RQ+  Y    FS  +W   +  G + ++GW+LHY+PF  M RVTY+HHY PA
Sbjct: 641 SVKLWRWQRQRDYYPNGVFS-VQWDSLIVQGILPILGWILHYLPFVAMSRVTYVHHYAPA 699

Query: 332 LYFSMLMAAFMMDHFTVSCKPKT-KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSR 390
           LYF++ +  F+++    +   +T     + I Y  I++ F Y KD+AFG+  P++  +  
Sbjct: 700 LYFAIFVTGFVVERVVYNHLNRTIARGFYIILYLAIILGFIYLKDLAFGMEGPSNAYRHL 759

Query: 391 KWLSTWNI 398
           K LSTW I
Sbjct: 760 KVLSTWMI 767



>gi|402225913|gb|EJU05973.1| glycosyltransferase family 39 protein [Dacryopinax sp. DJM-731 SS1]
          Length = 778

 Score =  240 bits (612), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 148/411 (36%), Positives = 214/411 (52%), Gaps = 20/411 (4%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKP---RKEQMYNN 57
           GS++ +++    GG LHSH + YPGGS+QQQ++ Y H D+NNDW IL          YN 
Sbjct: 355 GSKIVMRHWNTNGGYLHSHDHSYPGGSKQQQITLYPHLDVNNDWRILNATWDNNSPGYNW 414

Query: 58  ITE-VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHF--EVSAYG-NETLGDDNDYWV 113
            TE    + +GD I            SH+I  PV+ V F  EVS YG    LGD NDYW+
Sbjct: 415 ETEPFRALADGDMIKLQHIATSKMLHSHDIRPPVSEVDFQNEVSGYGFTGFLGDANDYWI 474

Query: 114 IEVVSDTN---TKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNA 170
           +E+                        H + GCYL S    LP+WG+ Q EVTC+K  NA
Sbjct: 475 VEIAEGDRHDRASSKRVRTLRTLFKLKHALTGCYLFSHKVKLPDWGYEQQEVTCNK--NA 532

Query: 171 KDIYTHWNVERHWNEKLPLGS-KVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDSIS 228
               + W +E + ++KLP  S KVN+ K  FL  F  L   M+T N  L     +  +  
Sbjct: 533 VRANSLWFIEWNEHDKLPATSPKVNYRKPGFLSKFLELQQVMWTTNAGLT----ERHAFD 588

Query: 229 SLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYI 288
           S P  WPIL  G+    W  D  + +LLGNP+VW+  T ++ L+F       +R KR Y 
Sbjct: 589 SRPNTWPILRRGINF--WVKDHRQIYLLGNPVVWYLSTLAVALYFFARGVLILRAKRGYK 646

Query: 289 EFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV 348
           +F+ +  + +  +    V+GW LHY PFF+M R  +LHHYFPAL+F++L++A + D  T 
Sbjct: 647 DFNNSGLVFYDNLCSFLVLGWGLHYAPFFLMARQLFLHHYFPALWFAVLLSAAVYDMATA 706

Query: 349 SCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
             KP+ +  +  +   L V  + +F  + +G  +   + +S KWL TW+  
Sbjct: 707 KLKPRYRVQVALVLVGLAVWTYSHFNPLVYGGVWTRGKCESSKWLKTWDFA 757



>gi|149237540|ref|XP_001524647.1| hypothetical protein LELG_04619 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452182|gb|EDK46438.1| hypothetical protein LELG_04619 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 770

 Score =  240 bits (612), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 146/414 (35%), Positives = 218/414 (52%), Gaps = 20/414 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S +T++++G    LLHSH + YP GS++QQ++ Y   D NN ++I  P  E ++++IT  
Sbjct: 360 SMVTIRSLGLSPNLLHSHEHNYPMGSQEQQITAYAFKDANNQFVIKHPLHE-LHHSITNT 418

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVS-AYGNETLGDDNDYWVIEVVSD- 119
             + N DT             S  I A +++  FEVS  Y +ET   +   WV+E+    
Sbjct: 419 TLIENFDTFRIMHNKTGCYLRSQPINAALSDHDFEVSCTYEDETENKEEQEWVLEIQGQE 478

