BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10407_c0_seq2-m.162 5prime_partial 368-1570(-) 401 (-)
         (400 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|395333868|gb|EJF66245.1| glycosyltransferase family 39 protei...   509   e-142   Dichomitus squalens LYAD-421 SS1
gi|170103424|ref|XP_001882927.1| glycosyltransferase family 39 p...   507   e-141   Laccaria bicolor S238N-H82
gi|409045639|gb|EKM55119.1| glycosyltransferase family 39 protei...   502   e-140   Phanerochaete carnosa HHB-10118-sp
gi|299752673|ref|XP_001841164.2| dolichyl-phosphate-mannose-prot...   501   e-139   Coprinopsis cinerea okayama7#130
gi|390597618|gb|EIN07017.1| glycosyltransferase family 39 protei...   497   e-138   Punctularia strigosozonata HHB-11173 SS5
gi|392567232|gb|EIW60407.1| glycosyltransferase family 39 protei...   496   e-138   Trametes versicolor FP-101664 SS1
gi|302690208|ref|XP_003034783.1| glycosyltransferase family 39 p...   486   e-135   Schizophyllum commune H4-8
gi|449547134|gb|EMD38102.1| glycosyltransferase family 39 protei...   485   e-134   Gelatoporia subvermispora B
gi|336380210|gb|EGO21364.1| glycosyltransferase family 39 protei...   484   e-134   Serpula lacrymans var. lacrymans S7.9
gi|389748450|gb|EIM89627.1| glycosyltransferase family 39 protei...   482   e-134   Stereum hirsutum FP-91666 SS1
gi|393220398|gb|EJD05884.1| glycosyltransferase family 39 protei...   482   e-134   Fomitiporia mediterranea MF3/22
gi|403413793|emb|CCM00493.1| predicted protein [Fibroporia radic...   480   e-133   Fibroporia radiculosa
gi|409080813|gb|EKM81173.1| hypothetical protein AGABI1DRAFT_119...   479   e-133   Agaricus bisporus var. burnettii JB137-S8
gi|426197728|gb|EKV47655.1| hypothetical protein AGABI2DRAFT_205...   479   e-133   Agaricus bisporus var. bisporus H97
gi|472585868|gb|EMS23410.1| protein o-mannosyl transferase, glyc...   476   e-132   Rhodotorula toruloides NP11
gi|402218221|gb|EJT98298.1| glycosyltransferase family 39 protei...   472   e-131   Dacryopinax primogenitus
gi|392577985|gb|EIW71113.1| hypothetical protein TREMEDRAFT_3756...   471   e-130   Tremella mesenterica DSM 1558
gi|67537870|ref|XP_662709.1| hypothetical protein AN5105.2 [Aspe...   469   e-130   Aspergillus nidulans FGSC A4
gi|353238988|emb|CCA70916.1| probable dolichyl-phosphate-mannose...   467   e-129   Serendipita indica DSM 11827
gi|471872546|emb|CCO36435.1| dolichyl-phosphate-mannose-proteinm...   467   e-129   Rhizoctonia solani AG-1 IB
gi|471872537|emb|CCO36440.1| dolichyl-phosphate-mannose-proteinm...   466   e-129   Rhizoctonia solani AG-1 IB
gi|392595355|gb|EIW84678.1| glycosyltransferase family 39 protei...   464   e-128   Coniophora puteana RWD-64-598 SS2
gi|393245706|gb|EJD53216.1| glycosyltransferase family 39 protei...   464   e-128   Auricularia subglabra TFB-10046 SS5
gi|407918001|gb|EKG11300.1| Glycosyl transferase family 39 [Macr...   463   e-128   Macrophomina phaseolina MS6
gi|358058654|dbj|GAA95617.1| hypothetical protein E5Q_02273 [Mix...   462   e-128   Mixia osmundae IAM 14324
gi|485925109|gb|EOD49758.1| putative dolichyl-phosphate-mannose-...   462   e-128   Neofusicoccum parvum UCRNP2
gi|121702259|ref|XP_001269394.1| protein O-mannosyl transferase ...   461   e-127   Aspergillus clavatus NRRL 1
gi|482809248|gb|EOA86083.1| glycosyltransferase family 39 protei...   460   e-127   Setosphaeria turcica Et28A
gi|336367500|gb|EGN95845.1| glycosyltransferase family 39 protei...   459   e-127   Serpula lacrymans var. lacrymans S7.3
gi|295658182|ref|XP_002789653.1| dolichyl-phosphate-mannose-prot...   459   e-127   Paracoccidioides lutzii Pb01
gi|169764100|ref|XP_001727950.1| dolichyl-phosphate-mannose--pro...   458   e-126   Aspergillus oryzae RIB40
gi|242807915|ref|XP_002485056.1| protein O-mannosyl transferase ...   458   e-126   Talaromyces stipitatus ATCC 10500
gi|406697559|gb|EKD00818.1| dolichyl-phosphate-mannose-protein m...   456   e-126   Trichosporon asahii var. asahii CBS 8904
gi|401885936|gb|EJT50015.1| dolichyl-phosphate-mannose-protein m...   456   e-126   Trichosporon asahii var. asahii CBS 2479
gi|46109306|ref|XP_381711.1| hypothetical protein FG01535.1 [Fus...   454   e-125   
gi|451994859|gb|EMD87328.1| glycosyltransferase family 39 protei...   454   e-125   Bipolaris maydis C5
gi|302907392|ref|XP_003049636.1| glycosyltransferase family 39 [...   454   e-125   Nectria haematococca mpVI 77-13-4
gi|408399963|gb|EKJ79052.1| hypothetical protein FPSE_00800 [Fus...   454   e-125   Fusarium pseudograminearum CS3096
gi|15011522|gb|AAK77607.1|AF396953_1 protein O-mannosyl transfer...   454   e-125   Aspergillus awamori
gi|302510847|ref|XP_003017375.1| hypothetical protein ARB_04255 ...   453   e-125   Arthroderma benhamiae CBS 112371
gi|451846165|gb|EMD59476.1| glycosyltransferase family 39 protei...   453   e-125   Bipolaris sorokiniana ND90Pr
gi|429863305|gb|ELA37779.1| protein o-mannosyl transferase [Coll...   453   e-125   Colletotrichum gloeosporioides Nara gc5
gi|48479770|gb|AAT44966.1| protein O-mannosyltransferase 2 [Aspe...   452   e-125   Aspergillus fumigatus
gi|58259910|ref|XP_567365.1| dolichyl-phosphate-mannose-protein ...   452   e-125   Cryptococcus neoformans var. neoformans JEC21
gi|119496253|ref|XP_001264900.1| protein O-mannosyl transferase ...   452   e-125   Aspergillus fischeri NRRL 181
gi|511007747|gb|EPB89028.1| dolichyl-phosphate-mannose-protein m...   452   e-125   Mucor circinelloides f. circinelloides 1006PhL
gi|477520408|gb|ENH72534.1| Dolichyl-phosphate-mannose--protein ...   452   e-125   Fusarium oxysporum f. sp. cubense race 1
gi|384488399|gb|EIE80579.1| hypothetical protein RO3G_05284 [Rhi...   452   e-125   Rhizopus delemar RA 99-880
gi|342878828|gb|EGU80117.1| hypothetical protein FOXB_09392 [Fus...   452   e-125   Fusarium oxysporum Fo5176
gi|475666795|gb|EMT64585.1| Dolichyl-phosphate-mannose--protein ...   452   e-124   Fusarium oxysporum f. sp. cubense race 4
gi|70991332|ref|XP_750515.1| protein O-mannosyl transferase [Asp...   451   e-124   Aspergillus fumigatus Af293
gi|327297568|ref|XP_003233478.1| O-mannosyl transferase [Trichop...   451   e-124   Trichophyton rubrum CBS 118892
gi|340992645|gb|EGS23200.1| dolichyl-phosphate-mannose-protein m...   451   e-124   Chaetomium thermophilum var. thermophilum DSM 1495
gi|302657403|ref|XP_003020425.1| hypothetical protein TRV_05484 ...   450   e-124   Trichophyton verrucosum HKI 0517
gi|310798070|gb|EFQ32963.1| dolichyl-phosphate-mannose-protein m...   450   e-124   Colletotrichum graminicola M1.001
gi|326472217|gb|EGD96226.1| O-mannosyl transferase [Trichophyton...   450   e-124   Trichophyton tonsurans CBS 112818
gi|326483272|gb|EGE07282.1| O-mannosyl transferase pmtA [Trichop...   450   e-124   Trichophyton equinum CBS 127.97
gi|145238926|ref|XP_001392110.1| dolichyl-phosphate-mannose--pro...   450   e-124   Aspergillus niger CBS 513.88
gi|296810152|ref|XP_002845414.1| dolichyl-phosphate-mannose-prot...   450   e-124   Arthroderma otae CBS 113480
gi|380473873|emb|CCF46073.1| glycosyltransferase family 39 [Coll...   450   e-124   Colletotrichum higginsianum
gi|225684883|gb|EEH23167.1| O-mannosyl-transferase [Paracoccidio...   449   e-124   
gi|449300557|gb|EMC96569.1| glycosyltransferase family 39 protei...   449   e-124   Baudoinia panamericana UAMH 10762
gi|512193004|gb|EPE08762.1| dolichyl-phosphate-mannose-protein m...   449   e-124   Ophiostoma piceae UAMH 11346
gi|343426349|emb|CBQ69879.1| probable dolichyl-phosphate-mannose...   449   e-124   Sporisorium reilianum SRZ2
gi|501308867|dbj|GAC97757.1| glycosyltransferase [Pseudozyma hub...   448   e-123   Pseudozyma hubeiensis SY62
gi|477528421|gb|ENH80206.1| protein o-mannosyl transferase [Coll...   448   e-123   Colletotrichum orbiculare MAFF 240422
gi|226287740|gb|EEH43253.1| dolichyl-phosphate-mannose-protein m...   447   e-123   Paracoccidioides brasiliensis Pb18
gi|405122688|gb|AFR97454.1| dolichyl-phosphate-mannose-protein m...   447   e-123   
gi|443898178|dbj|GAC75515.1| dolichyl-phosphate-mannose:protein ...   447   e-123   Moesziomyces antarcticus T-34
gi|396458468|ref|XP_003833847.1| similar to dolichyl phosphate-D...   447   e-123   Leptosphaeria maculans JN3
gi|328858004|gb|EGG07118.1| family 39 glycosyltransferase [Melam...   447   e-123   Melampsora larici-populina 98AG31
gi|340517873|gb|EGR48116.1| glycosyltransferase family 39 [Trich...   446   e-123   Trichoderma reesei QM6a
gi|500255999|gb|EON99317.1| putative dolichyl-phosphate-mannose-...   446   e-123   Phaeoacremonium minimum UCRPA7
gi|71022783|ref|XP_761621.1| hypothetical protein UM05474.1 [Ust...   446   e-123   
gi|400595792|gb|EJP63582.1| dolichyl-phosphate-mannose-protein m...   446   e-123   Beauveria bassiana ARSEF 2860
gi|452985856|gb|EME85612.1| glycosyltransferase family 39 protei...   445   e-123   Cercospora fijiensis CIRAD86
gi|425774255|gb|EKV12568.1| Protein O-mannosyl transferase [Peni...   445   e-122   Penicillium digitatum PHI26
gi|315044835|ref|XP_003171793.1| dolichyl-phosphate-mannose-prot...   444   e-122   Microsporum gypseum CBS 118893
gi|255931607|ref|XP_002557360.1| Pc12g05130 [Penicillium chrysog...   444   e-122   Penicillium rubens Wisconsin 54-1255
gi|320040582|gb|EFW22515.1| O-mannosyl transferase [Coccidioides...   444   e-122   Coccidioides posadasii str. Silveira
gi|321262843|ref|XP_003196140.1| dolichyl-phosphate-mannose-prot...   444   e-122   Cryptococcus gattii WM276
gi|303322440|ref|XP_003071213.1| Dolichyl-phosphate-mannose--pro...   444   e-122   Coccidioides posadasii C735 delta SOWgp
gi|388856084|emb|CCF50264.1| probable dolichyl-phosphate-mannose...   443   e-122   Ustilago hordei
gi|115385953|ref|XP_001209523.1| dolichyl-phosphate-mannose--pro...   443   e-122   Aspergillus terreus NIH2624
gi|320586039|gb|EFW98718.1| protein O-mannosyl transferase [Gros...   443   e-122   Grosmannia clavigera kw1407
gi|443920103|gb|ELU40091.1| protein O-mannosyl transferase [Rhiz...   442   e-122   Rhizoctonia solani AG-1 IA
gi|346319255|gb|EGX88857.1| dolichyl-phosphate-mannose-protein m...   442   e-122   Cordyceps militaris CM01
gi|212537941|ref|XP_002149126.1| protein O-mannosyl transferase ...   442   e-122   Talaromyces marneffei ATCC 18224
gi|240273718|gb|EER37237.1| dolichyl-phosphate-mannose-protein m...   442   e-121   Histoplasma capsulatum H143
gi|261192876|ref|XP_002622844.1| dolichyl-phosphate-mannose-prot...   441   e-121   Blastomyces gilchristii SLH14081
gi|239613563|gb|EEQ90550.1| dolichyl-phosphate-mannose-protein m...   441   e-121   Blastomyces dermatitidis ER-3
gi|345560349|gb|EGX43474.1| hypothetical protein AOL_s00215g210 ...   441   e-121   Arthrobotrys oligospora ATCC 24927
gi|336468287|gb|EGO56450.1| dolichyl-phosphate-mannose-protein m...   441   e-121   Neurospora tetrasperma FGSC 2508
gi|164428088|ref|XP_956270.2| dolichyl-phosphate-mannose-protein...   441   e-121   Neurospora crassa OR74A
gi|9368945|emb|CAB99175.1| probable dolichyl-phosphate-mannose--...   441   e-121   Neurospora crassa
gi|402084072|gb|EJT79090.1| dolichyl-phosphate-mannose-protein m...   440   e-121   Gaeumannomyces graminis var. tritici R3-111a-1
gi|225555541|gb|EEH03833.1| dolichyl-phosphate-mannose-protein m...   440   e-121   Histoplasma capsulatum G186AR
gi|403174471|ref|XP_003333435.2| dolichyl-phosphate-mannose-prot...   440   e-121   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|358378327|gb|EHK16009.1| glycosyltransferase family 39 protei...   439   e-121   Trichoderma virens Gv29-8
gi|358397085|gb|EHK46460.1| glycosyltransferase family 39 protei...   439   e-121   Trichoderma atroviride IMI 206040
gi|258569719|ref|XP_002543663.1| dolichyl-phosphate-mannose--pro...   439   e-121   Uncinocarpus reesii 1704
gi|119196351|ref|XP_001248779.1| hypothetical protein CIMG_02550...   438   e-120   Coccidioides immitis RS
gi|154288412|ref|XP_001545001.1| dolichyl-phosphate-mannose--pro...   437   e-120   Histoplasma capsulatum NAm1
gi|189195184|ref|XP_001933930.1| protein O-mannosyl-transferase ...   437   e-120   Pyrenophora tritici-repentis Pt-1C-BFP
gi|171689102|ref|XP_001909491.1| hypothetical protein [Podospora...   436   e-120   Podospora anserina S mat+
gi|471561503|gb|EMR63260.1| putative dolichyl-phosphate-mannose-...   436   e-120   Eutypa lata UCREL1
gi|330925781|ref|XP_003301191.1| hypothetical protein PTT_12634 ...   435   e-120   Pyrenophora teres f. teres 0-1
gi|336271891|ref|XP_003350703.1| hypothetical protein SMAC_02375...   435   e-120   Sordaria macrospora k-hell
gi|453087664|gb|EMF15705.1| glycosyltransferase family 39 protei...   435   e-119   Sphaerulina musiva SO2202
gi|452845997|gb|EME47930.1| glycosyltransferase family 39 protei...   435   e-119   Dothistroma septosporum NZE10
gi|156050067|ref|XP_001590995.1| hypothetical protein SS1G_07619...   435   e-119   Sclerotinia sclerotiorum 1980 UF-70
gi|169596911|ref|XP_001791879.1| hypothetical protein SNOG_01229...   434   e-119   Parastagonospora nodorum SN15
gi|406865997|gb|EKD19037.1| dolichyl-phosphate-mannose-protein m...   434   e-119   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|440631744|gb|ELR01663.1| dolichyl-phosphate-mannose-protein m...   432   e-119   Pseudogymnoascus destructans 20631-21
gi|346979040|gb|EGY22492.1| dolichyl-phosphate-mannose-protein m...   432   e-119   Verticillium dahliae VdLs.17
gi|367055346|ref|XP_003658051.1| glycosyltransferase family 39 p...   432   e-119   Thielavia terrestris NRRL 8126
gi|494824411|gb|EON61702.1| dolichyl-phosphate-mannose-protein m...   430   e-118   Coniosporium apollinis CBS 100218
gi|367035654|ref|XP_003667109.1| glycosyltransferase family 39 p...   429   e-118   Myceliophthora thermophila ATCC 42464
gi|399166390|emb|CCE32809.1| probable dolichyl-phosphate-mannose...   429   e-118   Claviceps purpurea 20.1
gi|389635487|ref|XP_003715396.1| dolichyl-phosphate-mannose-prot...   428   e-117   Magnaporthe oryzae 70-15
gi|440469185|gb|ELQ38305.1| dolichyl-phosphate-mannose-protein m...   428   e-117   Magnaporthe oryzae Y34
gi|398407257|ref|XP_003855094.1| Dolichyl-phosphate-mannose-prot...   427   e-117   Zymoseptoria tritici IPO323
gi|116204893|ref|XP_001228257.1| hypothetical protein CHGG_10330...   427   e-117   Chaetomium globosum CBS 148.51
gi|322710683|gb|EFZ02257.1| dolichyl-phosphate-mannose-protein m...   426   e-117   Metarhizium robertsii ARSEF 23
gi|470316308|gb|EMR08070.1| hypothetical protein PNEG_03510 [Pne...   426   e-117   Pneumocystis murina B123
gi|512202057|gb|EPE30885.1| MIR [Glarea lozoyensis ATCC 20868]        426   e-117   Glarea lozoyensis ATCC 20868
gi|322692625|gb|EFY84523.1| putative dolichyl-phosphate-mannose-...   425   e-116   Metarhizium acridum CQMa 102
gi|378728657|gb|EHY55116.1| dolichyl-phosphate-mannose-protein m...   425   e-116   Exophiala dermatitidis NIH/UT8656
gi|501756504|emb|CCG80557.1| Protein O-mannosyl transferase [Tap...   424   e-116   Taphrina deformans PYCC 5710
gi|388579301|gb|EIM19626.1| glycosyltransferase family 39 protei...   423   e-116   Wallemia mellicola CBS 633.66
gi|154317996|ref|XP_001558317.1| hypothetical protein BC1G_02981...   421   e-115   Botrytis cinerea B05.10
gi|347831485|emb|CCD47182.1| glycosyltransferase family 39 prote...   421   e-115   Botrytis cinerea T4
gi|430811869|emb|CCJ30725.1| unnamed protein product, partial [P...   421   e-115   Pneumocystis jirovecii
gi|511010539|gb|EPB91760.1| dolichyl-phosphate-mannose-protein m...   421   e-115   Mucor circinelloides f. circinelloides 1006PhL
gi|505755843|gb|EOR00037.1| Dolichyl-phosphate-mannose--protein ...   406   e-111   Wallemia ichthyophaga EXF-994
gi|361131365|gb|EHL03063.1| putative Dolichyl-phosphate-mannose-...   405   e-111   Glarea lozoyensis 74030
gi|465795908|emb|CCV00340.1| Protein O-mannosyltransferase-like ...   394   e-107   Malassezia sympodialis ATCC 42132
gi|384483971|gb|EIE76151.1| hypothetical protein RO3G_00855 [Rhi...   392   e-106   Rhizopus delemar RA 99-880
gi|328768324|gb|EGF78371.1| hypothetical protein BATDEDRAFT_2050...   385   e-105   Batrachochytrium dendrobatidis JAM81
gi|50549415|ref|XP_502178.1| YALI0C23364p [Yarrowia lipolytica] ...   380   e-103   Yarrowia lipolytica CLIB122
gi|302418096|ref|XP_003006879.1| dolichyl-phosphate-mannose-prot...   364   2e-98   Verticillium alfalfae VaMs.102
gi|164657398|ref|XP_001729825.1| hypothetical protein MGL_2811 [...   363   7e-98   Malassezia globosa CBS 7966
gi|320581398|gb|EFW95619.1| Protein O-mannosyltransferase [Ogata...   352   7e-95   
gi|27469358|ref|NP_009379.2| Pmt2p [Saccharomyces cerevisiae S28...   349   9e-94   Saccharomyces cerevisiae S288c
gi|151941369|gb|EDN59740.1| dolichyl phosphate-D-mannose:protein...   349   9e-94   Saccharomyces cerevisiae YJM789
gi|323334791|gb|EGA76163.1| Pmt2p [Saccharomyces cerevisiae AWRI...   349   1e-93   Saccharomyces cerevisiae AWRI796
gi|349576230|dbj|GAA21402.1| K7_Pmt2p [Saccharomyces cerevisiae ...   348   1e-93   Saccharomyces cerevisiae Kyokai no. 7
gi|207348012|gb|EDZ73997.1| YAL023Cp-like protein [Saccharomyces...   348   2e-93   Saccharomyces cerevisiae AWRI1631
gi|323306152|gb|EGA59884.1| Pmt2p [Saccharomyces cerevisiae Fost...   346   6e-93   Saccharomyces cerevisiae FostersB
gi|354545592|emb|CCE42320.1| hypothetical protein CPAR2_808690 [...   345   1e-92   Candida parapsilosis
gi|255732894|ref|XP_002551370.1| dolichyl-phosphate-mannose--pro...   344   3e-92   Candida tropicalis MYA-3404
gi|406602575|emb|CCH45891.1| dolichyl-phosphate-mannose-proteinm...   343   4e-92   Wickerhamomyces ciferrii
gi|50291311|ref|XP_448088.1| hypothetical protein [Candida glabr...   343   6e-92   Candida glabrata CBS 138
gi|444314239|ref|XP_004177777.1| hypothetical protein TBLA_0A046...   342   8e-92   Tetrapisispora blattae CBS 6284
gi|150863992|ref|XP_001382657.2| Phospho Mannno Transferase; dol...   342   8e-92   Scheffersomyces stipitis CBS 6054
gi|448520650|ref|XP_003868329.1| Pmt2 hypothetical protein manno...   342   1e-91   Candida orthopsilosis Co 90-125
gi|513032850|gb|AGO12842.1| AaceriACR290Wp [Saccharomycetaceae s...   340   4e-91   Saccharomycetaceae sp. 'Ashbya aceri'
gi|156839943|ref|XP_001643657.1| hypothetical protein Kpol_1040p...   340   4e-91   Vanderwaltozyma polyspora DSM 70294
gi|241953727|ref|XP_002419585.1| dolichyl-phosphate-D-mannose:pr...   339   7e-91   Candida dubliniensis CD36
gi|401626946|gb|EJS44859.1| pmt2p [Saccharomyces arboricola H-6]      339   8e-91   Saccharomyces arboricola H-6
gi|260943918|ref|XP_002616257.1| hypothetical protein CLUG_03498...   339   1e-90   Clavispora lusitaniae ATCC 42720
gi|238881078|gb|EEQ44716.1| dolichyl-phosphate-mannose-protein m...   339   1e-90   Candida albicans WO-1
gi|363755572|ref|XP_003648001.1| hypothetical protein Ecym_7356 ...   338   2e-90   Eremothecium cymbalariae DBVPG#7215
gi|68472223|ref|XP_719907.1| hypothetical protein CaO19.6812 [Ca...   338   2e-90   Candida albicans SC5314
gi|459365940|gb|EMG45430.1| Dolichyl-phosphate-mannose--protein ...   337   3e-90   Candida maltosa Xu316
gi|238597974|ref|XP_002394480.1| hypothetical protein MPER_05625...   336   7e-90   
gi|365762199|gb|EHN03800.1| Pmt2p [Saccharomyces cerevisiae x Sa...   335   1e-89   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|448099446|ref|XP_004199151.1| Piso0_002564 [Millerozyma farin...   333   5e-89   Millerozyma farinosa CBS 7064
gi|344232248|gb|EGV64127.1| PMT-domain-containing protein [Candi...   332   8e-89   Candida tenuis ATCC 10573
gi|294658242|ref|XP_460573.2| DEHA2F04840p [Debaryomyces hanseni...   332   1e-88   Debaryomyces hansenii CBS767
gi|149242363|ref|XP_001526455.1| dolichyl-phosphate-mannose-prot...   332   1e-88   Lodderomyces elongisporus NRRL YB-4239
gi|448103305|ref|XP_004200004.1| Piso0_002564 [Millerozyma farin...   332   1e-88   Millerozyma farinosa CBS 7064
gi|50311535|ref|XP_455792.1| hypothetical protein [Kluyveromyces...   331   3e-88   Kluyveromyces lactis NRRL Y-1140
gi|365989682|ref|XP_003671671.1| hypothetical protein NDAI_0H025...   330   5e-88   Naumovozyma dairenensis CBS 421
gi|344301487|gb|EGW31799.1| hypothetical protein SPAPADRAFT_6239...   330   6e-88   Spathaspora passalidarum NRRL Y-27907
gi|255713082|ref|XP_002552823.1| KLTH0D02266p [Lachancea thermot...   327   3e-87   Lachancea thermotolerans CBS 6340
gi|367017894|ref|XP_003683445.1| hypothetical protein TDEL_0H037...   326   9e-87   Torulaspora delbrueckii
gi|403218180|emb|CCK72671.1| hypothetical protein KNAG_0L00480 [...   325   1e-86   Kazachstania naganishii CBS 8797
gi|45185976|ref|NP_983692.1| ACR290Wp [Ashbya gossypii ATCC 1089...   321   3e-85   Eremothecium gossypii ATCC 10895
gi|254581354|ref|XP_002496662.1| ZYRO0D05258p [Zygosaccharomyces...   320   5e-85   Zygosaccharomyces rouxii CBS 732
gi|410078638|ref|XP_003956900.1| hypothetical protein KAFR_0D011...   317   3e-84   Kazachstania africana CBS 2517
gi|366994482|ref|XP_003677005.1| hypothetical protein NCAS_0F016...   316   9e-84   Naumovozyma castellii CBS 4309
gi|254568076|ref|XP_002491148.1| Protein O-mannosyltransferase, ...   315   1e-83   Komagataella phaffii GS115
gi|367006206|ref|XP_003687834.1| hypothetical protein TPHA_0L004...   313   4e-83   Tetrapisispora phaffii CBS 4417
gi|19115047|ref|NP_594135.1| protein O-mannosyltransferase Ogm2 ...   313   7e-83   Schizosaccharomyces pombe 972h-
gi|254574224|ref|XP_002494221.1| Protein O-mannosyltransferase, ...   311   2e-82   Komagataella phaffii GS115
gi|259149797|emb|CAY86601.1| Pmt3p [Saccharomyces cerevisiae EC1...   310   5e-82   Saccharomyces cerevisiae EC1118
gi|349581471|dbj|GAA26629.1| K7_Pmt3p [Saccharomyces cerevisiae ...   308   2e-81   Saccharomyces cerevisiae Kyokai no. 7
gi|6324897|ref|NP_014966.1| Pmt3p [Saccharomyces cerevisiae S288...   308   2e-81   Saccharomyces cerevisiae S288c
gi|256272582|gb|EEU07561.1| Pmt3p [Saccharomyces cerevisiae JAY291]   308   2e-81   Saccharomyces cerevisiae JAY291
gi|151945401|gb|EDN63644.1| dolichyl phosphate-D-mannose:protein...   308   3e-81   Saccharomyces cerevisiae YJM789
gi|323346365|gb|EGA80654.1| Pmt3p [Saccharomyces cerevisiae Lalv...   307   4e-81   Saccharomyces cerevisiae Lalvin QA23
gi|156837076|ref|XP_001642573.1| hypothetical protein Kpol_316p8...   306   7e-81   Vanderwaltozyma polyspora DSM 70294
gi|633652|emb|CAA58728.1| PMT3 [Saccharomyces cerevisiae]             306   9e-81   Saccharomyces cerevisiae [brewer's yeast]
gi|367004348|ref|XP_003686907.1| hypothetical protein TPHA_0H027...   305   1e-80   Tetrapisispora phaffii CBS 4417
gi|323307268|gb|EGA60549.1| Pmt3p [Saccharomyces cerevisiae Fost...   305   1e-80   Saccharomyces cerevisiae FostersO
gi|365758212|gb|EHN00065.1| Pmt3p [Saccharomyces cerevisiae x Sa...   303   4e-80   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|403215726|emb|CCK70225.1| hypothetical protein KNAG_0D04860 [...   301   2e-79   Kazachstania naganishii CBS 8797
gi|367014887|ref|XP_003681943.1| hypothetical protein TDEL_0E048...   301   3e-79   Torulaspora delbrueckii
gi|344305369|gb|EGW35601.1| hypothetical protein SPAPADRAFT_1317...   300   7e-79   Spathaspora passalidarum NRRL Y-27907
gi|406606320|emb|CCH42311.1| dolichyl-phosphate-mannose-proteinm...   298   1e-78   Wickerhamomyces ciferrii
gi|384496594|gb|EIE87085.1| hypothetical protein RO3G_11796 [Rhi...   298   2e-78   Rhizopus delemar RA 99-880
gi|320582731|gb|EFW96948.1| Protein O-mannosyltransferase [Ogata...   295   2e-77   
gi|401623527|gb|EJS41624.1| pmt3p [Saccharomyces arboricola H-6]      295   2e-77   Saccharomyces arboricola H-6
gi|255711158|ref|XP_002551862.1| KLTH0B01650p [Lachancea thermot...   290   4e-76   Lachancea thermotolerans CBS 6340
gi|366996587|ref|XP_003678056.1| hypothetical protein NCAS_0I004...   290   4e-76   Naumovozyma castellii CBS 4309
gi|255721445|ref|XP_002545657.1| hypothetical protein CTRG_00438...   287   4e-75   Candida tropicalis MYA-3404
gi|50287155|ref|XP_446007.1| hypothetical protein [Candida glabr...   286   5e-75   Candida glabrata CBS 138
gi|365982845|ref|XP_003668256.1| hypothetical protein NDAI_0A086...   285   2e-74   Naumovozyma dairenensis CBS 421
gi|50312059|ref|XP_456061.1| hypothetical protein [Kluyveromyces...   283   5e-74   Kluyveromyces lactis NRRL Y-1140
gi|365985898|ref|XP_003669781.1| hypothetical protein NDAI_0D022...   282   1e-73   Naumovozyma dairenensis CBS 421
gi|410083956|ref|XP_003959555.1| hypothetical protein KAFR_0K006...   281   2e-73   Kazachstania africana CBS 2517
gi|366987797|ref|XP_003673665.1| hypothetical protein NCAS_0A072...   281   3e-73   Naumovozyma castellii CBS 4309
gi|294656631|ref|XP_458928.2| DEHA2D10648p [Debaryomyces hanseni...   278   2e-72   Debaryomyces hansenii CBS767
gi|470308139|ref|XP_004363760.1| protein-O-mannosyltransferase 2...   276   7e-72   
gi|308198020|ref|XP_001387014.2| protein mannosyltransferase [Sc...   276   7e-72   Scheffersomyces stipitis CBS 6054
gi|366998505|ref|XP_003683989.1| hypothetical protein TPHA_0A048...   275   1e-71   Tetrapisispora phaffii CBS 4417
gi|207340887|gb|EDZ69098.1| YOR321Wp-like protein [Saccharomyces...   274   3e-71   Saccharomyces cerevisiae AWRI1631
gi|403216641|emb|CCK71137.1| hypothetical protein KNAG_0G00810 [...   273   5e-71   Kazachstania naganishii CBS 8797
gi|296413150|ref|XP_002836279.1| hypothetical protein [Tuber mel...   271   2e-70   Tuber melanosporum Mel28
gi|448088827|ref|XP_004196644.1| Piso0_003868 [Millerozyma farin...   270   4e-70   Millerozyma farinosa CBS 7064
gi|190344842|gb|EDK36600.2| hypothetical protein PGUG_00698 [Mey...   268   2e-69   Meyerozyma guilliermondii ATCC 6260
gi|241954746|ref|XP_002420094.1| dolichyl-phosphate-mannose-prot...   268   2e-69   Candida dubliniensis CD36
gi|146422773|ref|XP_001487321.1| hypothetical protein PGUG_00698...   267   3e-69   Meyerozyma guilliermondii ATCC 6260
gi|365760510|gb|EHN02225.1| Pmt6p [Saccharomyces cerevisiae x Sa...   267   4e-69   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|156848302|ref|XP_001647033.1| hypothetical protein Kpol_1050p...   265   1e-68   Vanderwaltozyma polyspora DSM 70294
gi|238881391|gb|EEQ45029.1| dolichyl-phosphate-mannose-protein m...   265   1e-68   Candida albicans WO-1
gi|410081413|ref|XP_003958286.1| hypothetical protein KAFR_0G011...   265   2e-68   Kazachstania africana CBS 2517
gi|68477313|ref|XP_717283.1| hypothetical protein CaO19.11283 [C...   263   5e-68   Candida albicans SC5314
gi|354544485|emb|CCE41209.1| hypothetical protein CPAR2_301980 [...   261   3e-67   Candida parapsilosis
gi|344233863|gb|EGV65733.1| PMT-domain-containing protein [Candi...   259   7e-67   Candida tenuis ATCC 10573
gi|260947120|ref|XP_002617857.1| hypothetical protein CLUG_01316...   258   2e-66   Clavispora lusitaniae ATCC 42720
gi|190406792|gb|EDV10059.1| dolichyl-phosphate-mannose-protein m...   258   3e-66   Saccharomyces cerevisiae RM11-1a
gi|259146701|emb|CAY79958.1| Pmt6p [Saccharomyces cerevisiae EC1...   257   4e-66   Saccharomyces cerevisiae EC1118
gi|323348459|gb|EGA82704.1| Pmt6p [Saccharomyces cerevisiae Lalv...   257   5e-66   Saccharomyces cerevisiae Lalvin QA23
gi|50291669|ref|XP_448267.1| hypothetical protein [Candida glabr...   257   5e-66   Candida glabrata CBS 138
gi|6321638|ref|NP_011715.1| Pmt6p [Saccharomyces cerevisiae S288...   257   5e-66   Saccharomyces cerevisiae S288c
gi|365765461|gb|EHN06969.1| Pmt6p [Saccharomyces cerevisiae x Sa...   256   6e-66   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|323354864|gb|EGA86697.1| Pmt6p [Saccharomyces cerevisiae VL3]      256   6e-66   Saccharomyces cerevisiae VL3
gi|323308951|gb|EGA62182.1| Pmt6p [Saccharomyces cerevisiae Fost...   256   6e-66   Saccharomyces cerevisiae FostersO
gi|207344990|gb|EDZ71953.1| YGR199Wp-like protein [Saccharomyces...   256   7e-66   Saccharomyces cerevisiae AWRI1631
gi|254585857|ref|XP_002498496.1| ZYRO0G11682p [Zygosaccharomyces...   256   9e-66   Zygosaccharomyces rouxii CBS 732
gi|151943475|gb|EDN61786.1| dolichyl phosphate-D-mannose:protein...   256   9e-66   Saccharomyces cerevisiae YJM789
gi|6561139|gb|AAF16867.1|AF104916_1 protein mannosyltransferase ...   255   1e-65   Candida albicans
gi|256271480|gb|EEU06529.1| Pmt6p [Saccharomyces cerevisiae JAY291]   255   2e-65   Saccharomyces cerevisiae JAY291
gi|349578404|dbj|GAA23570.1| K7_Pmt6p [Saccharomyces cerevisiae ...   255   2e-65   Saccharomyces cerevisiae Kyokai no. 7
gi|385302605|gb|EIF46729.1| dolichyl-phosphate-mannose-protein m...   254   3e-65   Brettanomyces bruxellensis AWRI1499
gi|157137169|ref|XP_001663919.1| mannosyltransferase 1, putative...   254   3e-65   Aedes aegypti
gi|459366657|gb|EMG45940.1| hypothetical protein G210_3836 [Cand...   254   4e-65   Candida maltosa Xu316
gi|389744218|gb|EIM85401.1| glycosyltransferase family 39 protei...   253   8e-65   Stereum hirsutum FP-91666 SS1
gi|402225913|gb|EJU05973.1| glycosyltransferase family 39 protei...   251   2e-64   Dacryopinax primogenitus
gi|390341472|ref|XP_786089.3| PREDICTED: protein O-mannosyl-tran...   251   3e-64   Strongylocentrotus purpuratus [purple urchin]
gi|444320295|ref|XP_004180804.1| hypothetical protein TBLA_0E023...   249   1e-63   Tetrapisispora blattae CBS 6284
gi|392569121|gb|EIW62295.1| glycosyltransferase family 39 protei...   246   6e-63   Trametes versicolor FP-101664 SS1
gi|471893796|emb|CCO31660.1| dolichyl-phosphate-mannose-proteinm...   246   9e-63   Rhizoctonia solani AG-1 IB
gi|392573539|gb|EIW66678.1| hypothetical protein TREMEDRAFT_4555...   246   9e-63   Tremella mesenterica DSM 1558
gi|449540788|gb|EMD31776.1| glycosyltransferase family 39 protei...   246   1e-62   Gelatoporia subvermispora B
gi|395330763|gb|EJF63146.1| glycosyltransferase family 39 protei...   244   2e-62   Dichomitus squalens LYAD-421 SS1
gi|302673186|ref|XP_003026280.1| glycosyltransferase family 39 p...   244   2e-62   Schizophyllum commune H4-8
gi|347968334|ref|XP_312249.5| AGAP002674-PA [Anopheles gambiae s...   244   3e-62   Anopheles gambiae str. PEST
gi|336389020|gb|EGO30163.1| glycosyltransferase family 39 protei...   244   4e-62   Serpula lacrymans var. lacrymans S7.9
gi|409081798|gb|EKM82157.1| hypothetical protein AGABI1DRAFT_355...   243   7e-62   Agaricus bisporus var. burnettii JB137-S8
gi|170106263|ref|XP_001884343.1| glycosyltransferase family 39 p...   243   8e-62   Laccaria bicolor S238N-H82
gi|385301795|gb|EIF45959.1| dolichyl-phosphate-mannose-protein m...   243   9e-62   Brettanomyces bruxellensis AWRI1499
gi|426198634|gb|EKV48560.1| hypothetical protein AGABI2DRAFT_678...   243   1e-61   Agaricus bisporus var. bisporus H97
gi|58266730|ref|XP_570521.1| hypothetical protein [Cryptococcus ...   241   3e-61   Cryptococcus neoformans var. neoformans JEC21
gi|125983634|ref|XP_001355582.1| GA11548 [Drosophila pseudoobscu...   241   4e-61   Drosophila pseudoobscura pseudoobscura
gi|195432490|ref|XP_002064256.1| GK20066 [Drosophila willistoni]...   240   6e-61   
gi|91086799|ref|XP_973439.1| PREDICTED: similar to mannosyltrans...   240   7e-61   Tribolium castaneum [rust-red flour beetle]
gi|393228305|gb|EJD35954.1| mannosyltransferase 1 [Auricularia d...   240   7e-61   Auricularia subglabra TFB-10046 SS5
gi|403416537|emb|CCM03237.1| predicted protein [Fibroporia radic...   239   9e-61   Fibroporia radiculosa
gi|358054342|dbj|GAA99268.1| hypothetical protein E5Q_05962 [Mix...   239   9e-61   Mixia osmundae IAM 14324
gi|213408807|ref|XP_002175174.1| dolichyl-phosphate-mannose-prot...   239   9e-61   
gi|444316886|ref|XP_004179100.1| hypothetical protein TBLA_0B076...   239   1e-60   Tetrapisispora blattae CBS 6284
gi|149237540|ref|XP_001524647.1| hypothetical protein LELG_04619...   239   1e-60   Lodderomyces elongisporus NRRL YB-4239
gi|472583626|gb|EMS21259.1| dolichyl-phosphate-mannose-protein m...   239   1e-60   Rhodotorula toruloides NP11
gi|332376358|gb|AEE63319.1| unknown [Dendroctonus ponderosae]         238   3e-60   Dendroctonus ponderosae
gi|478252392|gb|ENN72818.1| hypothetical protein YQE_10621, part...   238   3e-60   Dendroctonus ponderosae
gi|391339827|ref|XP_003744248.1| PREDICTED: protein O-mannosyl-t...   237   5e-60   Metaseiulus occidentalis
gi|195168592|ref|XP_002025115.1| GL26758 [Drosophila persimilis]...   237   5e-60   
gi|321474046|gb|EFX85012.1| hypothetical protein DAPPUDRAFT_3008...   236   6e-60   
gi|321262617|ref|XP_003196027.1| dolichyl-phosphate-mannose--pro...   236   1e-59   
gi|409049529|gb|EKM59006.1| glycosyltransferase family 39 protei...   235   1e-59   
gi|405119872|gb|AFR94643.1| dolichyl-phosphate-mannose-protein m...   234   2e-59   
gi|498958980|ref|XP_004524402.1| PREDICTED: protein O-mannosyl-t...   234   4e-59   
gi|195059379|ref|XP_001995623.1| GH17663 [Drosophila grimshawi] ...   234   4e-59   
gi|126282566|ref|XP_001374120.1| PREDICTED: protein O-mannosyl-t...   233   8e-59   
gi|299746945|ref|XP_001839434.2| mannosyltransferase 1 [Coprinop...   233   9e-59   
gi|260788358|ref|XP_002589217.1| hypothetical protein BRAFLDRAFT...   233   1e-58   
gi|340370628|ref|XP_003383848.1| PREDICTED: protein O-mannosyl-t...   231   2e-58   
gi|71024181|ref|XP_762320.1| hypothetical protein UM06173.1 [Ust...   231   4e-58   
gi|113680040|ref|NP_001038498.1| protein O-mannosyl-transferase ...   230   5e-58   
gi|340714118|ref|XP_003395579.1| PREDICTED: protein O-mannosyl-t...   229   9e-58   
gi|312385298|gb|EFR29833.1| hypothetical protein AND_00937 [Anop...   229   1e-57   
gi|331226126|ref|XP_003325733.1| dolichyl-phosphate-mannose-prot...   228   2e-57   
gi|149579988|ref|XP_001508555.1| PREDICTED: protein O-mannosyl-t...   228   2e-57   
gi|353241619|emb|CCA73422.1| related to dolichyl-phosphate-manno...   228   3e-57   
gi|328851930|gb|EGG01080.1| family 39 glycosyltransferase [Melam...   228   3e-57   
gi|513188453|ref|XP_004941882.1| PREDICTED: protein O-mannosyl-t...   228   3e-57   
gi|513188444|ref|XP_004941879.1| PREDICTED: protein O-mannosyl-t...   228   3e-57   
gi|513188476|ref|XP_004941889.1| PREDICTED: protein O-mannosyl-t...   228   3e-57   
gi|513188447|ref|XP_004941880.1| PREDICTED: protein O-mannosyl-t...   228   3e-57   
gi|327259306|ref|XP_003214479.1| PREDICTED: protein O-mannosyl-t...   227   4e-57   
gi|483519839|gb|EOB05507.1| Protein O-mannosyl-transferase 2, pa...   227   4e-57   
gi|513188456|ref|XP_004941883.1| PREDICTED: protein O-mannosyl-t...   227   4e-57   
gi|449504440|ref|XP_002200042.2| PREDICTED: protein O-mannosyl-t...   226   1e-56   
gi|315047182|ref|XP_003172966.1| dolichyl-phosphate-mannose-prot...   226   1e-56   
gi|452836944|gb|EME38887.1| glycosyltransferase family 39 protei...   226   1e-56   
gi|344274064|ref|XP_003408838.1| PREDICTED: protein O-mannosyl-t...   225   1e-56   
gi|336268530|ref|XP_003349029.1| hypothetical protein SMAC_06805...   225   2e-56   
gi|291406713|ref|XP_002719676.1| PREDICTED: protein-O-mannosyltr...   225   2e-56   
gi|395827596|ref|XP_003786985.1| PREDICTED: protein O-mannosyl-t...   225   2e-56   
gi|305407924|dbj|BAJ15896.1| protein O-mannnosyltransferase 2 [D...   225   2e-56   
gi|512886758|ref|XP_004921812.1| PREDICTED: protein O-mannosyl-t...   224   2e-56   
gi|393215283|gb|EJD00774.1| glycosyltransferase family 39 protei...   224   2e-56   
gi|307178110|gb|EFN66937.1| Protein O-mannosyl-transferase 2 [Ca...   224   3e-56   
gi|195469575|ref|XP_002099712.1| GE16638 [Drosophila yakuba] >gi...   224   3e-56   
gi|471361125|ref|XP_004371128.1| PREDICTED: protein O-mannosyl-t...   224   5e-56   
gi|195392626|ref|XP_002054958.1| GJ19054 [Drosophila virilis] >g...   223   5e-56   
gi|501305938|dbj|GAC95044.1| glycosyltransferase [Pseudozyma hub...   223   6e-56   
gi|500254571|gb|EON98163.1| putative glycosyltransferase family ...   223   6e-56   
gi|388857595|emb|CCF48744.1| related to dolichyl-phosphate-manno...   223   7e-56   
gi|392592448|gb|EIW81774.1| glycosyltransferase family 39 protei...   223   8e-56   
gi|332026676|gb|EGI66785.1| Protein O-mannosyl-transferase 2 [Ac...   223   8e-56   
gi|512206364|gb|EPE35184.1| MIR [Glarea lozoyensis ATCC 20868]        223   1e-55   
gi|300798194|ref|NP_001179825.1| protein O-mannosyl-transferase ...   222   1e-55   
gi|115402577|ref|XP_001217365.1| hypothetical protein ATEG_08779...   222   1e-55   
gi|345495435|ref|XP_001600041.2| PREDICTED: protein O-mannosyl-t...   222   2e-55   
gi|406695584|gb|EKC98887.1| hypothetical protein A1Q2_06858 [Tri...   222   2e-55   
gi|406868440|gb|EKD21477.1| dolichyl-phosphate-mannose-protein m...   222   2e-55   
gi|390594940|gb|EIN04348.1| glycosyltransferase family 39 protei...   221   2e-55   
gi|119493178|ref|XP_001263808.1| protein mannosyltransferase 1 [...   221   2e-55   
gi|114051267|ref|NP_001040579.1| protein O-mannosyl-transferase ...   221   2e-55   
gi|71000555|ref|XP_754961.1| protein mannosyltransferase 1 [Aspe...   221   2e-55   
gi|401889015|gb|EJT52958.1| hypothetical protein A1Q1_00705 [Tri...   221   2e-55   
gi|504144001|ref|XP_004584431.1| PREDICTED: protein O-mannosyl-t...   221   3e-55   
gi|512949488|ref|XP_004837190.1| PREDICTED: protein O-mannosyl-t...   221   3e-55   
gi|378728111|gb|EHY54570.1| dolichyl-phosphate-mannose-protein m...   221   3e-55   
gi|440633318|gb|ELR03237.1| dolichyl-phosphate-mannose-protein m...   221   3e-55   
gi|346980057|gb|EGY23509.1| dolichyl-phosphate-mannose-protein m...   221   3e-55   
gi|194912068|ref|XP_001982428.1| GG12810 [Drosophila erecta] >gi...   221   3e-55   
gi|512949490|ref|XP_004837191.1| PREDICTED: protein O-mannosyl-t...   221   4e-55   
gi|343427919|emb|CBQ71444.1| related to dolichyl-phosphate-manno...   221   4e-55   
gi|48479754|gb|AAT44965.1| protein O-D-mannosyltransferase [Aspe...   221   4e-55   
gi|443899715|dbj|GAC77044.1| dolichyl-phosphate-mannose:protein ...   221   4e-55   
gi|425778493|gb|EKV16618.1| Protein mannosyltransferase 1 [Penic...   221   4e-55   
gi|332223375|ref|XP_003260845.1| PREDICTED: LOW QUALITY PROTEIN:...   221   4e-55   
gi|512852698|ref|XP_004887625.1| PREDICTED: protein O-mannosyl-t...   220   4e-55   
gi|507629778|ref|XP_004698790.1| PREDICTED: protein O-mannosyl-t...   220   5e-55   
gi|443692391|gb|ELT93986.1| hypothetical protein CAPTEDRAFT_1525...   220   5e-55   
gi|296413391|ref|XP_002836397.1| hypothetical protein [Tuber mel...   220   5e-55   
gi|296215596|ref|XP_002754196.1| PREDICTED: protein O-mannosyl-t...   220   5e-55   
gi|402221652|gb|EJU01720.1| glycosyltransferase family 39 protei...   220   6e-55   
gi|119601682|gb|EAW81276.1| protein-O-mannosyltransferase 2, iso...   219   8e-55   
gi|300708453|ref|XP_002996405.1| hypothetical protein NCER_10050...   219   8e-55   
gi|350417293|ref|XP_003491351.1| PREDICTED: protein O-mannosyl-t...   219   8e-55   
gi|297695601|ref|XP_002825016.1| PREDICTED: protein O-mannosyl-t...   219   8e-55   
gi|32455271|ref|NP_037514.2| protein O-mannosyl-transferase 2 [H...   219   8e-55   
gi|7527762|gb|AAF63184.1|AC007375_3 POMT2 [Homo sapiens]              219   9e-55   
gi|6492005|gb|AAF14118.1|AF105020_1 putative protein O-mannosylt...   219   9e-55   
gi|302419831|ref|XP_003007746.1| dolichyl-phosphate-mannose-prot...   219   9e-55   
gi|426377587|ref|XP_004055543.1| PREDICTED: protein O-mannosyl-t...   219   1e-54   
gi|114654130|ref|XP_510091.2| PREDICTED: protein O-mannosyl-tran...   219   1e-54   
gi|19074049|ref|NP_584655.1| DOLICHOL-PHOSPHATE MANNOSE PROTEIN ...   219   1e-54   
gi|511003859|gb|EPB85247.1| dolichyl-phosphate-mannose-protein m...   219   1e-54   
gi|453080101|gb|EMF08153.1| glycosyltransferase family 39 protei...   219   1e-54   
gi|350297170|gb|EGZ78147.1| MIR-domain-containing protein [Neuro...   219   1e-54   
gi|326476823|gb|EGE00833.1| dolichyl-phosphate-mannose-protein m...   219   1e-54   
gi|386780997|ref|NP_001247555.1| protein O-mannosyl-transferase ...   219   1e-54   
gi|403264757|ref|XP_003924639.1| PREDICTED: protein O-mannosyl-t...   219   1e-54   
gi|402876816|ref|XP_003902149.1| PREDICTED: protein O-mannosyl-t...   219   1e-54   
gi|355778761|gb|EHH63797.1| hypothetical protein EGM_16837, part...   218   2e-54   
gi|348573431|ref|XP_003472494.1| PREDICTED: protein O-mannosyl-t...   218   2e-54   
gi|327306061|ref|XP_003237722.1| mannosyltransferase [Trichophyt...   218   2e-54   
gi|507619620|ref|XP_004624952.1| PREDICTED: protein O-mannosyl-t...   218   2e-54   
gi|472236717|gb|EMR81640.1| putative dolichyl-phosphate-mannose-...   218   3e-54   
gi|171676205|ref|XP_001903056.1| hypothetical protein [Podospora...   218   3e-54   
gi|336463603|gb|EGO51843.1| hypothetical protein NEUTE1DRAFT_709...   218   3e-54   
gi|154296172|ref|XP_001548518.1| hypothetical protein BC1G_12913...   218   3e-54   
gi|85118928|ref|XP_965543.1| hypothetical protein NCU01912 [Neur...   218   3e-54   
gi|363755600|ref|XP_003648015.1| hypothetical protein Ecym_7372 ...   218   3e-54   
gi|156056593|ref|XP_001594220.1| hypothetical protein SS1G_04027...   218   3e-54   
gi|194763309|ref|XP_001963775.1| GF21197 [Drosophila ananassae] ...   218   3e-54   
gi|449274822|gb|EMC83900.1| Protein O-mannosyl-transferase 2, pa...   217   4e-54   
gi|50949977|emb|CAH10531.1| hypothetical protein [Homo sapiens]       217   6e-54   
gi|239613828|gb|EEQ90815.1| mannosyltransferase 1 [Ajellomyces d...   216   7e-54   
gi|261193675|ref|XP_002623243.1| mannosyltransferase 1 [Ajellomy...   216   7e-54   
gi|255945045|ref|XP_002563290.1| Pc20g07670 [Penicillium chrysog...   216   8e-54   
gi|407918498|gb|EKG11769.1| Glycosyl transferase family 39 [Macr...   216   8e-54   
gi|405971700|gb|EKC36523.1| Protein O-mannosyl-transferase 2 [Cr...   216   8e-54   
gi|326426950|gb|EGD72520.1| hypothetical protein PTSG_11609 [Sal...   216   9e-54   
gi|477525858|gb|ENH77730.1| dolichyl-phosphate-mannose-protein m...   216   1e-53   
gi|116193829|ref|XP_001222727.1| hypothetical protein CHGG_06632...   216   1e-53   
gi|345566064|gb|EGX49011.1| hypothetical protein AOL_s00079g232 ...   216   1e-53   
gi|402084830|gb|EJT79848.1| dolichyl-phosphate-mannose-protein m...   215   2e-53   
gi|383859512|ref|XP_003705238.1| PREDICTED: protein O-mannosyl-t...   215   2e-53   
gi|440889727|gb|ELR44692.1| Protein O-mannosyl-transferase 2, pa...   215   2e-53   
gi|335292821|ref|XP_001926197.3| PREDICTED: protein O-mannosyl-t...   215   2e-53   
gi|70794795|ref|NP_700464.2| protein O-mannosyl-transferase 2 [M...   214   2e-53   
gi|310794004|gb|EFQ29465.1| dolichyl-phosphate-mannose-protein m...   214   3e-53   
gi|241862484|ref|XP_002416386.1| mannosyltransferase 1, putative...   214   3e-53   
gi|340975566|gb|EGS22681.1| hypothetical protein CTHT_0011540 [C...   214   3e-53   
gi|396080976|gb|AFN82596.1| dolichyl-phosphate-mannose-protein O...   214   3e-53   
gi|452987174|gb|EME86930.1| glycosyltransferase family 39 protei...   214   3e-53   
gi|471574442|gb|EMR72292.1| putative glycosyltransferase family ...   214   3e-53   
gi|225685248|gb|EEH23532.1| dolichyl-phosphate-mannose-protein m...   214   3e-53   
gi|19171639|gb|AAL85627.1|AF246235_1 putative protein O-mannosyl...   214   4e-53   
gi|226294582|gb|EEH50002.1| dolichyl-phosphate-mannose-protein m...   214   4e-53   
gi|302505014|ref|XP_003014728.1| hypothetical protein ARB_07290 ...   214   4e-53   
gi|302664390|ref|XP_003023825.1| hypothetical protein TRV_02022 ...   214   4e-53   
gi|355693469|gb|EHH28072.1| hypothetical protein EGK_18414 [Maca...   214   4e-53   
gi|148670974|gb|EDL02921.1| protein-O-mannosyltransferase 2, iso...   213   7e-53   
gi|321474044|gb|EFX85010.1| hypothetical protein DAPPUDRAFT_3008...   213   7e-53   
gi|380478393|emb|CCF43627.1| dolichyl-phosphate-mannose-proteinm...   213   7e-53   
gi|328723754|ref|XP_001946715.2| PREDICTED: protein O-mannosyl-t...   213   8e-53   
gi|410898349|ref|XP_003962660.1| PREDICTED: protein O-mannosyl-t...   213   8e-53   
gi|242813269|ref|XP_002486133.1| protein mannosyltransferase 1 [...   213   9e-53   
gi|295663138|ref|XP_002792122.1| dolichyl-phosphate-mannose-prot...   213   1e-52   
gi|367041866|ref|XP_003651313.1| glycosyltransferase family 39 p...   212   1e-52   
gi|389646243|ref|XP_003720753.1| dolichyl-phosphate-mannose-prot...   212   2e-52   
gi|301781949|ref|XP_002926401.1| PREDICTED: LOW QUALITY PROTEIN:...   212   2e-52   
gi|344249827|gb|EGW05931.1| Protein O-mannosyl-transferase 2 [Cr...   212   2e-52   
gi|320036568|gb|EFW18507.1| dolichyl-phosphate-mannose-protein m...   212   2e-52   
gi|354475009|ref|XP_003499722.1| PREDICTED: protein O-mannosyl-t...   212   2e-52   
gi|303313077|ref|XP_003066550.1| Dolichyl-phosphate-mannose-prot...   211   2e-52   
gi|258573579|ref|XP_002540971.1| hypothetical protein UREG_00484...   211   2e-52   
gi|507530717|ref|XP_004649442.1| PREDICTED: protein O-mannosyl-t...   211   2e-52   
gi|195134392|ref|XP_002011621.1| GI11129 [Drosophila mojavensis]...   211   2e-52   
gi|426234295|ref|XP_004011132.1| PREDICTED: protein O-mannosyl-t...   211   2e-52   
gi|494831216|gb|EON67708.1| dolichyl-phosphate-mannose-protein m...   211   3e-52   
gi|485915658|gb|EOD43229.1| putative protein mannosyltransferase...   211   3e-52   
gi|444708823|gb|ELW49862.1| Protein O-mannosyl-transferase 2 [Tu...   211   3e-52   
gi|317151146|ref|XP_001824472.2| protein mannosyltransferase 1 [...   211   4e-52   
gi|391868705|gb|EIT77915.1| dolichyl-phosphate-mannose,protein O...   211   4e-52   
gi|498934852|ref|XP_004540786.1| PREDICTED: protein O-mannosyl-t...   211   4e-52   
gi|66564240|ref|XP_623973.1| PREDICTED: protein O-mannosyl-trans...   211   4e-52   
gi|238505946|ref|XP_002384175.1| protein mannosyltransferase 1 [...   210   5e-52   
gi|83773212|dbj|BAE63339.1| unnamed protein product [Aspergillus...   210   5e-52   
gi|358369134|dbj|GAA85749.1| hypothetical protein AKAW_03863 [As...   210   5e-52   
gi|121704800|ref|XP_001270663.1| protein mannosyltransferase 1 [...   210   6e-52   
gi|511829034|ref|XP_004739233.1| PREDICTED: protein O-mannosyl-t...   210   6e-52   
gi|392864095|gb|EAS35103.2| dolichyl-phosphate-mannose-protein m...   209   1e-51   
gi|348520660|ref|XP_003447845.1| PREDICTED: protein O-mannosyl-t...   209   1e-51   
gi|465963931|ref|XP_004262326.1| PREDICTED: protein O-mannosyl-t...   209   1e-51   
gi|505829973|ref|XP_004610285.1| PREDICTED: protein O-mannosyl-t...   209   1e-51   
gi|119192122|ref|XP_001246667.1| dolichyl-phosphate-mannose--pro...   209   1e-51   
gi|505757572|gb|EOR01693.1| Dolichyl-phosphate-mannose--protein ...   209   1e-51   
gi|302921688|ref|XP_003053332.1| glycosyltransferase family 39 [...   209   2e-51   
gi|470604875|ref|XP_004313623.1| PREDICTED: LOW QUALITY PROTEIN:...   208   2e-51   
gi|357616666|gb|EHJ70322.1| putative mannosyltransferase 1 [Dana...   208   2e-51   
gi|196012118|ref|XP_002115922.1| hypothetical protein TRIADDRAFT...   208   2e-51   
gi|346320534|gb|EGX90134.1| protein mannosyltransferase 1 [Cordy...   208   2e-51   
gi|380025379|ref|XP_003696452.1| PREDICTED: protein O-mannosyl-t...   208   2e-51   
gi|498934856|ref|XP_004540787.1| PREDICTED: protein O-mannosyl-t...   207   3e-51   
gi|396469973|ref|XP_003838536.1| similar to dolichyl-phosphate-m...   207   3e-51   
gi|194225236|ref|XP_001491897.2| PREDICTED: protein O-mannosyl-t...   207   3e-51   
gi|401825526|ref|XP_003886858.1| dolichyl-phosphate-mannose-prot...   207   3e-51   
gi|444317252|ref|XP_004179283.1| hypothetical protein TBLA_0B094...   207   4e-51   
gi|507944954|ref|XP_004681723.1| PREDICTED: protein O-mannosyl-t...   207   5e-51   
gi|145245359|ref|XP_001394947.1| protein mannosyltransferase 1 [...   207   5e-51   
gi|429964884|gb|ELA46882.1| hypothetical protein VCUG_01656 [Vav...   207   6e-51   
gi|498934858|ref|XP_004540788.1| PREDICTED: protein O-mannosyl-t...   207   6e-51   
gi|320592584|gb|EFX05014.1| protein mannosyltransferase 1 [Grosm...   206   7e-51   
gi|388583041|gb|EIM23344.1| glycosyltransferase family 39 protei...   206   8e-51   
gi|240275187|gb|EER38702.1| dolichyl-phosphate-mannose-protein m...   206   8e-51   
gi|345803732|ref|XP_537521.3| PREDICTED: protein O-mannosyl-tran...   206   9e-51   
gi|482804363|gb|EOA81475.1| glycosyltransferase family 39 protei...   206   1e-50   
gi|472359528|ref|XP_004399379.1| PREDICTED: protein O-mannosyl-t...   206   1e-50   
gi|400595573|gb|EJP63368.1| glycosyltransferase family 39 [Beauv...   205   2e-50   
gi|350631659|gb|EHA20030.1| hypothetical protein ASPNIDRAFT_2090...   205   2e-50   
gi|303388498|ref|XP_003072483.1| dolichyl-phosphate-mannose-prot...   205   2e-50   
gi|478504304|ref|XP_004426453.1| PREDICTED: protein O-mannosyl-t...   205   2e-50   
gi|512860794|ref|XP_004917113.1| PREDICTED: protein O-mannosyl-t...   205   2e-50   
gi|512860787|ref|XP_002938909.2| PREDICTED: protein O-mannosyl-t...   205   2e-50   
gi|398388599|ref|XP_003847761.1| hypothetical protein MYCGRDRAFT...   204   3e-50   
gi|328770365|gb|EGF80407.1| hypothetical protein BATDEDRAFT_8857...   204   3e-50   
gi|399164477|emb|CCE34612.1| related to dolichyl-phosphate-manno...   204   4e-50   
gi|429851575|gb|ELA26760.1| dolichyl-phosphate-mannose-protein m...   204   4e-50   
gi|440491292|gb|ELQ73955.1| Dolichyl-phosphate-mannose:protein O...   204   5e-50   
gi|512860790|ref|XP_004917112.1| PREDICTED: protein O-mannosyl-t...   204   5e-50   
gi|511010155|gb|EPB91381.1| hypothetical protein HMPREF1544_0170...   203   8e-50   
gi|451852141|gb|EMD65436.1| glycosyltransferase family 39 protei...   202   1e-49   
gi|501755428|emb|CCG81347.1| Protein mannosyltransferase 1 [Taph...   202   1e-49   
gi|444316520|ref|XP_004178917.1| hypothetical protein TBLA_0B057...   202   1e-49   
gi|449302517|gb|EMC98526.1| glycosyltransferase family 39 protei...   202   2e-49   
gi|340519741|gb|EGR49979.1| glycosyltransferase family 39 [Trich...   201   3e-49   
gi|67537182|ref|XP_662365.1| hypothetical protein AN4761.2 [Aspe...   201   3e-49   
gi|351701872|gb|EHB04791.1| Protein O-mannosyl-transferase 2 [He...   201   3e-49   
gi|344230043|gb|EGV61928.1| hypothetical protein CANTEDRAFT_1252...   201   4e-49   
gi|513188450|ref|XP_004941881.1| PREDICTED: protein O-mannosyl-t...   201   5e-49   
gi|361124354|gb|EHK96454.1| putative Dolichyl-phosphate-mannose-...   200   5e-49   
gi|432937196|ref|XP_004082383.1| PREDICTED: protein O-mannosyl-t...   200   5e-49   
gi|477518933|gb|ENH71133.1| Dolichyl-phosphate-mannose--protein ...   200   5e-49   
gi|322702533|gb|EFY94173.1| dolichyl-phosphate-mannose-protein m...   200   6e-49   
gi|312383037|gb|EFR28269.1| hypothetical protein AND_04010 [Anop...   200   7e-49   
gi|431839159|gb|ELK01086.1| Protein O-mannosyl-transferase 2 [Pt...   200   7e-49   
gi|384491243|gb|EIE82439.1| hypothetical protein RO3G_07144 [Rhi...   200   8e-49   
gi|451997534|gb|EMD89999.1| glycosyltransferase family 39 protei...   199   1e-48   
gi|322693503|gb|EFY85361.1| Dolichyl-phosphate-mannose-protein m...   199   1e-48   
gi|189202610|ref|XP_001937641.1| dolichyl-phosphate-mannose-prot...   199   1e-48   