Query: 120 -------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKD 172
                   N                +K +GCYL S  R  P WGFRQ EV C     +KD
Sbjct: 479 KSPIPQFQNESEMELHPISTSFRLRNKHLGCYLASTGREYPPWGFRQGEVVCKYSLFSKD 538

Query: 173 IYTHWNVERHWNEKLPLGS--KVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSL 230
             T WNVE H N  L L +   V  K KF   F  LN GM   N+AL+P+PD+ D +SS 
Sbjct: 539 KTTWWNVEDHQNSALSLPAIPYVPPKPKFWKEFVLLNYGMMISNSALLPDPDRFDRLSSE 598

Query: 231 PIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFC----LLFWYSVRQKRK 286
             +WPIL  GLRMS W ++  K FL+GNP++ WS + +LV+       +LF Y  +Q+++
Sbjct: 599 WWEWPILRTGLRMSGWGENDFKCFLIGNPLITWSSSCALVISVLILAKILFGYQRQQQQQ 658

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
             +    E++    I  + +  W+ + +PF  MGRV YLHHY PA YF++ +  F++D  
Sbjct: 659 QQQQRNEEYLIPCLI--LPLAAWIFNLLPFLFMGRVKYLHHYMPAQYFAIFVTGFVVDRM 716

Query: 347 TVSCKPKT--KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
             S K  +  +N+++ + Y LI + FW  KD+A+G+       +  + LSTW I
Sbjct: 717 LSSNKIPSFIRNLVYVVIYILIAVTFWKLKDLAYGMVGSPKNFRHLRLLSTWMI 770



>gi|6561139|gb|AAF16867.1|AF104916_1 protein mannosyltransferase [Candida albicans]
          Length = 826

 Score =  239 bits (610), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 140/423 (33%), Positives = 214/423 (50%), Gaps = 46/423 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    L+HSH + YP GS++QQV+ Y   D NN+++        + N    
Sbjct: 389 GSLVTIRSQGLSPNLIHSHPHNYPQGSQEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHAT 448

Query: 61  VE-----------------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNE 103
           +E                  +++GDT+            ++ + AP+T+  +EVS +G+ 
Sbjct: 449 LENENSTRNGGNDDDYYHVIIHDGDTVRINHKNTGSYLRANAVGAPITSSSYEVSCFGDV 508

Query: 104 TLGDDNDYWVIEVVSDTNT--------KXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEW 155
              D  D WVIE+ S   +                       HK +GCYL +  +  P W
Sbjct: 509 ESNDWADEWVIEIQSQDQSPDPMFQDEDPSEIHSVSTSFRLKHKQLGCYLATTGKSYPAW 568

Query: 156 GFRQIEVTCDKRNNAKDIYTHWNVERHWNEKLPLGSK--VNFKSKFLHNFWHLNVGMYTV 213
           G++Q EV C     ++D  T WN+E+H N+KLPL +   V  K KF   F  LN  M   
Sbjct: 569 GYQQGEVVCKYSVFSRDKNTWWNIEKHVNDKLPLPATEYVPPKPKFWKEFILLNYAMMAS 628

Query: 214 NNALIPNPDKEDSISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFF 273
           NNALIP+PD+ D +SS   +WPIL  GLRM+ W D  +K+FLLGNP++ W  T +L++  
Sbjct: 629 NNALIPDPDRFDKLSSEWWEWPILNTGLRMNSWGDADIKYFLLGNPLITWMSTIALIVCP 688

Query: 274 CLLFWYSVRQKRKYIEFSPAE-----------WIHFLYIGKICVIGWLLHYIPFFIMGRV 322
             L    ++ +R++I  S  +                    + + GW+LHY+PF +MGRV
Sbjct: 689 LYLLVVGIKYQRQWILLSATDTSNANPANSQSLSLLAARALLPLAGWVLHYVPFILMGRV 748

Query: 323 TYLHHYFPALYFSMLMAAFMMD--------HFTVSCKPKTKNIIFGIYYSLIVIVFWYFK 374
            YLHHY PALYF++ +A F++D        +     +   K +I+   Y +I I FWYFK
Sbjct: 749 KYLHHYVPALYFAIFVAGFIVDAILNLDFSYHNNKFQYIFKVVIYSTLYLVICISFWYFK 808