>gi|395333868|gb|EJF66245.1| glycosyltransferase family 39 protein [Dichomitus squalens LYAD-421
           SS1]
          Length = 824

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 239/405 (59%), Positives = 294/405 (72%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GSEQQQV+CYH+ D NNDW+IL    E  Y+  T 
Sbjct: 417 GSRVTLKNMGWGGGLLHSHVQTYPVGSEQQQVTCYHYKDENNDWVILPRWDEAPYDPETP 476

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD +            SH I APVT ++ EVS YGN T+GD  DYWV+EV+DD+
Sbjct: 477 LRFLKDGDAVRLQHASTTRNLHSHPIPAPVTKLNNEVSCYGNSTIGDFQDYWVVEVVDDI 536

Query: 121 YT----KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
           +     K  +I SLTT +R RH   GCYLRAANA+LPQWGFKQ+EVSCDK NNP D  T+
Sbjct: 537 HRGSKDKYEKIHSLTTRLRLRHQASGCYLRAANAVLPQWGFKQIEVSCDKENNPGDVHTY 596

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND+LP G +  Y+S FL DFWHLNVAM T+NNALVPDPDKEDILAS P  WP+
Sbjct: 597 WNVESHWNDRLPPGDQKLYKSPFLRDFWHLNVAMATSNNALVPDPDKEDILASKPTDWPL 656

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + VGLRMC W D   K+YL+G P+IWW GT SLV+ V T   YLIR+QRKY D+ P +W+
Sbjct: 657 LRVGLRMCGWGDHQTKYYLIGTPVIWWGGTISLVLGVLTAGVYLIRQQRKYVDMEPREWE 716

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLYVGKV  +GW+LHYLPF IMGRVTY+HHY P LYFS+LM A ++DHF  S +    +
Sbjct: 717 HFLYVGKVALVGWVLHYLPFMIMGRVTYIHHYLPTLYFSVLMLAHLLDHFVFSSRRFSQR 776

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I+FG+   +IV  FW+F+ +AFGI+ P ++    KW S WNI
Sbjct: 777 TKQIVFGVCVFVIVGTFWWFRGVAFGIDGPINDHWGLKWRSNWNI 821



>gi|170103424|ref|XP_001882927.1| glycosyltransferase family 39 protein [Laccaria bicolor S238N-H82]
 gi|164642298|gb|EDR06555.1| glycosyltransferase family 39 protein [Laccaria bicolor S238N-H82]
          Length = 683

 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 234/405 (57%), Positives = 296/405 (73%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NND+++L    E  YN    
Sbjct: 276 GSKLTLKNMGWGGGLLHSHVQSYPVGSTQQQVTCYHYKDSNNDFVVLPRWDEPPYNPNDP 335

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH + APVT +++EVS YGNET+GD++DYW +EV+DD+
Sbjct: 336 IRFLKDGDVIRLNHAATTRNLHSHTVLAPVTKLNYEVSCYGNETIGDNHDYWQVEVVDDI 395

Query: 121 YT----KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                   +RI SLTT +RF+H  LGCYLRAANAILPQWGFKQVEVSCDK NNP+D  T+
Sbjct: 396 KQGPKESVDRIHSLTTRLRFKHQALGCYLRAANAILPQWGFKQVEVSCDKENNPKDVHTY 455

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND+LP+G   +YRS FL DFWHLNVAM T+NNAL+PDPDKEDILAS P  WP 
Sbjct: 456 WNVESHWNDRLPAGDTKFYRSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPFDWPF 515

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D  +K+YL+G PIIWW+ + SL + +F L  YL+R QRKY D+   +WD
Sbjct: 516 LHLGLRMCGWGDTQLKYYLMGTPIIWWASSISLFVGLFALGIYLLRWQRKYHDMDAHEWD 575

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLYVGK+   GW+ HY+PF IMGRVTYLHHY P LYF++LM A ++DHF  S K    K
Sbjct: 576 HFLYVGKIAFFGWVFHYVPFLIMGRVTYLHHYLPTLYFAVLMLAHVLDHFIFSSKLLTTK 635

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            KNI FG++  L++  FW+FK +AFGI+ P ++ K  +W S+WNI
Sbjct: 636 VKNIFFGVFAFLLLFSFWWFKGVAFGIDGPIADTKGLQWRSSWNI 680



>gi|409045639|gb|EKM55119.1| glycosyltransferase family 39 protein [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 813

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 237/403 (58%), Positives = 298/403 (73%), Gaps = 5/403 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN+G+GGGLLHSH+  +P GS QQQV+CYH+ D NNDW++L    E  Y+   E
Sbjct: 408 GSKLTLKNVGYGGGLLHSHVQTFPVGSGQQQVTCYHYKDSNNDWVVLPRWDEPPYDPDGE 467

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH + APVT ++ EVS YGNET+GDD DYWV+EV+DDL
Sbjct: 468 IRFLKDGDVIRLNHVPTTRNLHSHTVPAPVTKLNHEVSCYGNETIGDDKDYWVVEVVDDL 527

Query: 121 YT--KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
            +  K +RI SLTT MRFRH +LGCYLRAANAILPQWGFKQVEVSCD  NNPRD+ T+WN
Sbjct: 528 KSREKPDRIHSLTTRMRFRHKVLGCYLRAANAILPQWGFKQVEVSCDNENNPRDAHTYWN 587

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E HWND+LP G   +Y+S FL DFWHLNVAM T+NNAL+PDPDKEDILAS P  WP + 
Sbjct: 588 VESHWNDRLPPGNAKHYKSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPFDWPFLR 647

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           +GLRMC W D+  K+YLLG PIIWW GT SL++ +  LL YL+R QRKY D+ P +WDHF
Sbjct: 648 LGLRMCGWGDNQTKYYLLGTPIIWWGGTISLILSLVVLLVYLMRLQRKYVDMEPREWDHF 707

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKP---KTK 355
           LYVGK+  +GW LH+ PF IMGRVTY+HHY P LYFS+LM A ++DHF  + +    +TK
Sbjct: 708 LYVGKIAFLGWFLHFFPFLIMGRVTYIHHYLPTLYFSVLMLAHLIDHFAFTSRRLSNQTK 767

Query: 356 NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            I+F ++ + IV+ FW++K +AFGI+ P ++     W  TWNI
Sbjct: 768 WIVFWVWVTAIVVTFWWWKGVAFGIDGPINDHWGLHWRKTWNI 810



>gi|299752673|ref|XP_001841164.2| dolichyl-phosphate-mannose-protein mannosyltransferase [Coprinopsis
           cinerea okayama7#130]
 gi|298409946|gb|EAU80701.2| dolichyl-phosphate-mannose-protein mannosyltransferase [Coprinopsis
           cinerea okayama7#130]
          Length = 758

 Score =  501 bits (1291), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 229/406 (56%), Positives = 297/406 (73%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW+IL   +E  ++ +  
Sbjct: 350 GSKVTLKNMGWGGGLLHSHVQTYPVGSNQQQVTCYHYKDNNNDWVILPRWEESKFDPVEG 409

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           E+ ++ +GD +            SH + APVT +++EVS YGN T+GD +DYW +EV+DD
Sbjct: 410 ELRYLKHGDIVRLNHAPTTRNLHSHTVTAPVTKLNYEVSCYGNSTVGDRHDYWQVEVVDD 469

Query: 120 L----YTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFT 175
           +         RI SLTT +RFRH +LGCYLRAANA+LPQWGFKQ+EVSCDK NNPRD+ T
Sbjct: 470 IKRGKLGPGERIHSLTTRLRFRHKVLGCYLRAANAVLPQWGFKQIEVSCDKENNPRDAHT 529

Query: 176 HWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           HWN+E HWN++LP+G    Y+S FL DFWHLNVAM T+NNAL+PDPDKEDILAS P  WP
Sbjct: 530 HWNVESHWNERLPAGNMKLYKSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPFDWP 589

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQW 295
           ++ +GLRMC W D+ +KFYLLG P+IWW+ T SLV+ + T   Y++R QRKY D+   +W
Sbjct: 590 LLHLGLRMCGWGDNQLKFYLLGTPVIWWASTISLVVGLMTFGVYMLRWQRKYVDMDQREW 649

Query: 296 DHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---P 352
           DHF+YVGK+   GW+ HY+PF IMGRVTYLHHY P LYF++LM + ++DHF  S +    
Sbjct: 650 DHFMYVGKIAFFGWVFHYVPFLIMGRVTYLHHYLPTLYFAVLMLSHVLDHFIFSSRRFST 709

Query: 353 KTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           KTK+I+FG+   +IV  FW+FK +AFGI  P +E    +W  TWNI
Sbjct: 710 KTKSIVFGVIAGIIVFTFWWFKGVAFGIQGPINEHWGLQWRKTWNI 755



>gi|390597618|gb|EIN07017.1| glycosyltransferase family 39 protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 690

 Score =  497 bits (1279), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/405 (57%), Positives = 293/405 (72%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN+G+GGGLLHSH+  YP GS QQQV+CYH+ D NN W+I  P  E +Y++ + 
Sbjct: 283 GSKLTLKNVGYGGGLLHSHVQTYPVGSNQQQVTCYHYKDDNNQWIIQPPWDEPVYDSSSP 342

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + ++ +GD I            SH + APV+  + EVS YGN T+GD +DYWV+EV+DDL
Sbjct: 343 LRYLKHGDVIRLQHAPTTRNLHSHNVPAPVSKHNNEVSCYGNATIGDYHDYWVVEVVDDL 402

Query: 121 Y----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
           +     K +RI SLTT MRF+H +LGCYLRAANAILPQWGFKQ+EVSCDK NNP+D+ T+
Sbjct: 403 HRGRREKVDRIHSLTTRMRFKHQVLGCYLRAANAILPQWGFKQIEVSCDKENNPKDTHTY 462

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWN++LP G   YY S F+ DFWHLNVAM T+NNAL+PDPDKEDILAS P  WP+
Sbjct: 463 WNVESHWNERLPPGDARYYSSPFIRDFWHLNVAMMTSNNALIPDPDKEDILASKPTDWPL 522

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D+  K+YLLG PIIWW  T SL + +  L  YL+R+QRKY D+ P +WD
Sbjct: 523 LRLGLRMCGWGDNQTKYYLLGTPIIWWGSTISLGLSLVVLGVYLLRQQRKYVDMEPREWD 582

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLYVGK+   GW LH+ PF IMGRVTYLHHY P LYF++LMAA ++DH   + +    K
Sbjct: 583 HFLYVGKIAFFGWFLHFFPFLIMGRVTYLHHYLPTLYFAVLMAAHLIDHAVFTSRRLTEK 642

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK IIFG+    IV  FW+FK +AFGI+ P +E     W  TWNI
Sbjct: 643 TKWIIFGVISFSIVACFWWFKGLAFGIDGPINEHWGLLWRKTWNI 687



>gi|392567232|gb|EIW60407.1| glycosyltransferase family 39 protein [Trametes versicolor
           FP-101664 SS1]
          Length = 822

 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 226/405 (55%), Positives = 294/405 (72%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GSEQQQV+CYH+ D NNDW++L P  +  Y+  T 
Sbjct: 415 GSKVTLKNMGWGGGLLHSHVQTYPVGSEQQQVTCYHYKDENNDWVLLPPWDQAPYSPETP 474

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + ++ +GD I            SH I APV+ ++ EVS YGN T+GD  DYWV+EV+DD+
Sbjct: 475 LRYLKDGDVIRLQHASTTRNLHSHPIPAPVSKLNNEVSCYGNATVGDYQDYWVVEVVDDI 534

Query: 121 Y----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
           +     K   I SLTT +RF+H   GCYLRAANAILPQWGFKQ+EVSC+K N+P+D  T+
Sbjct: 535 HRGHKAKFETIHSLTTRLRFKHHASGCYLRAANAILPQWGFKQIEVSCEKENDPKDVHTY 594

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND++P+G   +Y+S FL DFWHLNVAM T+NNALVPDPDKEDILAS P +WP 
Sbjct: 595 WNVESHWNDRMPAGDVRFYKSPFLRDFWHLNVAMATSNNALVPDPDKEDILASKPTEWPF 654

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + VGLRMC W D   K+YL+G P+IWW GT SL++    +L Y +R+QRK+ D+ P +W+
Sbjct: 655 LHVGLRMCGWGDQQTKYYLVGTPVIWWGGTISLILGGAAVLVYFMRQQRKFIDMDPREWE 714

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLYVGKV  +GWLLHY PF IMGRVTY+HHY P LYFS+LM + + DHF  + +    +
Sbjct: 715 HFLYVGKVAAVGWLLHYAPFMIMGRVTYIHHYLPTLYFSVLMFSHLTDHFIFTSRRLSDR 774

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I+FG+   +IV  FW+F+ +A+GI+ P +E    KW S WN+
Sbjct: 775 TKQIVFGVISFIIVATFWWFRGVAWGIDGPINEHWGLKWRSNWNL 819



>gi|302690208|ref|XP_003034783.1| glycosyltransferase family 39 protein [Schizophyllum commune H4-8]
 gi|300108479|gb|EFI99880.1| glycosyltransferase family 39 protein [Schizophyllum commune H4-8]
          Length = 796

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 226/406 (55%), Positives = 288/406 (70%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GS++TLKN G+GGGLLHSH+  +P GS+QQQV+CYH+ D NN+W ++   +E  YN N  
Sbjct: 388 GSKITLKNYGYGGGLLHSHVQTFPTGSKQQQVTCYHYKDNNNEWNVMPTWEEPDYNPNDP 447

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           E+ F+ +GD I            SH I APVT +++EV+ YGN+T+GD NDYWV+E++DD
Sbjct: 448 EIRFLQDGDVIRLQHVSTGRNLHSHTIPAPVTKLNYEVAGYGNQTVGDHNDYWVVEIVDD 507

Query: 120 LYTKTN----RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFT 175
           +   +     R+ SLTT +RFRH +L CYLRAANA+LPQWGFKQ+EVSCDK NNP+D+ T
Sbjct: 508 VKAGSKDQVPRVHSLTTRLRFRHKVLNCYLRAANAVLPQWGFKQIEVSCDKENNPKDTHT 567

Query: 176 HWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           +WN+E HWND+LP+G    YRS FL DFWHLNVAM T+NNALVPDPDKEDILAS P  WP
Sbjct: 568 YWNVEGHWNDRLPAGDMKLYRSPFLRDFWHLNVAMMTSNNALVPDPDKEDILASKPFDWP 627

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQW 295
            + +GLRMC W D+  K+YLLG P+IWW  T SL+  V  L  Y++R+QR+Y D+   +W
Sbjct: 628 FLHLGLRMCGWGDNQTKYYLLGTPVIWWGSTLSLMGAVLALGVYVLRKQRRYVDMDAREW 687

Query: 296 DHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---P 352
           DHFLYVGK+   GW LHY+PF IMGRVTYLHHY P LYF++LM   M+DHF  S +    
Sbjct: 688 DHFLYVGKIAFFGWALHYVPFLIMGRVTYLHHYLPTLYFAVLMLGHMLDHFIFSSRRFSE 747

Query: 353 KTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           KTK   FG     I   FW+FK ++FGI+ P +E     W  +WNI
Sbjct: 748 KTKLYTFGGIAFTIFACFWWFKGVSFGIDGPINEHWGLGWRKSWNI 793



>gi|449547134|gb|EMD38102.1| glycosyltransferase family 39 protein [Ceriporiopsis subvermispora
           B]
          Length = 823

 Score =  485 bits (1248), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/407 (56%), Positives = 289/407 (71%), Gaps = 9/407 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  +P GSEQQQV+CYH+ D NN+W IL    +  Y+    
Sbjct: 411 GSRVTLKNMGWGGGLLHSHVQTFPVGSEQQQVTCYHYKDENNEWTILPRWDQPEYDPNGP 470

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++FV +GD +            SH I AP+T ++ EVS YGN T+GD +DYWV+EV+DD+
Sbjct: 471 IKFVADGDIVRLRHVPTTRNLHSHSIPAPITKLNNEVSCYGNATIGDHHDYWVVEVVDDI 530

Query: 121 Y----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
           +       ++I SLTT +RFRH  LGCYLRAANAILPQWGFKQ+EVSCDK NNP D  T+
Sbjct: 531 HRGGKEHVDKIHSLTTRIRFRHHTLGCYLRAANAILPQWGFKQIEVSCDKENNPSDIHTY 590

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWN++LP+G    Y S FL DFWHLNVAM T+NNAL+PDPDKEDILAS P  WP 
Sbjct: 591 WNVESHWNERLPAGDPKVYHSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPSDWPF 650

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D   K+YLLG P+IWW+G  SL + +  L+ YL+R+QRK+ D+ P +WD
Sbjct: 651 LRLGLRMCGWGDLQTKYYLLGTPVIWWTGATSLCLAIPILIVYLMRQQRKFVDMEPREWD 710

Query: 297 HFLYVGKVCGIGWLLHY--LPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK--- 351
           HFLYVGK+   G+ LHY  +PF IMGRVTY+HHY P LYF++LMAA ++DHF  S K   
Sbjct: 711 HFLYVGKIAFFGFFLHYVPVPFMIMGRVTYVHHYLPTLYFAVLMAAHLLDHFVFSSKRLT 770

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            +TK I FGI   LIV  FW+F   AFGI+ P ++    KW S W +
Sbjct: 771 DRTKAISFGICAFLIVTCFWWFSGFAFGIDGPINDQWGLKWRSVWPL 817



>gi|336380210|gb|EGO21364.1| glycosyltransferase family 39 protein [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 812

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/405 (56%), Positives = 284/405 (70%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW++L    E  YN    
Sbjct: 405 GSKITLKNMGWGGGLLHSHVQTYPAGSTQQQVTCYHYKDDNNDWVVLPRWDESEYNPNDP 464

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH + APVT ++ EVS YGN T+GD +DYW +EV+DD+
Sbjct: 465 LHFLQDGDVIRLQHAATTRNLHSHNVPAPVTKLNNEVSCYGNATIGDYHDYWKVEVVDDI 524

Query: 121 YT----KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                 K +RI SLTT +RFRH  LGCYLRAAN++LPQWG+KQ+EVSCDK NNP D  T+
Sbjct: 525 KQGSKDKVDRIHSLTTRLRFRHDTLGCYLRAANSVLPQWGYKQIEVSCDKENNPNDPHTY 584

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND+LP     +++S FL DFWHLNVAM T+NNAL+PDPDK+DILAS P  WP 
Sbjct: 585 WNVESHWNDRLPPADTKFFKSPFLRDFWHLNVAMMTSNNALIPDPDKDDILASNPTDWPW 644

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D   K+YLLG PIIWW G+ASLV+    L  YL R QRKY D+   +WD
Sbjct: 645 MHLGLRMCGWGDHQPKYYLLGTPIIWWGGSASLVVSFIVLGVYLFRHQRKYIDMDSREWD 704

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC---KPK 353
           HFLYVGK+   GW LHY PF IMGRVTY+HHY P LYFS+LM + ++DHF  S    K K
Sbjct: 705 HFLYVGKIAFYGWFLHYAPFFIMGRVTYVHHYLPTLYFSVLMFSHLLDHFIFSSRRWKEK 764

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I FG+   LIV  FW+F+ +A+GI+ P +E     W  +WNI
Sbjct: 765 TKKISFGVCAFLIVANFWWFRGLAWGIDGPINEHWGLLWRKSWNI 809



>gi|389748450|gb|EIM89627.1| glycosyltransferase family 39 protein [Stereum hirsutum FP-91666
           SS1]
          Length = 766

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 225/407 (55%), Positives = 286/407 (70%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSRLTLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW+I     E   +   E
Sbjct: 358 GSRLTLKNMGWGGGLLHSHVQTYPVGSNQQQVTCYHYKDSNNDWVISPKWDEPPVDPQGE 417

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH I AP++ ++ EVSAYGN T+GD +DYWV+EV+DD+
Sbjct: 418 IRFLEDGDVIRLVHASTTRNLHSHNIVAPISKLNNEVSAYGNATIGDFHDYWVVEVVDDV 477

Query: 121 YTKT----NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                    +I SLTT +RFRH   GCYLRAAN  LP+WGFKQ+EVSCDK NNP+D  T+
Sbjct: 478 KRGAKGHFEKIHSLTTRLRFRHEASGCYLRAANNPLPEWGFKQIEVSCDKENNPKDIHTY 537

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWN++LP+G   +YRS FL DFWHLNVAM T+NNAL+PDPDKEDILAS P  WP 
Sbjct: 538 WNVESHWNERLPAGNAKFYRSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASKPTDWPW 597

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D   K+YLLG PIIWW GT SL++ V     Y++R QR++ D+   +W+
Sbjct: 598 LRLGLRMCGWGDSQTKYYLLGTPIIWWGGTLSLIVSVAATGIYVLRMQRRFVDMDAREWE 657

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLYVGK+   GW+LHY PF +MGRVTY+HHY P LYFS+LM A ++DHF  S +    +
Sbjct: 658 HFLYVGKIALFGWILHYAPFLVMGRVTYVHHYLPTLYFSVLMLAHLIDHFVFSSRRLSER 717

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           TK I+FG+  S IV  FW+FK +AFGI+ P +     +W  +WNI +
Sbjct: 718 TKWIVFGVCTSSIVFSFWWFKGVAFGIDGPINNHWGLQWRESWNIYE 764



>gi|393220398|gb|EJD05884.1| glycosyltransferase family 39 protein [Fomitiporia mediterranea
           MF3/22]
          Length = 820

 Score =  482 bits (1240), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 227/407 (55%), Positives = 285/407 (70%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN+G+GGGLLHSH+  YP GS QQQV+CYH+ D NN+W++L    E   +    
Sbjct: 410 GSKLTLKNVGYGGGLLHSHVQTYPVGSNQQQVTCYHYKDNNNEWVVLPKWDEPPVDLNGP 469

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH + AP++ ++ EVS YGN T+GD +DYW +EV+DDL
Sbjct: 470 IRFLQDGDVIRLQHGPSTRNLHSHNVPAPISKLNNEVSCYGNATVGDFHDYWKVEVVDDL 529

Query: 121 YT----KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                   +RI SLTT MR RH  +GCYLRAANAILP+WGFKQVEVSC K NNP D  T 
Sbjct: 530 KRGNKDHVDRIHSLTTRMRLRHERMGCYLRAANAILPEWGFKQVEVSCTKENNPTDVHTW 589

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND+LP+G   +Y+S FL DFWHLNVAM T+NNAL+PDPDKEDILAS P  WP 
Sbjct: 590 WNVESHWNDRLPAGDTKFYKSPFLRDFWHLNVAMMTSNNALIPDPDKEDILASNPTDWPF 649

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + VGLRMC W D   K+YLLG PIIWW+G+ +L++ +  L  YL+R+QRKYKD  P +W+
Sbjct: 650 LYVGLRMCGWGDQQTKYYLLGTPIIWWAGSTALIVALVVLGVYLLRQQRKYKDFDPDEWE 709

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLYVGKV  IGW LHY PF IMGRVTY+HHY P L+FS+LM A ++DHF  + +    +
Sbjct: 710 HFLYVGKVAFIGWALHYFPFLIMGRVTYIHHYLPTLFFSVLMFAHLLDHFVFTNRRLADR 769

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           TK  +FG+    IV  FW+F+ +AFGI+ P  E     W  TWNI D
Sbjct: 770 TKWAVFGVTAFAIVANFWWFRGLAFGIDGPIKEHWGLLWRKTWNIYD 816



>gi|403413793|emb|CCM00493.1| predicted protein [Fibroporia radiculosa]
          Length = 832

 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/407 (56%), Positives = 286/407 (70%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+ GGLLHSH+  YP GS QQQV+CYH+ D NNDW+IL    E  Y+    
Sbjct: 425 GSKITLKNMGWAGGLLHSHVQTYPVGSNQQQVTCYHYKDENNDWIILPKWDEPSYDAAAP 484

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+++GDTI            SH I APV+ ++ EVS YG++ +GD +DYWV+EV+DDL
Sbjct: 485 IRFLSDGDTIRLSHVSTRRNLHSHLIPAPVSKLNNEVSGYGDDKVGDFHDYWVVEVVDDL 544

Query: 121 Y----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                +  ++I SLTT +R RH   GCYLRAANAILPQWGFKQ+EVSCDK+NNP D  T+
Sbjct: 545 RRGSKSHVDKIHSLTTRLRLRHHATGCYLRAANAILPQWGFKQIEVSCDKDNNPGDVHTY 604

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E H N++LP G    YR+ F+ DFWHLNVAM TTNNALVPDPDKED+LAS P  WP 
Sbjct: 605 WNVETHTNERLPPGDHKLYRTSFIRDFWHLNVAMMTTNNALVPDPDKEDVLASKPSDWPW 664

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W     K+YLLG PI+WW GT SL + V  L  YL+R QRKY D+   +WD
Sbjct: 665 MTLGLRMCGWGPTQTKYYLLGTPIVWWGGTLSLFVGVAVLALYLMRIQRKYVDMEAREWD 724

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF---TVSCKPK 353
           HFLYV KV  +GWLLHY+PF IMGRVTY+HHY P LYFS+LMAA ++DHF   T     +
Sbjct: 725 HFLYVSKVAMLGWLLHYVPFLIMGRVTYVHHYLPTLYFSVLMAAHLLDHFFFTTRRLSER 784

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           TK I+FG     +V  FW+F  +AFGI+ P ++    +W S+WNI D
Sbjct: 785 TKWIVFGSAAFAVVASFWWFSGVAFGIDGPINDHWGLRWRSSWNIYD 831



>gi|409080813|gb|EKM81173.1| hypothetical protein AGABI1DRAFT_119690, partial [Agaricus bisporus
           var. burnettii JB137-S8]
          Length = 747

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 292/409 (71%), Gaps = 9/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSHI  YP GS QQQV+CYH+ D NN+W+IL P  E  Y+   E
Sbjct: 337 GSKVTLKNMGWGGGLLHSHIQTYPTGSNQQQVTCYHYKDNNNEWVILPPWNEAEYDPNAE 396

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD +            SH + AP++ +++EVS YGNET+GD +D W +EV+DD+
Sbjct: 397 LRFLKDGDLVRLNHPATTRNLHSHTVLAPISKLNYEVSGYGNETVGDVHDIWRVEVVDDI 456

Query: 121 YT------KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSF 174
           +       K + I SLTT +RF+H+ LGCYLRAANA+LPQWGFKQ+EVSCDK NN +D+ 
Sbjct: 457 HRGKLVPGKDDDIHSLTTRLRFKHNQLGCYLRAANAVLPQWGFKQIEVSCDKENNAKDAH 516

Query: 175 THWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQW 234
           T+WN+E HWND+LP+G    Y+S FL DFWHLNVAM T+NNALVPDPDK DILAS P  W
Sbjct: 517 TYWNVESHWNDRLPAGDMKLYKSPFLRDFWHLNVAMMTSNNALVPDPDKADILASKPFDW 576

Query: 235 PIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQ 294
           P++ +GLRMC W D  +K+YL+G P IWW GT SL+  + T   Y++R QRKY+D+   +
Sbjct: 577 PLLHLGLRMCGWGDAQLKYYLIGTPTIWWGGTVSLIAGLATWGVYVLRWQRKYQDMDVRE 636

Query: 295 WDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF---TVSCK 351
           W+HF+YVGKV  +GW  H++PF IMGRVTY+HHY P LYFS+LM A ++DHF   T    
Sbjct: 637 WEHFMYVGKVAFLGWAFHFVPFLIMGRVTYIHHYLPTLYFSVLMLAHVLDHFVFTTPRLS 696

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            K K+I FGI   +IV  FW+F+ ++FGI  P ++    +W  TWNI +
Sbjct: 697 HKNKSIAFGICAFVIVATFWWFRGVSFGIGGPINDHWGLRWRKTWNIYE 745



>gi|426197728|gb|EKV47655.1| hypothetical protein AGABI2DRAFT_205019, partial [Agaricus bisporus
           var. bisporus H97]
          Length = 747

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 291/409 (71%), Gaps = 9/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSHI  YP GS QQQV+CYH+ D NN+W+IL P  E  Y+    
Sbjct: 337 GSKVTLKNMGWGGGLLHSHIQTYPTGSNQQQVTCYHYKDNNNEWVILPPWNEAEYDPNAA 396

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + FV +GD +            SH + AP++ +++EVS YGNET+GD +D W +EV+DD+
Sbjct: 397 LRFVKDGDLVRLNHPATTRNLHSHTVLAPISKLNYEVSGYGNETVGDVHDIWRVEVVDDI 456

Query: 121 YT------KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSF 174
           +       K + I SLTT +RF+H+ LGCYLRAANA+LPQWGFKQ+EVSCDK NN +D+ 
Sbjct: 457 HRGKLVPGKDDDIHSLTTRLRFKHNQLGCYLRAANAVLPQWGFKQIEVSCDKENNAKDAH 516

Query: 175 THWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQW 234
           T+WN+E HWND+LP+G    Y+S FL DFWHLNVAM T+NNALVPDPDK DILAS P  W
Sbjct: 517 TYWNVESHWNDRLPAGDMKLYKSPFLRDFWHLNVAMMTSNNALVPDPDKADILASKPFDW 576

Query: 235 PIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQ 294
           P++ +GLRMC W D  +K+YL+G P IWW GT SL+  + T   Y++R QRKY+D+   +
Sbjct: 577 PLLHLGLRMCGWGDAQLKYYLIGTPTIWWGGTVSLIAGLATWGVYVLRWQRKYQDMDVRE 636

Query: 295 WDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF---TVSCK 351
           W+HF+YVGKV  +GW  H++PF IMGRVTY+HHY P LYFS+LM A ++DHF   T    
Sbjct: 637 WEHFMYVGKVAFLGWAFHFVPFLIMGRVTYIHHYLPTLYFSVLMLAHVLDHFVFTTPRLS 696

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            K K+I FGI   +IV  FW+F+ ++FGI  P ++    +W  TWNI +
Sbjct: 697 HKNKSIAFGICAFVIVATFWWFRGVSFGIGGPINDHWGLRWRKTWNIYE 745



>gi|472585868|gb|EMS23410.1| protein o-mannosyl transferase, glycosyltransferase family 39
           protein [Rhodosporidium toruloides NP11]
          Length = 858

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 225/409 (55%), Positives = 289/409 (70%), Gaps = 10/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKP--RKEQMYNNI 58
           GSR+TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NNDW +L P    +Q+    
Sbjct: 451 GSRITLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYKDENNDW-VLTPTWEADQIDLEN 509

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
            E+ F+ +GD +            SH IAAPVT +  EVS YGN T+GD NDYWV+EV+D
Sbjct: 510 GEIVFLRHGDQLRLVHASTGRNLHSHAIAAPVTKLANEVSCYGNATVGDSNDYWVVEVVD 569

Query: 119 DLYT----KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSF 174
           D       K +RI SL+T +RF+H   GCYLRAANA+LPQWGFKQVEVSC+K NNP+D  
Sbjct: 570 DFLRGARHKFDRIHSLSTRLRFKHLNSGCYLRAANAVLPQWGFKQVEVSCEKENNPKDEH 629

Query: 175 THWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQW 234
           T+WNIE HWN++LP+G +  YRS F  DFWHLNVAM T+NNALVPD DKED +AS P +W
Sbjct: 630 TYWNIESHWNERLPTGNQKLYRSPFFRDFWHLNVAMMTSNNALVPDADKEDTIASKPFEW 689

Query: 235 PIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQ 294
           P +  G+RM  W D  +K+YL+GNP+ WW  +ASL+++ FTLL++L+R QRK  D +P +
Sbjct: 690 PFLWNGMRMNGWQDFGIKYYLIGNPVTWWLSSASLIVWAFTLLWHLMRFQRKINDFAPGE 749

Query: 295 WDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK--- 351
           W+HFLY+ K+   GW  HY PF IMGRVTYLHHY P L+FS+LMA  ++DHF    +   
Sbjct: 750 WNHFLYLSKIAFGGWFFHYFPFLIMGRVTYLHHYLPTLWFSVLMAGVLLDHFFFRSRRLT 809

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +TK ++F I    +V  +W+F+  A+GI+ PAS L  RKW  TWNI D
Sbjct: 810 GRTKTLVFAIVAGAVVGTWWWFRACAWGIHGPASNLWGRKWRKTWNIYD 858



>gi|402218221|gb|EJT98298.1| glycosyltransferase family 39 protein [Dacryopinax sp. DJM-731 SS1]
          Length = 763

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/406 (56%), Positives = 287/406 (70%), Gaps = 9/406 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH + YP GS+QQQV+CYH+ D NN W+++    E+ Y+   +
Sbjct: 358 GSKITLKNMGWGGGLLHSHPHSYPTGSQQQQVTCYHYKDDNNHWLVMPRWDEKEYDPNGD 417

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GDT+            SH + AP+T ++ EVS YGN T+GD  D+W +EV+DDL
Sbjct: 418 LRFLQDGDTVRLIHASTGRNMHSHPLPAPITKLNNEVSCYGNATVGDHQDHWAVEVVDDL 477

Query: 121 ----YTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                 K +RI SLTT +R +H   GCYLRAANAILPQWG+KQVEVSC K NNPRD+ T+
Sbjct: 478 NMGSKDKVHRIHSLTTRLRLKHVAQGCYLRAANAILPQWGWKQVEVSCVKENNPRDAHTY 537

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND+LP G    YRS F  DFWHLNVAM T+NNAL+PDPDKEDILASTP QWP 
Sbjct: 538 WNVESHWNDRLPRGEVKLYRSPFFRDFWHLNVAMMTSNNALIPDPDKEDILASTPYQWPW 597

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + VGLRMC W D  +K+YLLGNPI+WWSGTASL++ +  L  YL+R QR+Y D  P QWD
Sbjct: 598 LNVGLRMCGWGDQQIKYYLLGNPIVWWSGTASLLLSLVALGVYLLRMQRRYNDFEPGQWD 657

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           H LYVGKV  IGW LHY PF  MGRVTY+HHY PAL+FS+LM   ++DHF    K    +
Sbjct: 658 HVLYVGKVALIGWFLHYFPFLAMGRVTYIHHYLPALWFSVLMTGHLLDHFIFKSKRLSER 717

Query: 354 TKNIIFGIYYSLIVI-VFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK  +F I+ +L VI  F +F+ I FGI  P  + K   W  +WNI
Sbjct: 718 TKWTVF-IFCALAVIETFLWFRGIVFGIEGPIQDYKGLLWRKSWNI 762



>gi|392577985|gb|EIW71113.1| hypothetical protein TREMEDRAFT_37568 [Tremella mesenterica DSM
           1558]
          Length = 823

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 226/406 (55%), Positives = 282/406 (69%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN G+GGGLLHSH+   P GS QQQV+CYH+ D NN W+I    +E   +    
Sbjct: 416 GSKLTLKNYGYGGGLLHSHVQTLPVGSLQQQVTCYHYKDDNNHWVITPTWEEDPVDFDGP 475

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + ++ +GD +            SH IAAPVT  ++EVS YGN T+GDDND WV+EV+DD 
Sbjct: 476 IRYLQHGDALRLVHSSTGRNLHSHSIAAPVTKENWEVSGYGNATIGDDNDIWVVEVVDDT 535

Query: 121 Y-----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFT 175
           +      K  RI SLTT MRFRH  L CYLRAANA+LPQWGFKQVEVSC K NNPRD  T
Sbjct: 536 HRSRKDQKDGRIHSLTTRMRFRHRTLDCYLRAANAVLPQWGFKQVEVSCVKENNPRDLHT 595

Query: 176 HWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           +WN+E HWND+LP G    Y+S F  DF HLNVAM+T+NNALVPDPDKEDILAS P  WP
Sbjct: 596 YWNVESHWNDRLPPGDLKLYKSPFWRDFVHLNVAMWTSNNALVPDPDKEDILASKPGDWP 655

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQW 295
            + +GLRMC W D  +K+YLLG PIIWW+ + SL + +    +YL+R QR+YKD +P QW
Sbjct: 656 FLRLGLRMCGWGDSQIKYYLLGTPIIWWASSVSLFVGLGLAGWYLLRMQRQYKDWAPGQW 715

Query: 296 DHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTK 355
           DHFLYVGKV   GW LHY+PF IMGRVTYLHHY P L+F++LMA  ++DH   S   ++ 
Sbjct: 716 DHFLYVGKVAFFGWFLHYVPFLIMGRVTYLHHYLPTLWFAVLMAGQVLDHLIFSSPRRSH 775

Query: 356 NII---FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            +    F ++ S +V+ FW+FKD+A GI+ P  +    KW S+WNI
Sbjct: 776 TVKVTWFVLWASGVVLSFWWFKDLALGIHGPVGDHWGWKWRSSWNI 821



>gi|67537870|ref|XP_662709.1| hypothetical protein AN5105.2 [Aspergillus nidulans FGSC A4]
 gi|14625800|gb|AAK71510.1| dolichyl-phosphate-mannose:protein mannosyltransferase [Emericella
           nidulans]
 gi|40743096|gb|EAA62286.1| hypothetical protein AN5105.2 [Aspergillus nidulans FGSC A4]
 gi|259484550|tpe|CBF80869.1| TPA: Dolichyl-phosphate-mannose:protein mannosyltransferasePutative
           uncharacterized protein ;
           [Source:UniProtKB/TrEMBL;Acc:Q96WN5] [Aspergillus
           nidulans FGSC A4]
          Length = 740