Query: 375 DIA 377
           D++
Sbjct: 809 DLS 811



>gi|389744218|gb|EIM85401.1| glycosyltransferase family 39 protein [Stereum hirsutum FP-91666
           SS1]
          Length = 767

 Score =  238 bits (608), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 138/406 (33%), Positives = 210/406 (51%), Gaps = 21/406 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE----QMYN 56
           GS ++++++   GG LHSH + YPGGS QQQ++ Y H D NNDW IL   ++      + 
Sbjct: 361 GSTVSIRHVNTQGGYLHSHAHNYPGGSMQQQITLYPHGDENNDWRILNGTEQGNPLDDWE 420

Query: 57  NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHF--EVSAYGNET-LGDDNDYWV 113
           ++  + F+ NG  +            SH+   PV+ V F  EVSAYG    +GD ND W+
Sbjct: 421 SLNPLRFITNGQRLKFRHLTTEKNLHSHDFRPPVSEVEFQNEVSAYGMPGFVGDSNDDWI 480

Query: 114 IEVVSDTNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDI 173
           IE+     T               H + GCYL S    LP+WG+ Q EVTC+K  NA   
Sbjct: 481 IELDGGAKT----LKTLRTKFRLRHVLTGCYLFSHKVKLPQWGYEQQEVTCNK--NAVKA 534

Query: 174 YTHWNVERHWNEKLPLGSK-VNFKS-KFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLP 231
            + W +E   +  +P  +K VN++   FL  FW L   M+T N  L     +  +  S P
Sbjct: 535 NSLWMIETSDHPYMPTNAKKVNYRQMGFLAKFWELQQVMWTTNAGLT----ERHTFDSRP 590

Query: 232 IQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFS 291
             WP L  G+    W  D  + +LLGNP+VWW  TA+++ +  +  +  +RQKR Y +F 
Sbjct: 591 DSWPTLRRGINF--WVKDHRQVYLLGNPMVWWLSTAAVLAYTSVRGFLILRQKRGYRDFE 648

Query: 292 PAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK 351
             + + +  +     +GW LHY+PF++M R  +LHHYFPALYF++L+   + D  T + +
Sbjct: 649 NTKVVKYDSLCGFLFLGWALHYLPFYLMSRQLFLHHYFPALYFAILLLCSVFDFLTSTLR 708

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
           P+ +  I      L V  +W F  + +G  +   +    KW+ TW+
Sbjct: 709 PRLRLQIAVFLVVLAVWNYWIFSPLVYGGQWTKGKCLEAKWVKTWD 754



>gi|392569121|gb|EIW62295.1| glycosyltransferase family 39 protein [Trametes versicolor
           FP-101664 SS1]
          Length = 756

 Score =  238 bits (606), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 141/408 (34%), Positives = 207/408 (50%), Gaps = 19/408 (4%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMIL---KPRKEQMYNN 57
           GS +TL+++   GG LHSH++ YPGGS+QQQV+ Y H D NNDW I+    P        
Sbjct: 346 GSEITLRHVNTQGGYLHSHVHTYPGGSKQQQVTLYPHRDTNNDWRIVNATAPGDPYTAWQ 405

Query: 58  ITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHF--EVSAYGNETL-GDDNDYWVI 114
              + +V  G  +            SH+I  PV++V F  EVS YG     GD ND W++
Sbjct: 406 DDGITYVTEGARVKLRHIQTEKSLHSHDIRPPVSDVEFQNEVSGYGIPGYSGDANDDWIV 465

Query: 115 EV-VSDTNTKXXXXXXXXXXXX--XXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAK 171
           E+   D   +                H + GCYL S    LPEW F Q EVTC+K+    
Sbjct: 466 EIHKGDRRDRESSKRVRTLRTQFRLKHPMTGCYLFSHKVKLPEWAFEQQEVTCNKQAVMA 525

Query: 172 DIYTHWNVERHWNEKLPLGS-KVNFK-SKFLHNFWHLNVGMYTVNNALIPNPDKEDSISS 229
           +  + W VE   +  LP  + KVN+K   F   FW L   M+T N  L        +  S
Sbjct: 526 N--SLWYVETSTHPNLPADAPKVNYKLPGFFAKFWELQQVMWTTNAGLT----DRHTYDS 579