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 219/401 (54%), Positives = 277/401 (69%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   RKE  Y+    
Sbjct: 340 GSRVTLKNMGYGGGLLHSHVQTYPEGSSQQQVTCYHHKDANNDWFIYPNRKEPQYDAEAP 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + FV +GD I            SH I AP+T  H EVS YGN T+GDD D+W +EV+DD+
Sbjct: 400 LRFVGDGDVIRLIHGQTGRNLHSHNIPAPITKNHHEVSCYGNLTIGDDKDHWKVEVVDDV 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH++LGCYLRA N  LPQWGFKQ+E +C K N PRD +THWNI
Sbjct: 460 ASRDRSRIRTLTTAFRLRHAVLGCYLRAGNTNLPQWGFKQIETTCVKENKPRDVYTHWNI 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H ND+LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS P QWPI+ V
Sbjct: 520 ETHTNDRLPPGDPGSYKSPFFKDFVHLNVAMMTSNNALVPDPDKQDDLASKPWQWPILNV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW + VVK+YLLGNP+++W  T SL +F    L+YL+R QR Y +LS A  DH  
Sbjct: 580 GLRMCSWDEKVVKYYLLGNPVVYWGSTLSLAVFGLLTLWYLVRWQRGYNELSQADIDHIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHY+PF  M RVTY+HHY+PALY+++L   F +D  T +   K + +++
Sbjct: 640 YAGLYPVLGWFLHYVPFIAMARVTYVHHYYPALYYAILTFGFCVDWLTKTLNTKVRFLVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+L+  VF YF+ I FGI  P+ + +   WLS W I +
Sbjct: 700 GLLYALVAGVFVYFRVIVFGIEGPSQQWRHLNWLSGWRIAN 740



>gi|353238988|emb|CCA70916.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Piriformospora indica DSM 11827]
          Length = 827

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/407 (52%), Positives = 276/407 (67%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T KNMG+GGGLLHSH   YP GS+QQQV+CYH+ D NN W + KP      ++  +
Sbjct: 419 GSKVTFKNMGYGGGLLHSHTQTYPVGSQQQQVTCYHYKDDNNHWRVEKPWTSAPVDDEGD 478

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +EF+ + D +            SH +AAPVT ++ EVS YGN T GD  D+W++E++DD+
Sbjct: 479 IEFLKHNDVVRLVHTPTGRNLHSHTVAAPVTKLNNEVSCYGNTTTGDAGDHWIVEIVDDM 538

Query: 121 YTKTNR----IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                +    +RSLTT +RF+H  LGCYL A N +LP WGFKQ+EVSCDK NNP D  TH
Sbjct: 539 VLGKRQNVPHVRSLTTKLRFKHQQLGCYLVAPNTVLPPWGFKQIEVSCDKENNPNDPHTH 598

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWN +LP G   +Y+S F  DFWHLNVAM T+NNALVPD DKEDILAS+P  WP 
Sbjct: 599 WNVESHWNGRLPVGETKFYKSPFFRDFWHLNVAMMTSNNALVPDADKEDILASSPTDWPW 658

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D+  K+YL+GNP +WWSGTASL I V  +  YLIR QR Y+D    +WD
Sbjct: 659 LHLGLRMCGWGDNQTKYYLIGNPAVWWSGTASLGICVLVICVYLIRNQRGYRDWGVGEWD 718

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLYV K+ G+GW+  Y+PF IMGRVTY+HHY P LYF++LM   + DH     +    +
Sbjct: 719 HFLYVCKIAGLGWVFQYVPFLIMGRVTYIHHYLPTLYFAVLMVGHLFDHLVFKSRRFSER 778

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           TK IIF I   +++ VFW+F+ +AFGI+ P  E     W  TWNI +
Sbjct: 779 TKWIIFAIASGIVIGVFWWFRGVAFGIDGPIKEHWGLLWRKTWNIYE 825



>gi|471872546|emb|CCO36435.1| dolichyl-phosphate-mannose-proteinmannosyltransferase [Rhizoctonia
           solani AG-1 IB]
          Length = 407

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/404 (53%), Positives = 282/404 (69%), Gaps = 6/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKN+G+GGGLLHSH+  YP GS+QQQV+CYH+ D NN W+ + P      +   E
Sbjct: 3   GSKVTLKNVGYGGGLLHSHVQTYPVGSQQQQVTCYHYKDDNNHWVFIPPWGSPDIDPNGE 62

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +  + +G  +            SH + APVT  ++EVS YGN T+GD +D+WV+EV+DDL
Sbjct: 63  LVPLQHGSVVRLQHTSTTRNLHSHTVVAPVTKSNYEVSCYGNTTVGDSHDHWVVEVVDDL 122

Query: 121 Y----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
           +     K +RI SLTT +RFRH  LGCYLRAANA+LPQWGFKQ+EVSC K N+  D+ T+
Sbjct: 123 HRGRREKVDRIHSLTTRLRFRHQSLGCYLRAANAVLPQWGFKQIEVSCIKENDESDTHTY 182

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWN +LP G    Y S FL DFWHLN+AM T+NNALVPDPDKEDILAS P +WP 
Sbjct: 183 WNVESHWNSRLPPGNAKLYSSPFLRDFWHLNIAMMTSNNALVPDPDKEDILASKPTEWPF 242

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + VGLRMC W D+ VK+YLLG+PI+WWSG+ +L + +F    YL+R QRKY D  P +WD
Sbjct: 243 LHVGLRMCGWGDEQVKYYLLGHPIVWWSGSIALGLSLFATGVYLLRAQRKYVDFGPGEWD 302

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK--PKT 354
            F YV K+   GW+ H+ PF IMGRVTY+HHY PAL+FS+LM   + +HF  + +   +T
Sbjct: 303 QFSYVTKLAFFGWVFHFAPFLIMGRVTYIHHYLPALWFSVLMVGHLFNHFVFAARIPERT 362

Query: 355 KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           K I+F +  S+IV VFW+F+ IAFGI  P  +     W +TWNI
Sbjct: 363 KWIVFSVAVSIIVGVFWWFRGIAFGITGPIKDYWGLGWRNTWNI 406



>gi|471872537|emb|CCO36440.1| dolichyl-phosphate-mannose-proteinmannosyltransferase [Rhizoctonia
           solani AG-1 IB]
          Length = 407

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 217/404 (53%), Positives = 281/404 (69%), Gaps = 6/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKN+G+GGGLLHSH+  YP GS+QQQV+CYH+ D NN W  + P      +   E
Sbjct: 3   GSKVTLKNVGYGGGLLHSHVQTYPVGSQQQQVTCYHYKDDNNHWAFIPPWGSPDIDPNGE 62

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +  + +G  +            SH + APVT  ++EVS YGN T+GD +D+WV+EV+DDL
Sbjct: 63  LVPLQHGSVVRLQHTSTTRNLHSHTVVAPVTKSNYEVSCYGNTTVGDSHDHWVVEVVDDL 122

Query: 121 Y----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
           +     K +RI SLTT +RF+H  LGCYLRAANA+LPQWGFKQ+EVSC K N+  D+ T+
Sbjct: 123 HRGRREKVDRIHSLTTRLRFKHQTLGCYLRAANAVLPQWGFKQIEVSCIKENDESDAHTY 182

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWN +LP G    Y S FL DFWHLN+AM T+NNALVPDPDKEDILAS P +WP 
Sbjct: 183 WNVESHWNSRLPPGNAKLYSSPFLRDFWHLNIAMMTSNNALVPDPDKEDILASKPTEWPF 242

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + VGLRMC W D+ VK+YLLG+PI+WWSG+ +L + +F    YL+R QRKY D  P +WD
Sbjct: 243 LHVGLRMCGWGDEQVKYYLLGHPIVWWSGSIALGLSLFATGVYLLRAQRKYVDFGPGEWD 302

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK--PKT 354
            F YV K+   GW+ H+ PF IMGRVTY+HHY PAL+FS+LM   + +HF  + +   +T
Sbjct: 303 QFSYVTKLAFFGWVFHFAPFLIMGRVTYIHHYLPALWFSVLMVGHLFNHFVFAARIPERT 362

Query: 355 KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           K I+F I  S+IV VFW+F+ IAFGI  P  +     W +TWNI
Sbjct: 363 KWIVFSIAVSIIVGVFWWFRGIAFGITGPIKDYWGLGWRNTWNI 406



>gi|392595355|gb|EIW84678.1| glycosyltransferase family 39 protein [Coniophora puteana
           RWD-64-598 SS2]
          Length = 826

 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 283/405 (69%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GSEQQQV+CYH+ D NN+W IL    E  ++  ++
Sbjct: 419 GSRITLKNMGWGGGLLHSHVQTYPTGSEQQQVTCYHYKDNNNEWNILPRWDEPAFDPNSD 478

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SHE+A P+T V++EVS YGN T+GD +DYWV+EV+DD+
Sbjct: 479 MRFLKHGDIIRLQHGPSTRNLHSHEVAGPITKVNYEVSCYGNATVGDYHDYWVVEVLDDI 538

Query: 121 ----YTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                    +I +LTT +RFRHS LGCYL A    LPQWGFKQ+E +C K N+P D+ T 
Sbjct: 539 KQGKREHVEKIHALTTRLRFRHSTLGCYLHAGTVPLPQWGFKQIETTCIKENDPSDAHTI 598

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND+LP    +Y++S FL DFWHLNVAM T+NNAL+PD DKEDILAS P  WP+
Sbjct: 599 WNVEGHWNDRLPPADATYHKSPFLRDFWHLNVAMMTSNNALMPDVDKEDILASVPTDWPL 658

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D++ K+YL+G PI+WW    +++I VF L  YL+R QRKY D+   +W 
Sbjct: 659 MRLGLRMCGWGDEIPKYYLIGTPIVWWGSFVAIIISVFVLGAYLLRWQRKYVDMDAHEWG 718

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HFLYVGK+   GW LHY+PF IMGRVTY+HHY P LYF++LM   + DHF  S +    K
Sbjct: 719 HFLYVGKIAFYGWFLHYIPFFIMGRVTYVHHYLPTLYFAVLMFGHVFDHFFFSSRRLSTK 778

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I+FG+   LIV  FW+F+ +A+G+  P ++    +W  +WNI
Sbjct: 779 TKRIVFGVVTFLIVANFWWFRGLAWGMEGPINDHWGLQWRKSWNI 823



>gi|393245706|gb|EJD53216.1| glycosyltransferase family 39 protein [Auricularia delicata
           TFB-10046 SS5]
          Length = 688

 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/405 (53%), Positives = 279/405 (68%), Gaps = 7/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  +P GS+QQQV+CYH+ D NN W IL P  E   +   E
Sbjct: 283 GSRVTLKNMGYGGGLLHSHVQSFPTGSKQQQVTCYHYKDDNNHWQILPPWGEPPVDPNGE 342

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++F+ + D +            SH + APVT +  EVS YGNET+GD+ND+WV+EV+DD+
Sbjct: 343 IKFLQHNDVVRLQHVSTHRNLHSHAVPAPVTKLANEVSCYGNETIGDNNDHWVVEVVDDI 402

Query: 121 YTKT----NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
              +     RI SLTT +RF+H   GCYLRAAN ILPQWGFKQVEVSCDK+ +P D+ T+
Sbjct: 403 KQGSRQHVKRIHSLTTRLRFKHRRFGCYLRAANVILPQWGFKQVEVSCDKDTSPSDTHTY 462

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WNIE HWND+LPS     +RS F  DFWHLNVAM T+NNAL+PDPDKEDILAS P  WP 
Sbjct: 463 WNIENHWNDRLPSADAKQFRSPFWRDFWHLNVAMMTSNNALIPDPDKEDILASKPLDWPF 522

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D   K+YLLGNP++WW GT SL++ V  L  Y +R QRKY D  PA+ +
Sbjct: 523 MHLGLRMCGWGDHQTKYYLLGNPMVWWGGTVSLILAVVALGIYALRWQRKYVDFEPAELE 582

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
            +++  KV  +GW LH+LPF IMGRVTY+HHY PALYFS+L    ++D+F    +    +
Sbjct: 583 KYMFQNKVSLLGWTLHFLPFLIMGRVTYVHHYLPALYFSVLAFGMLVDNFVFQSRWLNRR 642

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            K  IF I    +V  FW+F+ +AFGI+ P  E K  +W  +WNI
Sbjct: 643 AKWTIFAIIVFAVVDTFWWFRGVAFGIDGPIGEHKGLQWRKSWNI 687



>gi|407918001|gb|EKG11300.1| Glycosyl transferase family 39 [Macrophomina phaseolina MS6]
          Length = 739

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 279/402 (69%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R E  Y    E
Sbjct: 338 GSRATIKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRFEPDYVVGEE 397

Query: 61  -VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            + F  +GD I            SH+IAAPV+   +EVS+YGN T+GD  D+W IEV+ D
Sbjct: 398 PMRFPKDGDVIRLIHAQTGRNLHSHQIAAPVSKADWEVSSYGNVTIGDSKDHWKIEVVSD 457

Query: 120 LYTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             ++  ++IR+LTTS R +H  LGCYLRA N  LPQWGFKQ+EV+C K NNPRD +THWN
Sbjct: 458 AASRDYSKIRTLTTSFRLKHVDLGCYLRAGNVNLPQWGFKQIEVTCTKTNNPRDVYTHWN 517

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E HWND+LP+G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS P QWPI+ 
Sbjct: 518 VESHWNDRLPAGDPGSYKSPFFRDFIHLNVAMMTSNNALVPDPDKQDDLASAPWQWPILH 577

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMC W D+ VK++LLGNP ++W+ TASL      + +YLIR QR Y +L PA  D  
Sbjct: 578 VGLRMCGWGDETVKYFLLGNPFVYWASTASLAGVGLIVAWYLIRWQRGYTELKPADIDQI 637

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    IGW LHY PF  M RVTY+HHYFPALYF++L   F++D FT + + + + ++
Sbjct: 638 HYAGIYPIIGWFLHYFPFVAMARVTYVHHYFPALYFAILTFTFVVDWFTRNARTQIRWVV 697

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +GI Y++ + +F YF+DI FG+  P+++ K  KW STW + D
Sbjct: 698 YGILYTVTLGLFIYFRDITFGMQGPSAQWKHLKWFSTWRVTD 739



>gi|358058654|dbj|GAA95617.1| hypothetical protein E5Q_02273 [Mixia osmundae IAM 14324]
          Length = 1715

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 213/393 (54%), Positives = 272/393 (69%), Gaps = 7/393 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GSEQQQV+CYH+ D NN+W+I    +    +  ++
Sbjct: 454 GSKITLKNMGYGGGLLHSHVQTYPVGSEQQQVTCYHYKDSNNEWIITPTWESPAVDPNSD 513

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + ++   D +            SH + APV+ ++ EVS YGN T+GD ND+W IE++DD 
Sbjct: 514 LLYLKGTDVVRLVHEPTLRNLHSHNVPAPVSKLNMEVSCYGNATVGDSNDHWQIEIVDDF 573

Query: 121 ----YTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
               +    RI SL+T MRFRH   GCYLRAANAILPQWGFKQVEVSCDK NN +D  T+
Sbjct: 574 LRGGHDPQMRIHSLSTRMRFRHVNSGCYLRAANAILPQWGFKQVEVSCDKTNNKKDEHTY 633

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WNIE HWND+LP G    YRS F  DFWHLNVAM T+NNALVPDPDKEDI+AS P  WP 
Sbjct: 634 WNIEGHWNDRLPRGDMKLYRSPFFRDFWHLNVAMMTSNNALVPDPDKEDIIASKPMDWPF 693

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +G+RM  W+D  VK+YL+GNPI+WW G+ SL  F+  L +Y++R+QRK  DLSP QW 
Sbjct: 694 LHLGMRMNGWSDASVKYYLVGNPIVWWGGSISLFAFLGLLSFYILRQQRKINDLSPHQWA 753

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK---PK 353
           HF + G++   GW LHYLPF IMGRVTYLHHY PAL+FS+LM   ++DHF    +   P 
Sbjct: 754 HFTHCGRIAFGGWALHYLPFLIMGRVTYLHHYLPALFFSVLMVGMLLDHFVFQSRRFAPN 813

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASE 386
            K  +F +  S IV  F +FK+ AFG+  P ++
Sbjct: 814 VKLAVFSLVASWIVGTFLWFKNTAFGLEGPITD 846



>gi|485925109|gb|EOD49758.1| putative dolichyl-phosphate-mannose-protein mannosyltransferase
           protein [Neofusicoccum parvum UCRNP2]
          Length = 740

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/402 (53%), Positives = 278/402 (69%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR TLKNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R +  Y     
Sbjct: 338 GSRATLKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRADPDYVVGED 397

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            + +  +G  +            SH+IAAPVT   +EVS+YGN T+GD  D+W IEV++D
Sbjct: 398 PIRYPQDGSVVRLIHAQTGRNLHSHQIAAPVTKADWEVSSYGNVTIGDTKDHWKIEVVND 457

Query: 120 LYTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             T   +RIR+LTTS R +H  LGCYLRA N  LPQWGFKQ+EV+C K NNPRD +THWN
Sbjct: 458 AATSDYSRIRTLTTSFRLKHIDLGCYLRAGNVNLPQWGFKQIEVTCTKTNNPRDVYTHWN 517

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E HWND+LP+     Y+S F+ DF HLNVAM T+NNALVPDPDK+D LAS P QWPI+ 
Sbjct: 518 VESHWNDRLPASDPGSYKSPFIRDFLHLNVAMMTSNNALVPDPDKQDDLASAPWQWPILH 577

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMC W D+ VK++LLGNP ++W+ TASL      + +YLIR QR Y +L P++ D  
Sbjct: 578 VGLRMCGWGDETVKYFLLGNPFVYWASTASLAGVALVIAWYLIRWQRGYVELKPSEIDQI 637

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    IGW LHY PF  M RVTY+HHYFPALYF++L   FM+D FT + + + + ++
Sbjct: 638 HYAGIYPIIGWFLHYFPFVAMARVTYVHHYFPALYFAILSFTFMVDWFTRNARSQIRWVV 697

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y++ + +F YF+DI FG+  P ++ K  KW STW +VD
Sbjct: 698 YGVLYAITLGLFVYFRDITFGMVGPNAQWKHLKWFSTWRVVD 739



>gi|121702259|ref|XP_001269394.1| protein O-mannosyl transferase [Aspergillus clavatus NRRL 1]
 gi|119397537|gb|EAW07968.1| protein O-mannosyl transferase [Aspergillus clavatus NRRL 1]
          Length = 740

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 279/401 (69%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R+E  Y+    
Sbjct: 340 GSRVTLKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWFIYPNRQEPEYDPQGP 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH I APVT   +EVS YGN T+GD+ D+W +EV+DD+
Sbjct: 400 LSFIGDGDIIRLIHGQTGRNLHSHTIPAPVTKSQYEVSCYGNVTIGDEKDHWAVEVVDDV 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWNI
Sbjct: 460 ASRDRSRIRTLTTAFRLRHIILGCYLRAGNVNLPQWGFKQIETTCAKENNPRDVYTHWNI 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H+ND+LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWP++ V
Sbjct: 520 ESHFNDRLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPVLNV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D ++K+YLLGNP+++W  T SL +F   +L++L R QR Y DLS A  DHF 
Sbjct: 580 GLRMCSWDDHIIKYYLLGNPVVYWGSTISLGVFGLLILWHLARWQRGYNDLSQADIDHFH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHYLPF IM RVTY+HHY+PALY+++L   F +D  T    P+ + ++F
Sbjct: 640 YSGFYPLVGWVLHYLPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTRPMSPRVRGVLF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++++ +F +F+ I FG+     +     WLS W I +
Sbjct: 700 GLLYTVVIGLFVHFQAIVFGMEGSNQQWAHLNWLSGWRIAN 740



>gi|482809248|gb|EOA86083.1| glycosyltransferase family 39 protein [Setosphaeria turcica Et28A]
          Length = 740

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 218/401 (54%), Positives = 276/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y    E
Sbjct: 340 GSRATLKNMGYGGGLLHSHVQTYPEGSAQQQVTCYHHKDSNNDWFFYPNRHEAPYQPDEE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F  NGD I            SH++AAPVT   +EVS YGN T+GD  D+WVIEV+ D 
Sbjct: 400 LRFPGNGDVIRLLHAQTGRNLHSHQVAAPVTKSDWEVSCYGNVTVGDTKDHWVIEVVRDA 459

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH  LGCYLRA N  LPQWGFKQ+E +C K NNP D +THWNI
Sbjct: 460 ASRDYSRIRTLTTAFRLRHKDLGCYLRAGNVNLPQWGFKQIETTCVKANNPSDVYTHWNI 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS+  QWPI+ V
Sbjct: 520 ESHTNERLPPGNPGDYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP+++W  TASL IF   +L+YL+R QR Y DL  ++ D   
Sbjct: 580 GLRMCGWNDDIVKYFLLGNPLVYWGSTASLGIFGLIVLFYLVRWQRGYDDLKQSEIDQIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY+PF  MGRVTY+HHY+PAL+F++L+  F +D  T     + +  IF
Sbjct: 640 YAGLYPVIGWFLHYVPFVAMGRVTYVHHYYPALWFAILVMGFCLDFVTRKLNKQIQWGIF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y  +++++W F+ I+FG+  P+S+ K  KWL +W I D
Sbjct: 700 GVLYLAVIVLYWLFRAISFGMVGPSSQWKHLKWLESWRITD 740



>gi|336367500|gb|EGN95845.1| glycosyltransferase family 39 protein [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 417

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 221/405 (54%), Positives = 275/405 (67%), Gaps = 21/405 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW++L    E  YN    
Sbjct: 24  GSKITLKNMGWGGGLLHSHVQTYPAGSTQQQVTCYHYKDDNNDWVVLPRWDESEYNPNDP 83

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH + APVT ++ EVS YGN T+GD +DYW +EV+DD+
Sbjct: 84  LHFLQDGDVIRLQHAATTRNLHSHNVPAPVTKLNNEVSCYGNATIGDYHDYWKVEVVDDI 143

Query: 121 YT----KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                 K +RI SLTT +RFRH  LGCYLRAAN++LPQWG+KQ+EVSCDK NNP D  T+
Sbjct: 144 KQGSKDKVDRIHSLTTRLRFRHDTLGCYLRAANSVLPQWGYKQIEVSCDKENNPNDPHTY 203

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND+LP     +++S FL DFWHLNVAM T+NNAL+PDPDK+DILAS P  WP 
Sbjct: 204 WNVESHWNDRLPPADTKFFKSPFLRDFWHLNVAMMTSNNALIPDPDKDDILASNPTDWPW 263

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D   K+YLLG PIIWW G+ASLV+    L  YL R QRKY D+   +WD
Sbjct: 264 MHLGLRMCGWGDHQPKYYLLGTPIIWWGGSASLVVSFIVLGVYLFRHQRKYIDMDSREWD 323

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC---KPK 353
           HFLYVGK+   GW LHY PF IMGRVTY+HHY P LYFS+LM + ++DHF  S    K K
Sbjct: 324 HFLYVGKIAFYGWFLHYAPFFIMGRVTYVHHYLPTLYFSVLMFSHLLDHFIFSSRRWKEK 383

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK                +F+ +A+GI+ P +E     W  +WNI
Sbjct: 384 TKKN--------------FFRGLAWGIDGPINEHWGLLWRKSWNI 414



>gi|295658182|ref|XP_002789653.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226283138|gb|EEH38704.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 745

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 215/399 (53%), Positives = 276/399 (69%), Gaps = 1/399 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  YN    
Sbjct: 343 GSQATLKNMGYGGGLLHSHVQSYPEGSGQQQITCYHHKDANNDWFFYPSRDEPDYNPEAP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ + D I            SH IAAPVT   +EVS YGN T+GD  D+WVIEV++D+
Sbjct: 403 LNFIGDKDVIRLVHAQTGRNLHSHPIAAPVTKSSYEVSGYGNTTIGDHKDHWVIEVVNDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +K  ++IR+LTT+ R RH++LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 463 ASKDRSKIRTLTTAFRLRHAVLGCYLRAGNVNLPQWGFKQIETTCVKQNNPRDIYTHWNV 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H ND+LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D L+S   +WPI+ V
Sbjct: 523 ESHINDRLPPGDPGSYKSPFLKDFLHLNVAMMTSNNALVPDPDKQDDLSSEFWEWPILHV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNPI++W GTASLV+    LL+YL+R QR Y +L+ A+ DH  
Sbjct: 583 GLRMCSWEDNVVKYFLLGNPIVYWGGTASLVVLSMILLWYLVRWQRGYDELNMAEIDHIY 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    I W  HY PF  M RVTY+HHY+PALYFS+L  AF ++ FT     K +  I+
Sbjct: 643 YSGIYPAIAWFFHYFPFIAMARVTYVHHYYPALYFSILTLAFCVNWFTRKLPAKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            + Y+ ++ +F +F+DI FG+  P+S+ +   W S W I
Sbjct: 703 TVLYAAVIGLFLHFRDIVFGMEGPSSKWEHLSWFSVWRI 741



>gi|169764100|ref|XP_001727950.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Aspergillus oryzae RIB40]
 gi|238490093|ref|XP_002376284.1| protein O-mannosyl transferase [Aspergillus flavus NRRL3357]
 gi|83770978|dbj|BAE61111.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220698672|gb|EED55012.1| protein O-mannosyl transferase [Aspergillus flavus NRRL3357]
 gi|391871204|gb|EIT80369.1| dolichyl-phosphate-mannose protein O-mannosyl transferase
           [Aspergillus oryzae 3.042]
          Length = 741

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/401 (53%), Positives = 282/401 (70%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSHI  YP GS QQQV+CYHH D NNDW I   R+E  Y+    
Sbjct: 341 GSRVTLKNMGYGGGLLHSHIQTYPEGSTQQQVTCYHHKDANNDWFIYPSRREPEYDPSAP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++FV +GD I            SH I+AP+T  H+EVS YGN T+GDD D+W++EV+DD+
Sbjct: 401 LKFVGDGDVIRLIHGQTGRNLHSHAISAPITKSHYEVSCYGNVTIGDDKDHWLVEVVDDV 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +K  ++IR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K N P D +THWN+
Sbjct: 461 ASKDRSKIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCVKENKPSDVYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H+ND+LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 521 ESHFNDRLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+ +K+YLLGNP ++W  T SL IF   +++YL+R QR Y +LS A  +H  
Sbjct: 581 GLRMCSWDDNTIKYYLLGNPFVYWGSTFSLGIFGLLVIWYLVRWQRGYNELSQADINHIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYLPF +MGRVTY+HHY+PALY+++L   F +D  T +   K++ +I+
Sbjct: 641 YSGLYPVIGWILHYLPFIVMGRVTYVHHYYPALYYAILTFGFCVDWLTQTMDVKSRWVIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y++IV +F +F+ + FGI   + +     WLS W I +
Sbjct: 701 SLLYAIIVGMFVHFRVLVFGIEGSSQQWGHLDWLSGWRIAN 741



>gi|242807915|ref|XP_002485056.1| protein O-mannosyl transferase [Talaromyces stipitatus ATCC 10500]
 gi|218715681|gb|EED15103.1| protein O-mannosyl transferase [Talaromyces stipitatus ATCC 10500]
          Length = 740

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/401 (54%), Positives = 276/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+  T 
Sbjct: 340 GSRVTLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFMYPNRYQPEYDPETP 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH +AAP+T   +EVS YGN T+GD+ D+W IEV+ D 
Sbjct: 400 LRFIGDGDVIRLIHAQTGRNLHSHSVAAPITKADWEVSCYGNTTVGDEKDHWKIEVVSDA 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R RH  LGCYLRA    LPQWGFKQ+E +C K N PRD +THWN+
Sbjct: 460 ASRDKSKIRTLTTAFRLRHESLGCYLRAGTVNLPQWGFKQIETTCVKENKPRDVYTHWNV 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 520 ETHVNERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNP+++W  TASLV F     +YLIR QR Y DLSP++ D   
Sbjct: 580 GLRMCSWDDNVVKYFLLGNPLVYWGSTASLVGFGLIFAWYLIRWQRGYVDLSPSEIDQIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYLPF +M RVTY+HHY+PALYF++L A F +D FT     K + +I+
Sbjct: 640 YAGVYPVIGWVLHYLPFVVMARVTYVHHYYPALYFAILTAGFCVDWFTRRLSTKVQWVIY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y  ++ +F+ FKDI FG+  P  +    KWLSTW I D
Sbjct: 700 IPLYIAVISLFFVFKDIVFGMEGPNRQWAYLKWLSTWRISD 740



>gi|406697559|gb|EKD00818.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Trichosporon asahii var. asahii CBS 8904]
          Length = 798

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 211/405 (52%), Positives = 281/405 (69%), Gaps = 9/405 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN G+GGGLLHSH+  +P GS+QQQV+CYH+ D NNDW++  P   +   +  E
Sbjct: 392 GSKLTLKNYGYGGGLLHSHVQTFPTGSQQQQVTCYHYKDNNNDWIVTPPWGGEF--DEEE 449

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + ++ +GD +            SH IAAPVT   +EVS YGN ++GD  D+WV+E++DD 
Sbjct: 450 LRYLKDGDVMRLVHASTGRNLHSHSIAAPVTKEAWEVSGYGNGSIGDTKDHWVVEIVDDT 509

Query: 121 YTKT----NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                    ++ +LTT MR RH  LGCYLRAAN+ILPQWGFKQVEV+C K+NNP+D  T+
Sbjct: 510 SRSKKDSDGKVHALTTRMRLRHKDLGCYLRAANSILPQWGFKQVEVTCTKDNNPKDVHTY 569

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND+LP+G   +Y+S F  DF HLNVAM+T+NNAL+PDPDKEDILAS P  WP 
Sbjct: 570 WNVESHWNDRLPAGNAKFYKSPFWRDFSHLNVAMWTSNNALIPDPDKEDILASAPSDWPF 629

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D  +KFYLLG PIIWW  +  +V  +   L+Y++R QR YKD +P +WD
Sbjct: 630 LHLGLRMCGWGDGQIKFYLLGTPIIWWFSSICVVGLLLVGLWYVLRMQRHYKDWAPGEWD 689

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC---KPK 353
           HFLYVGK+   GW  H++PF IMGRVTYLHHY P LYF++LMA  +++ F         +
Sbjct: 690 HFLYVGKIAFGGWFFHFIPFLIMGRVTYLHHYLPTLYFAVLMAGQVLNTFIFGSPRWSER 749

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I F  + S + + FW+F+D+A GI+ P ++ K  +W  +WNI
Sbjct: 750 TKLIWFIFWTSAVFLNFWWFRDMALGIHGPINDHKGWQWRRSWNI 794



>gi|401885936|gb|EJT50015.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Trichosporon asahii var. asahii CBS 2479]
          Length = 798

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 211/405 (52%), Positives = 281/405 (69%), Gaps = 9/405 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+LTLKN G+GGGLLHSH+  +P GS+QQQV+CYH+ D NNDW++  P   +   +  E
Sbjct: 392 GSKLTLKNYGYGGGLLHSHVQTFPTGSQQQQVTCYHYKDNNNDWIVTPPWGGEF--DEEE 449

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + ++ +GD +            SH IAAPVT   +EVS YGN ++GD  D+WV+E++DD 
Sbjct: 450 LRYLKDGDVMRLVHASTGRNLHSHSIAAPVTKEAWEVSGYGNGSIGDTKDHWVVEIVDDT 509

Query: 121 YTKT----NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                    ++ +LTT MR RH  LGCYLRAAN+ILPQWGFKQVEV+C K+NNP+D  T+
Sbjct: 510 SRSKKDSDGKVHALTTRMRLRHKDLGCYLRAANSILPQWGFKQVEVTCTKDNNPKDVHTY 569

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWND+LP+G   +Y+S F  DF HLNVAM+T+NNAL+PDPDKEDILAS P  WP 
Sbjct: 570 WNVESHWNDRLPAGNAKFYKSPFWRDFSHLNVAMWTSNNALIPDPDKEDILASAPSDWPF 629

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           + +GLRMC W D  +KFYLLG PIIWW  +  +V  +   L+Y++R QR YKD +P +WD
Sbjct: 630 LHLGLRMCGWGDGQIKFYLLGTPIIWWFSSICVVGLLLVGLWYVLRMQRHYKDWAPGEWD 689

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC---KPK 353
           HFLYVGK+   GW  H++PF IMGRVTYLHHY P LYF++LMA  +++ F         +
Sbjct: 690 HFLYVGKIAFGGWFFHFIPFLIMGRVTYLHHYLPTLYFAVLMAGQVLNTFIFGSPRWSER 749

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK I F  + S + + FW+F+D+A GI+ P ++ K  +W  +WNI
Sbjct: 750 TKLIWFIFWTSAVFLNFWWFRDMALGIHGPINDHKGWQWRRSWNI 794



>gi|46109306|ref|XP_381711.1| hypothetical protein FG01535.1 [Fusarium graminearum PH-1]
          Length = 741

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 277/401 (69%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ Y+   +
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYSPEGD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +   I            SH+IAAP+T  H EVS+YGN T+GD+ D+W +EVI D 
Sbjct: 401 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPITRGHKEVSSYGNLTVGDEKDHWKVEVIRDT 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K NNPRD++THWN+
Sbjct: 461 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP      Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWP + V
Sbjct: 521 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP+I+W  TASL I    +++Y++R QR   DLS  + DH  
Sbjct: 581 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIVWYILRWQRGVNDLSEKEIDHIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y       GW LHYLPF IM RVTY+HHY+PALYF++L   F++D FT +     K+I++
Sbjct: 641 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLIDWFTRNRNNTIKSIVY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++I+ ++ YF  I +G+  P  E K  KW   W + D
Sbjct: 701 GVLYTVIIGLYIYFIPICWGMTGPHKEYKYMKWFDNWRVTD 741



>gi|451994859|gb|EMD87328.1| glycosyltransferase family 39 protein [Bipolaris maydis C5]
 gi|477589451|gb|ENI06527.1| glycosyltransferase family 39 protein [Bipolaris maydis ATCC 48331]
          Length = 740

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/401 (53%), Positives = 274/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y    E
Sbjct: 340 GSRATLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHEVPYQPDEE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F  NGD I            SH++AAPVT   +EVS YGN T+GD  D+WV+EV+ D 
Sbjct: 400 LRFPGNGDVIRLIHAQTGRNLHSHQVAAPVTKSDWEVSCYGNTTVGDTKDHWVVEVVRDA 459

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +R+R+LTT+ R RH  LGCYLRA N  LPQWGFKQ+E +C K N+PRD +THWNI
Sbjct: 460 SSRDHSRLRTLTTAFRLRHKDLGCYLRAGNVNLPQWGFKQIETTCTKQNSPRDVYTHWNI 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS+  QWPI+ V
Sbjct: 520 ESHTNERLPPGNPGDYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP I+W  TASL IFV  + +YL+R QR Y DL   + D   
Sbjct: 580 GLRMCGWNDDIVKYFLLGNPAIYWGSTASLGIFVLIVFFYLVRWQRGYDDLKQWEIDQIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY+PF  MGRVTY+HHY+PAL+F++L+  F +D  T     + +  IF
Sbjct: 640 YAGIYPIIGWFLHYMPFVAMGRVTYVHHYYPALWFAILVMGFCLDFSTRKLPKQVQWGIF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y L++ ++W+F+ I+FG+  P+S+ +  KWL +W + D
Sbjct: 700 TALYVLVIGLYWFFRAISFGMVGPSSQWRHLKWLDSWKVTD 740



>gi|302907392|ref|XP_003049636.1| glycosyltransferase family 39 [Nectria haematococca mpVI 77-13-4]
 gi|256730572|gb|EEU43923.1| glycosyltransferase family 39 [Nectria haematococca mpVI 77-13-4]
          Length = 740

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/401 (52%), Positives = 278/401 (69%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R++  YN   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRRDDDYNPEAD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +G  I            SH+IAAP+T  H EVS+YGN T+GDD D+W IEV+ D 
Sbjct: 400 LRFIGDGSVIRLIHAQTGRNLHSHDIAAPITRGHKEVSSYGNLTVGDDKDHWKIEVVRDA 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K+NNPRD++THWN+
Sbjct: 460 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPRDTYTHWNV 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP      YRS F HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 520 EAHWNDKLPPAEAGVYRSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC WADD+VK++LLGNP+++W  TASL +    +++Y++R QR + DL+  + DH  
Sbjct: 580 GLRMCGWADDIVKYFLLGNPLVYWGSTASLGVAGLVVVWYILRWQRGFNDLNQDEIDHIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y       GW LHYLPF IM RVTY+HHY+PALYF++L   F++D F  +     K I++
Sbjct: 640 YSALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLVDWFVRNRNNTLKAIVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++I+ ++ YF  I +G+     + K  KW   W + D
Sbjct: 700 GLLYTVIIGLYIYFLPICWGMTGNHRQYKYMKWFDNWRVTD 740



>gi|408399963|gb|EKJ79052.1| hypothetical protein FPSE_00800 [Fusarium pseudograminearum CS3096]
          Length = 741

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 276/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ Y+   +
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYSPEGD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +   I            SH+IAAP+T  H EVS+YGN T+GD+ D+W +EVI D 
Sbjct: 401 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPITRGHKEVSSYGNLTVGDEKDHWKVEVIRDT 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K NNPRD++THWN+
Sbjct: 461 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP      Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWP + V
Sbjct: 521 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP+I+W  TASL I    + +Y++R QR   DLS  + DH  
Sbjct: 581 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIAWYILRWQRGVNDLSEKEIDHIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y       GW LHYLPF IM RVTY+HHY+PALYF++L   F++D FT +     K+I++
Sbjct: 641 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLIDWFTRNRNNTIKSIVY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++I+ ++ YF  I +G+  P  E K  KW   W + D
Sbjct: 701 GVLYTVIIGLYIYFIPICWGMTGPHKEYKYMKWFDNWRVTD 741



>gi|15011522|gb|AAK77607.1|AF396953_1 protein O-mannosyl transferase [Aspergillus awamori]
 gi|358369006|dbj|GAA85622.1| protein O-mannosyl transferase [Aspergillus kawachii IFO 4308]
          Length = 741

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSHI  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 341 GSRVTLKNMGYGGGLLHSHIQTYPEGSTQQQVTCYHHKDSNNDWFIYPNRYEPDYDPEDS 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + FV +GD I            SH I+APVT   FEVS YGN T+GDD D+W +EV+DD+
Sbjct: 401 LRFVGDGDIIRLIHGQTGRNLHSHAISAPVTKSQFEVSCYGNITIGDDKDHWAVEVVDDV 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K N P D +THWN+
Sbjct: 461 ASRDRSRIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCVKENKPSDVYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H+N++LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 521 ESHYNERLPPGDPGSYKSPFWKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+ +K+YLLGNP ++W  T SL IF   +L+YL+R QR Y +L+ A  DH  
Sbjct: 581 GLRMCSWDDNTIKYYLLGNPFVYWGSTLSLGIFALLVLWYLVRWQRGYTELTQADIDHIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYLPF +M RVTY+HHY+PALY+++L   F +D FT     K +  I+
Sbjct: 641 YSGLYPVIGWVLHYLPFAVMARVTYVHHYYPALYYAILTFGFCVDWFTQQMSNKLRWAIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y  IV +F YF+ I FGI  P+ +     W S W I +
Sbjct: 701 TLLYCAIVGLFAYFRAIVFGIEGPSQQWSHLNWFSGWRIAN 741



>gi|302510847|ref|XP_003017375.1| hypothetical protein ARB_04255 [Arthroderma benhamiae CBS 112371]
 gi|291180946|gb|EFE36730.1| hypothetical protein ARB_04255 [Arthroderma benhamiae CBS 112371]
          Length = 744

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/401 (53%), Positives = 276/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRSQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEV+ D+
Sbjct: 403 ISFIGDGDVIRLIHAQTGRNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT++R RH++LGCYLRA    LPQWGFKQ+E +C K N P D +THWNI
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP      Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 523 ESHVNERLPPSEPGTYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNP ++W  T SL +F   +L+YL+R QR Y +LS A+ DH  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFSLLVLWYLLRWQRGYAELSMAEIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPVVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y +I+ +F  FKDI FG+     + KS  WLS+W I +
Sbjct: 703 SVLYVIIIGLFIVFKDIVFGMEGSNQQWKSLNWLSSWKIAN 743



>gi|451846165|gb|EMD59476.1| glycosyltransferase family 39 protein [Bipolaris sorokiniana
           ND90Pr]
          Length = 740

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 274/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y    E
Sbjct: 340 GSRATLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHEVPYQPDEE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F  NGD I            SH++AAPVT   +EVS YGN T+GD  D+WV+EV+ D 
Sbjct: 400 LRFPGNGDVIRLIHAQTGRNLHSHQVAAPVTKSDWEVSCYGNTTVGDTKDHWVVEVVRDA 459

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +++R+LTT+ R RH  LGCYLRA N  LPQWGFKQ+E +C K N+PRD +THWNI
Sbjct: 460 SSRDYSKLRTLTTAFRLRHKDLGCYLRAGNVNLPQWGFKQIETTCTKQNSPRDVYTHWNI 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS+  QWPI+ V
Sbjct: 520 ESHTNERLPPGNPGDYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP I+W  TASL IFV  + +YL+R QR Y DL   + D   
Sbjct: 580 GLRMCGWNDDIVKYFLLGNPAIYWGSTASLGIFVLIVFFYLVRWQRGYDDLKQWEIDQIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY+PF  MGRVTY+HHY+PAL+F++L+  F +D  T     + +  IF
Sbjct: 640 YAGIYPIIGWFLHYVPFVAMGRVTYVHHYYPALWFAILVMGFCLDFSTRKLSKQVQWGIF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y L++ ++W+F+ I+FG+  P+S+ +  KWL +W + D
Sbjct: 700 TALYVLVIGLYWFFRAISFGMVGPSSQWRHLKWLDSWKVTD 740



>gi|429863305|gb|ELA37779.1| protein o-mannosyl transferase [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 738

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 209/401 (52%), Positives = 273/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R ++ Y+    
Sbjct: 338 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHDEDYDAEGP 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           V F+ +G TI            SHEIAAP+T    EVS+YGN T+GDD D+W +EV+ D+
Sbjct: 398 VRFIGDGSTIRLIHAQTGRNLHSHEIAAPITKADKEVSSYGNLTIGDDKDHWQVEVVRDV 457

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+EV+C K NNP+D++THWN+
Sbjct: 458 ASRDRSRIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIEVTCTKTNNPKDTYTHWNV 517

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP      Y+S FLHDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 518 EAHWNDKLPPADAGSYKSPFLHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 577

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TA L +F   +L+YL+R QR Y DL+  + D   
Sbjct: 578 GLRMCGWDDSIVKYFLLGNPLVYWGSTAGLGVFGLVVLWYLVRWQRGYSDLNEKELDQIH 637

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G     GW+LHYLPF +M RVTY+HHY+PALYF++L   F+ D F  + +   +  ++
Sbjct: 638 YAGVYPVAGWVLHYLPFIVMARVTYVHHYYPALYFAILTFGFLADWFLRNKQQAIQYGVY 697

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G  Y+ ++ ++  F  I FG+  P  +    KW  TW + D
Sbjct: 698 GALYAAVIGLYILFSPICFGMTGPNKQYSYMKWFDTWRMSD 738



>gi|48479770|gb|AAT44966.1| protein O-mannosyltransferase 2 [Aspergillus fumigatus]
          Length = 741

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/401 (52%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 341 GSRVTLKNMGYGGGLLHSHVQTYPDGSNQQQVTCYHHKDANNDWFIYPNRHEPEYDASGP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + FV +GD I            SH I AP+T   +EVS YGN T+GD+ D+W +EV+DD+
Sbjct: 401 LSFVGDGDVIRLIHGQTGRNLHSHAIPAPITKSQYEVSCYGNITIGDEKDHWAVEVVDDV 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 461 ASRDRSRIRTLTTAFRLRHIVLGCYLRAGNVNLPQWGFKQIETTCVKENNPRDVYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H+ND+LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 521 ESHFNDRLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+ +K+YLLGNP ++W  T SL +F   + +YL R QR YKDL+ A  DH  
Sbjct: 581 GLRMCSWDDNTIKYYLLGNPFVYWGSTFSLGVFGLLIFWYLARWQRGYKDLNQADIDHIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHY PF IM RVTY+HHY+PALY+++L   F +D  T    P  +  ++
Sbjct: 641 YSGFYPLLGWILHYFPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTQKMSPVARGSLY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +I+ +F +F+ I FGI  P+ +  +  WLS W I +
Sbjct: 701 AFLYVIIIGMFVHFRVIVFGIEGPSQQWANLNWLSGWRIAN 741



>gi|58259910|ref|XP_567365.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Cryptococcus neoformans var. neoformans JEC21]
 gi|134116410|ref|XP_773159.1| hypothetical protein CNBJ1540 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255780|gb|EAL18512.1| hypothetical protein CNBJ1540 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229415|gb|AAW45848.1| dolichyl-phosphate-mannose-protein mannosyltransferase, putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 807

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 218/406 (53%), Positives = 275/406 (67%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +TLKN G+GGGLLHSH+   P GS QQQV+CYH+ D NN+W I+ P      +    
Sbjct: 400 GSTVTLKNYGYGGGLLHSHVQTLPVGSLQQQVTCYHYKDENNNWQIVPPWGADPVDPDGP 459

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH IAAPVT   +EVS YGN T+GD+ND W++EV+DD 
Sbjct: 460 IRFLKDGDEIRLVHTQTGRNMHSHAIAAPVTKESWEVSGYGNLTIGDENDLWIVEVVDDT 519

Query: 121 YT-----KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFT 175
           +T     +  RI SLTT MR +H  L CYLRAANA+LPQWGFKQVEVSC K NNP+D  T
Sbjct: 520 HTSKKNNEDGRIHSLTTRMRLKHRQLNCYLRAANAVLPQWGFKQVEVSCTKENNPKDLHT 579

Query: 176 HWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           +WN+E HWND+LP+G    Y+S F  DF HLNVAM+T+NNALVPDPDKEDILAS P  WP
Sbjct: 580 YWNVESHWNDRLPAGNAKLYKSPFWRDFVHLNVAMWTSNNALVPDPDKEDILASQPFDWP 639

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQW 295
            + +GLRMC W D  +KFYLLG PIIWW  T SL I +    +Y+ R QR YK+    +W
Sbjct: 640 FLHLGLRMCGWGDHQIKFYLLGTPIIWWFSTISLAIGLGLAAWYVARMQRGYKEWKAGEW 699

Query: 296 DHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH--FTVSCKPK 353
           DH+L+ GKV   GW LH+ PF IMGRVTYLHHY P LYF++LMA  ++DH  F  S +  
Sbjct: 700 DHWLWAGKVAFGGWALHFFPFLIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASSTRSH 759

Query: 354 TKNII-FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           TK +I F ++  ++++ FW+FKD+A GI+   +      W S+WNI
Sbjct: 760 TKKLIWFAVWAGVVILSFWWFKDLALGISGNVNNHWGWGWRSSWNI 805



>gi|119496253|ref|XP_001264900.1| protein O-mannosyl transferase [Neosartorya fischeri NRRL 181]
 gi|119413062|gb|EAW23003.1| protein O-mannosyl transferase [Neosartorya fischeri NRRL 181]
          Length = 748

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/401 (52%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 348 GSRVTLKNMGYGGGLLHSHVQTYPDGSNQQQVTCYHHKDANNDWFIYPNRHEPEYDANGP 407

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + FV +GD I            SH I AP+T   +EVS YGN T+GD+ D+W +EV+DD+
Sbjct: 408 LSFVGDGDIIRLIHGQTGRNLHSHAIPAPITKSQYEVSCYGNITIGDEKDHWAVEVVDDV 467

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 468 ASRDRSRIRTLTTAFRLRHIVLGCYLRAGNVNLPQWGFKQIETTCVKENNPRDVYTHWNV 527

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H+ND+LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 528 ESHFNDRLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 587

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+ +K+YLLGNP ++W  T SL +F   + +YL R QR YKDL+ A  DH  
Sbjct: 588 GLRMCSWDDNTIKYYLLGNPFVYWGSTVSLGVFGLLIFWYLARWQRGYKDLNQADIDHIH 647

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHY PF IM RVTY+HHY+PALY+++L   F +D  T    P  +  ++
Sbjct: 648 YSGFYPLLGWILHYFPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTQKMSPVARGSLY 707

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +I+ +F +F+ I FGI  P+ +  +  WLS W I +
Sbjct: 708 AFLYMVIIGMFVHFRVIVFGIEGPSQQWANLNWLSGWRIAN 748



>gi|511007747|gb|EPB89028.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Mucor
           circinelloides f. circinelloides 1006PhL]
          Length = 754

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 211/406 (51%), Positives = 268/406 (66%), Gaps = 6/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---- 56
           GS+LT KN G+GGGLLHSH+  YP GS+QQQV+CYHH D NN W I  PR    +     
Sbjct: 345 GSKLTFKNTGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDDNNHWEIRPPRNSNAHEYEQP 404

Query: 57  -NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
            N   + FV +GD +            SH + APVT   +EVS YGNET+GD  D W +E
Sbjct: 405 ENEEFIRFVKDGDIVRLQHSSTGRNLHSHPVNAPVTASQWEVSCYGNETIGDIQDNWKVE 464

Query: 116 VIDD-LYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSF 174
           ++DD +Y    RIRSLTT  R RH   GC L A    LPQWGFKQ EV CDKNN   D +
Sbjct: 465 IVDDFIYHDKERIRSLTTRFRLRHVKQGCLLTADGTSLPQWGFKQSEVFCDKNNKTNDPY 524

Query: 175 THWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQW 234
           + WN+E+HWN+KLP+   + Y++ FL DF  LN+AM+T+NNAL PDPDK DIL+STP +W
Sbjct: 525 SMWNVEQHWNEKLPAAPPNAYKTHFLRDFITLNIAMWTSNNALTPDPDKYDILSSTPTEW 584

Query: 235 PIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQ 294
           P V VGLRMC W D+ +K+YLLGNP +WW   AS+  F  T  YYLIR QRK  DL+ AQ
Sbjct: 585 PFVTVGLRMCGWGDNDIKYYLLGNPAVWWLSIASIFAFCLTTAYYLIRMQRKINDLTLAQ 644

Query: 295 WDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT 354
           WDH+ Y GK   +GW  HY+PF IMGRVTYLHHYFPALYFS+LM  F+MDH+T +C    
Sbjct: 645 WDHYFYAGKTLFLGWFFHYIPFFIMGRVTYLHHYFPALYFSILMVPFLMDHYTRNCSKAV 704

Query: 355 KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +  +F   Y +++ VF +F  ++FG+  P  +     W +TWN+++
Sbjct: 705 QWAVFIPVYVIVIGVFIHFAPVSFGLTGPIKDYSHLVWRNTWNLIE 750



>gi|477520408|gb|ENH72534.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Fusarium
           oxysporum f. sp. cubense race 1]
          Length = 740

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 275/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ YN   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYNPEGD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +   I            SH+IAAPVT  H EVS+YGN T+GDD D+W +EV+ D 
Sbjct: 400 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPVTRGHKEVSSYGNLTVGDDKDHWKVEVVRDS 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K NNPRD++THWN+
Sbjct: 460 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP      Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWP + V
Sbjct: 520 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP+I+W  TASL I    +++Y++R QR   DLS  + DH  
Sbjct: 580 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIVWYILRWQRGVNDLSENEIDHIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y       GW LHYLPF IM RVTY+HHY+PALYF++L   F++D FT +     + I++
Sbjct: 640 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLVDWFTRNRNKTIQTIVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GI Y++I+ ++ YF  I +G+     + K  KW   W + D
Sbjct: 700 GILYTVIIGLYIYFIPICWGMTGNHKQYKYMKWFDNWRVTD 740



>gi|384488399|gb|EIE80579.1| hypothetical protein RO3G_05284 [Rhizopus delemar RA 99-880]
          Length = 748