Query: 230 LPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIE 289
            P  WP L  G+    W  D  + +LLGNPIVWW  TA++  +  +  +  +R KR Y +
Sbjct: 580 RPDAWPRLRRGINF--WVKDHRQIYLLGNPIVWWLSTAAVFAYAAVRGFLVLRAKRGYRD 637

Query: 290 FSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS 349
           F   + + +  +     +GW LHY+PF++MGR  +LHHY PALYF++L+A+   D  T +
Sbjct: 638 FDNTKVVKYDTLCGFLFVGWALHYLPFYLMGRQLFLHHYLPALYFAILLASSAFDLVTST 697

Query: 350 CKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
            +P+ +  I  +   L +  + YF  I +G+ +  ++    +WL TW+
Sbjct: 698 LRPRIRLQIAAVLLLLAIWNYSYFSPITYGLPWTKAKCHKAQWLKTWD 745



>gi|190406792|gb|EDV10059.1| dolichyl-phosphate-mannose-protein mannosyltransferase 6
           [Saccharomyces cerevisiae RM11-1a]
          Length = 759

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 212/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIITITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V          +N                HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      V  KS F  +F   N  M + NNAL+P+ DK DS
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDS 585

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W  T SL++F  ++ +   R +R+
Sbjct: 586 LSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ 645

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF+ML+  F++D  
Sbjct: 646 TLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFT 705

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 706 LTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758



>gi|323348459|gb|EGA82704.1| Pmt6p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 573

 Score =  237 bits (605), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 212/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 160 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 219

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 220 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRXNYEVSGYGSQSVGDEKDDWIVE 279

Query: 116 VVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V          +N                HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 280 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 339

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      V  KS F  +F   N  M + NNAL+P+ DK DS
Sbjct: 340 WSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDS 399

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W  T SL++F  ++ +   R +R+
Sbjct: 400 LSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ 459

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF+ML+  F++D  
Sbjct: 460 TLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFT 519

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 520 LTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 572



>gi|390341472|ref|XP_786089.3| PREDICTED: protein O-mannosyl-transferase 2 [Strongylocentrotus
           purpuratus]
          Length = 773

 Score =  237 bits (604), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 146/414 (35%), Positives = 217/414 (52%), Gaps = 26/414 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSE--QQQVSCYHHNDINNDWMILKPRKEQMYNNI 58
           GS +TLKN    GGLLHSH + YP GS   QQQV+ Y H D+NN+W++ K       N+ 
Sbjct: 368 GSLITLKNHRSSGGLLHSHHHLYPEGSGAMQQQVTAYTHKDVNNEWLVKKFNVNPDPND- 426

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVS 118
           T +E+V +GD I            SH + AP+++ H +V+ YG    GD ND W +E+V 
Sbjct: 427 TSIEYVKHGDLIRLEHTATKRNLHSHPLPAPLSSRHQQVTCYGENGTGDVNDVWRVEIVG 486

Query: 119 DTNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWN 178
               +              H++ GC L S ++ LP+WG+ Q+EVTC+     +D+ T WN
Sbjct: 487 --GREGDLVKVVKTKLKLVHQINGCALFSHSKTLPKWGWEQLEVTCNPY--IRDVRTLWN 542

Query: 179 VERHWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILE 238
           VE H NEKLP  +   F   FL  F   ++ M + N+ L P   KE  I+S P QWPI  
Sbjct: 543 VEDHVNEKLPNMNISLFVPSFLERFLEAHLVMASGNSNLKP---KEGEITSEPWQWPINY 599

Query: 239 VGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHF 298
            G R S   + + + +LLGNP++WW G   ++  FCL     +   ++  E SP      
Sbjct: 600 RGQRFSGTNETEYRVYLLGNPVIWW-GNLVVLAIFCLAAVGWLFMMQRGCELSPQIQDSA 658

Query: 299 LYIGKIC---VIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTK 355
             +   C   ++GW LHY+PF++MGRV Y HHYFPA+ F+ ++    +DH     + K  
Sbjct: 659 ANVYPSCGWLLLGWGLHYLPFYLMGRVLYFHHYFPAMVFNSMITGIFLDHVLKVLELKLG 718