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/406 (53%), Positives = 270/406 (66%), Gaps = 7/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK---EQMYN- 56
           GS LT+KN GFGGGLLHSHI  YP GS+QQQV+CYHH D NN W I  PR+   EQ Y+ 
Sbjct: 338 GSNLTIKNAGFGGGLLHSHIQTYPEGSKQQQVTCYHHKDENNHWTIRPPREQDDEQSYDQ 397

Query: 57  --NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
             N   + F+ +GD I            SH + AP+T   +EVS YG +T+GD  D W +
Sbjct: 398 PDNPDFIRFLKDGDLIRLTHISTNRNLHSHPVNAPITTGQWEVSCYGTDTVGDTQDNWKV 457

Query: 115 EVIDDL-YTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDS 173
           E++DD  Y   +RIRSLTT  R RH  LGC L A N +LPQWGFKQVEV CDK N+  + 
Sbjct: 458 EIVDDFNYQNKDRIRSLTTRFRLRHERLGCLLTADNTVLPQWGFKQVEVYCDKRNDTENP 517

Query: 174 FTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQ 233
            + WN+E+HWN KLP   ++ Y+S FL DF  LNVAM+T+NNAL PDPDK DIL+S P +
Sbjct: 518 HSMWNVEQHWNTKLPPAPRNAYKSPFLRDFITLNVAMWTSNNALTPDPDKVDILSSEPSE 577

Query: 234 WPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA 293
           WP+  VGLRMC W D  VK+YLLGNPI+WW    ++ +F  T   Y+IR QRK  DL+ A
Sbjct: 578 WPLATVGLRMCGWGDKQVKYYLLGNPIVWWLSIGAIFVFCLTTGVYVIRMQRKIFDLTNA 637

Query: 294 QWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPK 353
           QWDHF YVGK   +GW  HY+PF IMGRVTYLHHYFPALYFS+LM  F+MDHFT     +
Sbjct: 638 QWDHFFYVGKTLFLGWFFHYIPFFIMGRVTYLHHYFPALYFSILMVPFLMDHFTQHKSVR 697

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            +  +F   Y  ++  F +F  I+FG+  P ++    +WL TWN+V
Sbjct: 698 VQWAVFIPVYLAVIATFIHFAPISFGLEGPITDYTYLEWLKTWNLV 743



>gi|342878828|gb|EGU80117.1| hypothetical protein FOXB_09392 [Fusarium oxysporum Fo5176]
          Length = 740

 Score =  452 bits (1162), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 275/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ YN   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYNPEGD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +   I            SH+IAAPVT  H EVS+YGN T+GDD D+W +EV+ D 
Sbjct: 400 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPVTRGHKEVSSYGNLTVGDDKDHWKVEVVRDS 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K NNPRD++THWN+
Sbjct: 460 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP      Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWP + V
Sbjct: 520 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP+I+W  TASL I    +++Y++R QR   DLS  + DH  
Sbjct: 580 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIVWYILRWQRGVNDLSENEIDHIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y       GW LHYLPF IM RVTY+HHY+PALYF++L   F++D FT +     + I++
Sbjct: 640 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLVDWFTRNRNKTIQTIVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GI Y++I+ ++ YF  I +G+     + K  KW   W + D
Sbjct: 700 GILYTVIIGLYIYFIPICWGMTGNHKQYKYMKWFDNWRVTD 740



>gi|475666795|gb|EMT64585.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Fusarium
           oxysporum f. sp. cubense race 4]
          Length = 740

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 275/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E+ YN   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSKQQQVTCYHHKDTNNDWFFYPNRREEDYNPEGD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +   I            SH+IAAPVT  H EVS+YGN T+GDD D+W +EV+ D 
Sbjct: 400 LRFIGDNSVIRLIHAQTGRNLHSHDIAAPVTRGHKEVSSYGNLTVGDDKDHWKVEVVRDS 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K NNPRD++THWN+
Sbjct: 460 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNV 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP      Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWP + V
Sbjct: 520 EAHWNDKLPPAEAGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASKWWQWPFLHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP+I+W  TASL I    +++Y++R QR   DLS  + DH  
Sbjct: 580 GLRMCGWGDDIVKYFLLGNPLIYWGSTASLGIAGLVIVWYILRWQRGVNDLSENEIDHIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y       GW LHYLPF IM RVTY+HHY+PALYF++L   F++D FT +     + I++
Sbjct: 640 YAALYPLAGWFLHYLPFVIMARVTYVHHYYPALYFAILNFGFLVDWFTRNRNKTIQTIVY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GI Y++I+ ++ YF  I +G+     + K  KW   W + D
Sbjct: 700 GILYTVIIGLYIYFIPICWGMTGNHKQYKYMKWFDNWRVTD 740



>gi|70991332|ref|XP_750515.1| protein O-mannosyl transferase [Aspergillus fumigatus Af293]
 gi|66848147|gb|EAL88477.1| protein O-mannosyl transferase [Aspergillus fumigatus Af293]
 gi|159130988|gb|EDP56101.1| protein O-mannosyl transferase [Aspergillus fumigatus A1163]
          Length = 759

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/401 (52%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 359 GSRVTLKNMGYGGGLLHSHVQTYPDGSNQQQVTCYHHKDANNDWFIYPNRHEPEYDASGP 418

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + FV +GD I            SH I AP+T   +EVS YGN T+GD+ D+W +EV+DD+
Sbjct: 419 LSFVGDGDVIRLIHGQTGRNLHSHAIPAPITKSQYEVSCYGNITIGDEKDHWAVEVVDDV 478

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 479 ASRDRSRIRTLTTAFRLRHIVLGCYLRAGNVNLPQWGFKQIETTCVKENNPRDVYTHWNV 538

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H+ND+LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 539 ESHFNDRLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 598

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+ +K+YLLGNP ++W  T SL +F   + +YL R QR YKDL+ A  DH  
Sbjct: 599 GLRMCSWDDNTIKYYLLGNPFVYWGSTFSLGVFGLLIFWYLARWQRGYKDLNQADIDHIH 658

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHY PF IM RVTY+HHY+PALY+++L   F +D  T    P  +  ++
Sbjct: 659 YSGFYPLLGWILHYFPFIIMARVTYVHHYYPALYYAILTFGFCVDWLTQKMSPVARGSLY 718

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +I+ +F +F+ I FGI  P+ +  +  WLS W I +
Sbjct: 719 AFLYVIIIGMFVHFRVIVFGIEGPSQQWANLNWLSGWRIAN 759



>gi|327297568|ref|XP_003233478.1| O-mannosyl transferase [Trichophyton rubrum CBS 118892]
 gi|326464784|gb|EGD90237.1| O-mannosyl transferase [Trichophyton rubrum CBS 118892]
          Length = 744

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/401 (53%), Positives = 275/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEV+ D+
Sbjct: 403 IAFIGDGDVIRLIHAQTGRNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT++R RH++LGCYLRA    LPQWGFKQ+E +C K N P D +THWNI
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP      Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 523 ESHVNERLPPSEPGTYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNP ++W  T SL +F   +L+YL+R QR Y +LS A  DH  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFSLLVLWYLLRWQRGYDELSMADIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y +I+ +F  FKDI FG+     + KS  WLS+W I +
Sbjct: 703 SVLYVVIIGLFVVFKDIVFGMEGSNQQWKSLNWLSSWKIAN 743



>gi|340992645|gb|EGS23200.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2-like
           protein [Chaetomium thermophilum var. thermophilum DSM
           1495]
          Length = 740

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/401 (52%), Positives = 273/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R +  Y+    
Sbjct: 340 GSLVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNNWFFYPNRHDVPYDPNAP 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ NGD +            SH I AP+T   +EVS YGN T+GDD D+W IEV+ D 
Sbjct: 400 PRFIGNGDVVRLLHAQTGRNLHSHTIPAPITKSQWEVSGYGNLTVGDDKDHWQIEVVKDT 459

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+EV+C K+NNPRD +THWNI
Sbjct: 460 ASRDYSRIRTLTTAFRLRHKVLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPRDKYTHWNI 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E+H N+KLP G  S Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 520 EQHTNEKLPPGNPSLYKSPFFQDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D VVK++LLGNP ++W  TASLV+F   + +YLIR QR Y++LS +  D   
Sbjct: 580 GLRMCSWDDKVVKYFLLGNPAVYWGSTASLVVFGGLVAWYLIRWQRGYRELSASDLDQIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L   F+ D F  +    T+  +F
Sbjct: 640 YAGVYPAVGWFLHYLPFIIMARVTYVHHYYPALYFAILTFGFLADWFLRNRGKVTQTAVF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y++++ ++ YF  I FG+  P  + +  KW   W + D
Sbjct: 700 GVLYAVVIGLYIYFIPICFGMTGPNKKYRYMKWFDNWRMSD 740



>gi|302657403|ref|XP_003020425.1| hypothetical protein TRV_05484 [Trichophyton verrucosum HKI 0517]
 gi|291184256|gb|EFE39807.1| hypothetical protein TRV_05484 [Trichophyton verrucosum HKI 0517]
          Length = 744

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 275/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEV+ D+
Sbjct: 403 ISFIGDGDVIRLIHAQTGRNLHSHTVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT++R RH++LGCYLRA    LPQWGFKQ+E +C K N P D +THWNI
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP      Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 523 ESHVNERLPPSQPGTYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D++VK++LLGNP ++W  T SL +F   +L+YL+R QR Y +LS A  DH  
Sbjct: 583 GLRMCSWDDNIVKYFLLGNPFVYWGSTLSLGVFSLLVLWYLLRWQRGYDELSMADIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y +I+ +F  FKDI FG+     + KS  WLS+W I +
Sbjct: 703 SVLYVVIIGLFVIFKDIVFGMEGSNQQWKSLNWLSSWKIAN 743



>gi|310798070|gb|EFQ32963.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Glomerella
           graminicola M1.001]
          Length = 738

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSHI  YP GS QQQV+CYHH D NNDW     R ++ YN   E
Sbjct: 338 GSRATIKNMGYGGGLLHSHIQTYPEGSTQQQVTCYHHKDANNDWFFYPNRHDEDYNPEAE 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G TI            SHEIAAP+T    EVS YGN T+GDD D+W +EV+ D+
Sbjct: 398 PRFIADGSTIRLIHAQTGRNLHSHEIAAPITKADKEVSCYGNLTIGDDKDHWQVEVVRDV 457

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K NNP+DS+THWN+
Sbjct: 458 ASRDRSRIRTLTTAFRLKHPVLGCYLRAGNVNLPQWGFKQIEVTCTKKNNPKDSYTHWNV 517

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H NDKLP G    Y+S FLHDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 518 EAHTNDKLPPGDPGSYKSPFLHDFIHLNVAMMTSNNALVPDPDKQDDLASHWWQWPILNV 577

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP+++W  TA L IF   +++Y++R QR Y DL+  + D   
Sbjct: 578 GLRMCGWDDNIVKYFLLGNPLVYWGSTAGLGIFALVVVWYIVRWQRGYNDLNTKEVDQIH 637

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G     GW LHYLPF +M RVTY+HHY+PALYF++L   F+ D F  +     +  ++
Sbjct: 638 YAGLYPVAGWFLHYLPFVVMARVTYVHHYYPALYFAILTFGFLADWFLRNRNHIVQYTVY 697

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+ I+ ++  F  I FG+  P  +    KW  +W I D
Sbjct: 698 GVLYAAIIGLYILFSPICFGMTGPNKQYSYLKWFDSWRISD 738



>gi|326472217|gb|EGD96226.1| O-mannosyl transferase [Trichophyton tonsurans CBS 112818]
          Length = 743

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 213/401 (53%), Positives = 276/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEV+ D+
Sbjct: 403 IAFIGDGDVIRLIHAQTGRNLHSHAVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT++R RH++LGCYLRA    LPQWGFKQ+E +C K N P D +THWNI
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP      Y+S FL DF HLNVAM T+NNALVPDP+K+D LAS   QWPI+ V
Sbjct: 523 ESHVNERLPPSQPGTYKSPFLKDFIHLNVAMMTSNNALVPDPNKQDDLASKFWQWPILNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNP ++W  T SL +F   +++YL+R QR Y +LS A  DH  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFSLLVVWYLLRWQRGYDELSLADIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I Y++++ +F  FKDI FG+     + KS  WLSTW + +
Sbjct: 703 SILYAVVIGLFVVFKDIVFGMEGSNQQWKSLNWLSTWKVAN 743



>gi|326483272|gb|EGE07282.1| O-mannosyl transferase pmtA [Trichophyton equinum CBS 127.97]
          Length = 743

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 213/401 (53%), Positives = 276/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW I   R +  YN    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNDWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH +AAPVT   +EVSAYGN T+GD  D+W IEV+ D+
Sbjct: 403 IAFIGDGDVIRLIHAQTGRNLHSHAVAAPVTKAQYEVSAYGNTTVGDAKDHWTIEVVKDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT++R RH++LGCYLRA    LPQWGFKQ+E +C K N P D +THWNI
Sbjct: 463 ASRDRSKIRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPWDVYTHWNI 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP      Y+S FL DF HLNVAM T+NNALVPDP+K+D LAS   QWPI+ V
Sbjct: 523 ESHVNERLPPSQPGTYKSPFLKDFIHLNVAMMTSNNALVPDPNKQDDLASKFWQWPILNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNP ++W  T SL +F   +++YL+R QR Y +LS A  DH  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFSLLVVWYLLRWQRGYDELSLADIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L  AF +D FT     K +  I+
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I Y++++ +F  FKDI FG+     + KS  WLSTW + +
Sbjct: 703 SILYAVVIGLFVVFKDIVFGMEGSNQQWKSLNWLSTWKVAN 743



>gi|145238926|ref|XP_001392110.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Aspergillus niger CBS 513.88]
 gi|134076611|emb|CAK45164.1| protein O-mannosyl transferase pmtA-Aspergillus niger
 gi|350636019|gb|EHA24380.1| hypothetical protein ASPNIDRAFT_53120 [Aspergillus niger ATCC 1015]
          Length = 741

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 213/401 (53%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSHI  YP GS QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 341 GSRVTLKNMGYGGGLLHSHIQTYPEGSTQQQVTCYHHKDSNNDWFIYPNRYEPDYDPEGS 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + FV +GD I            SH I+APVT   FEVS YGN T+GDD D+W +EV+DD+
Sbjct: 401 LRFVGDGDIIRLIHGQTGRNLHSHAISAPVTKSQFEVSCYGNITIGDDKDHWAVEVVDDV 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K N P D +THWN+
Sbjct: 461 ASRDRSKIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCVKENKPSDVYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H+N++LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 521 ESHYNERLPPGDPGSYKSPFWKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+ +K+YLLGNP ++W  T SL +F   +L+YL+R QR Y +L+ A  DH  
Sbjct: 581 GLRMCSWDDNTIKYYLLGNPFVYWGSTLSLGVFALLVLWYLVRWQRGYTELTQADIDHIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYLPF +M RVTY+HHY+PALY+++L   F +D FT     K +  I+
Sbjct: 641 YSGLYPVIGWVLHYLPFAVMARVTYVHHYYPALYYAILTFGFCVDWFTQRMSNKLRWAIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y  I+ +F YF+ I FGI  P+ +     W + W I +
Sbjct: 701 TLLYCAIISLFAYFRAIVFGIEGPSQQWSHLNWFNGWRIAN 741



>gi|296810152|ref|XP_002845414.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Arthroderma otae CBS 113480]
 gi|238842802|gb|EEQ32464.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Arthroderma otae CBS 113480]
          Length = 744

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 213/401 (53%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R +  Y+    
Sbjct: 343 GSKITLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDSNNDWFIYPNRTQPNYDPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ NGD I            SH +AAP+T  H+EVSAYGN T+GD  D+W IE+  D+
Sbjct: 403 ITFIGNGDVIRLIHAQTGRNLHSHAVAAPITKSHYEVSAYGNTTVGDSKDHWTIEIAKDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +R+R+LTT++R RH++LGCYLRA    LPQWGFKQ+E +C K N P D +THWNI
Sbjct: 463 SSRDKSRVRTLTTALRLRHTVLGCYLRAGGVSLPQWGFKQIETTCVKENRPLDVYTHWNI 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N+KLP      Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 523 ESHVNEKLPPSEPGTYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNP ++W  T SL +F   +L+YL+R QR Y +LS    DH  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPFVYWGSTLSLGVFGLLVLWYLLRWQRGYDELSMKDIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L  AF +D FT     K +  ++
Sbjct: 643 YSGVYPVVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y  ++ +F  FKDI FG+     + KS  WLS W I +
Sbjct: 703 SVLYIAVIALFIVFKDIVFGMQGSNEQWKSLNWLSNWKIAN 743



>gi|380473873|emb|CCF46073.1| glycosyltransferase family 39 [Colletotrichum higginsianum]
          Length = 509

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 271/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R ++ Y+   E
Sbjct: 109 GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFFYPNRHDEDYDPEAE 168

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G TI            SHEIAAP+T    EVS YGN T+GDD D+W +EV+ D+
Sbjct: 169 PRFIADGSTIRLIHAQTGRNLHSHEIAAPMTKADKEVSCYGNLTIGDDKDHWQVEVVRDV 228

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH  LGCYLRA N  LPQWGFKQ+EV+C K NNP+DS+THWN+
Sbjct: 229 ASRDRSRIRTLTTAFRLRHPTLGCYLRAGNVNLPQWGFKQIEVTCTKKNNPKDSYTHWNV 288

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N+KLP G    Y+S FLHDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 289 EAHTNEKLPPGDPGSYKSPFLHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILNV 348

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP+++W  TA L IF   +++Y+IR QR Y DL+  + D   
Sbjct: 349 GLRMCGWDDNIVKYFLLGNPLVYWGSTAGLGIFALVVVWYVIRWQRGYADLNSKEIDQIH 408

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G     GW LHYLPF +M RVTY+HHY+PALYF++L   F+ D F  +     +  I+
Sbjct: 409 YAGLYPVAGWFLHYLPFVVMARVTYVHHYYPALYFAILTFGFLADWFLRNKNQAVQYTIY 468

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+ I+ ++  F  I FG+  P  +    KW  +W I D
Sbjct: 469 GVLYATIIGLYILFSPICFGMTGPNKQYSYLKWFDSWRISD 509



>gi|225684883|gb|EEH23167.1| O-mannosyl-transferase [Paracoccidioides brasiliensis Pb03]
          Length = 776

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 210/400 (52%), Positives = 273/400 (68%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y+    
Sbjct: 343 GSKATLKNMGYGGGLLHSHVQSYPEGSGQQQITCYHHKDANNDWFFYPNRDEPDYDPEAP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ + D I            SH + APVT   +EVS YGN T+GD+ D+WVIEV+ D+
Sbjct: 403 LSFIGDKDVIRLVHAQTGRNLHSHPVPAPVTKSSYEVSGYGNTTIGDNKDHWVIEVVSDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   ++IR+LTT+ R RH++LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWNI
Sbjct: 463 ASNDRSKIRTLTTAFRIRHAVLGCYLRAGNVNLPQWGFKQIETTCVKKNNPRDIYTHWNI 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H ND+LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D L+S   +WPI+  
Sbjct: 523 ESHINDRLPPGDAGSYKSPFLKDFLHLNVAMMTSNNALVPDPDKQDDLSSEFWEWPILHT 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNPI++W GTASL+I    LL+YL+R QR Y +L+ A+ DH  
Sbjct: 583 GLRMCSWEDNVVKYFLLGNPIVYWGGTASLLIISMILLFYLVRWQRGYDELNMAEIDHIY 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    I W  HY PF  M RVTY+HHY+PALYFSML  AF ++ FT     K +  I+
Sbjct: 643 YSGIYPAIAWFFHYFPFIAMARVTYVHHYYPALYFSMLTLAFCVNWFTRKLPAKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            + Y+ ++ +F +F+DI FG+  P+S+ +   W   +N+ 
Sbjct: 703 TVLYAAVIGLFLHFRDIVFGMEGPSSKWEHLSWFRIFNVA 742



>gi|449300557|gb|EMC96569.1| glycosyltransferase family 39 protein [Baudoinia compniacensis UAMH
           10762]
          Length = 744

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/401 (51%), Positives = 274/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  ++    
Sbjct: 343 GSRATLKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDANNDWFFYPNRHEPEFDAEAP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++FV + DTI            SH++AAPVT   +EVS YGN T+GD  D+W++EV+DD 
Sbjct: 403 LKFVGDKDTIRLIHAQTGRNLHSHQVAAPVTKADYEVSCYGNTTVGDTKDHWIVEVVDDA 462

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   +++R+LTT+ R +H+ L CYLRA N  LPQWGFKQ+E +C K N+PRD +THWN+
Sbjct: 463 ASSDYSKLRTLTTAFRLKHADLNCYLRAGNVNLPQWGFKQIETTCVKENHPRDPYTHWNV 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWN+KLP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS+P QWP++ V
Sbjct: 523 ESHWNEKLPPGDPGSYKSPFLRDFVHLNVAMMTSNNALVPDPDKQDDLASSPWQWPLLHV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNPI++W  T SLV F   + +Y IR QR + +L+  Q DHF 
Sbjct: 583 GLRMCGWDDHIVKYFLLGNPIVYWGSTFSLVFFFGMVAWYAIRWQRGFDELTWKQVDHFH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF  M RVTY+HHY+PALYF++L A F +D +T   +   +  I 
Sbjct: 643 YSGVYPVLGWFLHYLPFIAMARVTYVHHYYPALYFAILCAGFCVDWYTRDLRSGVQWGIH 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +++ +FW F+ I FG+  P  + +  +WLSTW + D
Sbjct: 703 MALYGVVIYLFWLFRAICFGMVGPNQQWQHLRWLSTWRMAD 743



>gi|512193004|gb|EPE08762.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ophiostoma piceae UAMH 11346]
          Length = 750

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/401 (52%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y +  E
Sbjct: 350 GSRVTLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDANNDWFFYPTRDEPAYESEEE 409

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             FV +   I            SHEI+APVT    EVS YGN T+GD  DYW IEV+DD+
Sbjct: 410 PTFVADNAVIRLIHAQTGRNLHSHEISAPVTKADKEVSCYGNLTVGDAKDYWKIEVLDDV 469

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTTS R +H+++GCYLRA N  LPQWGF+Q+EV+C K+NNPRD++THWN+
Sbjct: 470 ASRDRSRIRTLTTSFRIKHTVMGCYLRAGNVNLPQWGFRQIEVTCAKDNNPRDTYTHWNV 529

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N+KLP+G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 530 EAHTNEKLPAGNPGVYKSPFLRDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILNV 589

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TA L IF   + +Y IR QR Y +LS  + DH  
Sbjct: 590 GLRMCGWDDKIVKYFLLGNPLVYWGSTAGLGIFGALVAWYAIRWQRGYTELSQTEIDHIH 649

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF IM RVTY+HHY+PALYF++L   F+ D F  +     + + F
Sbjct: 650 YAGIYPIIGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLADWFLKARNAIIRIVAF 709

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G  Y++ + ++ YF  I +G+  P+++    KW   W I D
Sbjct: 710 GALYAVTIGLYVYFIPICWGMTGPSAQYSYMKWFENWRISD 750



>gi|343426349|emb|CBQ69879.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Sporisorium reilianum SRZ2]
          Length = 790

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/422 (54%), Positives = 281/422 (66%), Gaps = 24/422 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM----YN 56
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYH+ D NN+++I  P  E      Y+
Sbjct: 368 GSKITLKNMGYGGGLLHSHVQTYPVGSGQQQVTCYHYRDNNNEFIITPPWNEPQLPANYS 427

Query: 57  NITE-VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           + TE +  + N D I            SH +AAPVT  + E+S YG+E  GDDND+WV+E
Sbjct: 428 SSTEPIRMLKNNDVIRIVHDQTKRNIHSHNVAAPVTKENLEISGYGDEATGDDNDHWVVE 487

Query: 116 VIDDL-YTKTNR---IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           V+DD+ + K  R   +RSLTT +R RH  LGCY+RAANA+LPQWG+KQVEVSCDK NNPR
Sbjct: 488 VVDDMVHGKVPRGGPVRSLTTRLRLRHKNLGCYMRAANAVLPQWGWKQVEVSCDKENNPR 547

Query: 172 DSFTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTP 231
           D  T WNIE HWND+LP G    YRS FL DF HLNVAM T+NNAL+PD DKEDILAS P
Sbjct: 548 DQHTWWNIENHWNDRLPPGDSQLYRSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 607

Query: 232 RQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS 291
             WP +  GLRM SW D  +KFYLLGNP+IWWS + SL+ F  T L+Y++RRQR+ +DLS
Sbjct: 608 FDWPFLWNGLRMNSWDDSSIKFYLLGNPVIWWSSSLSLLAFAATWLWYMMRRQRRIQDLS 667

Query: 292 PAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFT---- 347
           PA W HFLYVGK+ G GWLLHYLPF +M RV YLHHY P LYF++LM   ++DHF     
Sbjct: 668 PADWSHFLYVGKIAGFGWLLHYLPFLVMARVCYLHHYLPILYFAVLMLVHLIDHFVWRPT 727

Query: 348 --------VSCKP---KTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTW 396
                      KP     K+ +F      +V  FW+FK  ++G        K  KW  +W
Sbjct: 728 TAVYYMGRKQRKPLSEAVKDAVFVGSVVAVVGGFWWFKGNSYGFKGDIKGYKGLKWRKSW 787

Query: 397 NI 398
           NI
Sbjct: 788 NI 789



>gi|501308867|dbj|GAC97757.1| glycosyltransferase [Pseudozyma hubeiensis SY62]
          Length = 861

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/424 (52%), Positives = 284/424 (66%), Gaps = 26/424 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM----YN 56
           GS++TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NN+++I  P  EQ     Y+
Sbjct: 437 GSKITLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYRDNNNEFIITPPWGEQQLPANYS 496

Query: 57  NITE-VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           +  E +  + N D I            SH +AAPVT  + EVS YG+  +GDDND+WV+E
Sbjct: 497 SSEEPIRMLKNNDIIRIVHDQTKRNIHSHNVAAPVTKENLEVSGYGDAEVGDDNDHWVVE 556

Query: 116 VIDDL-YTKTNR---IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           V+DD+ + K  R   +RSLTT +R RH  L CY+RAANA+LPQWG+KQVEVSCDK NNP+
Sbjct: 557 VVDDMVHGKVPRGGPVRSLTTRLRLRHKNLNCYMRAANAVLPQWGWKQVEVSCDKENNPK 616

Query: 172 DSFTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTP 231
           D  T WNIE HWND+LP G    Y+S FL DF HLNVAM T+NNAL+PD DKEDILAS P
Sbjct: 617 DQHTWWNIENHWNDRLPPGDSQLYKSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 676

Query: 232 RQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS 291
             WP +  GLRM SW D+ +KFYLLGNP+IWWS + SL+ F  T L+Y++RRQR+ +DLS
Sbjct: 677 FDWPFLWNGLRMNSWDDNSIKFYLLGNPVIWWSSSFSLLAFAGTWLWYMMRRQRRIQDLS 736

Query: 292 PAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF----T 347
           P  W HFLYV K+ G GW+LHYLPF IM RV YLHHY P LYF++LM   +MDHF    T
Sbjct: 737 PTDWSHFLYVAKLAGFGWILHYLPFLIMARVCYLHHYLPILYFAVLMLVHLMDHFFWRRT 796

Query: 348 VSC----------KPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLS 394
            +           +P  + +   ++   +V V   FW+F+  ++G     S  K  KW  
Sbjct: 797 TAVYSFGGKKGRREPLGEGVKNAVFVGSVVAVAGAFWWFRGNSYGFKGDISGYKGLKWRK 856

Query: 395 TWNI 398
           +WNI
Sbjct: 857 SWNI 860



>gi|477528421|gb|ENH80206.1| protein o-mannosyl transferase [Colletotrichum orbiculare MAFF
           240422]
          Length = 738

 Score =  448 bits (1152), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 206/401 (51%), Positives = 273/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R +  Y+    
Sbjct: 338 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHDADYDAEAA 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G+TI            SHEI+AP+T    EVS+YGN T+GDD D+W +EV+ D+
Sbjct: 398 PRFIGDGETIRLIHAQTGRNLHSHEISAPITKADKEVSSYGNLTIGDDKDHWKVEVVRDV 457

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R +H++LGCYLRA N  LPQWGFKQ+EV+C KNNNP+D++THWN+
Sbjct: 458 ASRDRSRIRTLTTAFRLKHTVLGCYLRAGNVNLPQWGFKQIEVTCTKNNNPKDTYTHWNV 517

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWN+KLP      Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 518 EAHWNEKLPPADAGSYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 577

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TA L +F   + +YLIR QR Y DLS  + D   
Sbjct: 578 GLRMCGWDDSIVKYFLLGNPLVYWGSTAGLGVFGLVVAWYLIRWQRGYDDLSDKEVDQIH 637

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           + G     GW+LHYLPF +M RVTY+HHY+PALYF++L   F+ D F  +     +  ++
Sbjct: 638 FAGLYPVAGWVLHYLPFIVMARVTYVHHYYPALYFAILTFGFLADWFLRNKNQAIQYGVY 697

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+ I+ ++  F  I FG+  P  +    KW  TW + D
Sbjct: 698 GVLYATIIGLYILFSPICFGMTGPNRQYSYMKWFDTWRMSD 738



>gi|226287740|gb|EEH43253.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Paracoccidioides brasiliensis Pb18]
          Length = 736

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 209/394 (53%), Positives = 271/394 (68%), Gaps = 1/394 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y+    
Sbjct: 343 GSKATLKNMGYGGGLLHSHVQSYPEGSGQQQITCYHHKDANNDWFFYPNRDEPDYDPEAP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ + D I            SH + APVT   +EVS YGN T+GD+ D+WVIEV+ D+
Sbjct: 403 LSFIGDKDVIRLVHAQTGRNLHSHPVPAPVTKSSYEVSGYGNTTIGDNKDHWVIEVVSDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   ++IR+LTT+ R RH++LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWNI
Sbjct: 463 ASNDRSKIRTLTTAFRIRHAVLGCYLRAGNVNLPQWGFKQIETTCVKKNNPRDIYTHWNI 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H ND+LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D L+S   +WPI+  
Sbjct: 523 ESHINDRLPPGDAGSYKSPFLKDFLHLNVAMMTSNNALVPDPDKQDDLSSEFWEWPILHT 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNPI++W GTASL+I    LL+YL+R QR Y +L+ A+ DH  
Sbjct: 583 GLRMCSWEDNVVKYFLLGNPIVYWGGTASLLIISMILLFYLVRWQRGYDELNMAEIDHIY 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    I W  HY PF  M RVTY+HHY+PALYFSML  AF ++ FT     K +  I+
Sbjct: 643 YSGIYPAIAWFFHYFPFIAMARVTYVHHYYPALYFSMLTLAFCVNWFTRKLPAKVEWAIY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWL 393
            + Y+ ++ +F +F+DI FG+  P+S+ +   W+
Sbjct: 703 TVLYAAVIGLFLHFRDIVFGMEGPSSKWEHLSWV 736



>gi|405122688|gb|AFR97454.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Cryptococcus neoformans var. grubii H99]
          Length = 810

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/406 (52%), Positives = 273/406 (67%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +TLKN G+GGGLLHSH+   P GS QQQV+CYH+ D NN+W I+ P      +    
Sbjct: 403 GSTVTLKNYGYGGGLLHSHVQTLPVGSLQQQVTCYHYKDENNNWQIVPPWGADPVDPDGP 462

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH IAAPVT   +EVS YGN T+GD+ND W++EV+DD 
Sbjct: 463 IRFLKDGDEIRLVHTQTGRNMHSHAIAAPVTKESWEVSGYGNLTIGDENDLWIVEVVDDT 522

Query: 121 YT-----KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFT 175
           +T     +  RI SLTT MRF+H  L CYLRAANA+LPQWGFKQVEVSC K NNP+D  T
Sbjct: 523 HTSKKNNEDGRIHSLTTRMRFKHRQLKCYLRAANAVLPQWGFKQVEVSCTKENNPKDLHT 582

Query: 176 HWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           +WN+E HWN++LP G    Y+S F  DF HLNVAM+T+NNALVPDPDKEDILAS P  WP
Sbjct: 583 YWNVESHWNERLPPGNAKLYKSPFWRDFVHLNVAMWTSNNALVPDPDKEDILASQPFDWP 642

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQW 295
            + +GLRMC W D  +KFYLLG PIIWW  T SL I +    +Y+ R QR Y++    +W
Sbjct: 643 FLHLGLRMCGWGDHQIKFYLLGTPIIWWFSTVSLAIGLGLAAWYVARMQRGYREWKAGEW 702

Query: 296 DHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT- 354
           DH+L+ GK+   GW LH+ PF IMGRVTYLHHY P LYF++LMA  ++DHF  +   ++ 
Sbjct: 703 DHWLWAGKMAFGGWALHFFPFLIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASSTRSH 762

Query: 355 --KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
             K I F I+  ++++ FW+FKD+A GI    +      W S+WNI
Sbjct: 763 IKKLIWFAIWAGVVILSFWWFKDLALGIYGNVNNHWGWGWRSSWNI 808



>gi|443898178|dbj|GAC75515.1| dolichyl-phosphate-mannose:protein O-mannosyl transferase
           [Pseudozyma antarctica T-34]
          Length = 883

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 275/421 (65%), Gaps = 23/421 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKP-RKEQMYNNIT 59
           GS++TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NN+++I  P  + Q+  N +
Sbjct: 462 GSKVTLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYRDNNNEFIITPPWNQPQLPANYS 521

Query: 60  EVE----FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
             E     V NGD I            SH  AAPVT  + EVS YG+E +GDDND+WV+E
Sbjct: 522 SSEEPIRMVKNGDIIRLVHDQTKRNIHSHNFAAPVTKENLEVSGYGDEKVGDDNDHWVVE 581

Query: 116 VIDDLYTKTNR----IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           V+DD+     +    +RSLTT MR RH  L CYLRAANA+LPQWG+KQVEVSCDK NNP+
Sbjct: 582 VVDDMVLGKVKLGAPVRSLTTRMRLRHHNLNCYLRAANAVLPQWGWKQVEVSCDKENNPK 641

Query: 172 DSFTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTP 231
           D  T WNIE HWND+LP G +  YRS FL DF HLNVAM T+NNAL+PD DKEDILAS P
Sbjct: 642 DEHTWWNIENHWNDRLPPGDEKLYRSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 701

Query: 232 RQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS 291
             WP +  GLRM SW D  +K+YL+GNP++WW  +ASLV+F  T L+Y++RRQR+  DLS
Sbjct: 702 FDWPWLWNGLRMNSWDDSSIKYYLIGNPVVWWGSSASLVVFAGTWLWYMMRRQRRIHDLS 761

Query: 292 PAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFT---- 347
           P+ W HFLYV K+   GW LHY+PF IM RV YLHHY P LYF++LM A ++DHF     
Sbjct: 762 PSDWAHFLYVSKIAAFGWALHYVPFLIMARVCYLHHYLPILYFAVLMLAHLLDHFVWRPT 821

Query: 348 ----------VSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
                     V      KN +F      +   FW+F   ++G        K  KW  +WN
Sbjct: 822 TAVYARGGRRVPLSQTVKNAVFVGAVLAVGGAFWWFSGNSYGYTGDIKRHKGLKWRKSWN 881

Query: 398 I 398
           I
Sbjct: 882 I 882



>gi|396458468|ref|XP_003833847.1| similar to dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase [Leptosphaeria maculans JN3]
 gi|312210395|emb|CBX90482.1| similar to dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase [Leptosphaeria maculans JN3]
          Length = 738

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 210/401 (52%), Positives = 270/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y+   E
Sbjct: 338 GSRATLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFFYPNRHEVEYHPDEE 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F  N D I            SH++AAPVT   +EVS YGN T+GD  D+W++EV+ D 
Sbjct: 398 LRFPGNKDVIRLIHAQTGRNLHSHQVAAPVTKADWEVSCYGNVTVGDTKDHWIVEVVRDA 457

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +R+R+LTT+ R +H  LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWNI
Sbjct: 458 ASRDYSRLRTLTTAFRLKHKDLGCYLRAGNVNLPQWGFKQIETTCVKTNNPRDVYTHWNI 517

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+  
Sbjct: 518 ESHTNERLPPGNPGDYKSPFFQDFIHLNVAMMTSNNALVPDPDKQDDLASAFWQWPILHT 577

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK+YLLGNP ++W  TASLV+ +  + +Y IR QR Y DL   + D   
Sbjct: 578 GLRMCGWNDDIVKYYLLGNPAVYWGSTASLVVLLLIVAFYTIRWQRGYTDLKQDEIDQIH 637

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYLPF  MGRVTY+HHY+PAL+F++L+  F +D  T       +  ++
Sbjct: 638 YAGIYPLIGWVLHYLPFMAMGRVTYVHHYYPALWFAILVMGFCLDFSTRKLSKAAQWGVY 697

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G  Y LI+ ++W F+ I+FG+  P+S+ +  KW S+W + D
Sbjct: 698 GALYVLIIGLYWLFRAISFGMVGPSSQWRHLKWFSSWKMTD 738



>gi|328858004|gb|EGG07118.1| family 39 glycosyltransferase [Melampsora larici-populina 98AG31]
          Length = 707

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 212/407 (52%), Positives = 276/407 (67%), Gaps = 7/407 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T KNMG+GGGLLHSH+  +P GS+QQQV+CYH+ D NN+WMI     E+ Y+    
Sbjct: 296 GSRVTFKNMGYGGGLLHSHVQTFPVGSQQQQVTCYHYRDNNNEWMITPLLHEEPYSESQP 355

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD +            SHEI AP+T V+ EV+ YGN T+ D N YWVIEVIDD+
Sbjct: 356 IRFLKHGDVVRLVHIMTGRNLHSHEIPAPITKVNKEVACYGNATIDDSNSYWVIEVIDDI 415

Query: 121 Y----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                 +   I +L+T  R RH  LGCYL+A N +LPQWGFKQVEVSCDK NNP D  T 
Sbjct: 416 LRGKKERFQHINTLSTRFRIRHLNLGCYLKADNKVLPQWGFKQVEVSCDKKNNPNDKHTF 475

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E H N +LP G     +S FLHDFWHLN+AM T+NNAL+PDPDK+D +AS P +WP 
Sbjct: 476 WNVESHMNGRLPPGDMKVMKSPFLHDFWHLNIAMMTSNNALIPDPDKQDAIASHPFEWPF 535

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           +  G+RM  W ++ +KFYL+GNPI WW+ + SL+++   L++YL R +R++ DLS AQWD
Sbjct: 536 LYTGMRMNGWFENGIKFYLIGNPITWWTSSFSLLVYSVGLVWYLARFKRQFNDLSLAQWD 595

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF---TVSCKPK 353
            F++VGKV   GWLLHYLPF  MGRVTYLHHY P L+F+++      DHF   + + KP 
Sbjct: 596 QFIWVGKVGLGGWLLHYLPFLFMGRVTYLHHYLPTLWFAIITCGLCFDHFIFRSKTIKPI 655

Query: 354 TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            K IIF +  SLI     +FKD A+GI  P ++ K R+W  +WNI D
Sbjct: 656 HKKIIFYLMASLITFTGIWFKDCAWGIEGPINQYKGRQWRKSWNIYD 702



>gi|340517873|gb|EGR48116.1| glycosyltransferase family 39 [Trichoderma reesei QM6a]
          Length = 740

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 206/401 (51%), Positives = 275/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y+   E
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHEPDYDPEGE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +G  I            SH+I AP+T  H EVS+YGN T+GD+ D+W IEV+ D 
Sbjct: 400 LRFIGDGSVIRLIHAQTGRNLHSHDIDAPITKSHREVSSYGNLTVGDEKDHWKIEVVRDA 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R +H++LGCYLRA N  LPQWGFKQ+EV+CDK NNPRD++THWN+
Sbjct: 460 ASRDRSRIRTLTTAFRLKHTVLGCYLRAGNVNLPQWGFKQIEVTCDKQNNPRDTYTHWNV 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWND+LP      Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 520 EAHWNDRLPPSDPGVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D++VK++LLGNP ++W+ TASL      + +Y++R QR +K+LS ++ D   
Sbjct: 580 GLRMCSWDDNIVKYFLLGNPFVYWASTASLGAVALVIAWYVVRWQRGFKELSNSEVDQIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF IM RVTY+HHY+PALYF++L   F++D    +     + + +
Sbjct: 640 YAGIYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILSLGFLVDWVLRNRAAVVQGVAY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GI Y++++ ++  F  I +G+   + +    KW   W I D
Sbjct: 700 GILYTVVIGLYILFMPICWGMTGSSKQYSYLKWFDNWRISD 740



>gi|500255999|gb|EON99317.1| putative dolichyl-phosphate-mannose-protein mannosyltransferase 2
           protein [Togninia minima UCRPA7]
          Length = 740

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/401 (51%), Positives = 274/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R +  Y+   E
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFFYPNRGDADYDENAE 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G+TI            SHEIAAPVT    EVS YGN T+GDD D+W IEV+ D+
Sbjct: 400 PRFIGDGETIRLIHAQTGRNLHSHEIAAPVTKADKEVSCYGNLTVGDDKDHWKIEVVRDV 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H ++GCYLRA N  LPQWGF+Q+EV+C K+NNPRD++THWN+
Sbjct: 460 ASRDRSKIRTLTTAFRLKHPVMGCYLRAGNVNLPQWGFRQIEVTCTKDNNPRDTYTHWNV 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP+G    Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 520 EAHWNDKLPAGDPGQYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP ++W  TASL      + +YL+R QR YK+LS A+ D   
Sbjct: 580 GLRMCGWDDNIVKYFLLGNPFVYWVSTASLGALGLLVAWYLVRWQRGYKELSQAEIDQLH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y      IGW LHYLP  IM RVTY+HHY+PALYF++L+  F+ D F  + +   +   +
Sbjct: 640 YSALYPIIGWGLHYLPSVIMARVTYVHHYYPALYFAILVLGFLADWFLRNQRKAVQYGAY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ ++ YF  I +G+  P  +    KW  TW + D
Sbjct: 700 AVLYATVIGLYIYFMPICWGMTGPNKQYSYMKWFDTWRMSD 740



>gi|71022783|ref|XP_761621.1| hypothetical protein UM05474.1 [Ustilago maydis 521]
 gi|46101174|gb|EAK86407.1| hypothetical protein UM05474.1 [Ustilago maydis 521]
          Length = 866

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 221/425 (52%), Positives = 282/425 (66%), Gaps = 29/425 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM----YN 56
           GS++TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NN+++I  P  E+     Y+
Sbjct: 443 GSKITLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYRDNNNEFIITPPWNERALPANYS 502

Query: 57  NITE-VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           + TE V  + N D I            SH +AAPVT  + EVS YG++  GDDND+WV+E
Sbjct: 503 SSTEPVRMLKNNDVIRLVHDQTKRNIHSHHVAAPVTKENLEVSGYGDDQTGDDNDHWVVE 562

Query: 116 VIDDL-YTKTNR---IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           V+DD+ + K  R   +RSLT+ +R RH  LGCY+RAANA+LPQWG+KQVEVSCDK NNP+
Sbjct: 563 VVDDMVHGKVARDAPVRSLTSRLRLRHKNLGCYMRAANAVLPQWGWKQVEVSCDKENNPK 622

Query: 172 DSFTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTP 231
           D  T WNIE HWN++L  G    Y+S FL DF HLNVAM T+NNAL+PD DKEDILAS P
Sbjct: 623 DQHTWWNIENHWNERLAPGDSQLYKSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 682

Query: 232 RQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS 291
             WP +  GLRM SW D+ +KFYLLGNP+IWW+ ++SL+ F  T L+Y++RRQR+  DLS
Sbjct: 683 FDWPWLWNGLRMNSWDDNSIKFYLLGNPVIWWASSSSLLAFGATWLWYMMRRQRRIHDLS 742

Query: 292 PAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK 351
           PA W HFLYV K+   GWLLHYLPF +M RV YLHHY P LYF++LM   ++DHF    +
Sbjct: 743 PADWAHFLYVAKLAAFGWLLHYLPFLVMARVCYLHHYLPILYFAVLMLVHLIDHFV--WR 800

Query: 352 PKT------------------KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWL 393
           P T                  KN +F +    I   FW+F+  ++G        K  KW 
Sbjct: 801 PSTAVYAFGASRRKQPLSEALKNAVFVVSVVAITAAFWWFRGNSYGFKGDIKSHKGLKWR 860

Query: 394 STWNI 398
            +WNI
Sbjct: 861 KSWNI 865



>gi|400595792|gb|EJP63582.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Beauveria
           bassiana ARSEF 2860]
          Length = 739

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 206/402 (51%), Positives = 276/402 (68%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R E  Y+ N T
Sbjct: 338 GSRATIKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRSEADYDVNST 397

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++ ++++G  I            SHEIAAP+T    EVS+YGN T+GDD D+W +EV+ D
Sbjct: 398 DIRYISDGSVIRLIHASTGRNLHSHEIAAPITKSDREVSSYGNLTIGDDKDHWQVEVVRD 457

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             ++  +RIR+L TS R +H +LGCYLRA N  LPQWGFKQ+EV+C   NNPRD++THWN
Sbjct: 458 AASRDRSRIRTLATSFRLKHPVLGCYLRAGNTNLPQWGFKQIEVTCTPKNNPRDAYTHWN 517

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           IE HWN+KLP+G    Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 518 IESHWNEKLPAGDPGSYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 577

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMC W D++VK++LLGNP ++W+ T SL +    +++Y++R QR +KDL+  + D  
Sbjct: 578 VGLRMCGWDDNIVKYFLLGNPFVYWASTVSLGLVGLVVVWYILRWQRGFKDLNSEEVDQI 637

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L   F +D    +     +  +
Sbjct: 638 HYAGIYPVLGWFLHYLPFVIMARVTYVHHYYPALYFAILALGFFVDWLVRNRSQVVQGAV 697

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y++I+ ++  F  I +G+  P  +    KW  TW + D
Sbjct: 698 YGVLYTVIIGLYILFMPICWGMTGPNQQYSYMKWFDTWRVSD 739



>gi|452985856|gb|EME85612.1| glycosyltransferase family 39 protein [Pseudocercospora fijiensis
           CIRAD86]
          Length = 741

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 207/401 (51%), Positives = 265/401 (66%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  +N    
Sbjct: 341 GSRATLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDANNDWFFYPNRNEPEFNPEAP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +++V NGD I            SH++AAPVT   +EVS YGN T+GD  D+W++EV+DD 
Sbjct: 401 IKYVGNGDVIRLIHAQTGRNLHSHQVAAPVTKADYEVSCYGNVTIGDTKDHWIVEVVDDA 460

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +++R+LTTS R +H  LGCYLRA N  LPQWGFKQ+E SC K N PRD FTHWN+
Sbjct: 461 ASRDWSKVRTLTTSFRLKHKDLGCYLRAGNVNLPQWGFKQIETSCVKENRPRDKFTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWN+KLP+G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS P QWP++ V
Sbjct: 521 ESHWNEKLPAGDPGSYKSPFFRDFIHLNVAMMTSNNALVPDPDKQDDLASAPWQWPLLNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D  VK+YLLGNP ++W+ TASL  F+    +Y IR QR + +L+    D F 
Sbjct: 581 GLRMCGWDDKNVKYYLLGNPFVYWASTASLFFFIGMFAWYAIRWQRGFDELTWKDIDQFQ 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF  M RVTY+HHY+PALYF++L   F +D  T       +  ++
Sbjct: 641 YAGIYPVIGWFLHYLPFVAMARVTYVHHYYPALYFAILTFGFCIDWCTSRLPKPVEWGLY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +++ +FW F+ + FG+     + K  KWL  W + D
Sbjct: 701 TALYGVVIFMFWLFRALCFGMVGSNQQWKHLKWLPKWRMSD 741



>gi|425774255|gb|EKV12568.1| Protein O-mannosyl transferase [Penicillium digitatum PHI26]
 gi|425778534|gb|EKV16658.1| Protein O-mannosyl transferase [Penicillium digitatum Pd1]
          Length = 737

 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 271/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  +P GS QQQV+CYHH D NNDW I   R+E  Y+   +
Sbjct: 335 GSRVTLKNMGYGGGLLHSHVQTFPEGSMQQQVTCYHHKDANNDWFIYPNRQEPDYDATAD 394

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + FV +GD I            SH I AP+T  H EVS+YGN T+GDD D+W +EV+DD+
Sbjct: 395 LRFVGDGDVIRLIHGQTGRNLHSHAIPAPITKSHHEVSSYGNITIGDDKDHWKVEVVDDV 454

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K N P D +THWN+
Sbjct: 455 ASRDRSRIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCTKENKPGDVYTHWNV 514

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H ND+LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 515 ESHTNDRLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 574

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D VVK+YLLGNP+++W  TA+L  F    L++L+R QR Y DLS  +  H  
Sbjct: 575 GLRMCSWDDGVVKYYLLGNPLVYWGSTAALGGFGLLFLWHLLRWQRGYNDLSNEEISHIH 634

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYLPF IM RVTY+HHY+PALY+++L   F +D  T    P+    ++
Sbjct: 635 YSGLYPVIGWVLHYLPFIIMARVTYVHHYYPALYYAILNFGFCIDWVTRKMNPRLSAAVY 694

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +IV +F +F+ I FG+     +    +WL  W + +
Sbjct: 695 AFLYVIIVGLFIHFRAIVFGMEGSNQQWTHLRWLPGWKMAN 735



>gi|315044835|ref|XP_003171793.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Arthroderma gypseum CBS 118893]
 gi|311344136|gb|EFR03339.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Arthroderma gypseum CBS 118893]
          Length = 744

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 209/401 (52%), Positives = 274/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQ++CYHH D NN+W I   R +  YN    
Sbjct: 343 GSKITVKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDSNNEWFIYPNRTQPDYNPEGP 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++F+ +GD I            SH + APVT   +EVSAYGN T+GD  D+W +EV+ D+
Sbjct: 403 IDFIGDGDVIRLIHAQTGRNLHSHTVPAPVTKSQYEVSAYGNTTVGDAKDHWTMEVVKDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH++LGCYLRA    LPQWGFKQ+E +C K N P D +THWNI
Sbjct: 463 ASRDRSRIRTLTTAFRLRHTVLGCYLRAGGVSLPQWGFKQIETTCTKENRPLDVYTHWNI 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP      Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 523 ESHVNERLPPSEPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+VVK++LLGNP+++W  T SL +F   +++Y++R QR Y +LS A  DH  
Sbjct: 583 GLRMCSWDDNVVKYFLLGNPLVYWGSTMSLGVFSLIVVWYVLRWQRGYNELSMADIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L  AF +D FT     K +  ++
Sbjct: 643 YSGIYPIVGWFLHYLPFMIMARVTYVHHYYPALYFAILTMAFCIDWFTQKLNRKVEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y  ++ +F  FKDI FG+     + KS  WLSTW I +
Sbjct: 703 SVLYIAVIGLFVLFKDIVFGMEGSNQQWKSLNWLSTWKIAN 743



>gi|255931607|ref|XP_002557360.1| Pc12g05130 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211581979|emb|CAP80140.1| Pc12g05130 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 744

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 270/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R+E  Y+   +
Sbjct: 342 GSRVTLKNMGYGGGLLHSHVQTYPEGSMQQQVTCYHHKDANNDWFIYPNRQEPDYDATAD 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + FV +GD I            SH I AP+T  H EVS+YGN T+GDD D+W +EV+DD+
Sbjct: 402 LRFVGDGDVIRLIHGQTGRNLHSHAIPAPITKSHHEVSSYGNITIGDDKDHWKVEVVDDV 461