Query: 356 NIIFGIYYSLIVIV-------FWYFKDIAFGI-----NYPASELKSRKWLSTWN 397
                ++ S +VI+       F+ F  +++G+     + P S++    WLSTW 
Sbjct: 719 GRFPHLHQSGVVILLAIVIHSFYLFYPLSYGMVGPLADKPGSQMAGLHWLSTWE 772



>gi|259146701|emb|CAY79958.1| Pmt6p [Saccharomyces cerevisiae EC1118]
          Length = 759

 Score =  237 bits (604), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 212/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRRNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V          +N                HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      V  KS F  +F   N  M + NNAL+P+ DK DS
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDS 585

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W  T SL++F  ++ +   R +R+
Sbjct: 586 LSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ 645

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF+ML+  F++D  
Sbjct: 646 TLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFT 705

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 706 LTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758



>gi|323308951|gb|EGA62182.1| Pmt6p [Saccharomyces cerevisiae FostersO]
          Length = 632

 Score =  237 bits (604), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 212/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 219 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 278

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 279 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 338

Query: 116 VVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V          +N                HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 339 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 398

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      V  KS F  +F   N  M + NNAL+P+ DK DS
Sbjct: 399 WSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDS 458

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W  T SL++F  ++ +   R +R+
Sbjct: 459 LSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ 518

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF+ML+  F++D  
Sbjct: 519 TLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFT 578

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 579 LTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 631



>gi|365765461|gb|EHN06969.1| Pmt6p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 632

 Score =  236 bits (603), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 212/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 219 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 278

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 279 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRRNYEVSGYGSQSVGDEKDDWIVE 338

Query: 116 VVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V          +N                HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 339 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 398

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      V  KS F  +F   N  M + NNAL+P+ DK DS
Sbjct: 399 WSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDS 458

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W  T SL++F  ++ +   R +R+
Sbjct: 459 LSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ 518

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF+ML+  F++D  
Sbjct: 519 TLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFT 578

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 579 LTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 631



>gi|6321638|ref|NP_011715.1| Pmt6p [Saccharomyces cerevisiae S288c]
 gi|1172543|sp|P42934.1|PMT6_YEAST RecName: Full=Dolichyl-phosphate-mannose--protein
           mannosyltransferase 6
 gi|790490|emb|CAA88992.1| unknown [Saccharomyces cerevisiae]
 gi|1323355|emb|CAA97226.1| PMT6 [Saccharomyces cerevisiae]
 gi|285812392|tpg|DAA08292.1| TPA: Pmt6p [Saccharomyces cerevisiae S288c]
 gi|392299452|gb|EIW10546.1| Pmt6p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 759

 Score =  236 bits (603), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 212/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V          +N                HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      V  KS F  +F   N  M + NNAL+P+ DK DS
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDS 585

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W  T SL++F  ++ +   R +R+
Sbjct: 586 LSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ 645

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF+ML+  F++D  
Sbjct: 646 TLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFT 705

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 706 LTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758



>gi|207344990|gb|EDZ71953.1| YGR199Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 640

 Score =  236 bits (603), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 212/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 227 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 286

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 287 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 346

Query: 116 VVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V          +N                HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 347 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 406

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      V  KS F  +F   N  M + NNAL+P+ DK DS
Sbjct: 407 WSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDS 466

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W  T SL++F  ++ +   R +R+
Sbjct: 467 LSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ 526

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF+ML+  F++D  
Sbjct: 527 TLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFT 586

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 587 LTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 639



>gi|323354864|gb|EGA86697.1| Pmt6p [Saccharomyces cerevisiae VL3]
          Length = 632

 Score =  236 bits (602), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 212/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 219 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 278

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 279 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 338

Query: 116 VVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V          +N                HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 339 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 398

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      V  KS F  +F   N  M + NNAL+P+ DK DS
Sbjct: 399 WSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDS 458

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W  T SL++F  ++ +   R +R+
Sbjct: 459 LSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ 518

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF+ML+  F++D  
Sbjct: 519 TLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFT 578

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 579 LTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 631



>gi|151943475|gb|EDN61786.1| dolichyl phosphate-D-mannose:protein O-D-mannosyltransferase
           [Saccharomyces cerevisiae YJM789]
          Length = 759