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K N P D +THWN+
Sbjct: 462 ASRDRSKIRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCTKENKPSDVYTHWNV 521

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 522 ESHTNERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 581

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D VVK+YLLGNP+++W  TA+L  F    L+YL+R QR Y DLS     H  
Sbjct: 582 GLRMCSWDDSVVKYYLLGNPLVYWGSTAALGGFGLLFLWYLLRWQRGYNDLSNEDIRHIH 641

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYLPF IM RVTY+HHY+PALY+++L   F +D  T    P+    ++
Sbjct: 642 YSGLYPVIGWVLHYLPFIIMARVTYVHHYYPALYYAILNFGFCVDWVTRKMNPRLSAAVY 701

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +IV +F +F+ I FG+     +    +WL  W + +
Sbjct: 702 AFLYVIIVGLFIHFRAIVFGMEGSNQQWTHLRWLPGWKMAN 742



>gi|320040582|gb|EFW22515.1| O-mannosyl transferase [Coccidioides posadasii str. Silveira]
          Length = 747

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/401 (51%), Positives = 275/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+   E
Sbjct: 343 GSKVTIKNMGYGGGLLHSHVQTYPSGSSQQQVTCYHHKDSNNDWFVYPNRTQPDYDPEGE 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH I AP+T  ++EVS YGN T+GDD D+WV+EV++D+
Sbjct: 403 LRFIGDGDIIRLIHAQTGRNLHSHAIPAPITKSNWEVSCYGNTTVGDDKDHWVVEVVNDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +K  ++IR+LTT+ R RHS LGCYLRA N  LPQWGFKQ+E +C K N P D  THWN+
Sbjct: 463 ASKDRSKIRTLTTAFRLRHSSLGCYLRAGNVNLPQWGFKQIETTCVKENKPYDVHTHWNV 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWP++ V
Sbjct: 523 ESHVNERLPKGDPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPVLNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW +D VK++LLGNP ++W  TASL +F   + +YL+R QR Y +LS A  DH  
Sbjct: 583 GLRMCSWDNDTVKYFLLGNPFVYWGSTASLAVFGLVVAWYLVRWQRGYTELSQADIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHYLPF IM RVTY+HHY+PALYF++L   F ++ FT +     +  ++
Sbjct: 643 YSGIYPLLGWVLHYLPFIIMARVTYVHHYYPALYFAILTMGFCVNWFTQNLSKPAEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ +F  FKDI FG+     + +   WLSTW I +
Sbjct: 703 FVLYAAVISLFVVFKDIVFGMQGSNEQWQYLNWLSTWRIAN 743



>gi|321262843|ref|XP_003196140.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Cryptococcus gattii WM276]
 gi|317462615|gb|ADV24353.1| Dolichyl-phosphate-mannose-protein mannosyltransferase, putative
           [Cryptococcus gattii WM276]
          Length = 807

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/406 (52%), Positives = 270/406 (66%), Gaps = 8/406 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +TLKN G+GGGLLHSH+   P GS QQQ++CYH+ D NN+W I+ P      +    
Sbjct: 400 GSTVTLKNYGYGGGLLHSHVQTLPVGSLQQQITCYHYKDENNNWQIVPPWGADPVDPDGP 459

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH IAAPVT   +EVS YGN T+GD ND WVIEV+DD 
Sbjct: 460 IRFLKDGDEIRLVHTQTGRNMHSHAIAAPVTKESWEVSGYGNLTIGDANDLWVIEVVDDT 519

Query: 121 YT-----KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFT 175
           +T     +  RI SLTT MR +H  L CYLRAANA+LPQWGFKQVEVSC K NNP+D  T
Sbjct: 520 HTSKKDNENGRIHSLTTRMRLKHRELNCYLRAANAVLPQWGFKQVEVSCTKENNPKDLHT 579

Query: 176 HWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           +WN+E HWN +LP G    Y+S F  DF HLNVAM+T+NNAL+PDPDKEDILAS P  WP
Sbjct: 580 YWNVESHWNGRLPPGNAKLYKSPFWRDFVHLNVAMWTSNNALIPDPDKEDILASEPFDWP 639

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQW 295
            + +GLRMC W D  +KFYLLG PIIWW  T SL I +    +Y+ R QR YK+    +W
Sbjct: 640 FLHLGLRMCGWGDHQIKFYLLGTPIIWWFSTVSLAIGLGLAAWYVARMQRGYKEWKAGEW 699

Query: 296 DHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT- 354
           DH+L+ GKV   GW LH+ PF IMGRVTYLHHY P LYF++LMA  ++DHF  +   ++ 
Sbjct: 700 DHWLWAGKVAFGGWALHFFPFLIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASPTRSH 759

Query: 355 --KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
             K I F ++  ++++ FW+FKD+A GI    +      W S+WNI
Sbjct: 760 TKKLIWFTVWAGVVILSFWWFKDLALGIYGNVNNHWGWGWRSSWNI 805



>gi|303322440|ref|XP_003071213.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240110912|gb|EER29068.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2, putative
           [Coccidioides posadasii C735 delta SOWgp]
          Length = 747

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/401 (51%), Positives = 274/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+   E
Sbjct: 343 GSKVTIKNMGYGGGLLHSHVQTYPSGSSQQQVTCYHHKDSNNDWFVYPNRTQPDYDPEGE 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH I AP+T   +EVS YGN T+GDD D+WV+EV++D+
Sbjct: 403 LRFIGDGDIIRLIHAQTGRNLHSHAIPAPITKSSWEVSCYGNTTVGDDKDHWVVEVVNDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +K  ++IR+LTT+ R RHS LGCYLRA N  LPQWGFKQ+E +C K N P D  THWN+
Sbjct: 463 ASKDRSKIRTLTTAFRLRHSSLGCYLRAGNVNLPQWGFKQIETTCVKENKPYDVHTHWNV 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWP++ V
Sbjct: 523 ESHVNERLPKGDPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPVLNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW +D VK++LLGNP ++W  TASL +F   + +YL+R QR Y +LS A  DH  
Sbjct: 583 GLRMCSWDNDTVKYFLLGNPFVYWGSTASLAVFGLVVAWYLVRWQRGYTELSQADIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHYLPF IM RVTY+HHY+PALYF++L   F ++ FT +     +  ++
Sbjct: 643 YSGIYPLLGWVLHYLPFIIMARVTYVHHYYPALYFAILTMGFCVNWFTQNLSKPAEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ +F  FKDI FG+     + +   WLSTW I +
Sbjct: 703 FVLYAAVISLFVVFKDIVFGMQGSNEQWQYLNWLSTWRIAN 743



>gi|388856084|emb|CCF50264.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Ustilago hordei]
          Length = 788

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 226/422 (53%), Positives = 287/422 (68%), Gaps = 24/422 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKP-RKEQMYNNIT 59
           GS++TLKNMG+GGGLLHSH+  YP GS+QQQV+CYH+ D NN+++I  P  +EQ+  N +
Sbjct: 366 GSKITLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYRDNNNEFIITPPWNEEQLPANYS 425

Query: 60  ----EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
                +  + + D I            SH IAAPVT  + EVS YG+E  GDDND+W++E
Sbjct: 426 GSDQPLRMLKDNDIIRLVHDQTKRNIHSHHIAAPVTKENLEVSCYGDENTGDDNDHWIVE 485

Query: 116 VIDDL-YTKTNR---IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           V+DD+ + K  R   +RSLTT +R RH  +GCYLRAANA+LPQWG+KQVEVSCDK NN +
Sbjct: 486 VVDDMVHGKVYRGGPVRSLTTRIRLRHKNIGCYLRAANAVLPQWGWKQVEVSCDKENNAK 545

Query: 172 DSFTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTP 231
           D  T WNIE HWND+LP G +  YRS FL DF HLNVAM T+NNAL+PD DKEDILAS P
Sbjct: 546 DEHTWWNIENHWNDRLPPGDEKLYRSPFLRDFIHLNVAMMTSNNALIPDADKEDILASKP 605

Query: 232 RQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS 291
             WP +  GLRM SW D+ +K+YLLGNP+IWWS + SLV+F  T LYY++RRQR+ +DLS
Sbjct: 606 FDWPFLWNGLRMNSWDDNTIKYYLLGNPVIWWSSSISLVVFGATWLYYMMRRQRRIQDLS 665

Query: 292 PAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF----T 347
           P  W HFLYVGK+   GW LHYLPF IM RV YLHHY P LYF++LM A +MDHF    T
Sbjct: 666 PNDWAHFLYVGKIAAFGWALHYLPFLIMARVCYLHHYLPILYFAVLMLAHLMDHFLWRPT 725

Query: 348 VSC--------KP---KTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTW 396
            +         KP     KN+ F    + +   FW+F++ ++G     ++ K  KW  +W
Sbjct: 726 TAVYYFGGRQRKPLGQGVKNVAFATAVAAVATAFWWFRNNSYGFQGDINKHKGLKWRKSW 785

Query: 397 NI 398
           NI
Sbjct: 786 NI 787



>gi|115385953|ref|XP_001209523.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Aspergillus terreus NIH2624]
 gi|114187970|gb|EAU29670.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Aspergillus terreus NIH2624]
          Length = 739

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/401 (52%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KN G+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R E  Y+    
Sbjct: 339 GSRVTIKNRGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRNEPDYDANAP 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++F  + D I            SH I+APVT  H+EVS YGN T+GD+ D+W IEV+DD 
Sbjct: 399 LKFPGDRDVIRLIHGQTGRNLHSHAISAPVTKSHYEVSGYGNITIGDEKDHWEIEVVDDA 458

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +R+R+LTT+ R RH +LGCYLRA N  LPQWGFKQ+E +C K N PRD +THWNI
Sbjct: 459 ASRDRSRVRTLTTAFRLRHPVLGCYLRAGNVNLPQWGFKQIETTCVKENKPRDVYTHWNI 518

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H+N++LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 519 ESHFNERLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNV 578

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+ +K+YLLGNP ++W  TASL +F   +L+YL+R QR Y DL+  + DH  
Sbjct: 579 GLRMCSWDDNTIKYYLLGNPFVYWGSTASLGVFGLLVLWYLVRWQRGYNDLTQGEIDHIH 638

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHY+PF +M RVTY+HHY+PALY+++L   F  D  T +   K    I 
Sbjct: 639 YSGIYPAIGWVLHYIPFVVMARVTYVHHYYPALYYAILTFGFCTDWLTRNAHNKVYWAIH 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y++I+ +F YF+ I FGI   + +     WLS W I +
Sbjct: 699 IVLYAVIIGLFTYFRVIVFGIEGSSQQWAHLGWLSGWRIAN 739



>gi|320586039|gb|EFW98718.1| protein O-mannosyl transferase [Grosmannia clavigera kw1407]
          Length = 741

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 269/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R+E  Y+   E
Sbjct: 341 GSRVTLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNEWFFYPTREEPEYDENAE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             FV +  TI            SHE++APVT    EVS YGN T+GD  DYW IEV+DD+
Sbjct: 401 PRFVGDDSTIRLIHAQTGRNLHSHEVSAPVTKADREVSCYGNLTVGDAKDYWKIEVLDDV 460

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTTS R ++ ++GCYLRA N  LPQWGF+Q+EV+C K+NNPRD++THWNI
Sbjct: 461 ASRDHSRIRTLTTSFRLKNPVMGCYLRAGNVNLPQWGFRQIEVTCTKDNNPRDTYTHWNI 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N KLP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 521 EAHINKKLPEGNPGSYKSPFLRDFVHLNVAMMTSNNALVPDPDKQDDLASMWWQWPILNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNPI++W  TASL IF   + +Y+IR QR Y +LS    D   
Sbjct: 581 GLRMCGWDDKIVKYFLLGNPIVYWGSTASLGIFASLVAWYVIRWQRGYTELSQDDIDQIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF IM RVTY+HHY+PALYF++L   F+ D F        +  ++
Sbjct: 641 YAGIYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLADWFLKKRVKTIQAAVY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+ ++ ++ +F  I +G+  P  +    KW   W I D
Sbjct: 701 GLLYATVIGLYIFFIPICWGMTGPNKQYSYLKWFDGWRITD 741



>gi|443920103|gb|ELU40091.1| protein O-mannosyl transferase [Rhizoctonia solani AG-1 IA]
          Length = 765

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 216/423 (51%), Positives = 278/423 (65%), Gaps = 25/423 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKN+G+GGGLLHSH+  YP GS+QQQV+CYH+ D NN W  L P      +   E
Sbjct: 342 GSKVTLKNVGYGGGLLHSHVQTYPVGSQQQQVTCYHYKDDNNHWTFLPPWGSPDIDPNGE 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +  + +   +            SH + APVT  ++EVS YGN T+GD +D+WV+EV+DDL
Sbjct: 402 LVPLKHAAVVRLQHTPTTRNLHSHTVTAPVTKSNYEVSCYGNTTVGDSHDHWVVEVVDDL 461

Query: 121 Y----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
           +     K +RI SLTT +RF+H  LGCYLRAANA+LPQWGFKQ+EVSC K N+  D+ T+
Sbjct: 462 HRGRREKVDRIHSLTTRLRFKHQSLGCYLRAANAVLPQWGFKQIEVSCVKENDESDTHTY 521

Query: 177 WNIERHWNDK-------------------LPSGGKSYYRSKFLHDFWHLNVAMYTTNNAL 217
           WN+E HWN +                   +P G    Y S FL DFWHLNVAM T+NNAL
Sbjct: 522 WNVESHWNSRRKSLHSPPKLGSTLTNRRIVPPGNAKLYSSPFLRDFWHLNVAMMTSNNAL 581

Query: 218 VPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLL 277
           VPDPDKEDILAS P +WP + VGLRMC W DD  K+YLLG+PI+WWSG+ +L + +    
Sbjct: 582 VPDPDKEDILASKPTEWPFLHVGLRMCGWGDDQAKYYLLGHPIVWWSGSLALGLSLLATG 641

Query: 278 YYLIRRQRKYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSML 337
            YL+R QRKY D  P +WD F YV K+   GW+ H++PF IMGRVTY+HHY PAL+FS+L
Sbjct: 642 VYLLRAQRKYVDFGPGEWDQFSYVTKLAFFGWVFHFMPFLIMGRVTYIHHYLPALWFSVL 701

Query: 338 MAAFMMDHFTVSCK--PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLST 395
           M   + +HF  + +   +TK I+FG   S+IV VFW+F+ IAFGI  P  +     W  T
Sbjct: 702 MVGHLFNHFVFAARIAERTKWIVFGAAVSVIVGVFWWFRGIAFGITGPIKDYWGLAWRKT 761

Query: 396 WNI 398
           WNI
Sbjct: 762 WNI 764



>gi|346319255|gb|EGX88857.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2 [Cordyceps
           militaris CM01]
          Length = 743

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/402 (52%), Positives = 272/402 (67%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR TLKNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW I   R E  Y+ N T
Sbjct: 342 GSRATLKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFIYPNRGEADYDANST 401

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++ ++ +G  I            SHEIAAP+T    EVS+YGN T+GDD D+W IEVI D
Sbjct: 402 DIRYIADGSVIRLIHASTGRNLHSHEIAAPMTKSDREVSSYGNLTIGDDKDHWQIEVIRD 461

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             ++  +RIR+LTT  R +H  LGCYLRA N  LPQWGFKQ+EV+C   NNPRDS+THWN
Sbjct: 462 AASRDRSRIRTLTTGFRLKHPTLGCYLRAGNTNLPQWGFKQIEVTCTPKNNPRDSYTHWN 521

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E HWN+KLP G    Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 522 VESHWNEKLPPGDPGSYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 581

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMC W D++VK++LLGNP ++W+ TASL +    +++Y++R QR +KDL   + D  
Sbjct: 582 VGLRMCGWDDNIVKYFLLGNPFVYWASTASLGLVGLVVVWYILRWQRGFKDLDSEEVDQI 641

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L   F +D    +     +  +
Sbjct: 642 HYAGIYPVLGWFLHYLPFVIMARVTYVHHYYPALYFAILALGFFVDWLLRNRSQAIQGAV 701

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ YS+IV ++  F  I +G+     +    +W  TW + D
Sbjct: 702 YGVLYSVIVGLYITFIPICWGMTGNNRQYSYMRWFETWRMSD 743



>gi|212537941|ref|XP_002149126.1| protein O-mannosyl transferase [Talaromyces marneffei ATCC 18224]
 gi|210068868|gb|EEA22959.1| protein O-mannosyl transferase [Talaromyces marneffei ATCC 18224]
          Length = 739

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/401 (52%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+    
Sbjct: 339 GSKVTLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFMYPNRYQPEYDPEAP 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH +AAP+T   +EVS YGN T+GD+ D+W IEV+ D 
Sbjct: 399 LRFLGDGDVIRLIHAQTGRNLHSHSVAAPITKSDWEVSCYGNTTIGDEKDHWKIEVVSDA 458

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R RH  LGCYLRA    LPQWGFKQ+E +C K N PRD +THWN+
Sbjct: 459 ASRDRSKIRTLTTAFRLRHEALGCYLRAGTVNLPQWGFKQIETTCVKENKPRDVYTHWNV 518

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWP++ V
Sbjct: 519 ETHVNERLPPGDPGSYKSPFFKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPLLHV 578

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D++VK++LLGNP+++W  TASL+ F   + +YLIR QR Y DLSP++ D   
Sbjct: 579 GLRMCSWDDNIVKYFLLGNPLVYWGSTASLLGFGLIVAWYLIRWQRGYVDLSPSEIDQIH 638

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYLPF +M RVTY+HHY+PALYF++L A F +D  T     K +  I+
Sbjct: 639 YAGIYPLIGWVLHYLPFAVMARVTYVHHYYPALYFAILTAGFCVDWVTRKLGTKVQWAIY 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y  ++ +F  FKDI FG+     + +  KWLSTW I D
Sbjct: 699 IPLYIAVISLFVVFKDIVFGMEGSNRQWEYLKWLSTWRISD 739



>gi|240273718|gb|EER37237.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Ajellomyces
           capsulatus H143]
 gi|325094850|gb|EGC48160.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Ajellomyces
           capsulatus H88]
          Length = 744

 Score =  442 bits (1136), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/400 (51%), Positives = 268/400 (67%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  +N   +
Sbjct: 345 GSKATLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRQEPDFNPDGD 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++FV + D I            SH ++APVT   +EVS YGN T+GD+ D+W +EV+DD+
Sbjct: 405 LKFVGDKDVIRLIHAQTGRNLHSHAVSAPVTKSDYEVSCYGNTTVGDEKDHWRVEVVDDV 464

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +K  + IR+LTTS R RH +LGCYLRA    LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 465 ASKDRSNIRTLTTSFRLRHVVLGCYLRAGTVNLPQWGFKQIETTCVKQNNPRDVYTHWNV 524

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 525 ESHINERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPILHV 584

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW +D +K++LLGNP ++W GT SL +    L +YLIR QR Y +LS    DH  
Sbjct: 585 GLRMCSWDNDTIKYFLLGNPFVYWGGTLSLCVLGVILAWYLIRWQRGYDELSLVDMDHIY 644

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+  T   +   +  I+
Sbjct: 645 YSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWLTQKLRRSVEWAIY 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            ++Y++++ +F  F+DI FG+  P+ +     W  TW I 
Sbjct: 705 AVFYAVVIGLFVLFRDIVFGMEGPSLKWAHLAWFKTWRIA 744



>gi|261192876|ref|XP_002622844.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ajellomyces dermatitidis SLH14081]
 gi|239588979|gb|EEQ71622.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ajellomyces dermatitidis SLH14081]
          Length = 745

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 208/400 (52%), Positives = 273/400 (68%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+ GGLLHSH+  YP GS QQQV+CYHH D NNDW I   R+E  Y+    
Sbjct: 346 GSKVTLKNMGYSGGLLHSHVQTYPEGSTQQQVTCYHHKDTNNDWFIYPNRQEPNYDPNDP 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +++V + D I            SH ++AP+T  H EVS YGN T+GD+ D+W IEV+ D+
Sbjct: 406 LKYVADKDVIRLIHAQTGRNLHSHTVSAPITKSHNEVSCYGNTTVGDEKDHWRIEVLGDV 465

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTTS R RH++LGCYLRA    LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 466 ASRDRSKIRTLTTSFRLRHAVLGCYLRAGTVNLPQWGFKQIETTCIKENNPRDRYTHWNV 525

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNAL+PDPDK+D LAS   QWPI+ V
Sbjct: 526 ESHVNERLPPGDPGSYKSPFLQDFIHLNVAMMTSNNALIPDPDKQDELASQFWQWPILHV 585

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+V+K++LLGNPI++W GT SLV+    L +YLIR QR Y +LS A  +H  
Sbjct: 586 GLRMCSWDDNVIKYFLLGNPIVYWGGTLSLVLLGAILAWYLIRWQRGYDELSLADMEHIY 645

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           + G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+ FT       +  ++
Sbjct: 646 HSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWFTQKLPRSVEWAVY 705

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            + Y+ ++ +F  F+DI FG+   +S+     WLSTW I 
Sbjct: 706 TVLYAAVIGLFVLFRDIVFGMEGSSSKWAHLGWLSTWRIA 745



>gi|239613563|gb|EEQ90550.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ajellomyces dermatitidis ER-3]
 gi|327352671|gb|EGE81528.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Ajellomyces dermatitidis ATCC 18188]
          Length = 745

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/400 (51%), Positives = 273/400 (68%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++TLKNMG+ GGLLHSH+  YP GS QQQV+CYHH D NNDW I   R+E  Y+    
Sbjct: 346 GSKVTLKNMGYSGGLLHSHVQTYPEGSTQQQVTCYHHKDTNNDWFIYPNRQEPNYDPNDP 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +++V + D I            SH ++AP+T  H EVS YGN T+GD+ D+W +EV+ D+
Sbjct: 406 LKYVADKDVIRLIHAQTGRNLHSHTVSAPITKSHNEVSCYGNTTVGDEKDHWRVEVLGDV 465

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTTS R RH++LGCYLRA    LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 466 ASRDRSKIRTLTTSFRLRHAVLGCYLRAGTVNLPQWGFKQIETTCIKENNPRDRYTHWNV 525

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNAL+PDPDK+D LAS   QWPI+ V
Sbjct: 526 ESHVNERLPPGDPGSYKSPFLQDFIHLNVAMMTSNNALIPDPDKQDELASQFWQWPILHV 585

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D+V+K++LLGNPI++W GT SLV+    L +YLIR QR Y +LS A  +H  
Sbjct: 586 GLRMCSWDDNVIKYFLLGNPIVYWGGTLSLVLLGAILAWYLIRWQRGYDELSLADMEHIY 645

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           + G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+ FT       +  ++
Sbjct: 646 HSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWFTQKLPRSVEWAVY 705

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            + Y+ ++ +F  F+DI FG+   +S+     WLSTW I 
Sbjct: 706 TVLYAAVIGLFVLFRDIVFGMEGSSSKWAHLGWLSTWRIA 745



>gi|345560349|gb|EGX43474.1| hypothetical protein AOL_s00215g210 [Arthrobotrys oligospora ATCC
           24927]
          Length = 735

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 206/399 (51%), Positives = 266/399 (66%), Gaps = 1/399 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS+QQQ++CYHH D NNDW I   R ++ Y    +
Sbjct: 335 GSRATLKNMGYGGGLLHSHVQTYPEGSQQQQITCYHHKDANNDWFIYPNRSQKDYEVGED 394

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ N D I            SH IAAPVT   +EVS YGN T+GD+ D+W IEV+ D 
Sbjct: 395 LRFIKNNDVIRLIHAQTGRNLHSHTIAAPVTKADYEVSCYGNTTVGDEKDHWKIEVVRDA 454

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H +L CYLRA N  LPQWGFKQ+E SC K NNPRD +THWNI
Sbjct: 455 ASRDYSKIRTLTTAFRLKHPVLNCYLRAGNVNLPQWGFKQIETSCVKENNPRDQYTHWNI 514

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWN+KLP   K  ++S F +DF HLNVAM T+NNALVPDPDK+D LAS P QWPI+ V
Sbjct: 515 ESHWNEKLPPAKKDAFKSPFWNDFVHLNVAMMTSNNALVPDPDKQDDLASQPWQWPILHV 574

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W + +VK++LLGNP ++W   ASL +  F +L YL+R QR + DL+  Q DH  
Sbjct: 575 GLRMCGWDNHIVKYFLLGNPAVYWGAFASLFVLGFMILTYLVRFQRGFPDLTQDQIDHIK 634

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
             G    IGW+LH++PF IM RVTY+HHY+PALYF +L+  F  D  T       +   F
Sbjct: 635 LAGLYPAIGWVLHFIPFVIMARVTYVHHYYPALYFGILVFGFCFDWLTNLLPTNARLASF 694

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           G+ Y+++  ++ YF  I FG+   A++    KW   W I
Sbjct: 695 GVAYTIVTGLYIYFIPICFGMVGDAADYAYLKWFDRWRI 733



>gi|336468287|gb|EGO56450.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Neurospora tetrasperma FGSC 2508]
 gi|350289460|gb|EGZ70685.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Neurospora tetrasperma FGSC 2509]
          Length = 750

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/402 (51%), Positives = 273/402 (67%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+EQ Y+ N  
Sbjct: 349 GSRVTIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWFFYPNRREQAYDENSD 408

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           E+ ++ +G T+            SHEI AP+T    EVS YGN T+GD+ D+W IEV+ D
Sbjct: 409 EIRYIGDGSTVRLIHAQTGRNLHSHEIPAPMTKSDKEVSCYGNLTVGDEKDHWKIEVVKD 468

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             ++  ++IR+LTT+ R +H +LGCYLRA    LPQWGFKQ+E +C K NNPRD++THWN
Sbjct: 469 TNSRDRSKIRTLTTAFRLKHEVLGCYLRAGTVNLPQWGFKQIETTCTKTNNPRDTYTHWN 528

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E H N KLP      Y+S+FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 529 VESHTNPKLPPAEPGQYKSQFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 588

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMCSW D  VK++LLGNP+++W  TA+L +F   +++Y +R QR YK+L     D  
Sbjct: 589 VGLRMCSWDDKTVKYFLLGNPLVYWGSTAALGVFGLLVVWYTLRWQRGYKELGQDGIDQI 648

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    IGW LHYLPF +MGRVTY+HHY+PALYF++L   F+ D F  +    T+ I 
Sbjct: 649 HYAGVYPVIGWFLHYLPFIVMGRVTYVHHYYPALYFAILCFGFLADWFLRAKSKLTQGIA 708

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +GI Y+ ++ ++ +F  I++G+  P  + K  KW   W I D
Sbjct: 709 YGILYATVIGLYIFFMPISWGMVGPNQQYKYMKWFDNWRISD 750



>gi|164428088|ref|XP_956270.2| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Neurospora crassa OR74A]
 gi|157072006|gb|EAA27034.2| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Neurospora crassa OR74A]
          Length = 750

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/402 (51%), Positives = 273/402 (67%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+EQ Y+ N  
Sbjct: 349 GSRVTIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWFFYPNRREQAYDENSD 408

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           E+ ++ +G T+            SHEI AP+T    EVS YGN T+GD+ D+W IEV+ D
Sbjct: 409 EIRYIGDGSTVRLIHAQTGRNLHSHEIPAPMTKSDKEVSCYGNLTVGDEKDHWKIEVVKD 468

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             ++  ++IR+LTT+ R +H +LGCYLRA    LPQWGFKQ+E +C K NNPRD++THWN
Sbjct: 469 TNSRDRSKIRTLTTAFRLKHEVLGCYLRAGTVNLPQWGFKQIETTCTKTNNPRDTYTHWN 528

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E H N KLP      Y+S+FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 529 VESHTNPKLPPAEPGQYKSQFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 588

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMCSW D  VK++LLGNP+++W  TA+L +F   +++Y +R QR YK+L     D  
Sbjct: 589 VGLRMCSWDDKTVKYFLLGNPLVYWGSTAALGVFGLLVVWYTLRWQRGYKELGQDGIDQI 648

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    IGW LHYLPF +MGRVTY+HHY+PALYF++L   F+ D F  +    T+ I 
Sbjct: 649 HYAGVYPVIGWFLHYLPFIVMGRVTYVHHYYPALYFAILCFGFLADWFLRAKSKLTQGIA 708

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +GI Y+ ++ ++ +F  I++G+  P  + K  KW   W I D
Sbjct: 709 YGILYATVIGLYIFFMPISWGMVGPNQQYKYMKWFDNWRISD 750



>gi|9368945|emb|CAB99175.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Neurospora crassa]
          Length = 748

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/402 (51%), Positives = 273/402 (67%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+EQ Y+ N  
Sbjct: 347 GSRVTIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWFFYPNRREQAYDENSD 406

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           E+ ++ +G T+            SHEI AP+T    EVS YGN T+GD+ D+W IEV+ D
Sbjct: 407 EIRYIGDGSTVRLIHAQTGRNLHSHEIPAPMTKSDKEVSCYGNLTVGDEKDHWKIEVVKD 466

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             ++  ++IR+LTT+ R +H +LGCYLRA    LPQWGFKQ+E +C K NNPRD++THWN
Sbjct: 467 TNSRDRSKIRTLTTAFRLKHEVLGCYLRAGTVNLPQWGFKQIETTCTKTNNPRDTYTHWN 526

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E H N KLP      Y+S+FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 527 VESHTNPKLPPAEPGQYKSQFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 586

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMCSW D  VK++LLGNP+++W  TA+L +F   +++Y +R QR YK+L     D  
Sbjct: 587 VGLRMCSWDDKTVKYFLLGNPLVYWGSTAALGVFGLLVVWYTLRWQRGYKELGQDGIDQI 646

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    IGW LHYLPF +MGRVTY+HHY+PALYF++L   F+ D F  +    T+ I 
Sbjct: 647 HYAGVYPVIGWFLHYLPFIVMGRVTYVHHYYPALYFAILCFGFLADWFLRAKSKLTQGIA 706

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +GI Y+ ++ ++ +F  I++G+  P  + K  KW   W I D
Sbjct: 707 YGILYATVIGLYIFFMPISWGMVGPNQQYKYMKWFDNWRISD 748



>gi|402084072|gb|EJT79090.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Gaeumannomyces graminis var. tritici R3-111a-1]
          Length = 741

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 205/401 (51%), Positives = 274/401 (68%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  YN   E
Sbjct: 341 GSRVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRREPEYNETEE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +GD+             SHEI+APVT    EVS YGN T+GDD D+W +EV+ D+
Sbjct: 401 PRFIGDGDSFRLIHAQTGRNMHSHEISAPVTKSDKEVSCYGNLTIGDDKDHWKVEVVRDV 460

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C   NNPRD++T WN+
Sbjct: 461 ASRNRSRIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVACTPKNNPRDTYTWWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H NDKLP G  + Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 521 EAHTNDKLPKGNPAVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP ++W+ TASL      +++Y++R QR Y++LS  + +  L
Sbjct: 581 GLRMCGWDDNIVKYFLLGNPFVYWATTASLGFVGLLVVWYVLRWQRGYRELSKPEMEQIL 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF +M RVTY+HHY+PALYF++L   F++D    S +   +  ++
Sbjct: 641 YSGIYPIIGWFLHYLPFVVMARVTYVHHYYPALYFAILSFGFLIDWTLRSLQKPIQYGLY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I Y +++ ++  F  I +G+  P  +    KW  TW + D
Sbjct: 701 SILYVVVIGLYIMFMPICWGMTGPNKQYSYMKWFDTWRMSD 741



>gi|225555541|gb|EEH03833.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Ajellomyces
           capsulatus G186AR]
          Length = 744

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/400 (51%), Positives = 268/400 (67%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  +N   +
Sbjct: 345 GSKATLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRQEPDFNPDGD 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++FV + D I            SH ++APVT   +EVS YGN T+GD+ D+W +EV+DD+
Sbjct: 405 LKFVGDKDVIRLIHAQTGRNLHSHAVSAPVTKSDYEVSCYGNTTVGDEKDHWRVEVVDDV 464

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +K  + IR+LTTS R RH +LGCYLRA    LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 465 ASKDRSNIRTLTTSFRLRHVVLGCYLRAGTVNLPQWGFKQIETTCVKQNNPRDVYTHWNV 524

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 525 ESHINERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPILHV 584

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW +D +K++LLGNP ++W GT SL +    L +YLIR QR Y +LS    DH  
Sbjct: 585 GLRMCSWDNDTIKYFLLGNPFVYWGGTLSLCVLGVILAWYLIRWQRGYDELSLVDMDHIY 644

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+  T   +   +  I+
Sbjct: 645 YSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWLTQKLRRSVEWAIY 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            ++Y++++ +F  F+DI FG+  P+ +     W  TW I 
Sbjct: 705 VVFYAVVIGLFVLFRDIVFGMEGPSLKWAHLAWFKTWRIA 744



>gi|403174471|ref|XP_003333435.2| dolichyl-phosphate-mannose-protein mannosyltransferase [Puccinia
           graminis f. sp. tritici CRL 75-36-700-3]
 gi|375170992|gb|EFP89016.2| dolichyl-phosphate-mannose-protein mannosyltransferase [Puccinia
           graminis f. sp. tritici CRL 75-36-700-3]
          Length = 778

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/412 (51%), Positives = 275/412 (66%), Gaps = 12/412 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMGFGGGLLHSH+  YP GS+QQQV+CYH+ D+NNDWM+     E  YN    
Sbjct: 362 GSRVTIKNMGFGGGLLHSHVQTYPTGSQQQQVTCYHYRDMNNDWMVTPLLHEPAYNESQP 421

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++F+ +G  I            +H I AP+T ++ EV+ YGN T+ D + YW+IEV+DD+
Sbjct: 422 IKFLKHGSVIRLVHVLTGRNLHTHTIPAPITTLNHEVAGYGNATIDDSSSYWLIEVVDDM 481

Query: 121 YTKTNR----IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
                +    I  L+T  R R+  LGCYLRAANA+LPQWGFKQVEVSCDK N+P D  T+
Sbjct: 482 IRGKRKNFENINILSTRFRIRNLNLGCYLRAANAVLPQWGFKQVEVSCDKQNDPNDHHTY 541

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E H N +LP G     RS FL DFWHLNVAM T+NNAL+PDPDKED  ASTP +WP 
Sbjct: 542 WNVESHINPRLPEGDMKLMRSPFLKDFWHLNVAMMTSNNALIPDPDKEDATASTPLEWPF 601

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           V  G+RM +W D+ +KFYL+GNP+ WW  T++LV++  +L++YL R +R+  DLSP +W 
Sbjct: 602 VYTGMRMNAWIDNGIKFYLIGNPLTWWLSTSALVVYCLSLVWYLGRYKRQINDLSPIEWR 661

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPK--- 353
            F+Y GKV   GW+LHY PF  MGRVTYLHHYFPAL+FS+LM   ++DHF    K     
Sbjct: 662 RFIYGGKVALGGWILHYAPFLFMGRVTYLHHYFPALWFSILMFGLIVDHFIFKAKTSRFI 721

Query: 354 --TKNIIFGIYYSLIVIVFW---YFKDIAFGINYPASELKSRKWLSTWNIVD 400
             TK     I  +L V +     +FKD A+GI+ P    K R+W  +W+I D
Sbjct: 722 RLTKLNKIAICSTLCVAIMLTGIWFKDCAWGISGPIHLYKYRQWRKSWSIYD 773



>gi|358378327|gb|EHK16009.1| glycosyltransferase family 39 protein [Trichoderma virens Gv29-8]
          Length = 740

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/400 (51%), Positives = 274/400 (68%), Gaps = 2/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y+  + 
Sbjct: 339 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRFEADYDAESP 398

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++ F+ +G  I            SHEI APVT  H EVS+YGN T+GDD D+W IEV+ D
Sbjct: 399 DLRFIGDGSVIRLIHAQTGRNLHSHEIDAPVTKSHREVSSYGNLTVGDDKDHWRIEVVRD 458

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             ++  ++IR+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+CDK NNPRD++THWN
Sbjct: 459 TASRDRSKIRTLTTAFRLKHTALGCYLRAGNVNLPQWGFKQIEVTCDKQNNPRDTYTHWN 518

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E HWN+KLP+     Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 519 VEAHWNEKLPASDPGVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASHWWQWPILH 578

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMC W D++VK++LLGNP ++W  TASL +    + +Y++R QR +K+L+ A+ D  
Sbjct: 579 VGLRMCGWDDNIVKYFLLGNPFVYWVSTASLGLVALVVAWYIVRWQRGFKELNNAEIDQI 638

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    IGW LHYLPF IM RVTY+HHY+PALYF++L   F++D    +     + +I
Sbjct: 639 HYAGIYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILSLGFLVDWVLRNRNAVVQGVI 698

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           +GI Y++I+ ++  F  I +G+     +    KW   W I
Sbjct: 699 YGILYTVIIGLYILFIPICWGMTGSNEQYSYLKWFDNWRI 738



>gi|358397085|gb|EHK46460.1| glycosyltransferase family 39 protein [Trichoderma atroviride IMI
           206040]
          Length = 740

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 206/401 (51%), Positives = 271/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  Y+   +
Sbjct: 340 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRYEPDYDAEGD 399

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +G  I            SH+I APVT  H EVS+YGN T+GDD D+W IEV+ D 
Sbjct: 400 LRFIGDGSVIRLIHAQTGRNLHSHDIDAPVTKSHREVSSYGNLTVGDDKDHWQIEVVRDA 459

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H+ L CYLRA N  LPQWGFKQ+EV+CDK NNPRD++THWN+
Sbjct: 460 ASRDRSKIRTLTTAFRLKHTALDCYLRAGNVNLPQWGFKQIEVTCDKQNNPRDTYTHWNV 519

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP    + Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 520 EAHWNDKLPESDPNVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILNV 579

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP I+W  T SL +    +++Y++R QR Y++L   + D   
Sbjct: 580 GLRMCGWDDNIVKYFLLGNPFIYWGSTVSLGLVGLVVVWYIVRWQRGYRELDNQEIDQIH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF IM RVTY+HHY+PALYF++L   F++D    +     + +I+
Sbjct: 640 YAGIYPIIGWFLHYLPFVIMARVTYVHHYYPALYFAILSLGFLVDWTMRNRAAVVQGVIY 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ YS+I+ ++  F  I +G+     +    KW   W I D
Sbjct: 700 GVLYSVIIGLYILFMPICWGMTGNNQQYSYLKWFDNWRISD 740



>gi|258569719|ref|XP_002543663.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Uncinocarpus reesii 1704]
 gi|237903933|gb|EEP78334.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Uncinocarpus reesii 1704]
          Length = 754

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 208/401 (51%), Positives = 271/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW I   R +  Y+   E
Sbjct: 350 GSKVTIKNMGYGGGLLHSHVQTYPSGSSQQQVTCYHHKDTNNDWFIYPNRTQPEYDPEGE 409

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH I AP+T  ++EVS YGN T+GDD D+WV+EV++D+
Sbjct: 410 LRFIGDGDIIRLIHAQTGRNLHSHTIPAPITKSNWEVSCYGNTTVGDDKDHWVVEVVNDV 469

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++   +IR+LTTS R RH  LGCYLRAAN  LPQWGFKQ+E +C K++ P D  THWN+
Sbjct: 470 ASRDRTKIRTLTTSFRLRHQSLGCYLRAANVNLPQWGFKQIETTCAKDSKPYDVHTHWNV 529

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP      Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 530 ESHVNERLPKSDPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILNV 589

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW +D VK++LLGNP ++W  TASL +F     +YL+R QR Y +LS A  DH  
Sbjct: 590 GLRMCSWDNDTVKYFLLGNPFVYWCSTASLGVFGLIFAWYLVRWQRGYTELSQADIDHIH 649

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHYLPF IM RVTY+HHY+PALYF++L   F ++ FT       +  ++
Sbjct: 650 YSGLYPLLGWVLHYLPFIIMARVTYVHHYYPALYFAILTMGFCVNWFTQKLNKPAEWAVY 709

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I Y+ ++ +F  FKDI FG+     + +   W STW I +
Sbjct: 710 FILYAAVISLFVVFKDIVFGMVGSNEQWQHLNWFSTWRIAN 750



>gi|119196351|ref|XP_001248779.1| hypothetical protein CIMG_02550 [Coccidioides immitis RS]
 gi|392862004|gb|EAS37392.2| O-mannosyl transferase pmtA [Coccidioides immitis RS]
          Length = 747

 Score =  438 bits (1127), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/401 (51%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW +   R +  Y+   E
Sbjct: 343 GSKVTIKNMGYGGGLLHSHVQTYPSGSSQQQVTCYHHKDSNNDWFVYPNRTQPDYDPEGE 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ +GD I            SH I AP+T  ++EVS YGN T+GDD D+WV+EV++D+
Sbjct: 403 LRFIGDGDIIRLIHAQTGRNLHSHAIPAPITKSNWEVSCYGNTTVGDDKDHWVVEVVNDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +K  ++IR+LTT+ R RH  LGCYLRA N  LPQWGFKQ+E +C K N P D  THWN+
Sbjct: 463 ASKDRSKIRTLTTAFRLRHPSLGCYLRAGNVNLPQWGFKQIETTCVKENKPYDVHTHWNV 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++L  G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWP++ V
Sbjct: 523 ESHVNERLQKGDPGAYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPVLNV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW +D VK++LLGNP ++W  TASL +F   + +YL+R QR Y +LS A  DH  
Sbjct: 583 GLRMCSWDNDTVKYFLLGNPFVYWGSTASLAVFGLVVAWYLVRWQRGYTELSQADIDHIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHYLPF IM RVTY+HHY+PALYF++L   F ++ FT       +  ++
Sbjct: 643 YSGIYPLLGWVLHYLPFIIMARVTYVHHYYPALYFAILTMGFCVNWFTQKLSKPVEWAVY 702

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ +F  FKDI FG+     + +   WLSTW I +
Sbjct: 703 FVLYAAVISLFVVFKDIVFGMQGSNEQWQYLNWLSTWRIAN 743



>gi|154288412|ref|XP_001545001.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Ajellomyces capsulatus NAm1]
 gi|150408642|gb|EDN04183.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Ajellomyces capsulatus NAm1]
          Length = 649

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/400 (51%), Positives = 268/400 (67%), Gaps = 1/400 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  +N   +
Sbjct: 250 GSKATLKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRQEPDFNPDGD 309

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++FV + D I            SH ++APVT   +EVS YGN T+GD+ D+W +EV+DD+
Sbjct: 310 LKFVGDKDVIRLIHAQTGRNLHSHAVSAPVTKSDYEVSCYGNTTVGDEKDHWRVEVVDDV 369

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +K  + IR+LTTS R RH++LGCYLRA    LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 370 ASKDRSNIRTLTTSFRLRHAVLGCYLRAGTVNLPQWGFKQIETTCVKQNNPRDVYTHWNV 429

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 430 ESHINERLPPGDPGSYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPILHV 489

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW +D +K++LLGNP ++W GT SL +    L +YLIR QR Y +LS    DH  
Sbjct: 490 GLRMCSWDNDTIKYFLLGNPFVYWGGTLSLCVLGVILAWYLIRWQRGYDELSLVDMDHIY 549

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY PF  M RVTY+HHY+PALYF++L   F M+  T   +   +  I+
Sbjct: 550 YSGLYPAIGWFLHYFPFVAMARVTYVHHYYPALYFTILSLGFCMNWLTQKLRRSVEWAIY 609

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            ++Y++++ +F  F+DI FG+   + +     W  TW I 
Sbjct: 610 VVFYAVVIGLFVLFRDIVFGMEGSSLKWAHLAWFKTWRIA 649



>gi|189195184|ref|XP_001933930.1| protein O-mannosyl-transferase 2 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187979809|gb|EDU46435.1| protein O-mannosyl-transferase 2 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 739

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/401 (51%), Positives = 269/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y    E
Sbjct: 339 GSRVTLKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDANNDWFFYPNRHEVEYKPDEE 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + +  NGD I            SH +AAPVT   +EVS YGN T+GD  D+WV+EV+ D 
Sbjct: 399 LRYPGNGDVIRLIHAQTGRNLHSHAVAAPVTKSDWEVSCYGNTTVGDTKDHWVVEVVRDA 458

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +++R+LTTS R +H  LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWNI
Sbjct: 459 ASRDYSKLRTLTTSFRLKHKDLGCYLRAGNVNLPQWGFKQIETTCVKKNNPRDVYTHWNI 518

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS+  QWPI+ V
Sbjct: 519 ESHTNERLPPGNPGDYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILHV 578

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP+++W  TASL IF   +L+YL+R QR Y DL+  + D   
Sbjct: 579 GLRMCGWNDDIVKYFLLGNPLVYWGSTASLGIFGLIVLFYLVRWQRGYNDLNKFEIDQIH 638

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHY+PF  MGRVTY+HHY+PAL+F++L+  F +D  T     + +  I 
Sbjct: 639 YAGIYPIIGWVLHYIPFVAMGRVTYVHHYYPALWFAILVMGFCLDFSTRKLSKQVQWGIC 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y+  + ++  F   +FG+  P S+ K  KW  +W + D
Sbjct: 699 AGLYAATIGLYILFAPTSFGMVGPNSQYKYLKWFDSWRVTD 739



>gi|171689102|ref|XP_001909491.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944513|emb|CAP70624.1| unnamed protein product [Podospora anserina S mat+]
          Length = 795

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/401 (50%), Positives = 271/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R++  Y+   E
Sbjct: 394 GSKVTIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRRDADYDAAAE 453

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G TI            SH+IAAP+T   +EVS+YGN T+GD+ D+W IEV+ D 
Sbjct: 454 PRFIADGQTIRLLHSQTGRNLHSHQIAAPITKADWEVSSYGNITVGDEKDHWKIEVVSDA 513

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K+N PRD++THWNI
Sbjct: 514 ASRDRSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCTKDNKPRDTYTHWNI 573

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N+KLP G    YRS F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 574 ESHINEKLPPGDPGQYRSPFFKDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 633

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TA L +F    ++Y++R QR Y++LS    D   
Sbjct: 634 GLRMCGWDDKIVKYFLLGNPLVYWGSTAGLGVFGLLTVWYILRWQRGYRELSQFDIDQIH 693

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF IM RVTY+HHY+PALYF++L   F+ D FT + K   +   +
Sbjct: 694 YAGIYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLTDWFTRNQKKIIQYATY 753

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +  + ++ ++ YF  I +G+  P  +    KW  TW + D
Sbjct: 754 AVLDATVIGLYIYFIPICWGMTGPNRQYGYMKWFDTWRMSD 794



>gi|471561503|gb|EMR63260.1| putative dolichyl-phosphate-mannose-protein mannosyltransferase 2
           protein [Eutypa lata UCREL1]
          Length = 741

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/402 (51%), Positives = 274/402 (68%), Gaps = 3/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KN G+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R +  Y+   +
Sbjct: 341 GSRVTIKNQGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDANNDWWFYPNRFDADYDPEAD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G  I            SH+I APV+  H EVS+YGN T+GDD D+W IEV+ D+
Sbjct: 401 PRFIGDGSVIRLIHSQTGRNLHSHDIPAPVSKSHKEVSSYGNLTVGDDKDHWKIEVVKDV 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  ++IR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+CDK+NNPRD+FTHWNI
Sbjct: 461 ASRDKSKIRTLTTAFRLKHEVLGCYLRAGNVNLPQWGFKQIEVTCDKSNNPRDTFTHWNI 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N+KLP G    Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 521 EGHTNEKLPPGDPGKYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP I+W  T SL +     L+Y++R QR +++LS    D   
Sbjct: 581 GLRMCGWDDKIVKYFLLGNPFIYWVSTGSLGVVGLMTLWYILRWQRGFRELSQEDIDQIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT-KNII 358
           Y G    +GW LHYLPF +M RVTY+HHY+PALYF++L   F++D F +  KPK  +  I
Sbjct: 641 YSGLYPILGWFLHYLPFVVMARVTYVHHYYPALYFAILSLGFLVD-FVLKEKPKVIQYAI 699

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y+++  ++ YF  I +G+     + K  KW  +W I D
Sbjct: 700 YGVLYTVVSGLYIYFIPICWGMTGSNQQYKYMKWFDSWRISD 741



>gi|330925781|ref|XP_003301191.1| hypothetical protein PTT_12634 [Pyrenophora teres f. teres 0-1]
 gi|311324296|gb|EFQ90718.1| hypothetical protein PTT_12634 [Pyrenophora teres f. teres 0-1]
          Length = 739

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/401 (51%), Positives = 269/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y    E
Sbjct: 339 GSRVTLKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDANNDWFFYPNRHEVDYKPDEE 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + +  NGD I            SH +AAPVT   +EVS YGN T+GD  D+WV+EV+ D 
Sbjct: 399 LRYPGNGDVIRLIHAQTGRNLHSHTVAAPVTKSDWEVSCYGNTTVGDTKDHWVVEVVRDA 458

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +++R+LTTS R +H  LGCYLRA N  LPQWGFKQ+E +C K NNPRD +THWNI
Sbjct: 459 ASRDYSKLRTLTTSFRLKHKDLGCYLRAGNVNLPQWGFKQIETTCVKKNNPRDVYTHWNI 518

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS+  QWPI+ V
Sbjct: 519 ESHTNERLPPGNPGDYKSPFFQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWQWPILNV 578

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W+DD+VK++LLGNP+++W  TASL IF   +L+YL+R QR Y DL+  + D   
Sbjct: 579 GLRMCGWSDDIVKYFLLGNPLVYWGSTASLGIFGLIVLFYLVRWQRGYTDLNKFEIDQIH 638

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHY+PF  MGRVTY+HHY+PAL+F++L+  F +D        + +  I 
Sbjct: 639 YAGFYPVVGWVLHYIPFVAMGRVTYVHHYYPALWFAILVMGFCLDFSIRKLSKQVQWGIC 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y + + ++  F   +FG+  P S+ K  KW  +W + D
Sbjct: 699 AVLYVVTIGLYILFAPTSFGMVGPNSQYKYLKWFDSWKVTD 739



>gi|336271891|ref|XP_003350703.1| hypothetical protein SMAC_02375 [Sordaria macrospora k-hell]
 gi|380094865|emb|CCC07367.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 750

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 204/402 (50%), Positives = 271/402 (67%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+EQ Y+  + 
Sbjct: 349 GSRVTIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDSNNDWFFYPNRREQAYDESSD 408

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           E+ ++ +G T+            SHEI AP+T    EVS YGN T+GD+ D+W IEV+ D
Sbjct: 409 EIRYIGDGSTVRLIHAQTGRNLHSHEIPAPMTKADKEVSCYGNLTVGDEKDHWKIEVVKD 468

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             ++  ++IR+LTT+ R +H +LGCYLRA    LPQWGFKQ+E +C K NNPRD++THWN
Sbjct: 469 TNSRDRSKIRTLTTAFRLKHEVLGCYLRAGTVNLPQWGFKQIETTCTKTNNPRDTYTHWN 528

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E H N KLP      Y+++F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 529 VESHTNPKLPPAEPGQYKNQFFQDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILH 588

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMCSW D  VK++LLGNP+++W  TA L +F   +++Y +R QR Y +L+    D  
Sbjct: 589 VGLRMCSWDDKTVKYFLLGNPLVYWGSTAGLGVFGLLVIWYTLRWQRGYNELNQDSIDQI 648

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    IGW LHYLPF +MGRVTY+HHY+PALYF++L   F+ D F       T++I 
Sbjct: 649 HYAGIYPVIGWFLHYLPFIVMGRVTYVHHYYPALYFAILSFGFLADWFFRGKSKLTQSIG 708

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           FGI Y+ ++ ++ +F  I++G+  P  + K  KW   W I D
Sbjct: 709 FGILYATVIGLYIFFMPISWGMVGPNQQYKYMKWFDNWRISD 750



>gi|453087664|gb|EMF15705.1| glycosyltransferase family 39 protein [Mycosphaerella populorum
           SO2202]
          Length = 741

 Score =  435 bits (1119), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/401 (51%), Positives = 266/401 (66%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  ++   E
Sbjct: 341 GSRVTLKNMGYGGGLLHSHVQTYPEGSNQQQITCYHHKDANNDWFFYPNRNEPDFDPEAE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++FV +   I            SH++AAPVT   +EVS YGN T+GD  D+W++EV++D 
Sbjct: 401 LKFVGDKAEIRLIHAQTGRNLHSHQVAAPVTKADYEVSCYGNVTVGDTKDHWIVEVVNDA 460

Query: 121 YT-KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   ++IR+LTT+ R +H  LGCYLRA N  LPQWGFKQ+E +C K N PRD +THWN+
Sbjct: 461 ASYDYSKIRTLTTAFRLKHRDLGCYLRAGNVNLPQWGFKQIETTCVKENKPRDPYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP+     Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS P QWP++ V
Sbjct: 521 ESHVNERLPASQPGSYKSPFFRDFVHLNVAMMTSNNALVPDPDKQDDLASAPWQWPLLNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK+YLLGNP ++W+ TASL  F+    +Y IR QR Y +L+ A  DHF 
Sbjct: 581 GLRMCGWDDHIVKYYLLGNPFVYWASTASLFFFIGLFGWYAIRWQRGYDELTWADLDHFQ 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF  M RVTY+HHY+PALYF++L   F +D  T S     +  IF
Sbjct: 641 YAGIYPVIGWFLHYLPFIAMARVTYVHHYYPALYFAILCFGFCIDWTTRSLHKGVQWGIF 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y+++  +FW F+   FG+     + K  KWL +W + D
Sbjct: 701 AGLYAVVFGMFWLFRAFCFGMEGSNQQWKHLKWLPSWKMAD 741



>gi|452845997|gb|EME47930.1| glycosyltransferase family 39 protein [Dothistroma septosporum
           NZE10]
          Length = 745

 Score =  435 bits (1118), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/401 (51%), Positives = 267/401 (66%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR TLKNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E  ++    
Sbjct: 345 GSRATLKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRHEADFDPEAP 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++FV + D I            SH++AAPVT   +EVS+YGN T+GD  D+W +E+I+D 
Sbjct: 405 LKFVGDKDVIRLIHAQTGRNLHSHQVAAPVTKADWEVSSYGNVTIGDTKDHWQVEIINDA 464

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +++R+LTT+ R +H  LGCYLRA N  LPQWGFKQ+EV+C K N PRD +THWN+
Sbjct: 465 ASRDHSKLRTLTTAFRLKHVDLGCYLRAGNVNLPQWGFKQIEVTCVKQNKPRDPYTHWNV 524

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N+KLP+G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS P QWP++ V
Sbjct: 525 ESHTNEKLPAGDPGSYKSPFFRDFIHLNVAMMTSNNALVPDPDKQDDLASKPWQWPLLNV 584

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W ++++K++LLGNP+++W  + SL  F+  + +Y IR QR Y +L+  Q DHF 
Sbjct: 585 GLRMCGWDENIIKYFLLGNPLVYWGSSLSLGFFLAMVAWYAIRWQRGYDELTWKQIDHFQ 644

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF  M RVTY+HHY+PALYF++L   F  D  T     + +  IF
Sbjct: 645 YSGIYPVIGWFLHYLPFIAMARVTYVHHYYPALYFAILSFGFCADWLTRQLPSRVQWAIF 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y     +FW FKD  FG+     +    KWLSTW + D
Sbjct: 705 TVLYVATTGLFWLFKDFCFGMVGNNQQWSHLKWLSTWRMSD 745



>gi|156050067|ref|XP_001590995.1| hypothetical protein SS1G_07619 [Sclerotinia sclerotiorum 1980]
 gi|154692021|gb|EDN91759.1| hypothetical protein SS1G_07619 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 742

 Score =  435 bits (1118), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/401 (49%), Positives = 271/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQ++CYHH D NN+W     R +  ++    
Sbjct: 342 GSRATIKNMGYGGGLLHSHVQTYPEGSNQQQITCYHHKDANNEWWFYPNRSQPEFDPEAP 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + +V NGD +            SH+++AP+T    EVS YGN T+GDD D+W +EV+ D+
Sbjct: 402 LRYVANGDVLRLVHSQTGRNLHSHDVSAPITKADKEVSCYGNTTVGDDKDHWTMEVVKDV 461

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   ++IR+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+C K+NNP+D +THWN+
Sbjct: 462 SSNDRSKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPKDVYTHWNV 521

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWN+KLP+     Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 522 EAHWNEKLPAADAGAYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASYFWQWPILNV 581

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP+++W  TASL +    +L+YLIR QR Y +LS    D   
Sbjct: 582 GLRMCGWDDNIVKYFLLGNPLVYWGSTASLGVLGVLVLWYLIRWQRGYGELSQTDIDQIH 641

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW+LHYLPF  M RVTY+HHY+PALYF++L   F  D    +     +  I+
Sbjct: 642 YAGLYPVLGWVLHYLPFVAMARVTYVHHYYPALYFAILTFGFCSDWMLRNQAKTLQYAIY 701

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y L + ++ +F  I++G++ P  +    KW  +W + D
Sbjct: 702 GVLYGLTIALYIFFIPISWGMSGPNQQYSRLKWFDSWRVTD 742



>gi|169596911|ref|XP_001791879.1| hypothetical protein SNOG_01229 [Phaeosphaeria nodorum SN15]
 gi|111069758|gb|EAT90878.1| hypothetical protein SNOG_01229 [Phaeosphaeria nodorum SN15]
          Length = 739

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/401 (51%), Positives = 268/401 (66%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R E  Y    E
Sbjct: 339 GSRVTLKNMGYGGGLLHSHVQTYPEGSMQQQITCYHHKDANNDWFFYPNRHEVDYQPDEE 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F  +   I            SH +AAPVT   +EVS YGN T+GD  D+W I+++ D 
Sbjct: 399 LRFPKDKSVIRLIHAQTGRNLHSHAVAAPVTKADWEVSCYGNTTVGDTKDHWEIQIVRDA 458

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   +++R+LTT++RF+H  LGCYLRA N  LPQWGFKQ+E +C K+NNPRD +THWNI
Sbjct: 459 ASNDRSKVRTLTTALRFKHVDLGCYLRAGNVNLPQWGFKQIETTCVKSNNPRDVYTHWNI 518

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H ND+LP+G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS+  +WP + V
Sbjct: 519 ESHVNDRLPAGNPGDYKSPFFQDFIHLNVAMMTSNNALVPDPDKQDDLASSFWEWPFLHV 578

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W DD+VK++LLGNP ++W  TASL IF   +++Y +R QR Y DL  A  D   
Sbjct: 579 GLRMCGWNDDIVKYFLLGNPFVYWGSTASLGIFGLIVIWYTVRWQRGYNDLKQADIDQIH 638

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHY+PF  MGRVTY+HHY+PAL+F++++  F +D  T     K +  IF
Sbjct: 639 YSGLYPIIGWALHYVPFVAMGRVTYVHHYYPALWFAIIVMGFCVDWATRGLNKKVQWGIF 698

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y +I+ ++W F+ I+FG+  P+S+    KW  +W I D
Sbjct: 699 SALYVIIIGLYWLFRAISFGMVGPSSQWSHLKWFDSWRITD 739



>gi|406865997|gb|EKD19037.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Marssonina
           brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 746

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 203/401 (50%), Positives = 267/401 (66%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R +   +   E
Sbjct: 346 GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNEWWFFPNRAQPDLDPEAE 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            +FV +GD +            SHE++APVT    EVS YGN T+GD+ D+W +EV+ D+
Sbjct: 406 PKFVADGDVLRLLHSQTGRNLHSHEVSAPVTKNDREVSCYGNVTVGDEKDHWTMEVVRDV 465

Query: 121 YT-KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +    +IR+LTT+ R RH++LGCYLRA N  LPQWGFKQ+EV+CDK NNP+D +THWN+
Sbjct: 466 GSGDKTKIRTLTTAFRLRHTVLGCYLRAGNVNLPQWGFKQIEVTCDKANNPKDVYTHWNV 525

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP+     Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 526 EAHWNDKLPAADAGAYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASEFWQWPILNV 585

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK+YLLGNP+++W  TASL +      +YL+R QR Y +L     D   
Sbjct: 586 GLRMCGWDDNIVKYYLLGNPLVYWGSTASLGLVALMFSWYLVRWQRGYMELREWDIDQIH 645

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHY+PF  MGRVTY+HHY+PALYF++L+  F+ D    S     +   +
Sbjct: 646 YAGLYPVLGWFLHYIPFVSMGRVTYVHHYYPALYFALLVFGFVTDWMLRSRGKTVQVAAY 705

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G  Y+L + ++ YF  I++G+  P    +  KW  +W + D
Sbjct: 706 GFLYALTIGLYIYFMPISWGMVGPNKNYRYMKWFDSWRVTD 746



>gi|440631744|gb|ELR01663.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Geomyces
           destructans 20631-21]
          Length = 746

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 202/402 (50%), Positives = 267/402 (66%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R E  Y+    
Sbjct: 345 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDSNNEWFFYPNRAEPEYDGEGP 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            +FV +GD +            SH+++AP+T V  EVS YGN T+GD+ D++ IEV+ D+
Sbjct: 405 PKFVAHGDVLRLIHAQTGRNLHSHDVSAPITKVDKEVSCYGNTTVGDEKDHFTIEVVKDV 464

Query: 121 YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
            + T++  IR+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+C K NNP+D+FTHWN
Sbjct: 465 SSNTDKTKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKANNPKDTFTHWN 524

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E HWN KLP+   + Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 525 VEAHWNSKLPAADANAYKSPFFQDFIHLNVAMATSNNALVPDPDKQDDLASHFWQWPILN 584

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMC W D +VK++LLGNPI++W  TASL +    +L+YLIR QR Y DL  ++ D  
Sbjct: 585 VGLRMCGWDDSIVKYFLLGNPIVYWGSTASLALLGLIVLWYLIRWQRGYADLKQSEIDQI 644

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G    IGW LHY PF  M RVTY+HHY+PALYF++L   F  D          +  +
Sbjct: 645 HYAGIYPVIGWFLHYFPFVAMARVTYVHHYYPALYFAILTFGFCADWMLRRRAKAVQFAV 704

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G  Y+ ++ ++  F  I++G+  P S+ +  KW   W + D
Sbjct: 705 YGALYTAVIGLYILFMPISWGMVGPNSQYRYLKWFEKWRVSD 746



>gi|346979040|gb|EGY22492.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Verticillium dahliae VdLs.17]
          Length = 744

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/401 (51%), Positives = 267/401 (66%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E+ Y+   E
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDTNNDWFFYPNRDEEPYDAEAE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             ++ +G TI            SHEIAAP+T    EVS YGN T+GD  D+W IEV+ D 
Sbjct: 401 PRYIADGTTIRLIHAQTGRNLHSHEIAAPMTKSDKEVSCYGNLTVGDAKDHWKIEVVRDA 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +R+R+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K NNPRD++THWN+
Sbjct: 461 ASRDRSRVRTLTTAFRLKHPVLGCYLRAGNKNLPQWGFKQIEVTCTKTNNPRDTYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDK+P      Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI++V
Sbjct: 521 EAHWNDKIPKSDPGVYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASHWWQWPILDV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D VVK++LLGNP ++W  T  L +F   + +Y++R QR + DL+  + D   
Sbjct: 581 GLRMCSWDDSVVKYFLLGNPFVYWGTTLGLGVFGLVIAWYVLRWQRGFGDLNYKEVDQIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW+LHYLPF  M RVTY+HHY+PALYF++L   F+ D F  +     +  I+
Sbjct: 641 YAGVYPVIGWVLHYLPFVAMARVTYVHHYYPALYFAILTFGFLADWFLRNKNKTIQYAIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y +I+ ++  F  I FG+     +    +W   W I D
Sbjct: 701 GVLYLVIIGLYINFIPICFGMVGSNKQFSYLRWSDKWRISD 741



>gi|367055346|ref|XP_003658051.1| glycosyltransferase family 39 protein [Thielavia terrestris NRRL
           8126]
 gi|347005317|gb|AEO71715.1| glycosyltransferase family 39 protein [Thielavia terrestris NRRL
           8126]
          Length = 743

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/401 (50%), Positives = 270/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R++  Y+   E
Sbjct: 342 GSMVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNNWFFYPNRRDIPYDPAAE 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G+ I            SH+IAAP+T   +EVS YGN T+GD+ D+W IEV+ D 
Sbjct: 402 PRFIGDGEVIRLLHAQTGRNLHSHQIAAPITKSQWEVSCYGNATIGDEKDHWKIEVVSDA 461

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R RH  LGCYLRA N  LPQWGFKQ+EV+C K NNPRD++THWNI
Sbjct: 462 ASRDRSRIRTLTTAFRLRHETLGCYLRAGNVNLPQWGFKQIEVTCTKENNPRDTYTHWNI 521

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N+KLP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 522 EAHVNEKLPPGNPGLYKSPFLKDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 581

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TA+L +F   + +Y IR QR Y++LSP + D   
Sbjct: 582 GLRMCGWDDSIVKYFLLGNPLVYWGSTAALGVFAGLVAWYTIRWQRGYRELSPPELDQIH 641

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G     GW LHYLPF IM RVTY+HHY+PALYF++L   F+ D F  + +   +   +
Sbjct: 642 YAGLYPVAGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLADWFLRNQRAVAQYAAY 701

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            + Y+ ++ ++ YF  I +G+  P  +    KW  +W + D
Sbjct: 702 ALLYAAVIGLYIYFIPICWGMTGPNRKYSYMKWFESWRMSD 742



>gi|494824411|gb|EON61702.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Coniosporium apollinis CBS 100218]
          Length = 745

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/401 (53%), Positives = 270/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  +P GS QQQV+CYHH D NNDW     R E  Y+    
Sbjct: 345 GSRATIKNMGYGGGLLHSHVQTFPEGSGQQQVTCYHHKDANNDWFFYPNRGEVEYDPEEP 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F  NG+TI            SH+IAAP+T    EVS YGN T+GD  D+WVIEV+ D 
Sbjct: 405 LRFPGNGNTIRLIHAQTGRNLHSHQIAAPITKADHEVSCYGNTTVGDTKDHWVIEVVRDA 464

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   ++IR+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+C K N PRD +THWN+
Sbjct: 465 ASNDYSKIRTLTTAFRLKHADLGCYLRAGNVNLPQWGFKQIEVTCTKENKPRDVYTHWNV 524

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWN+ LP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 525 ESHWNENLPPGDPGSYKSPFLRDFLHLNVAMMTSNNALVPDPDKQDDLASQFWQWPILHV 584

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TASL IF   +L+YLIR QR Y +L  A  DH  
Sbjct: 585 GLRMCGWDDHIVKYFLLGNPVVYWGSTASLGIFGLLILWYLIRWQRGYDELKQADIDHIH 644

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF  M RVTY+HHY+PALYF++L A F +D  T     + +  I+
Sbjct: 645 YSGLYPVIGWFLHYLPFVAMARVTYVHHYYPALYFAILTAGFCVDWATRRLSREVQWGIY 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y ++V +F  F+ I FG+    ++ +  KW STW I D
Sbjct: 705 GVLYVVVVGLFVLFRHICFGMVGSHTQWRHLKWFSTWRITD 745



>gi|367035654|ref|XP_003667109.1| glycosyltransferase family 39 protein [Myceliophthora thermophila
           ATCC 42464]
 gi|347014382|gb|AEO61864.1| glycosyltransferase family 39 protein [Myceliophthora thermophila
           ATCC 42464]
          Length = 744

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/404 (50%), Positives = 274/404 (67%), Gaps = 7/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+KNMG+GGGLLHSHI  YP GS QQQV+CYHH D NN+W     R +  Y+   +
Sbjct: 344 GSLVTIKNMGYGGGLLHSHIQTYPEGSGQQQVTCYHHKDANNNWFFYPNRGDTPYDPEAD 403

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G+ I            SH+IAAP+T   +EVS YGN T+GD  D+W IEV+ D 
Sbjct: 404 PRFIADGEVIRLLHAQTGRNLHSHQIAAPITKSQWEVSCYGNATIGDTKDHWRIEVVSDA 463

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +RIR+LTT+ R +H +LGCYLRA N  LPQWGFKQ+EV+C K NNPRD++THWNI
Sbjct: 464 ASRDRSRIRTLTTAFRLKHEVLGCYLRAGNKNLPQWGFKQIEVTCTKENNPRDTYTHWNI 523

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N+KLP G    Y+S F  DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 524 ESHINEKLPPGDPGQYKSPFFKDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 583

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TA+L +F   + +Y++R +R Y++LS A+ D   
Sbjct: 584 GLRMCGWDDKIVKYFLLGNPMVYWGSTAALGVFALLVAWYVLRWRRGYRELSQAEIDQIH 643

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHYLPF IM RVTY+HHY+PALYF++L   F+ D F    + ++K + +
Sbjct: 644 YSGLYPVLGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLSDWF---LRNRSKAVQW 700

Query: 360 GIYYSL---IVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+Y  L   ++ ++ YF  I +G+  P  + +  KW  TW + D
Sbjct: 701 GVYALLDATVIGLYIYFIPICWGMTGPNRQYRYMKWFDTWRMSD 744



>gi|399166390|emb|CCE32809.1| probable dolichyl-phosphate-mannose--protein mannosyltransferase
           [Claviceps purpurea 20.1]
          Length = 744

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/402 (49%), Positives = 268/402 (66%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R+E  Y+    
Sbjct: 342 GSRATIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFYPNRREPDYDPESP 401

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++ F+ +G T+            SH+IAAP++    EVS+YGN T+GD+ D+W +EV+ D
Sbjct: 402 DLRFIADGTTLRLIHAQTGRNLHSHDIAAPLSKADKEVSSYGNLTVGDEKDHWKVEVVRD 461

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           + ++  +RIR+LTT+ R +H +LGCYLR  N  LPQWGFKQ+EVSC K NNPRD++THWN
Sbjct: 462 VASRDRSRIRTLTTAFRLKHEVLGCYLRGTNKNLPQWGFKQIEVSCTKENNPRDAYTHWN 521

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E HWNDKLP+G    Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWP + 
Sbjct: 522 VEAHWNDKLPAGDPGVYKSPFFHDFLHLNVAMMTSNNALVPDPDKQDDLASQWWQWPFLH 581

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMC W D +VK++LLGNP ++W  T  L +    +++YL+R QR  KDLS  + D  
Sbjct: 582 VGLRMCGWDDTIVKYFLLGNPFVYWGSTVGLGLIGLIVVWYLLRWQRGCKDLSEEEIDQI 641

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G     GW LHYLPF +M RVTY+HHY+PALYF++L   F++D    +     + I 
Sbjct: 642 HYSGIYPVAGWFLHYLPFVVMARVTYVHHYYPALYFAILAFGFLIDWTARNRNTTVQGIT 701

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G  Y++I+ ++  F  I +G+  P  +    +W   W + D
Sbjct: 702 YGTLYTVIIGLYILFIPICWGMTGPNKQYSYLRWFDNWKMSD 743



>gi|389635487|ref|XP_003715396.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Magnaporthe oryzae 70-15]
 gi|351647729|gb|EHA55589.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Magnaporthe oryzae 70-15]
          Length = 743

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/404 (50%), Positives = 274/404 (67%), Gaps = 7/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R ++ Y    E
Sbjct: 343 GSRVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRNDREYKEEEE 402

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G+ +            SH+IAAP+T    EVS YGN T+GDD D+W +EV+ D+
Sbjct: 403 PRFIADGEVLRLIHVQTGRNLHSHDIAAPMTKSDKEVSCYGNLTVGDDKDHWKVEVVRDV 462

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +R+R+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+C   NNPRD++T WN+
Sbjct: 463 ASRDRSRVRTLTTAFRLKHASLGCYLRAGNVNLPQWGFKQIEVACTPKNNPRDTYTWWNV 522

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP G    YRS F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 523 EAHWNDKLPKGNPGVYRSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 582

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP ++W  TA + +    +++YL+R QR ++DLS  + D   
Sbjct: 583 GLRMCGWDDNIVKYFLLGNPFVYWGTTAGVGVIGLVVVWYLLRWQRGFQDLSMPEVDQIH 642

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF +M RVTY+HHY+PALYF++L   F++D FT   +   K+I +
Sbjct: 643 YSGVYPVIGWFLHYLPFVVMARVTYVHHYYPALYFAILTFGFLVDWFT---RDMHKSIQY 699

Query: 360 GIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GIY   Y++I+ ++  F  I +G+          KW  TW + D
Sbjct: 700 GIYTALYTIIIGLYILFMPICWGMVGSNKTYSYLKWFDTWRMSD 743



>gi|440469185|gb|ELQ38305.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Magnaporthe oryzae Y34]
 gi|440485776|gb|ELQ65698.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Magnaporthe oryzae P131]
          Length = 736

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/404 (50%), Positives = 274/404 (67%), Gaps = 7/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R ++ Y    E
Sbjct: 336 GSRVTIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRNDREYKEEEE 395

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G+ +            SH+IAAP+T    EVS YGN T+GDD D+W +EV+ D+
Sbjct: 396 PRFIADGEVLRLIHVQTGRNLHSHDIAAPMTKSDKEVSCYGNLTVGDDKDHWKVEVVRDV 455

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +R+R+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+C   NNPRD++T WN+
Sbjct: 456 ASRDRSRVRTLTTAFRLKHASLGCYLRAGNVNLPQWGFKQIEVACTPKNNPRDTYTWWNV 515

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP G    YRS F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 516 EAHWNDKLPKGNPGVYRSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 575

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP ++W  TA + +    +++YL+R QR ++DLS  + D   
Sbjct: 576 GLRMCGWDDNIVKYFLLGNPFVYWGTTAGVGVIGLVVVWYLLRWQRGFQDLSMPEVDQIH 635

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF +M RVTY+HHY+PALYF++L   F++D FT   +   K+I +
Sbjct: 636 YSGVYPVIGWFLHYLPFVVMARVTYVHHYYPALYFAILTFGFLVDWFT---RDMHKSIQY 692

Query: 360 GIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           GIY   Y++I+ ++  F  I +G+          KW  TW + D
Sbjct: 693 GIYTALYTIIIGLYILFMPICWGMVGSNKTYSYLKWFDTWRMSD 736



>gi|398407257|ref|XP_003855094.1| Dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Zymoseptoria tritici IPO323]
 gi|339474978|gb|EGP90070.1| Dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Zymoseptoria tritici IPO323]
          Length = 746

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 199/402 (49%), Positives = 263/402 (65%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLKNMG+GGGLLHSH+  YP GS QQQ++CYHH D NNDW     R +  Y+   +
Sbjct: 341 GSKATLKNMGYGGGLLHSHVQTYPEGSGQQQITCYHHKDANNDWFFYPNRHQPTYDPEAD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++FV NGD I            SH + APVT    EVS YGN T+GD  D+W++E + D 
Sbjct: 401 LKFVGNGDIIRLIHAQTGRNLHSHTVPAPVTKADHEVSCYGNLTVGDTKDHWMVETVSDA 460

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +    ++R+LTTS R +H  L CYLRA N  LPQWGFKQ+E +C K NNPRD +THWN+
Sbjct: 461 ASNDWTKLRTLTTSFRLKHVDLNCYLRAGNVNLPQWGFKQIETTCVKANNPRDVYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP      Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS P QWP++ V
Sbjct: 521 ESHVNERLPPSAPGAYKSPFLRDFIHLNVAMMTSNNALVPDPDKQDDLASAPWQWPLLHV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  T S+   +  + YY IR QR Y +L+    + F 
Sbjct: 581 GLRMCGWDDAIVKYFLLGNPVVYWGSTFSVFFIMAMIAYYAIRWQRGYDELTWKDLEQFH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT-KNII 358
           Y G    +GW LHY+PF  M RVTY+HHY+PALYF++L A F++D +T + +  + K  I
Sbjct: 641 YSGIYPLLGWFLHYMPFVAMARVTYVHHYYPALYFAILTAGFIVDWYTRNLRSTSVKVAI 700

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           FG+ Y L++ +FW F+   FG+     +    KW   W +VD
Sbjct: 701 FGVLYGLVIFMFWLFRAFCFGMEGSNRQWAHLKWFDQWRMVD 742



>gi|116204893|ref|XP_001228257.1| hypothetical protein CHGG_10330 [Chaetomium globosum CBS 148.51]
 gi|88176458|gb|EAQ83926.1| hypothetical protein CHGG_10330 [Chaetomium globosum CBS 148.51]
          Length = 727

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/401 (49%), Positives = 268/401 (66%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NN+W     R +  Y+   +
Sbjct: 326 GSLVTIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNNWFFYPNRGDTPYDAEAD 385

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             F+ +G+ +            SH+IAAP+T   +EVS+YGN T+GD  D+W IEV+ D 
Sbjct: 386 PRFIADGEVVRLLHAQTGRNLHSHQIAAPITKSQWEVSSYGNATIGDAKDHWRIEVVSDA 445

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +++R+LTT  R +H ++GCYLRA N  LPQWGFKQ+EV+C K NNPRD++THWNI
Sbjct: 446 ASRDRSKVRTLTTGFRLKHEVMGCYLRAGNTNLPQWGFKQIEVTCTKENNPRDTYTHWNI 505

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N+KLP G    Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 506 ESHINEKLPPGDPGQYKSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHV 565

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TA L IF   +++Y +R QR Y++LS  + D   
Sbjct: 566 GLRMCGWDDKIVKYFLLGNPLVYWGSTAGLGIFALLVVWYTLRWQRGYRELSQPEIDQIH 625

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF IM RVTY+HHY+PALYF++L   F+ D F  + K   +  ++
Sbjct: 626 YAGLYPVIGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLSDWFLRNRKAAVQWGVY 685

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +  + ++ ++ YF  I +G+     +    KW  TW + D
Sbjct: 686 ALLDATVIGLYIYFIPICWGMTGSNKQYGYMKWFDTWRMSD 726



>gi|322710683|gb|EFZ02257.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Metarhizium anisopliae ARSEF 23]
          Length = 750

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/402 (49%), Positives = 272/402 (67%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E  Y+  + 
Sbjct: 349 GSRATIKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFFYPNRREPDYDAESP 408

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++ F+ +G  I            SH+IAAP++    EVS+YGN T+GD+ D+W +EV+ D
Sbjct: 409 DLRFIGDGTIIRLIHAQTGRNLHSHDIAAPMSKSDKEVSSYGNLTVGDEKDHWKVEVVRD 468

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           + ++  +RIR+LTT+ R +H +LGCYL+  N  LPQWGFKQ+EVSC K NNPRD++THWN
Sbjct: 469 VASRDRSRIRTLTTAFRLKHEVLGCYLKGTNKNLPQWGFKQIEVSCTKENNPRDAYTHWN 528

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E HWNDKLP+G    Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 529 VEAHWNDKLPAGDPGVYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILH 588

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMC W D++VK++LLGNP+++W  T  + I    +++Y++R QR + DL+  + D  
Sbjct: 589 VGLRMCGWDDNIVKYFLLGNPLVYWGSTIGIGIVGLVVVWYILRWQRGFTDLNNKEIDQI 648

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G     GW LHYLPF IM RVTY+HHY+PALYF++L   F++D    +     +   
Sbjct: 649 HYSGIYPVAGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLVDWTVRNRNTIIQGAT 708

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y++I+ ++  F  I +G+  P  +    +W   W I D
Sbjct: 709 YGVLYAVIIGLYVLFMPICWGMVGPNQQYSYMRWFDNWRISD 750



>gi|470316308|gb|EMR08070.1| hypothetical protein PNEG_03510 [Pneumocystis murina B123]
          Length = 740

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/398 (51%), Positives = 269/398 (67%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++T+KNMG+ GGLLHSH+  +P GS QQQV+CYHH D NNDW I      +  ++   
Sbjct: 341 GSKVTIKNMGYSGGLLHSHVQTFPTGSNQQQVTCYHHRDENNDWRIHPSHNSEPVSSEDP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+ N D +            SH+I+AP+T    EVS YGN T+GDDND+WVIEVI D 
Sbjct: 401 LIFLRNNDVLRLIHNSTGCNLHSHDISAPITKTQNEVSCYGNLTIGDDNDHWVIEVIKDS 460

Query: 121 YTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNIE 180
             +  RI+++ T+ R RH +  CYLRA N  LPQWGFKQ+EV+CDK NNP+D +THWNIE
Sbjct: 461 NPRDTRIKTIKTAFRLRHIIHNCYLRAENVHLPQWGFKQIEVTCDKTNNPKDYYTHWNIE 520

Query: 181 RHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEVG 240
            HWND+LPSG   +Y+S F +DF+++N+AM  TNNAL+ D  K+D L S P QWPI   G
Sbjct: 521 NHWNDRLPSGNIKFYKSSFWYDFFYINIAMMNTNNALLLDKGKKDDLISYPWQWPIAISG 580

Query: 241 LRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFLY 300
           +RMCSW D+V KFYLLGNP ++W    S+ +F   +L+Y IR +R Y D +P ++DHF Y
Sbjct: 581 IRMCSWDDNVPKFYLLGNPAVYWISLGSIFLFFILILFYTIRWKRHYIDFTPDKFDHFHY 640

Query: 301 VGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIFG 360
           VG    +GW+LHY PF I+ RV YLHHYFPAL F++L   F+ DH T S     + IIF 
Sbjct: 641 VGLYPLLGWILHYFPFFIIKRVLYLHHYFPALLFAILTTGFVFDHLTGSIPVLFRKIIFS 700

Query: 361 IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           I Y  +++ F YFKDI FG+  P+++ K  +WL TW I
Sbjct: 701 IAYISVILTFIYFKDITFGMIGPSNQWKYLQWLPTWRI 738



>gi|512202057|gb|EPE30885.1| MIR [Glarea lozoyensis ATCC 20868]
          Length = 744

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/404 (48%), Positives = 270/404 (66%), Gaps = 7/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQ++CYHH D NN+W     R +  +N   +
Sbjct: 344 GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDSNNEWWFYPNRDQPEFNAEAD 403

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            +FV +GD +            SH+++APVT    EVS YGN T+GD+ D+W +EV+ D+
Sbjct: 404 PKFVADGDVLRLIHSQTGRNLHSHDVSAPVTKADKEVSCYGNTTVGDEKDHWTMEVVRDV 463

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   +++R+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+C K N P+D +THWN+
Sbjct: 464 ASNDRSKVRTLTTAFRLKHTALGCYLRAGNVNLPQWGFKQIEVTCTKENKPKDVYTHWNV 523

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP+     Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWP++ V
Sbjct: 524 EAHWNDKLPAADAGAYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPLLHV 583

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TA+L +    +++YLIR QR Y +L  A  D   
Sbjct: 584 GLRMCGWDDSIVKYFLLGNPLVYWGSTATLGVTALMVVWYLIRWQRGYTELKQADIDQIH 643

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI-- 357
           Y      +GW LHYLPF  M RVTY+HHY+PALYF++L   F++D      KP++K I  
Sbjct: 644 YAALYPILGWFLHYLPFVAMARVTYVHHYYPALYFAILNFGFVVDWV---LKPQSKAIQY 700

Query: 358 -IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            ++GI Y+  + ++ +F  I++G+  P  +    KW   W + D
Sbjct: 701 LLYGILYATTIGLYIFFMPISWGMVGPNKQYSYMKWFDNWRVTD 744



>gi|322692625|gb|EFY84523.1| putative dolichyl-phosphate-mannose--protein mannosyltransferase
           [Metarhizium acridum CQMa 102]
          Length = 742

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/402 (49%), Positives = 272/402 (67%), Gaps = 2/402 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GSR T+KNMG+GGGLLHSH+  YP GS+QQQV+CYHH D NNDW     R+E  Y+  + 
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSQQQQVTCYHHKDANNDWFFYPNRREPDYDAESP 400

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++ F+ +G  I            SH+IAAP++    EVS+YGN T+GD+ D+W +EVI D
Sbjct: 401 DLRFIGDGSIIRLIHAQTGRNLHSHDIAAPMSKSDKEVSSYGNLTVGDEKDHWKVEVIRD 460

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           + ++  +RIR+LTT+ R +H +LGCYL+  N  LPQWGFKQ+EVSC   NNP+D++THWN
Sbjct: 461 VASRDRSRIRTLTTAFRLKHEVLGCYLKGTNKNLPQWGFKQIEVSCTTENNPQDAYTHWN 520

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E HWNDKLP+G    Y+S F HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ 
Sbjct: 521 VEAHWNDKLPAGDPGVYKSPFFHDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPILH 580

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHF 298
           VGLRMC W D++VK++LLGNP+++W  T  + I    +++Y++R QR + DL+  + D  
Sbjct: 581 VGLRMCGWDDNIVKYFLLGNPLVYWGSTIGIGIVGLVVVWYILRWQRGFTDLNNKEIDQI 640

Query: 299 LYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNII 358
            Y G     GW LHYLPF IM RVTY+HHY+PALYF++L   F++D    +     + + 
Sbjct: 641 HYSGIYPVAGWFLHYLPFVIMARVTYVHHYYPALYFAILTFGFLVDWTVRNRNTTIQCVT 700

Query: 359 FGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +G+ Y++I+ ++  F  I +G+  P  +    +W   W I D
Sbjct: 701 YGVLYAVIIGLYVLFMPICWGMVGPNQQYSYLRWFDNWRISD 742



>gi|378728657|gb|EHY55116.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Exophiala
           dermatitidis NIH/UT8656]
          Length = 751

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/401 (50%), Positives = 263/401 (65%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R +  ++    
Sbjct: 345 GSRVTIKNMGYGGGLLHSHVQTYPEGSGQQQVTCYHHKDANNDWFFWPNRSQPEFDPEGP 404

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + F+++   +            SH + APVT   +EVS YGN T+GD+ D+W +EV+ D 
Sbjct: 405 LSFISDKQVLRLIHAQTGRNLHSHTVPAPVTKSDWEVSCYGNTTVGDEKDHWQVEVVSDA 464

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   +RIR+LTT+ R +H  LGCYLRA    LPQWGFKQ+EV+C K NNPRD +THWN+
Sbjct: 465 ASSDRSRIRTLTTAFRLKHVELGCYLRAGTVNLPQWGFKQIEVTCTKANNPRDVYTHWNV 524

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E H N++LP G    YRS FL DF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 525 ESHVNERLPPGDAKSYRSPFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILHV 584

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMCSW D + K++LLGNPI++W  TASL +    +++YLIR QR Y +LS A  D   
Sbjct: 585 GLRMCSWDDHITKYFLLGNPIVYWGSTASLGVAALIVVWYLIRWQRGYNELSRADIDQIH 644

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    IGW LHYLPF +MGRVTY+HHY+PALYF++L+A F +D  T     K +  I+
Sbjct: 645 YSGIYPVIGWFLHYLPFVVMGRVTYVHHYYPALYFAILVAGFCLDWTTQRLNKKVRWGIY 704

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              Y++++ +F  F  I FG+          +W   W I D
Sbjct: 705 IALYAVVIGLFVLFSPIVFGMQGSNRNYAYLRWFDRWRISD 745



>gi|501756504|emb|CCG80557.1| Protein O-mannosyl transferase [Taphrina deformans PYCC 5710]
          Length = 743

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/403 (50%), Positives = 268/403 (66%), Gaps = 6/403 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---N 57
           GSR T+KNMG+GGGLLHSH+  +P GS+QQQ++CYHH D NNDW     R E  ++   N
Sbjct: 279 GSRATIKNMGYGGGLLHSHVQSFPEGSQQQQITCYHHKDTNNDWFFYPNRFEPSFDPADN 338

Query: 58  ITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVI 117
              ++F+ + D +            SH IAAPVT   FEVS YGN T+GD+ D+W IEV+
Sbjct: 339 DAPLQFLKDRDVVRLIHAQTGRNLHSHAIAAPVTKSDFEVSCYGNLTVGDEKDHWQIEVV 398

Query: 118 DDLYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
           DD+ ++  +R+R+LT+++RFRH    CYLRAAN  LPQWGFKQ+EV+CDK++ P D F+H
Sbjct: 399 DDIRSRDRSRVRTLTSAIRFRHVSQDCYLRAANVNLPQWGFKQIEVTCDKDSKPNDQFSH 458

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E HWN++LP      ++S F  DF HLNVAM T+NNALVPDPDK D LAS   QWPI
Sbjct: 459 WNVESHWNERLPPASAKDFKSPFWRDFLHLNVAMMTSNNALVPDPDKADELASQAWQWPI 518

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
             VGLRMC W     K++LLGNP+++W  T SLV F   ++Y+++R QR  + L+P Q D
Sbjct: 519 AWVGLRMCGWDAKTTKYFLLGNPLVYWYSTFSLVAFGALVVYHVLRWQRSSQVLTPKQVD 578

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
           H +Y G    IGW  HY+PF IMGRV Y+HHYFPAL+F++L+  F+ D F V+  PK+  
Sbjct: 579 HMIYAGIYPAIGWFFHYIPFFIMGRVLYVHHYFPALWFAILVGGFVFD-FAVAGLPKSVR 637

Query: 357 I-IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           I +F + Y +I   F  F    FG++  A      KWL +W I
Sbjct: 638 IAMFVLAYVVITATFLNFSAFTFGMDGEAGLWHRLKWLDSWKI 680



>gi|388579301|gb|EIM19626.1| glycosyltransferase family 39 protein [Wallemia sebi CBS 633.66]
          Length = 704

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 194/413 (46%), Positives = 279/413 (67%), Gaps = 15/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---- 56
           GS++TLK MG+ GGLLHSH+  +P GS + QV+CYH+ D NN + +L   +E+  N    
Sbjct: 290 GSKITLKQMGYAGGLLHSHVQNFPLGSLEGQVTCYHYQDDNNQFNVLPTLQEEKANELKV 349

Query: 57  -----NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDY 111
                N   V F+++GD I            +H+I AP++ + +EV+A+G  T  D ND 
Sbjct: 350 LNEGDNADNVTFLHDGDVIRLEHVPYSRYIHAHDIPAPLSKLDYEVAAFGQSTEDDTNDN 409

Query: 112 WVIEVIDDLY----TKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           W++EV+DD+Y    +K ++I SLTT +RF++  LGCYLRAAN  LP+WGFKQ+EV+C K 
Sbjct: 410 WIVEVVDDVYRGRLSKEDKIHSLTTRLRFKNKNLGCYLRAANKNLPEWGFKQIEVTCTKE 469

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDIL 227
           N+PRD  T+WN+E HWNDKLP+G KS Y++ FL DFWHLN+AM  +NNAL+P+PDK+DIL
Sbjct: 470 NDPRDDHTYWNVESHWNDKLPAGKKSLYKTSFLKDFWHLNIAMMMSNNALIPNPDKQDIL 529

Query: 228 ASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKY 287
           AS P  WP + +GLRM  W D   K+YL+GNP++WW+ + +L +FV   LY+ IR +R+ 
Sbjct: 530 ASKPTDWPFLRLGLRMNGWGDHNTKYYLIGNPVVWWTSSLALFVFVAISLYHTIRERRRV 589

Query: 288 KDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-- 345
           +D++  + D+F YVG +   GW+ HY+PF IMGRVTYLHHY PALYF++L+   ++DH  
Sbjct: 590 RDVTKNEIDYFTYVGMIAFGGWVFHYIPFLIMGRVTYLHHYLPALYFAILVMGLVLDHLI 649

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           F      + K  +FG+     ++ F++F  + FG+  P S+ K  KW ++WNI
Sbjct: 650 FKRQIPERFKWFVFGLLAVNTIVTFYHFNGVVFGMVGPISKHKHLKWRNSWNI 702



>gi|154317996|ref|XP_001558317.1| hypothetical protein BC1G_02981 [Botryotinia fuckeliana B05.10]
          Length = 702

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/401 (48%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSHI  YP GS QQQ++CYHH D NN+W     R +  ++    
Sbjct: 302 GSRATIKNMGYGGGLLHSHIQTYPEGSNQQQITCYHHKDANNEWWFYPNRSQPEFDPEAP 361

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + +V +GD +            SH+++AP+T    EVS YGN T+GDD D+W +EV+ D+
Sbjct: 362 LRYVADGDVLRFVHSQTGRNLHSHDVSAPITKADKEVSCYGNTTVGDDKDHWTMEVVKDV 421

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   ++IR+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+C K+NNP+D +THWN+
Sbjct: 422 SSNDRSKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPKDVYTHWNV 481

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWN+KLP+     Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 482 EAHWNEKLPAADAGAYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASYFWQWPILNV 541

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP+++W  TASL +    +L+YL+R QR Y +L  ++ D   
Sbjct: 542 GLRMCGWDDNIVKYFLLGNPLVYWGSTASLGLLGLLVLWYLVRWQRGYDELKQSEIDQIH 601

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHY+PF  M RVTY+HHY+PALYF++L+  F  D    +     +  I+
Sbjct: 602 YAGLYPVLGWFLHYVPFVAMARVTYVHHYYPALYFAILVFGFCADWMLRNQVKTLQYAIY 661

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+L + ++ +F  I++G+  P  E    KW  +W + D
Sbjct: 662 GVLYALTIALYIFFMPISWGMEGPNREYSRLKWFDSWRVTD 702



>gi|347831485|emb|CCD47182.1| glycosyltransferase family 39 protein [Botryotinia fuckeliana T4]
 gi|472237169|gb|EMR82080.1| putative dolichyl-phosphate-mannose-protein mannosyltransferase 2
           protein [Botryotinia fuckeliana BcDW1]
          Length = 741

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/401 (48%), Positives = 272/401 (67%), Gaps = 1/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSHI  YP GS QQQ++CYHH D NN+W     R +  ++    
Sbjct: 341 GSRATIKNMGYGGGLLHSHIQTYPEGSNQQQITCYHHKDANNEWWFYPNRSQPEFDPEAP 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           + +V +GD +            SH+++AP+T    EVS YGN T+GDD D+W +EV+ D+
Sbjct: 401 LRYVADGDVLRFVHSQTGRNLHSHDVSAPITKADKEVSCYGNTTVGDDKDHWTMEVVKDV 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   ++IR+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+C K+NNP+D +THWN+
Sbjct: 461 SSNDRSKIRTLTTAFRLKHTSLGCYLRAGNVNLPQWGFKQIEVTCTKDNNPKDVYTHWNV 520

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWN+KLP+     Y+S F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+ V
Sbjct: 521 EAHWNEKLPAADAGAYKSPFIHDFIHLNVAMMTSNNALVPDPDKQDDLASYFWQWPILNV 580

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D++VK++LLGNP+++W  TASL +    +L+YL+R QR Y +L  ++ D   
Sbjct: 581 GLRMCGWDDNIVKYFLLGNPLVYWGSTASLGLLGLLVLWYLVRWQRGYDELKQSEIDQIH 640

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW LHY+PF  M RVTY+HHY+PALYF++L+  F  D    +     +  I+
Sbjct: 641 YAGLYPVLGWFLHYVPFVAMARVTYVHHYYPALYFAILVFGFCADWMLRNQVKTLQYAIY 700

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           G+ Y+L + ++ +F  I++G+  P  E    KW  +W + D
Sbjct: 701 GVLYALTIALYIFFMPISWGMEGPNREYSRLKWFDSWRVTD 741



>gi|430811869|emb|CCJ30725.1| unnamed protein product, partial [Pneumocystis jirovecii]
          Length = 740

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/399 (50%), Positives = 265/399 (66%), Gaps = 3/399 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR+T+KNM + GGLLHSH+  +P GS QQQV+CYHH D NNDW +      +  ++   
Sbjct: 342 GSRVTIKNMAYAGGLLHSHVQTFPEGSTQQQVTCYHHRDGNNDWYVHPIHGMKPVSDEDP 401

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           ++++ N D +            SH I APVT  + EVS YGN T+GD ND+WVIEVI D 
Sbjct: 402 IQYLQNNDALRLIHKSTGCNLHSHNIPAPVTKKNSEVSCYGNLTIGDTNDHWVIEVIKDP 461

Query: 121 YTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNIE 180
             +  RI+++ T+ R RH+ L CYLRA+   LPQWGFKQ+EV+CDK+NNP+D FTHWNIE
Sbjct: 462 DWQDTRIKTIKTAFRLRHTSLNCYLRASRTHLPQWGFKQIEVTCDKSNNPKDYFTHWNIE 521

Query: 181 RHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEVG 240
            HWND+LP+G  ++Y+  F HDF H N+ M  TNNAL+P+  K+D LAS   QWP   VG
Sbjct: 522 HHWNDRLPAGNVNFYKPSFWHDFVHANIGMMNTNNALIPEKGKKDELASYAWQWPTAIVG 581

Query: 241 LRMCSWADDVVKFYLLGNPIIWWSGTASLVI-FVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           +RMCSW D VVKFY+LGNPI++W  TAS++I FV  + Y  +     Y+ L    +DHF 
Sbjct: 582 IRMCSWDDQVVKFYMLGNPIVYWISTASILIFFVLAIFYTTLITSNTYRALD--SFDHFH 639

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNIIF 359
           Y G    +GW L+YLPF IM RV YLHHYFPAL F++L   F+ DHFT S     ++IIF
Sbjct: 640 YSGVYPVLGWALYYLPFFIMKRVLYLHHYFPALLFAILTTGFIFDHFTRSASTIVRSIIF 699

Query: 360 GIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            + Y  IV  F +FKDI FG+  P+++    +WLS+W I
Sbjct: 700 TVAYIAIVATFIHFKDITFGMLGPSTQWAHLQWLSSWKI 738



>gi|511010539|gb|EPB91760.1| dolichyl-phosphate-mannose-protein mannosyltransferase [Mucor
           circinelloides f. circinelloides 1006PhL]
          Length = 754

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/405 (47%), Positives = 263/405 (64%), Gaps = 5/405 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GS +TLKN G+GGGLLHSH +QYP GS+QQQ++CY   D NN W I +PR        T 
Sbjct: 347 GSNITLKNFGYGGGLLHSHPHQYPDGSKQQQITCYSFKDSNNQWQIRQPRTMSNVPAPTH 406

Query: 60  ---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEV 116
              E+++V +GD I            SH I APV++ H+EVSAYGNE +GD  D W +E+
Sbjct: 407 VDGEIQYVKHGDVIRLQHIMTKRNLHSHPINAPVSSKHWEVSAYGNEEIGDVQDNWRVEI 466

Query: 117 IDDLYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFT 175
           + D++ K T ++++LTT  R RH  L C L + N +LPQWGFKQ EV CD+   P D  T
Sbjct: 467 VQDIFDKDTTQVKALTTRFRLRHVYLDCLLTSRNVVLPQWGFKQQEVYCDRKAKPNDHHT 526

Query: 176 HWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
            WN+E H N+ LP   K+ Y+S FL DFWHLNVAM+ TNNAL+PDPDK DIL+S P +WP
Sbjct: 527 WWNVEDHRNEALPPAPKNSYKSNFLEDFWHLNVAMWNTNNALIPDPDKNDILSSGPTEWP 586

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQW 295
           +V  GLRMC W    VKFYLLGNP +WW    S++ F+     Y++R++R+  D++P +W
Sbjct: 587 MVTTGLRMCGWDSKTVKFYLLGNPSVWWPSFLSIITFMVATASYIVRQRRQIIDMTPDRW 646

Query: 296 DHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTK 355
             F  VGK+  +GW  HY+PF +MGRVTY+HHYFPALYFS+ M  F+++HF  +   + +
Sbjct: 647 SRFTSVGKLFFLGWFFHYIPFFMMGRVTYIHHYFPALYFSVFMVPFLLEHFFANTSSRAR 706

Query: 356 NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             ++ I   L+   F YF   +FG+        +R WL++WN+++
Sbjct: 707 LTVYAIVLGLVFANFAYFAPFSFGMTGDIKNYSNRLWLNSWNLIE 751



>gi|505755843|gb|EOR00037.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Wallemia
           ichthyophaga EXF-994]
          Length = 800

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/439 (43%), Positives = 274/439 (62%), Gaps = 41/439 (9%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GS++TLK MG+GGGLLHSH+  +P GS + QV+CYH+ D NN + +L    +Q  +  T 
Sbjct: 361 GSKVTLKQMGYGGGLLHSHVQNFPLGSLEGQVTCYHYQDDNNQFNVLPSLAQQKVDEATR 420

Query: 60  ----------------------------------EVEFVNNGDTIXXXXXXXXXXXXSHE 85
                                             E+ F+++GD I            +H+
Sbjct: 421 NAERGELSAGEVGELGERGEQSEDLSQDEGSDKDEIRFLHSGDIIRLQHVPYSRYIHAHD 480

Query: 86  IAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDLY----TKTNRIRSLTTSMRFRHSLL 141
           + AP++ + +EV+A+      D ND W++E +DD++    T  +RI SLTT +RFRH  L
Sbjct: 481 LPAPLSRLDYEVAAFSASREDDTNDNWIVEPVDDVFRGKLTPHDRIHSLTTRLRFRHRNL 540

Query: 142 GCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYYRSKFLH 201
           GCYLRAAN  LP+WGFKQVEV+C K N+ RD +THWN+E HWND+LP G KS YR+ FL 
Sbjct: 541 GCYLRAANRNLPEWGFKQVEVTCTKENDVRDDYTHWNVESHWNDRLPRGKKSLYRTNFLK 600

Query: 202 DFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPII 261
           DFWHLN+AM  +NNAL+P+PDK DILAS P  WP + +GLRM  W+D   K+YL+GNP++
Sbjct: 601 DFWHLNIAMMMSNNALIPNPDKADILASKPTDWPFLRLGLRMNGWSDHNTKYYLIGNPVV 660

Query: 262 WWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGR 321
           WW  + ++++FV    Y+++  +R+ +D++  + DHF+YVG V   GW+ HY+PF IMGR
Sbjct: 661 WWCSSVAVMLFVLISGYHVVCERRRVRDVTKRELDHFIYVGMVAFGGWVFHYIPFLIMGR 720

Query: 322 VTYLHHYFPALYFSMLMAAFMMDH--FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFG 379
           VTYLHHY PALYF++L+ A ++DH  F  +     K  +F +     ++ F++F+ + FG
Sbjct: 721 VTYLHHYLPALYFAVLVLALVLDHVVFKRNVSEGVKWFVFAVLALNTLLTFYHFRGVVFG 780

Query: 380 INYPASELKSRKWLSTWNI 398
           +  P S  K   W S+WNI
Sbjct: 781 MEGPMSRHKHLGWRSSWNI 799



>gi|361131365|gb|EHL03063.1| putative Dolichyl-phosphate-mannose--protein mannosyltransferase 2
           [Glarea lozoyensis 74030]
          Length = 431

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/404 (47%), Positives = 261/404 (64%), Gaps = 21/404 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQ++CYHH D NN+W     R +  +N   +
Sbjct: 45  GSRATIKNMGYGGGLLHSHVQTYPEGSTQQQITCYHHKDSNNEWWFYPNRDQPEFNAEAD 104