 Score =  236 bits (602), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 141/413 (34%), Positives = 211/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VVSD--------TNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V          +N                HKV+GCYL S     P WGF+Q E+ C   
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSK-VNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            + +D  T WNVE HWN  L      V  KS F  +F   N  M + NNAL+P+ DK DS
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDS 585

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +SS   +WP L  GLRM  WA    +++L+G+P   W  T SL++F  ++ +   R +R+
Sbjct: 586 LSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQ 645

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            +  S  +       G    I W+ HY+PF +MGRVTY+HHY PALYF+ML+  F++D  
Sbjct: 646 TLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFT 705

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K  I+   +   + ++  F  I  G+    +E    +WLSTW+I 
Sbjct: 706 LTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMYGDKAEYLPLQWLSTWDIA 758



>gi|213408807|ref|XP_002175174.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Schizosaccharomyces japonicus yFS275]
 gi|212003221|gb|EEB08881.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Schizosaccharomyces japonicus yFS275]
          Length = 607

 Score =  236 bits (602), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 133/399 (33%), Positives = 183/399 (45%), Gaps = 82/399 (20%)

Query: 4   LTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY--NNITEV 61
           L LKN    G LLHSH+  YP GS+QQQV+ YHH D NN+W    P     Y       +
Sbjct: 289 LYLKNRNPSGALLHSHVQTYPDGSQQQQVTGYHHKDDNNNWYFFPPHGPSRYFPEQDDSL 348

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVVSDTN 121
             + +G  +            +H + APV++  +EVS YGN T+GD+ DYW++EVV DT 
Sbjct: 349 TPIVHGSLVRMFHPATGRNLHTHSVPAPVSSGQYEVSCYGNSTIGDEKDYWIVEVVEDTL 408

Query: 122 TKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIYTHWNVER 181
           T                                          D   + KD+ THWNVE 
Sbjct: 409 T------------------------------------------DPNASPKDVRTHWNVEE 426

Query: 182 HWNEKLPLGSKVNFKSKFLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPIQWPILEVGL 241
           H+N +LP   K                                        QWP L   L
Sbjct: 427 HYNPRLPAALKA--------------------------------------YQWPFLLATL 448

Query: 242 RMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSPAEWIHFLYI 301
           RM  W D+++K+ L+GNP  +W  TA + +F  L   Y ++ +R  ++ +  E   F   
Sbjct: 449 RMCGWGDNQIKYLLIGNPFSYWLSTACIGVFLLLCVTYFLKWRRHTLKLTSTEIEKFRVA 508

Query: 302 GKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIFGI 361
           G    +GW  HY PFFIMGRV Y+HHY PA  FS + AAF +D  T       + +IF I
Sbjct: 509 GIYPFLGWFFHYFPFFIMGRVLYVHHYEPAFAFSAITAAFTIDWCTRKMPCAVRFVIFTI 568

Query: 362 YYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            Y  I+ VF +FKD+ FG++ PAS+    +WL +WN+ D
Sbjct: 569 LYVAIIAVFVFFKDVTFGMHGPASDFHRLRWLKSWNVHD 607



>gi|254585857|ref|XP_002498496.1| ZYRO0G11682p [Zygosaccharomyces rouxii]
 gi|238941390|emb|CAR29563.1| ZYRO0G11682p [Zygosaccharomyces rouxii]
          Length = 719

 Score =  236 bits (601), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 133/413 (32%), Positives = 211/413 (51%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK-----EQMY 55
           GS +T+++ G    LLHSH   YP GS Q QV+ Y   D NN W +  PR      E+ Y
Sbjct: 306 GSLITIRSHGLSPNLLHSHFQTYPEGSNQNQVTGYGFADDNNVWQVRFPRSSELNWEEDY 365

Query: 56  NNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
                  ++ +G  I            +H I + V+  ++EVS YG+E +GD  D W++E
Sbjct: 366 LPDEGSGYITDGSVIRLFHNQQKVNLHTHRIPSHVSRGNYEVSGYGSEEIGDLKDDWIVE 425

Query: 116 VVSDTNTK--------XXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKR 167
           +V  T++                       +K +GCYL S     P+WGF+Q E+ C   
Sbjct: 426 IVRQTDSSDPDYPKENYDELHPVSTFFRLRNKELGCYLTSTGFSYPKWGFQQAEIVCKHS 485