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            +FV +GD +            SH+++APVT    EVS YGN T+GD+ D+W +EV+ D+
Sbjct: 105 PKFVADGDVLRLIHSQTGRNLHSHDVSAPVTKADKEVSCYGNTTVGDEKDHWTMEVVRDV 164

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            +   +++R+LTT+ R +H+ LGCYLRA N  LPQWGFKQ+EV+C K N P+D +THWN+
Sbjct: 165 ASNDRSKVRTLTTAFRLKHTALGCYLRAGNVNLPQWGFKQIEVTCTKENKPKDVYTHWNV 224

Query: 180 ERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEV 239
           E HWNDKLP+     Y+S FL DF HLNVAM T+NNALVPDPDK+D LAS   QWP++ V
Sbjct: 225 EAHWNDKLPAADAGAYKSPFLQDFIHLNVAMMTSNNALVPDPDKQDDLASQFWQWPLLHV 284

Query: 240 GLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFL 299
           GLRMC W D +VK++LLGNP+++W  TA+L               R Y +L  A  D   
Sbjct: 285 GLRMCGWDDSIVKYFLLGNPLVYWGSTATL--------------GRGYTELKQADIDQIH 330

Query: 300 YVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI-- 357
           Y      +GW LHYLPF  M RVTY+HHY+PALYF++L   F++D      KP++K I  
Sbjct: 331 YAALYPILGWFLHYLPFVAMARVTYVHHYYPALYFAILNFGFVVDWV---LKPQSKAIQY 387

Query: 358 -IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            ++GI Y+  + ++ +F  I++G+  P  +    KW   W + D
Sbjct: 388 LLYGILYATTIGLYIFFMPISWGMVGPNKQYSYMKWFDNWRVTD 431



>gi|465795908|emb|CCV00340.1| Protein O-mannosyltransferase-like protein [Malassezia sympodialis
           ATCC 42132]
          Length = 516

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 204/447 (45%), Positives = 270/447 (60%), Gaps = 49/447 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMIL----KPRKEQMYN 56
           GS++TLKNMGFGGGLLHSHI  YP GS++QQV+CYH+ D NN +++     +P      +
Sbjct: 69  GSKVTLKNMGFGGGLLHSHIQTYPEGSQEQQVTCYHYKDTNNHFVLAPLFDEPPLPGPND 128

Query: 57  NITEVEFV-NNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
            +TE   +  +G               +H+  APVT  H+EVS +G+ T G+ +DYWVIE
Sbjct: 129 TVTEPPMIIRHGSVFRLSHVETSKSLRAHKSPAPVTKEHYEVSGHGDGTTGNSHDYWVIE 188

Query: 116 VIDDLYTKTNR----IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           +IDDL     R    + +LTT  R R+  LGCY+RAAN +LP WG+KQ EV+C  ++ P 
Sbjct: 189 IIDDLQMGKVRPEMPVHTLTTRFRLRNVQLGCYMRAANVVLPDWGWKQTEVTCVPDDQPY 248

Query: 172 DSFTHWNIERHWNDKLP-SGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILAST 230
           D+FTHWN+E HWN +LP S  K  YRS FL DF HLNVAM  +NNALVPD DK DILAS 
Sbjct: 249 DTFTHWNVENHWNPRLPISTSKQRYRSPFLKDFLHLNVAMMVSNNALVPDEDKFDILASK 308

Query: 231 PRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL 290
           P +WP +  GLRM  W  D  K+YL+GNP++WW  TASL + V  L +Y++RRQR   D+
Sbjct: 309 PLEWPWMWNGLRMNGWGADQDKYYLIGNPVVWWGSTASLYVAVVLLAWYILRRQRHIIDM 368

Query: 291 SPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF---- 346
            P  W  FL+  KV G+GW LHY PF +MGRVTY+HHY P LYF++++   ++DHF    
Sbjct: 369 DPKTWADFLFGLKVGGLGWFLHYFPFLMMGRVTYIHHYLPTLYFAVIVFVHLLDHFLWNE 428

Query: 347 --------------------------------TVSCKP---KTKNIIFGIYYSLIVIVFW 371
                                            V  KP   +TKNI FG+  +L++ VF 
Sbjct: 429 GTARYRIDWRLFLQTGRLQAGKLNPLVQDTSAPVLGKPLSQRTKNISFGVCAALVICVFL 488

Query: 372 YFKDIAFGINYPASELKSRKWLSTWNI 398
           +FK ++FG+    S+    KW  TWNI
Sbjct: 489 WFKGVSFGLYGDISDWHYLKWRKTWNI 515



>gi|384483971|gb|EIE76151.1| hypothetical protein RO3G_00855 [Rhizopus delemar RA 99-880]
          Length = 405

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/402 (46%), Positives = 256/402 (63%), Gaps = 14/402 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM--YNNI 58
           GS +T++N G+GGGLLHSH++ YP GSEQQQ++CYHH D NN W I  PR++     ++ 
Sbjct: 11  GSNVTIRNAGYGGGLLHSHVHTYPEGSEQQQITCYHHKDENNHWTIRPPRQDTFDPLDSP 70

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
             + F+ +GD +            SH I AP++   +EVS YGN+T+GD  D W +EV+ 
Sbjct: 71  DLIHFLKDGDLVRLVHIPTGRNLHSHRIDAPISP-GWEVSGYGNDTIGDIQDNWKVEVVH 129

Query: 119 DLYTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
           D+  K  +R+ SLTT  R RH  LGC L A N +LP WGFKQ EV CD      DS+  W
Sbjct: 130 DMVHKNKDRVHSLTTRFRLRHQTLGCLLTADNTVLPDWGFKQAEVFCDPRET-GDSYAMW 188

Query: 178 NIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           N+E+HWND+LP    + YR+ F  +F  LNVAM+T NNAL+PD DK D+LAS+P +WP+V
Sbjct: 189 NVEQHWNDRLPPAPPNAYRAPFWRNFIDLNVAMWTANNALIPDVDKVDLLASSPLEWPMV 248

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDH 297
            VGLRMC W D  VK+YLLGNPI+WW   +++  F  T   Y++R QR   D++      
Sbjct: 249 TVGLRMCGWGDKEVKYYLLGNPIVWWLSISAIFTFCLTTGIYMVRMQRSIIDMTQ----- 303

Query: 298 FLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI 357
               G+   +GW LHY+PF IMGRVTYLHHYFPALYFS+LM  F++DHFT     + +  
Sbjct: 304 ----GRTLFLGWFLHYIPFFIMGRVTYLHHYFPALYFSILMVPFLIDHFTQRKSQRVQWA 359

Query: 358 IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           +F   Y+ ++I F +F  I+FG+  P +     +W  +W I+
Sbjct: 360 VFAPIYAAVIITFIHFAPISFGLEGPITNYMHLEWRKSWGII 401



>gi|328768324|gb|EGF78371.1| hypothetical protein BATDEDRAFT_20500 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 691

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/404 (48%), Positives = 253/404 (62%), Gaps = 5/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS++++KN   GGGLLHSH+ +YP GS QQQV+CYHH D NN+++I+KP  +   + +TE
Sbjct: 287 GSKVSIKNNARGGGLLHSHVQRYPSGSTQQQVTCYHHKDSNNEFLIMKPWGDTT-DLMTE 345

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             FV +GD I            SH + AP+T   +EVS YGN T GD ND W IE +DD 
Sbjct: 346 PIFVEDGDKIRLVHISTFKNIHSHYVDAPITTTDYEVSGYGNATFGDQNDLWKIEKVDDW 405

Query: 121 YTKTN--RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
               N  RIRSLTT  R RH   GC LRA    LPQWGFKQ+EV C K     +   +WN
Sbjct: 406 TVGKNIKRIRSLTTRFRLRHVTSGCLLRADGVTLPQWGFKQIEVVCQKKPKDDEVANYWN 465

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKE-DILASTPRQWPIV 237
           IE H N  LP GGK+ Y+S F  DF  LNVAM+++NNAL PD DKE D L S P  WP++
Sbjct: 466 IELHVNSNLPPGGKNAYKSSFFRDFIDLNVAMWSSNNALTPDADKEPDQLVSQPYHWPLM 525

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA-QWD 296
             GLRMC W+D  +K+YLLGNPI+WW  T SL+  +   L Y+IR +R  +D S   +WD
Sbjct: 526 TRGLRMCGWSDSDIKYYLLGNPIVWWGSTVSLLGLIGLTLIYVIRWRRGCRDFSSLDEWD 585

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
           +F    KV  +GW LHY PF IMGRV Y+HHYFP+LYF+++  AF++DH +         
Sbjct: 586 NFYMAAKVGVLGWFLHYFPFYIMGRVMYVHHYFPSLYFAIIAFAFLVDHLSGKFSKLFHF 645

Query: 357 IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I  +   ++  VF +F D+ FG++   +   +RKWL TWNI D
Sbjct: 646 AIVTLIGLIVFRVFLFFADLTFGMSGSPNAYANRKWLKTWNIND 689



>gi|50549415|ref|XP_502178.1| YALI0C23364p [Yarrowia lipolytica]
 gi|49648045|emb|CAG82498.1| YALI0C23364p [Yarrowia lipolytica CLIB122]
          Length = 742

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/401 (45%), Positives = 245/401 (61%), Gaps = 3/401 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GSR TLKN G+ GGLLHSH+  YP GSEQQQ++ YHH D NN+W +  PR  + YN N +
Sbjct: 342 GSRFTLKNQGYNGGLLHSHVQTYPEGSEQQQITTYHHKDANNEWRVETPRDREAYNANTS 401

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           E+E + +GD I            SH+I AP+T    EVS YGN T+GD+ D+W++E+ D+
Sbjct: 402 EIELLKHGDVIRFIHLNTGRNLHSHQIPAPLTKGDHEVSCYGNLTIGDNKDHWIVEIYDN 461

Query: 120 LYTKTNRI-RSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
                N++   LTT++RF+H +LGCYL      LP WGFKQ EV+C      +D  THWN
Sbjct: 462 FGPGDNKVVHPLTTTVRFKHEVLGCYLSGKGNHLPPWGFKQGEVTCSNKVGKKDKSTHWN 521

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
            E+HWN+++P    +   ++ F+ DF  LNVAM  +NNALVPDPDK D LAS    WP+ 
Sbjct: 522 FEQHWNERMPDANNTKPPKTSFIRDFVQLNVAMMASNNALVPDPDKHDELASEAWMWPLN 581

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDH 297
            VGLR+C W+  ++K+YLLGNP+  W  T SL +F    L YLIR QR+  D S AQ + 
Sbjct: 582 WVGLRLCGWSSTIIKYYLLGNPVNMWGTTFSLFVFGIMTLVYLIRWQRQIPDFSDAQIEK 641

Query: 298 FLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI 357
           ++  G +  +GW  HYLPF IMGRV Y+HHY PA YF+ L+  F++DHFT       K  
Sbjct: 642 YMVSGIIPALGWFFHYLPFIIMGRVKYVHHYLPAFYFATLVFGFVVDHFTSRAPASVKWG 701

Query: 358 IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           +  ++ S +  +F  F  I+FG+           WL  W I
Sbjct: 702 VNILFISAVTGMFVLFSPISFGMEGEPGAYSYLNWLKGWKI 742



>gi|302418096|ref|XP_003006879.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Verticillium albo-atrum VaMs.102]
 gi|261354481|gb|EEY16909.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Verticillium albo-atrum VaMs.102]
          Length = 745

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 184/403 (45%), Positives = 243/403 (60%), Gaps = 4/403 (0%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GSR T+KNMG+GGGLLHSH+  YP GS QQQV+CYHH D NNDW     R E+ Y+   E
Sbjct: 341 GSRATIKNMGYGGGLLHSHVQTYPEGSNQQQVTCYHHKDTNNDWFFYPNRDEEPYDAEAE 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
             ++ +G TI            SHEIAAP+T    EVS YGN T+GD  D+W IEV+ D 
Sbjct: 401 PRYIADGTTIRLIHAQTGRNLHSHEIAAPMTKSDKEVSCYGNLTVGDAKDHWKIEVVRDA 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +R+R+LTT+ R +H +LGCYLRA     P  GF+     C K   P    +HWN 
Sbjct: 461 ASRDRSRVRTLTTAFRLKHPVLGCYLRAGTES-PSMGFQTDRSGCTKPTTPAIRSSHWNA 519

Query: 180 E--RHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
              +    + P          F+HDF HLNVAM T+NNALVPDPDK+D LAS   QWPI+
Sbjct: 520 REIKLITSQSPRATLVSTSPSFIHDFIHLNVAMMTSNNALVPDPDKQDDLASHWWQWPIL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDH 297
           +VGLRMCSW D VVK++LLGNP ++W  T  L +F   + +Y++R QR + DL+  + D 
Sbjct: 580 DVGLRMCSWDDSVVKYFLLGNPFVYWGTTLGLGVFGLVIAWYVLRWQRGFGDLNYKEVDQ 639

Query: 298 FLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI 357
             Y G    IGW+LHYLPF  M RVTY+HHY+PALYF++L   F+ D F  +     +  
Sbjct: 640 IHYAGVYPVIGWVLHYLPFVAMARVTYVHHYYPALYFAILTFGFLADWFLRNKNKTIQYA 699

Query: 358 IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           I+G+ Y +I+ ++  F  I FG+     +    +W   W I D
Sbjct: 700 IYGVLYLVIIGLYINFIPICFGMVGSNKQFSYLRWSDKWRISD 742



>gi|164657398|ref|XP_001729825.1| hypothetical protein MGL_2811 [Malassezia globosa CBS 7966]
 gi|159103719|gb|EDP42611.1| hypothetical protein MGL_2811 [Malassezia globosa CBS 7966]
          Length = 856

 Score =  363 bits (931), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 188/447 (42%), Positives = 257/447 (57%), Gaps = 49/447 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILK----PRKEQMYN 56
           GS+LTLKNM +GGGLLHSHI  YP GS   QV+CYHH D NN ++I      P       
Sbjct: 409 GSKLTLKNMAYGGGLLHSHIQTYPEGSHDHQVTCYHHKDENNHFIISPTYEDPPLPAADE 468

Query: 57  NITEV-EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           NI E    + +GD +            S  I AP+T    EV    +E   D ++YW++E
Sbjct: 469 NIDEPPRMLKSGDVLRLVHQQLQTNLRSEAIPAPITKEAHEVGCRASEKGADSSEYWIVE 528

Query: 116 VIDDLYTKTNR----IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           V+ D++    R    IR+L++++R RH  LGCYLR+ +A+LP WG+KQ+EV+CD  NNP+
Sbjct: 529 VLRDVHLGPGRPGMPIRTLSSTLRLRHKELGCYLRSGSAVLPDWGWKQMEVTCDPRNNPK 588

Query: 172 DSFTHWNIERHWNDKLPS-GGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILAST 230
           D  THWN+E HWND+LP+   +   RS FL DF HLNVAM  +NNALVPD DK D LAS 
Sbjct: 589 DIGTHWNVESHWNDRLPNVETRQRTRSPFLKDFVHLNVAMMISNNALVPDQDKFDHLASA 648

Query: 231 PRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL 290
           P +WP +  G+RM  W  D  K+YL+GNP+IWW  + SL++ +  L +Y++RRQR+  D+
Sbjct: 649 PSEWPFLYRGMRMNGWGADNYKYYLVGNPVIWWGSSLSLIVALPVLAWYIMRRQRRIHDM 708

Query: 291 SPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF---- 346
            P  WD FL+  KV  IGW L Y PF +MGRVTYLHHY P LYF++++   ++DH+    
Sbjct: 709 PPKVWDDFLFGLKVGWIGWFLQYFPFLMMGRVTYLHHYLPTLYFAVIVLVHLLDHYLWND 768

Query: 347 --------------------------------TVSCKPKT---KNIIFGIYYSLIVIVFW 371
                                            V  +P +   KN+ F     L+V VF+
Sbjct: 769 ATARTSIDWPTLLRSGRIASTKLNPFVHDTAAAVPGRPLSQHFKNMSFAAVTGLVVGVFF 828

Query: 372 YFKDIAFGINYPASELKSRKWLSTWNI 398
           +F  ++FG+    S+    KW   W+I
Sbjct: 829 WFCGVSFGMYGDISKWPYLKWRKNWDI 855



>gi|320581398|gb|EFW95619.1| Protein O-mannosyltransferase [Ogataea parapolymorpha DL-1]
          Length = 736

 Score =  352 bits (904), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 179/404 (44%), Positives = 247/404 (61%), Gaps = 6/404 (1%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S +T+KN G  GGLLHSHI  YP GS QQQV+ Y H D NNDW + +  +E   N  TE 
Sbjct: 333 SVVTIKNQGLTGGLLHSHIQTYPEGSNQQQVTTYSHKDSNNDW-VFELVREDPRNEFTEP 391

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDLY 121
            +V +G ++            +HEI APV++ H+EVS YGN T+GD  D WV+EV+D   
Sbjct: 392 HYVVDGMSVRLIHKSTGRNLHTHEIPAPVSSSHYEVSGYGNLTVGDFKDNWVVEVVDQYG 451

Query: 122 TKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNIE 180
           T+   R+  LTTS R R   LGCYL ++   LPQWGF+Q EV C KN   RD  T WNIE
Sbjct: 452 TEDKLRLHPLTTSFRLRSEALGCYLASSGIALPQWGFRQGEVMCMKNPFKRDKRTWWNIE 511

Query: 181 RHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
            H N +LP+  + +   ++ FL DF  LN+AM  TNNALVPDP+K+D LAS   QWP + 
Sbjct: 512 NHSNPELPNPPEDFKLPKTSFLKDFIQLNIAMMATNNALVPDPEKQDDLASNAWQWPTLH 571

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS--PAQWD 296
           VG+R+C W DD VK++L+G+P   W+ + ++V+FV  ++ YL+R QR+  D    P + D
Sbjct: 572 VGIRLCGWGDDNVKYFLIGSPATTWTSSIAIVVFVIMVVRYLLRWQRQINDFEGQPKKAD 631

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            F+  G    +GWLLHYLPFCIMGRVTY+HHY PALYF+M++  + +             
Sbjct: 632 LFVMGGLYPFLGWLLHYLPFCIMGRVTYVHHYLPALYFAMIVYCYTVYRLAEKLNRWAAA 691

Query: 357 IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            ++   Y+L++  F +   + FG++ P +  K    L +W + D
Sbjct: 692 ALYIFLYALVIGWFIFLLPLTFGMDGPNANYKYLNVLKSWRVAD 735



>gi|27469358|ref|NP_009379.2| Pmt2p [Saccharomyces cerevisiae S288c]
 gi|32130430|sp|P31382.2|PMT2_YEAST RecName: Full=Dolichyl-phosphate-mannose--protein
           mannosyltransferase 2
 gi|27316977|gb|AAC04934.2| Pmt2p: protein O-D-mannosyltransferase [Saccharomyces cerevisiae]
 gi|190406671|gb|EDV09938.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Saccharomyces cerevisiae RM11-1a]
 gi|256272298|gb|EEU07283.1| Pmt2p [Saccharomyces cerevisiae JAY291]
 gi|259144687|emb|CAY77628.1| Pmt2p [Saccharomyces cerevisiae EC1118]
 gi|285810179|tpg|DAA06965.1| TPA: Pmt2p [Saccharomyces cerevisiae S288c]
 gi|323349894|gb|EGA84105.1| Pmt2p [Saccharomyces cerevisiae Lalvin QA23]
 gi|365767215|gb|EHN08700.1| Pmt2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392301252|gb|EIW12340.1| Pmt2p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 759

 Score =  349 bits (895), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 175/409 (42%), Positives = 251/409 (61%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++D  
Sbjct: 407 IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++ +LTTS R ++  +GCYL      LP+WGF+Q EV C KN   RD  T WNI
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N++LP   +   Y ++ FL DF HLN+AM  TNNALVPDPDK D LAS+  QWP +
Sbjct: 527 ETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTL 586

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VGLR+C W DD  K++LLG P   W+ + +++ F+ T++  LIR QR+Y DL +P+ W+
Sbjct: 587 NVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWN 646

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSCK 351
            FL  G    + W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C 
Sbjct: 647 VFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCG 706

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 707 RIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|151941369|gb|EDN59740.1| dolichyl phosphate-D-mannose:protein O-D-mannosyltransferase
           [Saccharomyces cerevisiae YJM789]
          Length = 759

 Score =  349 bits (895), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 175/409 (42%), Positives = 251/409 (61%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++D  
Sbjct: 407 IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++ +LTTS R ++  +GCYL      LP+WGF+Q EV C KN   RD  T WNI
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N++LP   +   Y ++ FL DF HLN+AM  TNNALVPDPDK D LAS+  QWP +
Sbjct: 527 ETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTL 586

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VGLR+C W DD  K++LLG P   W+ + +++ F+ T++  LIR QR+Y DL +P+ W+
Sbjct: 587 NVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWN 646

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSCK 351
            FL  G    + W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C 
Sbjct: 647 VFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCG 706

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 707 RIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|323334791|gb|EGA76163.1| Pmt2p [Saccharomyces cerevisiae AWRI796]
          Length = 759

 Score =  349 bits (895), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 175/409 (42%), Positives = 251/409 (61%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++D  
Sbjct: 407 IEYLTPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++ +LTTS R ++  +GCYL      LP+WGF+Q EV C KN   RD  T WNI
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N++LP   +   Y ++ FL DF HLN+AM  TNNALVPDPDK D LAS+  QWP +
Sbjct: 527 ETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTL 586

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VGLR+C W DD  K++LLG P   W+ + +++ F+ T++  LIR QR+Y DL +P+ W+
Sbjct: 587 NVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWN 646

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSCK 351
            FL  G    + W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C 
Sbjct: 647 VFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCG 706

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 707 RIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|349576230|dbj|GAA21402.1| K7_Pmt2p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 759

 Score =  348 bits (894), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 175/409 (42%), Positives = 251/409 (61%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++D  
Sbjct: 407 IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++ +LTTS R ++  +GCYL      LP+WGF+Q EV C KN   RD  T WNI
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N++LP   +   Y ++ FL DF HLN+AM  TNNALVPDPDK D LAS+  QWP +
Sbjct: 527 ETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTL 586

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VGLR+C W DD  K++LLG P   W+ + +++ F+ T++  LIR QR+Y DL +P+ W+
Sbjct: 587 NVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWN 646

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSCK 351
            FL  G    + W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C 
Sbjct: 647 VFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCG 706

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 707 RIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|207348012|gb|EDZ73997.1| YAL023Cp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 554

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 175/409 (42%), Positives = 251/409 (61%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 142 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 201

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++D  
Sbjct: 202 IEYLTPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 261

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++ +LTTS R ++  +GCYL      LP+WGF+Q EV C KN   RD  T WNI
Sbjct: 262 GDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 321

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N++LP   +   Y ++ FL DF HLN+AM  TNNALVPDPDK D LAS+  QWP +
Sbjct: 322 ETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTL 381

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VGLR+C W DD  K++LLG P   W+ + +++ F+ T++  LIR QR+Y DL +P+ W+
Sbjct: 382 NVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWN 441

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSCK 351
            FL  G    + W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C 
Sbjct: 442 VFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCG 501

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 502 RIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 550



>gi|323306152|gb|EGA59884.1| Pmt2p [Saccharomyces cerevisiae FostersB]
          Length = 759

 Score =  346 bits (888), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 174/409 (42%), Positives = 250/409 (61%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++  G +             +H +AAPV+   +EVS YG+  +GD+ D WVIE++D  
Sbjct: 407 IEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQR 466

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++ +LTTS R ++  + CYL      LP+WGF+Q EV C KN   RD  T WNI
Sbjct: 467 GDEDPEKLHTLTTSFRIKNLEMXCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N++LP   +   Y ++ FL DF HLN+AM  TNNALVPDPDK D LAS+  QWP +
Sbjct: 527 ETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTL 586

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VGLR+C W DD  K++LLG P   W+ + +++ F+ T++  LIR QR+Y DL +P+ W+
Sbjct: 587 NVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWN 646

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSCK 351
            FL  G    + W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C 
Sbjct: 647 VFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCG 706

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + +++  + +L++  FWYF  I+FG+  P+S  +   W STW+I D
Sbjct: 707 RIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIAD 755



>gi|354545592|emb|CCE42320.1| hypothetical protein CPAR2_808690 [Candida parapsilosis]
          Length = 767

 Score =  345 bits (885), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 174/416 (41%), Positives = 251/416 (60%), Gaps = 17/416 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  +PR +  Y+   N 
Sbjct: 348 SIVTLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRPRGQPSYDTSGNN 407

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           T++E+V +G  I            +HEI APV+    EV+ YGN T+GD  D W++EV+D
Sbjct: 408 TDIEYVFDGMPIRIMHPQTGRNLHTHEIPAPVSKTELEVACYGNLTIGDAKDNWIVEVVD 467

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   R+  LTTS R ++ ++ CYL  + + LPQWGF+Q EV C KN   +D  T W
Sbjct: 468 QASNEDKMRLHPLTTSFRLKNEVMNCYLGVSGSTLPQWGFRQGEVVCFKNPFKKDKRTWW 527

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           NIE H N+ LP   + +   +++F+ DF  LN+AM  TNNAL+PDPDK+D LAS+  QWP
Sbjct: 528 NIEDHRNEHLPPAPEDFKLPKTRFIRDFIQLNLAMMATNNALLPDPDKQDDLASSFWQWP 587

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SP 292
            + VG+RMC W  D  K++++G+P   W+ +  +V+F    LYYLIR QR+  D     P
Sbjct: 588 TLNVGIRMCGWGADKPKYFMIGSPATTWTSSVGVVVFALITLYYLIRWQRQIVDFPSDQP 647

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKP 352
           A+   F+  G    +GW LH++PF IMGRVTY+HHY PALYF+M++  F ++ +T     
Sbjct: 648 ARLQKFIMGGIYPMLGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCFEIELWTSKLNK 707

Query: 353 KTKNII-----FGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K  + +       +Y +L  IV   F+Y +  +FG+  P    K  +WL +W + D
Sbjct: 708 KGASAVSKVAYVALYLALYFIVGFTFYYLRFFSFGMEGPKENWKHTQWLQSWRVSD 763



>gi|255732894|ref|XP_002551370.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Candida
           tropicalis MYA-3404]
 gi|240131111|gb|EER30672.1| dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Candida
           tropicalis MYA-3404]
          Length = 765

 Score =  344 bits (882), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 176/416 (42%), Positives = 252/416 (60%), Gaps = 17/416 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NNI 58
           S +TLKN G  GGLLHSH+  YP GS+QQQV+ Y H D NN+W+  +PR +  Y   NN 
Sbjct: 346 SFVTLKNQGLSGGLLHSHVQTYPEGSKQQQVTTYGHKDSNNNWIFQRPRGQPPYDPSNNN 405

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           T +E++ +G  +            +H++ APVT    EV+ YGN T+GD  D W++E++D
Sbjct: 406 TAIEYIIDGMHVRLMHPQSGRNLHTHDVQAPVTKGELEVACYGNLTIGDAKDNWIVEIVD 465

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   R+  LTTS R ++ ++ CYL  + + LPQWGF+Q EV C KN   +D  T W
Sbjct: 466 QAGDEDKMRLHPLTTSFRLKNEVMNCYLGTSGSTLPQWGFRQGEVVCYKNPFKKDKRTWW 525

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           N+E H N  LP   +S+   +++F+ DF  LN+AM  TNNAL+PD DK+D LAS+  QWP
Sbjct: 526 NLEDHRNAILPPAPESFKLPKTRFIRDFIQLNLAMMATNNALLPDNDKQDDLASSFWQWP 585

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SP 292
            + VG+RMC W+ D  K++++G+P   W+ TA +++F F +L+YLIR QR+Y D     P
Sbjct: 586 TLNVGIRMCRWSPDKPKYFMIGSPATTWTSTAGVILFAFIVLFYLIRWQRQYVDFPTTQP 645

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV---- 348
            +   FL  G     GW LH++PF IMGRVTY+HHY PALYF+M++  + +D FT     
Sbjct: 646 NKLRKFLMGGIYPMFGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCYEVDAFTSRFNR 705

Query: 349 -SCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +     K    GIY+ L   V   FWYF+ +++G+  P    K  K L +W + D
Sbjct: 706 PNATQAQKLTYAGIYFVLYFFVGYTFWYFRYLSWGMEGPKENWKHLKLLESWRVSD 761



>gi|406602575|emb|CCH45891.1| dolichyl-phosphate-mannose-proteinmannosyltransferase
           [Wickerhamomyces ciferrii]
          Length = 748

 Score =  343 bits (881), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 172/403 (42%), Positives = 243/403 (60%), Gaps = 5/403 (1%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT-E 60
           S +T+KN G GGGLLHSHI  +P GS QQQV+ Y H D NN+W+  + R  + +N+   +
Sbjct: 346 STVTIKNQGLGGGLLHSHIQTFPEGSNQQQVTTYGHKDANNEWIFHRERSREQFNSTRDQ 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            E++ +G ++            SHEI AP++   +EV+ YG+   GD+ D W+IEV    
Sbjct: 406 REYLVDGMSVRLWHRLTTRNLHSHEIPAPISRQDYEVAGYGDFDQGDEKDDWIIEVAHQY 465

Query: 121 YTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++   RI  LTTS R +H +LGCYL      LP WGF+Q EV+C KN   RD  T WNI
Sbjct: 466 GSEDKLRIHPLTTSFRLKHKVLGCYLSQTGNHLPAWGFRQGEVTCVKNPFSRDKRTWWNI 525

Query: 180 ERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N  LP     +   ++ F  DF  LN+AM  TNNALVPDPDK+D LAS   QWP +
Sbjct: 526 EHHANPSLPDPEPDFKLPKTNFFKDFIQLNLAMMATNNALVPDPDKQDDLASEAWQWPTL 585

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W     K++L+G+P   W+ +  +++F   +LYYLIR QR+++D     + +
Sbjct: 586 NVGIRLCGWGAGNPKYFLIGSPATTWTSSIGVILFALLVLYYLIRWQRQFRDFKDDKKLN 645

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            FL  G     GW LHY+PF IM RVTY+HHY PALYF+ML+  ++++    S +   K 
Sbjct: 646 LFLLGGIYPMFGWGLHYVPFIIMARVTYVHHYLPALYFAMLIFTYLIELGFASSRTPIKF 705

Query: 357 IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           II+   Y LI+ +FW+F  I+FG++    + +   WLS+W I 
Sbjct: 706 IIYSSLYVLIIGIFWHFSPISFGMDGDPEQYRYLNWLSSWRIA 748



>gi|50291311|ref|XP_448088.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527399|emb|CAG61039.1| unnamed protein product [Candida glabrata]
          Length = 742

 Score =  343 bits (879), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 174/409 (42%), Positives = 252/409 (61%), Gaps = 9/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GS +++KN    G LLHSH+  YP GS QQQV+ Y + D NN+W+  + R+E +++ N T
Sbjct: 334 GSSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINET 393

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++E+V +G               +H IAAPV   ++EVS YGN T+GD  DYWV+E++D 
Sbjct: 394 DIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQ 453

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             ++ T ++  LTTS R R+  L CYL      LP+WGF+Q E+SC K+   RD  T WN
Sbjct: 454 KGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWN 513

Query: 179 IERHWNDKLPSGGK-SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           +E H N+KLP+  +  Y  S FL DF HLN+AM  TNNALVP+ DK D LAS+  +WP +
Sbjct: 514 VESHENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTL 573

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VGLR+C W D+  K++LLG P+  W+ + +++ F+   +  L+R QR+Y D S    ++
Sbjct: 574 HVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFN 633

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFT-----VSCK 351
            FL  G    +GW LH++PF IM RVTY+HHY PALYF++++  +++D  T       C 
Sbjct: 634 LFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCG 693

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + ++F I  + +V  FWYF  I+FG+  PA      KW+ TW+I D
Sbjct: 694 SIMRLVVFAISIASVVGCFWYFSPISFGMTGPAINYHYLKWVKTWHIHD 742



>gi|444314239|ref|XP_004177777.1| hypothetical protein TBLA_0A04640 [Tetrapisispora blattae CBS 6284]
 gi|387510816|emb|CCH58258.1| hypothetical protein TBLA_0A04640 [Tetrapisispora blattae CBS 6284]
          Length = 753

 Score =  342 bits (878), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 178/408 (43%), Positives = 245/408 (60%), Gaps = 9/408 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S ++LKN   GG LLHSH+  +P GS+QQQ++CY H D NN+W+  +   +  Y+   E 
Sbjct: 343 SIVSLKNQALGGSLLHSHVQTFPEGSKQQQITCYGHKDSNNNWLFKRVWDQPDYSEEEEN 402

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDLY 121
           EFV +G T             SH+I A V+   FEVS YGN T+GD+ DYWV+EV++   
Sbjct: 403 EFVVDGATYRVVHLNTGRNLHSHQIPAAVSQTSFEVSGYGNSTIGDEKDYWVVEVVNQKG 462

Query: 122 TK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNIE 180
            +   R+  LTTS R RH  LGCYL    A LP+WGF+Q EV+C  +   RD  T WNIE
Sbjct: 463 KEDKTRLHPLTTSFRLRHKQLGCYLSQTGANLPEWGFRQSEVACVPSPFKRDKRTWWNIE 522

Query: 181 RHWNDKLPSG--GKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
            H N+KLP    G  Y ++ F  DF +LN+AM  TNNALVP+ DK D L+S   QWP + 
Sbjct: 523 THENEKLPESTEGFKYPKTNFFTDFVYLNLAMMATNNALVPESDKFDRLSSAAWQWPTLN 582

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQ-WDH 297
           +GLR+C W DD  K++LLG+P   W  TA++  F+   +   +R QR+YKD S A+  + 
Sbjct: 583 IGLRLCGWGDDNPKYFLLGSPATTWPSTAAVFGFMAFFIILTLRWQRQYKDYSDAKNVNT 642

Query: 298 FLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFT--VSCKPK-- 353
           FL  G     GW LH++PF IM RVTY+HHY PALYF++++  +  +  T  VS +    
Sbjct: 643 FLMGGIYPMFGWGLHFMPFIIMARVTYVHHYLPALYFALIVLVYFFEIGTQWVSHRKNGC 702

Query: 354 -TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             +  IFG YY+ I+ +F+ F  I+FG+  PA E     WL  W++ +
Sbjct: 703 LIRAAIFGAYYAAIMYIFYLFSPISFGMEGPAKEYSYLAWLPKWDMAE 750



>gi|150863992|ref|XP_001382657.2| Phospho Mannno Transferase; dolichyl-P-mannose-protein
           mannosyltransferase [Scheffersomyces stipitis CBS 6054]
 gi|149385248|gb|ABN64628.2| Phospho Mannno Transferase; dolichyl-P-mannose-protein
           mannosyltransferase [Scheffersomyces stipitis CBS 6054]
          Length = 759

 Score =  342 bits (878), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 180/414 (43%), Positives = 249/414 (60%), Gaps = 15/414 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NNI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R E  Y   NN 
Sbjct: 342 SVITLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWVFQRSRGETPYDTSNNN 401

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           TE+E+V +G  I            +H+I APVT  H EV+ YGN T+GD  D W +E+++
Sbjct: 402 TEIEYVLDGMKIRVMHPQTGRNLHTHDIPAPVTKGHHEVACYGNMTIGDLKDNWFVEIVE 461

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   R+  LTTS R ++ ++ CYL      LPQWGF+Q EV+C KN   +D  T W
Sbjct: 462 QQSDEDKLRLHPLTTSFRLKNEVMNCYLGVTGVSLPQWGFRQGEVACFKNPFKKDKRTWW 521

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           NIE + N+ LP     +   ++KFL DF  LNVAM  TNNALVPD DK+D LAS   QWP
Sbjct: 522 NIENNRNEILPPAPADFKLPKTKFLKDFIQLNVAMMATNNALVPDSDKQDDLASEAWQWP 581

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SP 292
            + VG+RMCSWA D VK++L+G+ +  W+ +  +V+F F  LYYLIR QR+  D     P
Sbjct: 582 TLNVGIRMCSWAKDKVKYFLIGSTVNTWASSVGVVLFAFLTLYYLIRWQRQIVDFPASEP 641

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV---- 348
            +   FL  G     GW LH++PF IMGRVTY+HHY PALYF++++  + ++ FT     
Sbjct: 642 NKLKLFLMGGIYPMFGWGLHFMPFVIMGRVTYVHHYVPALYFALIVLCYEIESFTSPLNK 701

Query: 349 --SCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
             S K   +  I+  +Y+ ++  FWY++ I++G+     + K    L TW I D
Sbjct: 702 GGSVKKYIRGAIYIAWYAAVIGAFWYWRYISWGLEGAKEDWKHLDLLPTWRISD 755



>gi|448520650|ref|XP_003868329.1| Pmt2 hypothetical protein mannosyltransferase (PMT) [Candida
           orthopsilosis Co 90-125]
 gi|380352669|emb|CCG25425.1| Pmt2 hypothetical protein mannosyltransferase (PMT) [Candida
           orthopsilosis]
          Length = 763

 Score =  342 bits (877), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 174/416 (41%), Positives = 250/416 (60%), Gaps = 17/416 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  +PR +  Y+   N 
Sbjct: 344 SVVTLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRPRGQPSYDPSGNN 403

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           T++E+V +G  I            +HEI APVT    EV+ YGN T+GD  D W++EV D
Sbjct: 404 TDIEYVFDGMPIRIMHPQTGRNLHTHEIPAPVTKTELEVACYGNLTVGDAKDNWIVEVAD 463

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   R+  LTTS R ++ ++ CYL  + + LPQWGF+Q EV C KN   +D  T W
Sbjct: 464 QASNEDKMRLHPLTTSFRLKNEVMDCYLGVSGSTLPQWGFRQGEVVCFKNPFKKDKRTWW 523

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           NIE H N+ LP   + +   +++F+ DF  LN+AM  TNNAL+PDPDK+D LAS+  QWP
Sbjct: 524 NIEDHRNELLPPAPEDFKLPKTRFIRDFIQLNLAMMATNNALLPDPDKQDDLASSFWQWP 583

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRK---YKDLSP 292
            + VG+RMC W  D  K++++G+P   WS +  +++F    LYYL+R QR+   Y    P
Sbjct: 584 TLNVGIRMCGWGADKPKYFMIGSPATTWSSSIGIIVFALITLYYLVRWQRQIVDYPSDQP 643

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKP 352
           A+   F+  G    +GW LH++PF IMGRVTY+HHY PALYF+M++  F ++ +T     
Sbjct: 644 ARLQKFIMGGIYPMLGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCFEVELWTSKLNY 703

Query: 353 KTKNII-----FGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           +  + +       IY +L  IV   F+Y +  +FG+  P    K  +WL +W + D
Sbjct: 704 RGASAVSKIAYIAIYLALYFIVGFTFYYLRYFSFGMEGPKENWKHTQWLQSWRVSD 759



>gi|513032850|gb|AGO12842.1| AaceriACR290Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 756

 Score =  340 bits (873), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 177/410 (43%), Positives = 247/410 (60%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSH+  YPGGS QQQV+ Y HND NN+W+  + R    ++ N TE
Sbjct: 347 SLVSIKNQALGGTLLHSHVQTYPGGSNQQQVTTYGHNDTNNNWVFDRIRGLPAWDANETE 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            EFV +G               SH I AP++  H+EVS YGN  +GD  D WVIE +   
Sbjct: 407 HEFVKDGHQYRLVHSNTGRNLHSHPIPAPLSKTHWEVSGYGNAEIGDPKDNWVIEFVSQP 466

Query: 121 YTKTNRI-RSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   +  +++TS R R+  +GCYL      LP+WGFKQ EV+C  N   RD  T WN+
Sbjct: 467 SDEDKSVLHTISTSFRIRNVEMGCYLAQTGYSLPEWGFKQGEVACLINPFKRDKRTWWNV 526

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E + N+KLP   +   Y ++ F  DF HLN+AM  TNNALVPDPDK D LAS+  QWP +
Sbjct: 527 ETNVNEKLPPMPEDFKYPKTNFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTL 586

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA-QWD 296
            VG+R+CSWADDV K++L+G+P   W  TA++ +F   ++YYL+R QR+      A   +
Sbjct: 587 NVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFSLLVVYYLLRWQRQLVLFRSADDAN 646

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            FL  G    +GW LHYLPF +MGRVTY+HHY PALYF++LM A++ +    + +   K+
Sbjct: 647 VFLMGGIYPLLGWCLHYLPFAVMGRVTYVHHYLPALYFALLMLAYVFEATLRAARHSQKS 706

Query: 357 -------IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                  +++  YY  ++  F+YF  I+ G+  P++  K   WL TW+I 
Sbjct: 707 YLKILVYVVYAAYYCTVIYGFYYFYPISVGMEGPSTNYKHLNWLKTWSIA 756



>gi|156839943|ref|XP_001643657.1| hypothetical protein Kpol_1040p12 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114277|gb|EDO15799.1| hypothetical protein Kpol_1040p12 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 753

 Score =  340 bits (872), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 174/409 (42%), Positives = 254/409 (62%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S ++++N   GG LLHSH+  YP GS+QQQV+ Y H D NNDW+  + R+  +YN N T+
Sbjct: 344 STVSIRNQALGGALLHSHVQGYPAGSKQQQVTGYGHQDANNDWIFHRIRQLPLYNANETD 403

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++ +G+T             SH++AAPV++  +EVS YG+   GD+ D W++EV+D  
Sbjct: 404 IEYILDGETYRLVHKNTNKNLHSHQVAAPVSSTQWEVSGYGDHNTGDNKDNWIVEVVDQK 463

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +++  LTTS R +H++LGCYL  ++  LP+WGF Q EV C KN   RD  T WNI
Sbjct: 464 GSEDKSKLHPLTTSFRLKHAVLGCYLAQSSNRLPEWGFSQSEVICLKNPFKRDKRTWWNI 523

Query: 180 ERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N+KLP+ G+ Y    + FL DF +LN+AM +TNNALV DPDK D LAS+  QWP +
Sbjct: 524 ELHVNEKLPTIGEDYKFPGNGFLKDFVYLNLAMMSTNNALVTDPDKLDRLASSAWQWPTL 583

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA-QWD 296
             GLR+  W DD VK+YL+G P   W+ TA+++ F+  ++  ++R QR+Y D   + + +
Sbjct: 584 NTGLRLNGWHDDNVKYYLMGTPASTWASTAAVLGFMVLVIILVLRWQRQYNDYQNSDKVN 643

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFT-VSCKPKTK 355
            FL  G     GW LH+ PF IM RVTY+HHY PALYF++++  +  +  T +  K KT 
Sbjct: 644 LFLMAGVYPMFGWGLHFCPFVIMARVTYVHHYLPALYFALIVLVYFFEAGTQLLTKTKTG 703

Query: 356 NI----IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +    IF  Y + ++  FWYF  I FG++ P        WL  W+I +
Sbjct: 704 RMIRIGIFATYITAVIACFWYFSPITFGMDGPNKNYSYLAWLPGWDISE 752



>gi|241953727|ref|XP_002419585.1| dolichyl-phosphate-D-mannose:protein O-D-mannosyltransferase,
           putative; protein O-mannosyltransferase, putative
           [Candida dubliniensis CD36]
 gi|223642925|emb|CAX43180.1| dolichyl-phosphate-D-mannose:protein O-D-mannosyltransferase,
           putative [Candida dubliniensis CD36]
          Length = 767

 Score =  339 bits (870), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 173/416 (41%), Positives = 254/416 (61%), Gaps = 17/416 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R +  Y+   N 
Sbjct: 348 SVITLKNQGLSGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGQPYYDTSGNT 407

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           T+VE++ +G  +            +H+I APV+   +EV+ YGN T+GD  D W++E+++
Sbjct: 408 TDVEYIFDGMHVRLMHPQTGRNLHTHDIPAPVSKSEYEVACYGNLTIGDPKDNWIVEIME 467

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   R+  LT+S R ++ ++ CYL      LPQWGF+Q EV C KN   +D  T W
Sbjct: 468 QASDEDKMRLHPLTSSFRLKNEVMNCYLGVTGTTLPQWGFRQGEVVCYKNPFKKDKRTWW 527

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           NIE + N  LP   + +   ++KF+ DF  LN+AM  TNNALVPD +K+D LAS+  QWP
Sbjct: 528 NIENNRNAILPPAPEDFKLPKTKFIRDFIQLNLAMMATNNALVPDTEKQDDLASSFWQWP 587

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SP 292
            + VG+RMC W  +  K+Y++G+P   W+ T  +++F F +LYYLIR QR+Y D    +P
Sbjct: 588 TLNVGIRMCGWGPENPKYYMIGSPATTWTSTFGVILFAFIVLYYLIRWQRQYVDFPSTNP 647

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF-----T 347
            +   F+  G     GW LH+LPF IMGRVTY+HHY PALYF+ML+  + ++ F     T
Sbjct: 648 HKLKLFVMGGIYPMFGWGLHFLPFAIMGRVTYVHHYVPALYFAMLVFCYEVESFASRLNT 707

Query: 348 VSCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +  P +K +   IY SL+ +V   FWYF+ +++G+  P  + K  K L +W + D
Sbjct: 708 PNASPVSKLLYLAIYISLLSLVAGTFWYFRYLSWGMEGPKEDWKHLKLLESWRVSD 763



>gi|401626946|gb|EJS44859.1| pmt2p [Saccharomyces arboricola H-6]
          Length = 760

 Score =  339 bits (870), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 171/409 (41%), Positives = 249/409 (60%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N TE
Sbjct: 348 SIVSIKNQALGGSLLHSHIQTYPEGSNQQQVTCYGYKDANNEWFFNRERGLPSWSANETE 407

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++  G +             +H +AA V+   +EVS YG++ +GD+ D W IE++D  
Sbjct: 408 LEYLKPGASYRLIHKSTGRNLHTHPVAAAVSKTQWEVSGYGDDFVGDNKDNWAIEIMDQR 467

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +  +++ +LTTS R ++  +GCYL      LP+WGF+Q EV C KN   RD  T WNI
Sbjct: 468 GDEDPDKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 527

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N++LP   +   Y ++ FL DF HLN+AM  TNNAL+PDPDK D LAS+  QWP +
Sbjct: 528 ETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALLPDPDKFDYLASSAWQWPTL 587

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VGLR+C W D+  K++LLG P   W+ T +++ F+ T++  +IR QR+Y DL SP+ W+
Sbjct: 588 NVGLRLCGWGDENPKYFLLGTPASTWASTIAVLAFMATIVILVIRWQRQYVDLTSPSDWN 647

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSCK 351
            FL  G    + W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C 
Sbjct: 648 IFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSKSKCG 707

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + +++  +  L++  FWYF  I+FG+  P+   +   W S+W+I D
Sbjct: 708 RIMRFVLYAGFMFLVIGCFWYFSPISFGMEGPSGNFRYLSWFSSWDIAD 756



>gi|260943918|ref|XP_002616257.1| hypothetical protein CLUG_03498 [Clavispora lusitaniae ATCC 42720]
 gi|238849906|gb|EEQ39370.1| hypothetical protein CLUG_03498 [Clavispora lusitaniae ATCC 42720]
          Length = 753

 Score =  339 bits (869), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 176/411 (42%), Positives = 253/411 (61%), Gaps = 15/411 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT-- 59
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  +PR +  Y+  T  
Sbjct: 338 SFVTLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYSHKDSNNNWIFQRPRPQPFYDTETNS 397

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           E E+V +G T+            +H+I+APV    +EV+ YGN T+GD  D W++EV++ 
Sbjct: 398 EAEYVLDGMTVRLIHPQTGRNLHTHDISAPVQKSEYEVACYGNMTVGDLKDNWIVEVMES 457

Query: 120 LYTKTN--RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
            Y K +  ++  LTTS R +  ++ CYL      LPQWGF+Q EV C KN   +D  T W
Sbjct: 458 -YGKEDALKLHPLTTSFRLKSEVMNCYLGVTGNSLPQWGFRQGEVVCFKNPFKKDKRTWW 516

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           NIE + N  LP   + +   ++ F  DF  +N+AM  TNNALVPD DK+D LAS   QWP
Sbjct: 517 NIENNRNAILPDAPEDFQLPKTNFFKDFIQINLAMMATNNALVPDDDKQDDLASKFWQWP 576

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA-Q 294
            +  G+RMCSWADD VK++L+G+P   W+ +  +V+F F  LY+LIR QR+  D   A +
Sbjct: 577 TLHSGIRMCSWADDKVKYFLIGSPATTWTSSVGVVLFCFITLYHLIRWQRQINDFETASK 636

Query: 295 WDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV----SC 350
              F+  G     GW LH++PF IMGRVTY+HHY PALYF+ML+  + ++ FT     S 
Sbjct: 637 LKKFVMGGIYPMFGWGLHFMPFVIMGRVTYVHHYLPALYFAMLVFTYEVEAFTQPLARSQ 696

Query: 351 KPKTKNIIFGIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           KP  K + +GI+   Y+L+++ FW+F+ I++G+  P ++      L +W +
Sbjct: 697 KPAMKVLYWGIFIALYALMILTFWHFRWISWGMEGPKTDWSHLDLLPSWRV 747



>gi|238881078|gb|EEQ44716.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2 [Candida
           albicans WO-1]
          Length = 769

 Score =  339 bits (869), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 171/416 (41%), Positives = 253/416 (60%), Gaps = 17/416 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R +  Y+   N 
Sbjct: 350 SVITLKNQGLSGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGQPYYDTSGNT 409

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           T++E++ +G  +            +H+I APV+   +EV+ YGN T+GD  D W++E+++
Sbjct: 410 TDIEYIFDGMHVRLMHPQTGRNLHTHDIPAPVSKSEYEVACYGNLTIGDPKDNWIVEIME 469

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   R+  LT+S R ++ ++ CYL      LPQWGF+Q EV C KN   +D  T W
Sbjct: 470 QASDEDKMRLHPLTSSFRLKNEVMNCYLGVTGTTLPQWGFRQGEVVCYKNPFKKDKRTWW 529

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           NIE + N  LP   + +   ++KF+ DF  LN+AM  TNNALVPD +K+D LAS+  QWP
Sbjct: 530 NIENNRNAVLPPAPEDFKLPKTKFIRDFIQLNLAMMATNNALVPDTEKQDDLASSFWQWP 589

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SP 292
            + VG+RMC W  +  K+Y++G+P   W+ T  +++F F +LYYLIR QR+Y D    +P
Sbjct: 590 TLNVGIRMCGWGPENPKYYMIGSPATTWTSTVGVILFAFIVLYYLIRWQRQYVDFPSTNP 649

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV---- 348
            +   FL  G     GW LH+LPF IMGRVTY+HHY PALYF+ML+  + ++ F+     
Sbjct: 650 HKLKLFLMGGIYPMFGWGLHFLPFAIMGRVTYVHHYVPALYFAMLVFCYEVESFSSRLNK 709

Query: 349 -SCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +  P +K +   IY  L+ +V   FWYF+ +++G+  P  + K  K L +W + D
Sbjct: 710 PNASPVSKLLYLAIYIGLLSLVAGTFWYFRYLSWGMEGPKEDWKHLKLLESWRVSD 765



>gi|363755572|ref|XP_003648001.1| hypothetical protein Ecym_7356 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356892037|gb|AET41184.1| hypothetical protein Ecym_7356 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 751