Query: 168 NNAKDIYTHWNVERHWNEKLPLGSKVNF-KSKFLHNFWHLNVGMYTVNNALIPNPDKEDS 226
            +  D  T WNVE HWNE LP+ +  +  KS+F  +F  +N  M + N+AL+ + DK D+
Sbjct: 486 WSKHDKSTWWNVEEHWNENLPIDTDWHPPKSRFWTDFVMINFAMASSNSALVEDHDKFDN 545

Query: 227 ISSLPIQWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRK 286
           +++   +WP L  GLRM  W+ D  ++FL+G+P   W  T SL +F  +      + KR+
Sbjct: 546 LATDAWEWPTLHRGLRMCSWSKDSYRYFLMGSPFNTWLSTLSLFVFLAITAKLLYQWKRQ 605

Query: 287 YIEFSPAEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
               + + +  F+  G +    W+ HY+PF +MGRVTY+HHY PALYF++L+  F++D  
Sbjct: 606 TKPMTESTFWEFIIQGVMPFTAWVTHYLPFVVMGRVTYVHHYLPALYFAILIFGFVVDRL 665

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
             S     K  ++   +   +  + YF  I  G+    ++    +WL +W++ 
Sbjct: 666 LRSSFNWIKYPVYIALFGGCIKTYTYFSPICQGMTGMWTDYIYLEWLKSWDMA 718



>gi|471893796|emb|CCO31660.1| dolichyl-phosphate-mannose-proteinmannosyltransferase [Rhizoctonia
           solani AG-1 IB]
          Length = 791

 Score =  236 bits (601), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 208/405 (51%), Gaps = 17/405 (4%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---N 57
           GS +TL+++   GG LHSH++ YPGGS+QQQ++ Y H D NNDW I+    +   +    
Sbjct: 196 GSVVTLRHVNTQGGYLHSHLHTYPGGSKQQQITLYPHIDANNDWRIINGTFDGAADFDWT 255

Query: 58  ITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHF--EVSAYGNETL-GDDNDYWVI 114
              +  + NG TI            SH++  PV++V F  EVSAYG     GD ND W++
Sbjct: 256 TEPISQIRNGQTIRFEHIATQKRLHSHDVRPPVSDVDFQNEVSAYGYPGFQGDANDNWIV 315

Query: 115 EVVSDTNTKXXXXXXXXXXXXXXHKVIGCYLRSANRVLPEWGFRQIEVTCDKRNNAKDIY 174
           E+  +   +              H + GCYL S    LP+W + Q EVTC+K  NA    
Sbjct: 316 EI-EEGAGRGQTVKTLQTKFRLRHPLTGCYLFSHKVKLPDWAYEQQEVTCNK--NAVREN 372

Query: 175 THWNVERHWNEKL-PLGSKVNFKSK-FLHNFWHLNVGMYTVNNALIPNPDKEDSISSLPI 232
           + W +E + +EKL     KVN+K   FL  F  L   M+T N  L        +  S P 
Sbjct: 373 SIWYIETNNHEKLGDDAEKVNYKPPGFLSKFLELQQVMWTTNAGLT----DRHAFDSRPS 428

Query: 233 QWPILEVGLRMSEWADDKVKFFLLGNPIVWWSGTASLVLFFCLLFWYSVRQKRKYIEFSP 292
            WP L  G+    W  D  + +L+GNP VW+  T S++ +     +  +R+KR Y +F  
Sbjct: 429 SWPRLRRGINF--WVKDHKQIYLIGNPFVWYMSTISVLSYAVFRGFLILREKRGYKDFHN 486

Query: 293 AEWIHFLYIGKICVIGWLLHYIPFFIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKP 352
              + +  +      GW+LHY PFF+M R  +LHHYFPALYF++LM+  + D  T + KP
Sbjct: 487 TTLVKYDQLCAFLATGWVLHYFPFFLMSRQLFLHHYFPALYFAILMSCAVFDAVTANLKP 546

Query: 353 KTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
           + +  I G+    ++  +  F  + +G  +  S+ +  KWL TW+
Sbjct: 547 RVRLQIAGVVLIFVLWNYMSFSPLTYGTPWTKSKCEGSKWLKTWD 591