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 173/410 (42%), Positives = 253/410 (61%), Gaps = 13/410 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GS QQQ++CY H D NN+W   + R    +N    T
Sbjct: 343 SVVSIKNQALGGSLLHSHVQTFPEGSNQQQITCYGHKDSNNNWKFDRMRGLDPWNESVDT 402

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           + EFV +                SH+I AP+TN ++EVS YGN  +GD  D WVIE +D 
Sbjct: 403 DPEFVQDNHVYRLVHINTLRNLHSHQIRAPITNSYWEVSGYGNNEIGDPKDNWVIEFVDQ 462

Query: 120 LYTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
             T+ N+  + +L+TS R RHS + CYL    A LP+WGF+Q EV+C  N   RD  T W
Sbjct: 463 P-TEENKTVLHTLSTSFRIRHSEMNCYLAQTGAHLPEWGFRQAEVACVPNPFKRDKRTWW 521

Query: 178 NIERHWNDKLPS--GGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           N+E H NDKLP+   G  + ++KF+ DF HLN+AM  TNNALVPDPDK D+LAS+  QWP
Sbjct: 522 NVETHENDKLPARPEGFRFPKTKFIKDFIHLNLAMMATNNALVPDPDKLDVLASSAWQWP 581

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQW 295
            + VG+R+C W+D++V+++L+G+P   W  T +++I +  ++YYL+R QR+       Q 
Sbjct: 582 SLNVGIRLCGWSDELVRYFLMGSPASTWPSTFAVIILISMVIYYLLRWQRQCVIFQSHQD 641

Query: 296 DHFLYVGKVCG-IGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT 354
            +   VG +   +GW LH+LPF IMGRVTY+HHY PALYF++L  +++ +    S K  +
Sbjct: 642 ANLFLVGALYPLLGWALHFLPFVIMGRVTYVHHYLPALYFALLGLSYLFEAGMQSWKKSS 701

Query: 355 -----KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                +  ++G+YY +++  F+YF  I+ G++ P  + +    L TW I 
Sbjct: 702 YGRLARIGVYGLYYFIVIYGFYYFFPISAGMSGPVKDFEYLNLLKTWTIA 751



>gi|68472223|ref|XP_719907.1| hypothetical protein CaO19.6812 [Candida albicans SC5314]
 gi|68472458|ref|XP_719790.1| hypothetical protein CaO19.14104 [Candida albicans SC5314]
 gi|46441623|gb|EAL00919.1| hypothetical protein CaO19.14104 [Candida albicans SC5314]
 gi|46441749|gb|EAL01044.1| hypothetical protein CaO19.6812 [Candida albicans SC5314]
          Length = 769

 Score =  338 bits (866), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 171/416 (41%), Positives = 252/416 (60%), Gaps = 17/416 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R +  Y+   N 
Sbjct: 350 SVITLKNQGLSGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGQPYYDTSGNT 409

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           T++E++ +G  +            +H+I APV+   +EV+ YGN T+GD  D W +E+++
Sbjct: 410 TDIEYIFDGMHVRLMHPQTGRNLHTHDIPAPVSKSEYEVACYGNLTIGDPKDNWTVEIME 469

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   R+  LT+S R ++ ++ CYL      LPQWGF+Q EV C KN   +D  T W
Sbjct: 470 QASDEDKMRLHPLTSSFRLKNEVMNCYLGVTGTTLPQWGFRQGEVVCYKNPFKKDKRTWW 529

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           NIE + N  LP   + +   ++KF+ DF  LN+AM  TNNALVPD +K+D LAS+  QWP
Sbjct: 530 NIENNRNAVLPPAPEDFKLPKTKFIRDFIQLNLAMMATNNALVPDTEKQDDLASSFWQWP 589

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SP 292
            + VG+RMC W  +  K+Y++G+P   W+ T  +++F F +LYYLIR QR+Y D    +P
Sbjct: 590 TLNVGIRMCGWGPENPKYYMIGSPATTWTSTVGVILFAFIVLYYLIRWQRQYVDFPSTNP 649

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV---- 348
            +   FL  G     GW LH+LPF IMGRVTY+HHY PALYF+ML+  + ++ F+     
Sbjct: 650 HKLKLFLMGGIYPMFGWGLHFLPFAIMGRVTYVHHYVPALYFAMLVFCYEVESFSSRLNK 709

Query: 349 -SCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +  P +K +   IY  L+ +V   FWYF+ +++G+  P  + K  K L +W + D
Sbjct: 710 PNASPVSKLLYLAIYIGLLSLVAGTFWYFRYLSWGMEGPKEDWKHLKLLESWRVSD 765



>gi|459365940|gb|EMG45430.1| Dolichyl-phosphate-mannose--protein mannosyltransferase 2 [Candida
           maltosa Xu316]
          Length = 766

 Score =  337 bits (865), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 252/416 (60%), Gaps = 17/416 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NNI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R +  Y   NN 
Sbjct: 347 SVVTLKNQGLTGGLLHSHVQTFPEGSKQQQVTTYGHKDSNNNWIFQRARGKVPYDASNNN 406

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           TE+E++ +G  +            +HE+ AP+T   +EVS YGN T+GD  D W++E+ +
Sbjct: 407 TEIEYIIDGMHVRLMHSQTGRNLHTHEVQAPLTKSEYEVSCYGNLTIGDPKDNWIVEIAE 466

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   R+  LT+S R ++ L+ CYL  +   LPQWGF+Q EV C KN   +D  T W
Sbjct: 467 QAGDEDKMRLHPLTSSFRLKNELMNCYLGVSGNSLPQWGFRQGEVVCYKNPFKKDKRTWW 526

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           N+E + N+ LP     +   +++FL DF  +N+AM  TNNALVPDPDK+D LAS+  QWP
Sbjct: 527 NLENNRNEILPPAPADFKLPKTRFLRDFIQINLAMMATNNALVPDPDKQDDLASSFWQWP 586

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SP 292
            + VG+RMC W+ D  K++++G+P   W+ TA + +F F +++YL+R QR+Y D    +P
Sbjct: 587 TLNVGIRMCGWSADKAKYFMIGSPATTWTSTAGVFLFAFIVIFYLVRWQRQYVDFPSTNP 646

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV---- 348
            +   FL  G     GW LH++PF IMGRVTY+HHY PALYF+M++  + ++ FT     
Sbjct: 647 QKLKLFLMGGIYPMFGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCYEVESFTACLNR 706

Query: 349 -SCKPKTKNIIFGIYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            +   K+K I   I+  L  +V   FWYF+ +++G+       K  K L +W I D
Sbjct: 707 PNASQKSKLIYLAIFIGLYFMVGYTFWYFRYLSWGMEGKKENWKHLKLLKSWRISD 762



>gi|238597974|ref|XP_002394480.1| hypothetical protein MPER_05625 [Moniliophthora perniciosa FA553]
 gi|215463566|gb|EEB95410.1| hypothetical protein MPER_05625 [Moniliophthora perniciosa FA553]
          Length = 364

 Score =  336 bits (861), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 212/333 (63%), Gaps = 41/333 (12%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM------ 54
           GS++TLKN G+GGGLLHSH+  YP GS QQQV+CYH+ D NNDW ++   +E M      
Sbjct: 4   GSKITLKNTGWGGGLLHSHVQTYPTGSTQQQVTCYHYKDENNDWYVMPTWEEYMPAPSSH 63

Query: 55  ------YNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDD 108
                     + + F+ + D I            SH + APV+   +EV+ YGN T+GD 
Sbjct: 64  TPVFDPLAPESPLRFLKHNDVIRLRHAPTTRNLHSHPVPAPVSKQFWEVAGYGNATIGDV 123

Query: 109 NDYWVIEVIDDLY---------------------------TKTNRIRSLTTSMRFRHSLL 141
            DYWV+EV+DD+                             K NRI SLTT +RFRH +L
Sbjct: 124 QDYWVVEVVDDVMRGDITKKPKHPTYDEDDERVGSQDKRVAKENRIHSLTTKLRFRHQVL 183

Query: 142 GCYLRAANAILPQWGFKQVEVSCDKNN--NPRDSFTHWNIERHWNDKLPSGGKSYYRSKF 199
           GCYLRAANA+LPQWGFKQ+EV+C  N+  + +D  T+WN+E H N++LP+  +S   S F
Sbjct: 184 GCYLRAANAVLPQWGFKQIEVTCVPNDRTSRKDKTTYWNVESHSNERLPAADRSRRSSPF 243

Query: 200 LHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNP 259
           L+DFWHLNVAM T+NNAL+PDPDKEDILAS P  WP + +GLRMC W+D  +K+YLLGNP
Sbjct: 244 LYDFWHLNVAMMTSNNALIPDPDKEDILASKPFDWPFMHLGLRMCGWSDQQIKYYLLGNP 303

Query: 260 IIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSP 292
           I+WW GT SL+ F+    +Y +RRQR+Y+D  P
Sbjct: 304 IVWWGGTCSLIAFLVVSAWYTVRRQRQYRDFDP 336



>gi|365762199|gb|EHN03800.1| Pmt2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 759

 Score =  335 bits (860), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 170/409 (41%), Positives = 247/409 (60%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSHI  YP GS QQQV+CY + D NN+W   + R    ++ N T+
Sbjct: 347 SLVSIKNQALGGSLLHSHIQTYPEGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENDTD 406

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++  G               +H +AA V+   +EVS YG++ +GD+ D WVIE+++  
Sbjct: 407 IEYLKAGAPYRLVHKSTGRNLHTHPVAAAVSKTQWEVSGYGDDFVGDNKDNWVIEIMNQR 466

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++ +LTTS R ++  + CYL    + LP+WGF+Q EV C KN   RD  T WNI
Sbjct: 467 GDEDPEKLHTLTTSFRIKNMEMDCYLAQTGSSLPEWGFRQQEVVCMKNPFKRDKRTWWNI 526

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N+ LP   +   Y ++ F  DF HLN+AM  TNNAL+PDPDK D LAS+  QWP +
Sbjct: 527 ETHENENLPPRPEDFQYPKTNFFKDFIHLNLAMMATNNALLPDPDKFDYLASSAWQWPSL 586

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VGLR+C W DD  K++LLG P   W+ + +++ F+  ++  LIR QR+Y DL SP+ W+
Sbjct: 587 NVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMAIIVILLIRWQRQYVDLTSPSNWN 646

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-----FTVSCK 351
            FL  G    + W LHY+PF IM RVTY+HHY PALYF++++ A+  D          C 
Sbjct: 647 VFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQRWSRSKCG 706

Query: 352 PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              + +++  + +L++  FWYF  I+FG+  P+   +   WLSTW+I D
Sbjct: 707 RIMRFVLYTGFMALVIGCFWYFSPISFGMEGPSDNFRYLNWLSTWDIAD 755



>gi|448099446|ref|XP_004199151.1| Piso0_002564 [Millerozyma farinosa CBS 7064]
 gi|359380573|emb|CCE82814.1| Piso0_002564 [Millerozyma farinosa CBS 7064]
          Length = 765

 Score =  333 bits (854), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 168/414 (40%), Positives = 252/414 (60%), Gaps = 15/414 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT-- 59
           S +TLK+ G  GGLLHSHI  +P GS+QQQV+ Y H D NN W+  + R    Y+  T  
Sbjct: 348 SVVTLKSQGLTGGLLHSHIQTFPDGSKQQQVTTYSHKDANNHWIFQRARGLPNYDAETSQ 407

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++E++ +G  +            +H IAAP++   +EV+ YGN T+GD  D W++EV+D 
Sbjct: 408 DIEYIIDGMEVRLVHPLTGRNLHTHTIAAPLSKSEYEVACYGNLTIGDYKDNWIVEVLDQ 467

Query: 120 LYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
              +   R+  LTTS R +++ LGCYL  +   LP WGF+Q EV C K+   +D  T WN
Sbjct: 468 QGDEDKLRLHPLTTSFRLKNAELGCYLGVSGQALPPWGFRQGEVVCYKDPFRKDKRTWWN 527

Query: 179 IERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           +E + N  LP     +   +++F  DF  +N+AM  TNNAL+P+ DK+D LAS+  QWP 
Sbjct: 528 VENNENKILPPAPADFKLPKTRFWKDFIQINLAMMATNNALLPETDKQDDLASSAWQWPT 587

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SPA 293
           +  G+RMC+WADD  K++L+G+    W+ + +L+IF+F +LYYLIR QR++ D     P 
Sbjct: 588 LHSGIRMCTWADDTPKYFLIGSISTTWTSSVALIIFMFVVLYYLIRWQRQFNDFPASDPK 647

Query: 294 QWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV----S 349
           ++D F+  G    +GW LH+ PF IMGR+TY+HHY PALYF+M +  ++++ FT     S
Sbjct: 648 KFDLFIIGGVYPLLGWFLHFFPFVIMGRITYVHHYLPALYFAMFVLCYLLELFTSPLTKS 707

Query: 350 CKPKTK---NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            KP  K    +I+ ++Y+ ++ VFW ++ IAFG+  P         L +W I +
Sbjct: 708 TKPSAKLTYALIYAVWYAFVIGVFWRWRHIAFGLIGPKENYAHLDLLPSWRIAN 761



>gi|344232248|gb|EGV64127.1| PMT-domain-containing protein [Candida tenuis ATCC 10573]
          Length = 763

 Score =  332 bits (852), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 169/413 (40%), Positives = 258/413 (62%), Gaps = 14/413 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN--NIT 59
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R    ++     
Sbjct: 347 SVITLKNQGLTGGLLHSHVQAFPEGSKQQQVTTYSHKDSNNNWVFQRARGLDHFDPQENK 406

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++E+V  G  +            SH + APVT  H+EV+ YGN+T+GD+ D WVIE+++ 
Sbjct: 407 DLEYVVEGMVVRLLHPMTGRNLHSHNVQAPVTKNHYEVAGYGNQTIGDNKDNWVIEIVEQ 466

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
              +  +++  LT+S+RF+++++ CYL    A LP WGF+Q EV+C K+   +D  T WN
Sbjct: 467 SGDEDKDKLHPLTSSVRFKNTVMNCYLGVTGASLPAWGFRQGEVACFKDPFKKDKRTWWN 526

Query: 179 IERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           IE H N  LP   + +   +++F+ DF  LN+AM  TNNALVPD +K+D LAS+  +WP 
Sbjct: 527 IESHVNTLLPPPPEDFKLPKTRFIRDFIQLNLAMMATNNALVPDYEKQDDLASSAWEWPT 586

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA--Q 294
           + VG+R+CSWA+D VK++L+G+P   W  TA +V F   +L+YL+R QR++ D      +
Sbjct: 587 LHVGIRLCSWANDKVKYFLIGSPATTWPSTAGVVFFAGLVLWYLLRWQRQFNDFDGQSHK 646

Query: 295 WDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKT 354
              F+  G     GW LH++PF IMGRVTY+HHY PALYF+M++  F+++H T   +  +
Sbjct: 647 LKLFIMGGIYPMFGWGLHFVPFVIMGRVTYVHHYLPALYFAMMILCFLIEHLTTPLRKSS 706

Query: 355 K---NIIF-GIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
               N+I+ G+Y   + ++V  FW+++ +A+G+  P S       LSTW I +
Sbjct: 707 SRALNLIYVGVYSSFFGVVVGCFWHWRYVAWGMEGPKSNWAYLDLLSTWRIAN 759



>gi|294658242|ref|XP_460573.2| DEHA2F04840p [Debaryomyces hansenii CBS767]
 gi|202952983|emb|CAG88897.2| DEHA2F04840p [Debaryomyces hansenii CBS767]
          Length = 765

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 167/412 (40%), Positives = 250/412 (60%), Gaps = 13/412 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNN--IT 59
           S +TLKN G  GGLLHSHI  +P GS+QQQV+ Y H D NN+W+  + R  + Y+     
Sbjct: 351 SVVTLKNQGLTGGLLHSHIQTFPEGSKQQQVTTYTHKDTNNNWVFQRARGMEPYDTEKSQ 410

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++++V +G  +            +H I AP++   +EV+ YGN TLGD  D WV+E+++ 
Sbjct: 411 DIDYVLDGMVVRLVHPMTGRNLHTHNIPAPISKSEWEVAGYGNLTLGDYKDNWVVEIMEQ 470

Query: 120 LYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
              +   R+  LT+S R R++ L CYL  +   LP WGF+Q EV+C +N   +D  T WN
Sbjct: 471 NGEEDKLRLHPLTSSFRLRNTELDCYLGVSGNNLPAWGFRQGEVACYQNPFKKDKRTWWN 530

Query: 179 IERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           IE + N  LP     +   +++FL DF  LN+AM  TNNALVPD DK+D LAS+  QWP 
Sbjct: 531 IENNANKLLPPSPPDFKLPKTRFLKDFIQLNLAMMATNNALVPDHDKQDDLASSAWQWPT 590

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           +  G+RMCSWADD +K++L+G+P   W  +  +++F F +L+YLIR QR+Y D    Q  
Sbjct: 591 LHTGIRMCSWADDKIKYFLIGSPATTWPSSIGVILFAFIVLFYLIRWQRQYNDFPDQQKL 650

Query: 297 HFLYVGKVCGI-GWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTK 355
               +G +  + GW LH++PF IMGRVTY+HHY PALYF+M++  + ++ FT+  +  + 
Sbjct: 651 KLFTMGGIYPMFGWGLHFMPFIIMGRVTYVHHYVPALYFAMMIFCYELELFTLPLRNSSS 710

Query: 356 NI-------IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            I       IF  +Y++++  FWY++ ++FGI  P  +      L +W I +
Sbjct: 711 AISKLAYALIFAAWYAIVIGTFWYWRHVSFGIEGPKEDWTHLDLLPSWRIAN 762



>gi|149242363|ref|XP_001526455.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Lodderomyces elongisporus NRRL YB-4239]
 gi|146450578|gb|EDK44834.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2
           [Lodderomyces elongisporus NRRL YB-4239]
          Length = 796

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 166/416 (39%), Positives = 251/416 (60%), Gaps = 17/416 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NI 58
           S +TLKN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R    Y+   N 
Sbjct: 377 SVVTLKNQGLSGGLLHSHVQTFPEGSKQQQVTTYSHKDSNNNWIFQRARPLPSYDPSANK 436

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           T++E+V +G  +            +HEI AP T   +EV+ YGN T+GD  D W++E++D
Sbjct: 437 TDIEYVIDGMHVRLMHPQTGRNLHTHEIPAPSTKSEWEVACYGNLTIGDAKDNWIVEIMD 496

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   ++  LT+S R ++ +LGCYL      LPQWGF+Q EV C KN   +D  T W
Sbjct: 497 QQGDEDKLKLHPLTSSFRLKNEVLGCYLGVTGTSLPQWGFRQGEVVCYKNPFKKDKRTWW 556

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
           NIE + N+ LP   +++   +++F+ DF  LN+AM  TNNAL+PDPDK+D LAS+  QWP
Sbjct: 557 NIENNRNEILPPAPENFKLPKTRFIRDFIQLNLAMMATNNALLPDPDKQDDLASSFWQWP 616

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS---P 292
            + VG+RMC W+ D  K++++G+P   W+ T  + IF F  LYY++R QR++ D     P
Sbjct: 617 TLNVGIRMCGWSPDKAKYFMIGSPATTWTSTVGVFIFAFITLYYIVRWQRQFVDFPSNHP 676

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF-TVSCK 351
            +   F+  G     GW LH++PF IMGRVTY+HHY PALYF+M++  + +D F ++  +
Sbjct: 677 QKLQKFIMGGIYPMFGWGLHFMPFVIMGRVTYVHHYVPALYFAMIVFCYEVDAFASIFNR 736

Query: 352 PKTKNI-------IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           P+   +       I+   Y+L+   FWY +  ++G+     E K  + +++W + D
Sbjct: 737 PRASAVSKIVYAAIYVTLYALVAGTFWYLRYFSWGMEGDKKEWKHLQLINSWRVSD 792



>gi|448103305|ref|XP_004200004.1| Piso0_002564 [Millerozyma farinosa CBS 7064]
 gi|359381426|emb|CCE81885.1| Piso0_002564 [Millerozyma farinosa CBS 7064]
          Length = 765

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 167/414 (40%), Positives = 252/414 (60%), Gaps = 15/414 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT-- 59
           S +TLK+ G  GGLLHSH+  +P GS+QQQV+ Y H D NN W+  + R    Y+  T  
Sbjct: 348 SVVTLKSQGLTGGLLHSHVQTFPEGSKQQQVTTYSHKDANNHWIFQRARGLPNYDTETSQ 407

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           ++E++ +G  +            +H IAAP++   +EV+ YGN T+GD  D W++EV+D 
Sbjct: 408 DIEYIIDGMEVRLVHPLTGRNLHTHSIAAPLSKSEYEVACYGNLTIGDYKDNWIVEVVDQ 467

Query: 120 LYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
              +   R+  LTTS R +++ LGCYL  +   LP WGF+Q EV C K+   +D  T WN
Sbjct: 468 QGDEDKLRLHPLTTSFRLKNAELGCYLGVSGHALPPWGFRQGEVVCYKDPFRKDKRTWWN 527

Query: 179 IERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           IE + N  LP     +   +++F  DF  +N+AM  TNNAL+P+ DK+D LAS+  QWP 
Sbjct: 528 IENNENKILPPAPADFKLPKTRFWKDFIQINLAMMATNNALLPETDKQDDLASSAWQWPT 587

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SPA 293
           +  G+RMC+WADD+ K++L+G+    W+ + +L+IF+F +LYYLIR QR++ D     P 
Sbjct: 588 LHSGIRMCTWADDIPKYFLIGSISTTWTSSVALIIFMFVVLYYLIRWQRQFNDFPASEPK 647

Query: 294 QWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV----S 349
           ++D F+  G    +GW LH+ PF IMGR+TY+HHY PALYF+M +  ++++ FT     S
Sbjct: 648 KFDLFIIGGVYPLLGWFLHFFPFVIMGRITYVHHYLPALYFAMFVLCYLLELFTSPLTKS 707

Query: 350 CKPKTK---NIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            KP  K    +I+  +Y+ ++ VFW ++ I+FG+  P         L +W I +
Sbjct: 708 TKPSAKLTYALIYAAWYAFVIGVFWRWRHISFGLIGPKENYSHLDLLPSWRIAN 761



>gi|50311535|ref|XP_455792.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644928|emb|CAG98500.1| KLLA0F15829p [Kluyveromyces lactis]
          Length = 741

 Score =  331 bits (848), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 173/412 (41%), Positives = 249/412 (60%), Gaps = 16/412 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +T+KN   GGGLLHSHI  YP GS+QQQV+ Y H D NN W   + R    Y+ N TE
Sbjct: 333 SEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETE 392

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            EFV +G               +H   APV    +EVS YG+  +GD  D W+IE++D  
Sbjct: 393 TEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIVDQK 452

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++  LT+S R +++ +GCYL      LPQWGF+Q EV+C KN   RD  T WNI
Sbjct: 453 GPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNI 512

Query: 180 ERHWNDKLPSGGKS--YYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E + N+KLP   ++  Y ++ F+ DF HLN+AM  TNNALVP+ +K D LAS+  QWP +
Sbjct: 513 ETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTL 572

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W +  +K++L+G+P   W  T +++ F+  +  YLIR QR+Y DL+ P   +
Sbjct: 573 NVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDIN 632

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS------- 349
            FL  G    + W LH++PF IM RVTY+HHY PALYF++L+ A++   F +S       
Sbjct: 633 LFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHYLPALYFALLVLAYL---FEISMKKWNKS 689

Query: 350 -CKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            C    +  I+G Y ++++  F+YF  I+FG++ P+++ +   WLSTW I D
Sbjct: 690 KCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYEYLNWLSTWTISD 741



>gi|365989682|ref|XP_003671671.1| hypothetical protein NDAI_0H02540 [Naumovozyma dairenensis CBS 421]
 gi|343770444|emb|CCD26428.1| hypothetical protein NDAI_0H02540 [Naumovozyma dairenensis CBS 421]
          Length = 757

 Score =  330 bits (846), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 173/410 (42%), Positives = 241/410 (58%), Gaps = 14/410 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSH+  YP GS QQQV+ Y + D NN+W   + R    +N N T+
Sbjct: 346 STVSIKNQALGGALLHSHVQGYPEGSHQQQVTAYSYKDPNNEWFFDRARGLPNWNENETD 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           VEFV    T             SH +AAP++   +EVS YG+  +GD  D W+IEV+D  
Sbjct: 406 VEFVLAESTYRLVHKSTGKSLHSHPVAAPISKTQWEVSGYGDAEIGDQRDNWIIEVVDQR 465

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++ T ++  LTTS R  H  + CYL    + LP+WGFKQ+EV+C KN   RD  T WNI
Sbjct: 466 GSENTTKLHPLTTSFRLYHPDMDCYLAQTGSQLPEWGFKQLEVACMKNPFKRDKRTWWNI 525

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N  LP   +   Y R+ F  DF HLN+AM  TNNALVPD DK D+LAS+  QWP +
Sbjct: 526 ETHENSVLPPRPEDFKYPRTNFFKDFIHLNLAMMATNNALVPDADKYDLLASSAWQWPTL 585

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA-QWD 296
            +GLR+C W +D VK++LLG P+  W+ + +++  +  ++  L+R QR+Y DL  A   +
Sbjct: 586 YLGLRICGWGNDTVKYFLLGTPVSTWASSVAIIGLMAFIVILLLRWQRQYTDLRNANDLN 645

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-------FTVS 349
            FL  G    +GW LHY PF IM RVTY+HHY PALYF++++  +++D          + 
Sbjct: 646 TFLMGGFYPLLGWGLHYTPFVIMSRVTYVHHYLPALYFALIILTYVLDASLKRVSGSKLG 705

Query: 350 CKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           C  KT  + +   ++ ++  FWYF  I+FG+  P        WL TWNI 
Sbjct: 706 CLVKT--VAYLTAFTSVIGCFWYFSPISFGMEGPKENYAYLNWLPTWNIA 753



>gi|344301487|gb|EGW31799.1| hypothetical protein SPAPADRAFT_62391 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 517

 Score =  330 bits (845), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 174/417 (41%), Positives = 247/417 (59%), Gaps = 19/417 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NNI 58
           S +T+KN G  GGLLHSH+  +P GS+QQQV+ Y H D NN+W+  + R    Y   NN 
Sbjct: 98  SSVTIKNQGLSGGLLHSHVQTFPSGSKQQQVTTYGHKDSNNNWVFQRARGVPHYDTANNN 157

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           T++E++ +G TI            SHE+ APV+   +EV+AYGN TLGD  D WV+E+++
Sbjct: 158 TDIEYIIDGMTIRLMHKNTGRNLHSHEVDAPVSKAQWEVAAYGNLTLGDVKDNWVVEIME 217

Query: 119 DLYTKTN-RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
               +   RI  LTTS R RH+ LGCYL  + + LPQWGF+Q EV C K+   +D  T W
Sbjct: 218 QNSNEDKMRIHPLTTSFRLRHAYLGCYLATSGSNLPQWGFRQGEVVCHKDPFKKDKRTWW 277

Query: 178 NIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWP 235
            IE + N  LP   + +   ++KF+ DF  LN+AM  TNNALVPD +K+D LAS   QWP
Sbjct: 278 IIEDNENPILPPPSEDFKLPKTKFIKDFIQLNLAMMATNNALVPDEEKQDDLASDFWQWP 337

Query: 236 IVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL---SP 292
            + VG+RMC W     K++++G+P   W+ T  +  F   ++YYL+R QR+  D    +P
Sbjct: 338 SLNVGIRMCGWGSKNPKYFMIGSPATTWTSTVGVFAFALLVIYYLVRWQRQIIDFPSTNP 397

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF------ 346
            +   FL  G     GW LHY+PF IMGRV Y+HHY PALYF+ML+  + +D F      
Sbjct: 398 DKLKRFLMGGIYPMFGWGLHYVPFVIMGRVKYVHHYMPALYFAMLVFCYEVDSFSRRLND 457

Query: 347 ---TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              +V+ K     +  G+ Y+L+   F+YF+  +FG+  P  + K  + L +W + D
Sbjct: 458 RNASVASKLSYAALYLGL-YALVGGTFYYFRYFSFGMEGPKEDWKHLQLLRSWRVAD 513



>gi|255713082|ref|XP_002552823.1| KLTH0D02266p [Lachancea thermotolerans]
 gi|238934203|emb|CAR22385.1| KLTH0D02266p [Lachancea thermotolerans CBS 6340]
          Length = 740

 Score =  327 bits (839), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 165/407 (40%), Positives = 248/407 (60%), Gaps = 10/407 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-TE 60
           S +++KN   GG LLHSH+  +P GS QQQV+CY H D NN+W+  + R    +    TE
Sbjct: 333 SHVSIKNQALGGSLLHSHVQGFPEGSNQQQVTCYGHKDSNNNWIFDRIRPLPFWTEEETE 392

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E+V  G++             +H I AP++   +EVS YG+ T+GD  D+WV+EV+   
Sbjct: 393 IEYVVPGESYRLVHPNTGKNLHTHPIPAPISKSAWEVSGYGSATVGDPKDHWVLEVVAQY 452

Query: 121 YTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
            ++  +R+  LT+S R +++ LGCYL      LP+WGF+Q EV+C KN   RD  T WNI
Sbjct: 453 GSENQSRVHPLTSSFRIKNAELGCYLAQTGESLPEWGFRQSEVACLKNPFKRDKRTWWNI 512

Query: 180 ERHWNDKLPS--GGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N++LP       Y +  F+ +F HLN+AM  TNNALVPDPDK D LAS+  QWP +
Sbjct: 513 ESHTNERLPDRPADFQYPKLNFIKNFIHLNLAMMATNNALVPDPDKLDTLASSAWQWPTL 572

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VG+R+C W D+ VK++L+G+P   W  TA ++ F+  ++  L+R QR+Y D  SP  ++
Sbjct: 573 NVGIRLCGWGDETVKYFLMGSPASTWPSTAGVLAFMVLVVVLLLRWQRQYADFSSPRDFN 632

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPK--- 353
            F+  G    +GW LH++PF IM RVTY+HHY PALYF++L+  ++ +    + +     
Sbjct: 633 LFMMGGFYPLLGWGLHFMPFVIMSRVTYVHHYLPALYFALLILCYLFEAGLKNLQKHKGG 692

Query: 354 --TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
              + +I+  Y ++++  F+YF  I+FG+  P+S      W+ TW I
Sbjct: 693 RLARTLIYFTYGAIVICGFYYFSPISFGLVGPSSNYAYLNWIKTWTI 739



>gi|367017894|ref|XP_003683445.1| hypothetical protein TDEL_0H03750 [Torulaspora delbrueckii]
 gi|359751109|emb|CCE94234.1| hypothetical protein TDEL_0H03750 [Torulaspora delbrueckii]
          Length = 750

 Score =  326 bits (835), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 173/409 (42%), Positives = 246/409 (60%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-TE 60
           S +++KN   GG LLHSH+  YP GS QQQV+ Y   D NN W   + R    YN+  T+
Sbjct: 338 SYVSIKNQALGGSLLHSHVQTYPEGSSQQQVTGYGFKDSNNLWFFDRQRAMPYYNDSETD 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           VE++  G               +H IAAPV+   +EVS YG+  LGD+ D+WVIEV+   
Sbjct: 398 VEYIVAGMAYRLVHNSTQRNLHTHPIAAPVSKSAWEVSGYGDHLLGDEKDHWVIEVVAQY 457

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +  +RI  LTTS R ++ ++ CYL      LP+WGF+Q E++C K+   RD  T WNI
Sbjct: 458 GDEDKSRIHPLTTSFRLKNIVMDCYLAQTGHHLPEWGFRQSEMACVKSPFKRDKRTWWNI 517

Query: 180 ERHWNDKLPSGGKS--YYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H ND LP   ++  Y ++ F+ DF HLN+AM  TNNAL+P+ DK D LAS   QWP +
Sbjct: 518 ESHENDVLPPRPENFRYPKTNFIKDFIHLNLAMMATNNALIPESDKLDNLASAAWQWPTL 577

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
           ++GLR+C W DD ++++LLGNP+  W  TA++V F   ++  L+R QR+Y DL+ P    
Sbjct: 578 DLGLRLCGWGDDNIRYFLLGNPLSTWPSTAAVVAFGALVVVLLLRWQRQYVDLANPQDAS 637

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS-CKPKTK 355
            FL  G    + W LH++PF IM RVTY+HHY PALYF++L+  ++ +       K K  
Sbjct: 638 VFLIGGIFPMLAWGLHFMPFVIMSRVTYVHHYLPALYFALLVMCYLFEAGLKGWTKSKCG 697

Query: 356 NI----IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           N+    I+G YY++++  F+YF  I+FG+  P S+ +   WL  W I D
Sbjct: 698 NVMRVCIYGSYYAIVIGCFFYFSPISFGMEGPVSKYEYLDWLPGWFISD 746



>gi|403218180|emb|CCK72671.1| hypothetical protein KNAG_0L00480 [Kazachstania naganishii CBS
           8797]
          Length = 749

 Score =  325 bits (833), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 172/411 (41%), Positives = 244/411 (59%), Gaps = 12/411 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-TE 60
           S +++KN   GG LLHSH+  YP GS QQQV+CY ++D NNDW+  + R    +NN  T+
Sbjct: 334 STISIKNQALGGALLHSHVQTYPEGSTQQQVTCYSYSDANNDWIFQRTRDLPAWNNEETD 393

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E+V N  T             +H ++APV+   +EVSAYG + +GD  DYWVIE++D +
Sbjct: 394 IEYVQNEQTYRLVHKNTGKNLHTHPVSAPVSKNDYEVSAYGTDEIGDPFDYWVIEIMDQV 453

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +  N++  LTTS R R   +GCYL    + LP+WGF+Q EV+C KN   RD  T WNI
Sbjct: 454 GDEDKNKLHPLTTSFRIRSKEIGCYLAQTGSSLPEWGFRQSEVACVKNPFRRDKRTWWNI 513

Query: 180 ERHWNDKLPSGGKS--YYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E + ND LP   ++  Y R+ FL DF HLN+AM  TNNAL+PD +K D LAS+  QWP +
Sbjct: 514 ETNENDILPPRPENFEYPRTGFLKDFVHLNLAMMATNNALIPDEEKFDHLASSAWQWPTL 573

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDH 297
            +GLR+C W DD VK+YLLG P   W  T +++  + T++   +R  R+         ++
Sbjct: 574 NIGLRLCGWDDDFVKYYLLGLPFSTWPSTVAVLAMMVTVVVLFLRWMRQLPVFHTNDDEN 633

Query: 298 -FLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFT---VSC--- 350
            FL  G    + W LHY+PF IM RVTY+HHY PALYF++++ A+  D      V C   
Sbjct: 634 VFLMGGLYPLLAWGLHYVPFVIMSRVTYVHHYLPALYFALIILAYYFDVLLKAHVQCVAR 693

Query: 351 -KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              K +  I+  Y+ + +  F++F  I+FG++ P S      WL  W+I D
Sbjct: 694 IPSKLRVAIYVSYFVIFLAGFYWFSPISFGMDGPNSNYAYLNWLPKWSIAD 744



>gi|45185976|ref|NP_983692.1| ACR290Wp [Ashbya gossypii ATCC 10895]
 gi|44981766|gb|AAS51516.1| ACR290Wp [Ashbya gossypii ATCC 10895]
 gi|374106899|gb|AEY95808.1| FACR290Wp [Ashbya gossypii FDAG1]
          Length = 755

 Score =  321 bits (822), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 171/410 (41%), Positives = 245/410 (59%), Gaps = 12/410 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSH+  YP GS QQQV+ Y HND NN+W+  + R    ++ N TE
Sbjct: 346 SLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETE 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            EFV +G               +H I APV+  H+EVS YG+  +GD  D W+IE +   
Sbjct: 406 HEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQP 465

Query: 121 YTKTNRI-RSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   +  +++TS R ++  +GCYL      LP+WGF+Q EV+C  N   RD  T WNI
Sbjct: 466 SDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNI 525

Query: 180 ERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E + N++LP   +   Y ++ F  DF HLN+AM  TNNALVPDPDK D LAS+  QWP +
Sbjct: 526 ETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPDKLDQLASSAWQWPTL 585

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA-QWD 296
            VG+R+CSWADDV K++L+G+P   W  TA++ +F    +YYL++ QR+      +   +
Sbjct: 586 NVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLKWQRQLVLFQASDDAN 645

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            FL  G    +GW LHYLPF +MGRVTY+HHY PALYF++L+ A++ +    + +   K+
Sbjct: 646 IFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAYVFEASLRAARQSQKS 705

Query: 357 -------IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                  +++ +YY  I+  F+YF  I  G+  P+S  K   WL TW+I 
Sbjct: 706 YWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPSSNYKHLNWLKTWSIA 755



>gi|254581354|ref|XP_002496662.1| ZYRO0D05258p [Zygosaccharomyces rouxii]
 gi|238939554|emb|CAR27729.1| ZYRO0D05258p [Zygosaccharomyces rouxii]
          Length = 750

 Score =  320 bits (820), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 168/409 (41%), Positives = 240/409 (58%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           SR+ +KN   GG LLHSHI  +P GS QQQV+CY   D NN W   +PR    YN N T+
Sbjct: 337 SRVAIKNQALGGSLLHSHIQAFPEGSNQQQVTCYGFKDANNLWQFDRPRGLPGYNENETD 396

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +EF+                  +H I AP++   +EVS YGN  +GD  D WVIEV+D  
Sbjct: 397 IEFITQDTEYRLVHISTGRNLHTHPIPAPISRQAWEVSGYGNAEIGDVKDNWVIEVMDQR 456

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             + T++I  LTTS R ++++L CYL      LP+WGF+Q EV+C K+   RD  T WN+
Sbjct: 457 GPEDTSKIHPLTTSFRIKNAVLNCYLAQTGQHLPEWGFRQSEVACVKDPFRRDKRTWWNV 516

Query: 180 ERHWNDKLPS--GGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N+ LP    G  + ++ F  DF HLN+AM  TNNAL+P+ DK D L S   QWP +
Sbjct: 517 ETHENELLPPRPEGFKFPKTNFFKDFIHLNLAMMATNNALIPENDKLDYLTSAAWQWPSL 576

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            +GLR+C W+DD ++++LLG PI  W+ TA++ IF    +  ++R QR+Y DL+ P  ++
Sbjct: 577 NIGLRLCGWSDDNIRYFLLGTPISTWASTAAVGIFAVLFVLLVLRWQRQYNDLNKPGDFN 636

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS-CKPKTK 355
            FL  G    + W  H++PF IM RVTY HHY PALYF++++ +++ D    S    KT 
Sbjct: 637 LFLIGGVFPMLAWGTHFVPFLIMSRVTYAHHYLPALYFALIVLSYIFDAGLKSWSVTKTN 696

Query: 356 NIIFGIYYSL----IVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
            ++    Y+L    ++  F+Y+  I+FG+    S+ +   WL  W I D
Sbjct: 697 QVLRLAIYALFGISVIACFFYYGPISFGMEGAISDFQYLDWLPRWYISD 745



>gi|410078638|ref|XP_003956900.1| hypothetical protein KAFR_0D01190 [Kazachstania africana CBS 2517]
 gi|372463485|emb|CCF57765.1| hypothetical protein KAFR_0D01190 [Kazachstania africana CBS 2517]
          Length = 753

 Score =  317 bits (813), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 240/409 (58%), Gaps = 11/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK--EQMY---N 56
           S L++KN   GG LLHSH+  +P GS+QQQV+CY ++D NNDW    PR   E+ Y    
Sbjct: 339 SILSIKNQALGGSLLHSHVQTFPEGSKQQQVTCYGYSDSNNDWFFDLPRALTEKGYRKEE 398

Query: 57  NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEV 116
           N T +E++                  +H + APVT   +EVSAYG+  +GD +D W+IE+
Sbjct: 399 NDTNIEYIEADGIYRLVHKNTGRNLHTHPVQAPVTKSEWEVSAYGDANIGDAHDDWLIEI 458

Query: 117 IDDLYTKT-NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFT 175
           +D   ++   R+  LT+S R +   LGCYL      LP+WGF+Q EV+C KN   RD  T
Sbjct: 459 VDQRGSENKTRLHPLTSSFRIKSVQLGCYLAQTGNHLPEWGFRQSEVACLKNPFKRDKRT 518

Query: 176 HWNIERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQ 233
            WNIE H N  LP       Y ++ FL DF HLN+AM  TNNAL+PD +K D L S+  +
Sbjct: 519 WWNIETHENSLLPPRPDDFEYPKTNFLKDFIHLNLAMMATNNALIPDSEKFDTLGSSAWE 578

Query: 234 WPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SP 292
           WP + VGLRMC W D+ +K+YLLG P   W+ T +++  + T++   +R  R+  +  S 
Sbjct: 579 WPSLHVGLRMCGWGDENIKYYLLGTPASTWASTIAVLGCMVTVVVLFLRWNRQMINFKSN 638

Query: 293 AQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC-- 350
              + F+       + W LHY+PF IM RVTY+HHY PALYF++++ A+  D F   C  
Sbjct: 639 KDLNTFMMGAFYPLLCWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYAFDAFLQLCNM 698

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           +   K +IF  Y++ +V  F+YF  I+FG+  P S+ +   WLS+W IV
Sbjct: 699 RAPIKWLIFISYFAAVVACFYYFSPISFGMVGPISDYEYLNWLSSWTIV 747



>gi|366994482|ref|XP_003677005.1| hypothetical protein NCAS_0F01660 [Naumovozyma castellii CBS 4309]
 gi|342302873|emb|CCC70650.1| hypothetical protein NCAS_0F01660 [Naumovozyma castellii CBS 4309]
          Length = 752

 Score =  316 bits (809), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 235/409 (57%), Gaps = 12/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +++KN   GG LLHSH N YP GS QQQV+ Y + D NN+W   +PR E  Y+ N T+
Sbjct: 341 SIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETD 400

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E+V                  +H + AP+++  +EVS YG+   GD  D W+IE++D  
Sbjct: 401 IEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQR 460

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++  LTTS R  +  + CYL      LP+WGFKQ EV+C +N   RD  T WNI
Sbjct: 461 GDEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNI 520

Query: 180 ERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E + ND LP     +   ++ F  DF  LN+AM  TNNALVPDP+K DILAS+  QWP +
Sbjct: 521 ETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTL 580

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
             GLR+CSW +DVVK++LLG P   W  + ++V  +  ++  LIR QR+Y DL  P   +
Sbjct: 581 YWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLN 640

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            F+       + W LHY PF IM RVTY+HHY PALYF++++ A++ D   +    KTK+
Sbjct: 641 TFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDA-GLKFLTKTKS 699

Query: 357 ------IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                 +I+   Y  ++  FWYF  I+FG+  P        W STWNI 
Sbjct: 700 TQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748



>gi|254568076|ref|XP_002491148.1| Protein O-mannosyltransferase, transfers mannose residues from
           dolichyl phosphate-D-mannose to prote [Komagataella
           pastoris GS115]
 gi|238030945|emb|CAY68868.1| Protein O-mannosyltransferase, transfers mannose residues from
           dolichyl phosphate-D-mannose to prote [Komagataella
           pastoris GS115]
 gi|328352327|emb|CCA38726.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Komagataella pastoris CBS 7435]
          Length = 750

 Score =  315 bits (808), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 172/423 (40%), Positives = 248/423 (58%), Gaps = 26/423 (6%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S++T+K+ G G GLLHSH+  YP GS QQQ++ Y H D NNDW + +  +E   N   E 
Sbjct: 329 SKVTIKSQGLGSGLLHSHVQTYPQGSSQQQITTYSHKDANNDW-VFQLTREDSRNAFKEA 387

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDLY 121
            +V +G ++            +H++AAPV++  +EVS YGNET+GD  D W++E++D  Y
Sbjct: 388 HYVVDGMSVRLVHSNTGRNLHTHQVAAPVSSSEWEVSCYGNETIGDPKDNWIVEIVDQ-Y 446

Query: 122 TKTNRIR--SLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
              +++R   LT+S R + + LGCYL  + A LPQWGF+Q EV C KN   RD  T WNI
Sbjct: 447 GDEDKLRLHPLTSSFRLKSATLGCYLGTSGASLPQWGFRQGEVVCYKNPFRRDKRTWWNI 506

Query: 180 ERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N  LP+  +++   R+ FL DF  LN+AM  TNNALVPDPDKED LAS+  +WP +
Sbjct: 507 EDHNNPDLPNPPENFVLPRTHFLKDFVQLNLAMMATNNALVPDPDKEDNLASSAWEWPTL 566

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQ--- 294
            VG+R+C W DD VK++L+G+P   W+ +  +V+F+F LL YLI+ QR+Y      Q   
Sbjct: 567 HVGIRLCGWGDDNVKYFLIGSPATTWTSSVGIVVFLFLLLIYLIKWQRQYVIFPSVQTPL 626

Query: 295 ----------------WDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLM 338
                           ++ FL  G    +GW LH+ PF IM RVTY+HHY PALYF+M++
Sbjct: 627 ESADTKTVALFDKSDSFNVFLMGGLYPLLGWGLHFAPFVIMSRVTYVHHYLPALYFAMIV 686

Query: 339 AAFMMDHFTVSCK-PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
             +++         P    +I+   YSL++  F +   + FG++ P         L +W 
Sbjct: 687 FCYLVSLLDKKLGHPALGLLIYVALYSLVIGTFIWLSPVVFGMDGPNRNYSYLNLLPSWR 746

Query: 398 IVD 400
           + D
Sbjct: 747 VSD 749



>gi|367006206|ref|XP_003687834.1| hypothetical protein TPHA_0L00440 [Tetrapisispora phaffii CBS 4417]
 gi|357526140|emb|CCE65400.1| hypothetical protein TPHA_0L00440 [Tetrapisispora phaffii CBS 4417]
          Length = 754

 Score =  313 bits (803), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 166/404 (41%), Positives = 240/404 (59%), Gaps = 9/404 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S +TLK    GG +LHSH N YP GS QQQV+ Y + D NNDW+  K R+EQ + +  + 
Sbjct: 349 SIVTLKAQTLGGAILHSHQNLYPSGSGQQQVTGYGYGDENNDWIFQKAREEQPWLDGQDT 408

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDLY 121
           EFV +G T+            SH I APVTN++ EV+ YG    GD  D W++E++  + 
Sbjct: 409 EFVKDGQTVRLVHKLTGRNLHSHAIPAPVTNIYKEVACYGTLEQGDVFDDWIVEIVSQMG 468

Query: 122 TKTNR-IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNIE 180
           ++    +  LT++ R +H+ LGCYL      LP+WGFKQ+E++C  N    D    WNIE
Sbjct: 469 SEDKTLLHPLTSTFRLKHAQLGCYLGQTGQFLPEWGFKQIEIACMSNVKLSDKRIIWNIE 528

Query: 181 RHWNDKLP--SGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
            H N+ LP  S    Y +  FL +F +LN+AM +TNNALVPD +K D ++S+  +WPI+ 
Sbjct: 529 SHINEGLPPVSEDFKYPQDSFLRNFIYLNLAMMSTNNALVPDSEKLDRISSSWWEWPILY 588

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSP-AQWDH 297
            GLR+  WADD VK+YLL  P+  W  TA+++IF+  ++   I+ QR+  +    A    
Sbjct: 589 RGLRLGGWADDNVKYYLLATPLTTWLSTAAVLIFMALVIVLAIKWQRQLDNFQDNASVSL 648

Query: 298 FLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKNI 357
           F   G    +GW LHY PF IMGRVTYLHHY PALYF++++  + ++  T++ K K   +
Sbjct: 649 FTIAGIYPMLGWGLHYTPFIIMGRVTYLHHYLPALYFALIVLTYFVE--TITSKCKNSLL 706

Query: 358 IFGIYYSL---IVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            + I Y L    +  F YF  ++FG+  P+++ +    L TWNI
Sbjct: 707 RYSISYGLSIATIACFAYFSPVSFGMEGPSTDYQYLNQLPTWNI 750



>gi|19115047|ref|NP_594135.1| protein O-mannosyltransferase Ogm2 [Schizosaccharomyces pombe
           972h-]
 gi|74638359|sp|Q9C100.1|PMT2_SCHPO RecName: Full=Dolichyl-phosphate-mannose--protein
           mannosyltransferase 2
 gi|13624764|emb|CAC36926.1| protein O-mannosyltransferase Ogm2 [Schizosaccharomyces pombe]
          Length = 739

 Score =  313 bits (801), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 163/404 (40%), Positives = 239/404 (59%), Gaps = 6/404 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS+ TLK+    G LLHSH+  YP GSEQQQV+ YHH D NN+WM + P     YN   E
Sbjct: 338 GSKFTLKSRNPTGALLHSHVQTYPEGSEQQQVTGYHHKDGNNEWMFV-PTHGVAYN-YEE 395

Query: 61  VEFVN---NGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVI 117
            + +N   NG  +            +H+I AP+    +EVS YG   +GD+ DYW++ ++
Sbjct: 396 NDPMNPILNGSVVRLIHPFTNRNLHTHKIPAPLNKRMYEVSGYGLGDVGDEKDYWIVNIL 455

Query: 118 -DDLYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTH 176
            D  +     +RSL+T  +  + ++GCYL ++++ LP WGF Q+E+ CD + +P ++ T 
Sbjct: 456 YDTAHRDAYNVRSLSTVFQLYNPVVGCYLSSSSSSLPSWGFGQIEMYCDPDPDPSNTDTQ 515

Query: 177 WNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           WN+E H N +LP G  + Y S F  DF HLN AM   NN L+PD DK D L S   QWP 
Sbjct: 516 WNVEEHINPRLPEGSINDYPSSFWSDFLHLNRAMLRANNGLIPDEDKLDALRSEAYQWPF 575

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWD 296
           +   LRMC W D+ +K+ L+GNP+ +W  T+SL++F   ++  ++  +R+    S    D
Sbjct: 576 LLATLRMCGWGDNQIKYLLVGNPVAYWFATSSLIVFALFVVGAVLAWRRRVLRWSQEACD 635

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            F Y G    +GW  +YLP+ IMGRV Y+HHY P+   S   AAF++D FT       + 
Sbjct: 636 TFHYAGIYPFLGWFFNYLPYYIMGRVLYVHHYEPSYALSTFTAAFVVDWFTKKMPKIVRV 695

Query: 357 IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           ++F   Y++I  VF YFKD+ FG++ PAS+    +WL++WN+ D
Sbjct: 696 VVFISLYAIIAGVFIYFKDVTFGMHGPASDFHRLRWLNSWNVHD 739



>gi|254574224|ref|XP_002494221.1| Protein O-mannosyltransferase, transfers mannose from dolichyl
           phosphate-D-mannose [Komagataella pastoris GS115]
 gi|238034020|emb|CAY72042.1| Protein O-mannosyltransferase, transfers mannose from dolichyl
           phosphate-D-mannose [Komagataella pastoris GS115]
 gi|328353958|emb|CCA40355.1| dolichyl-phosphate-mannose-protein mannosyltransferase
           [Komagataella pastoris CBS 7435]
          Length = 752

 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 168/419 (40%), Positives = 233/419 (55%), Gaps = 21/419 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI----LKPRKEQMYN 56
           GS LT+++ G    LLHSH + YP GS QQQV+ Y H D NN W++    L  ++ +  +
Sbjct: 335 GSELTIRSQGLSQNLLHSHGSIYPEGSNQQQVTTYGHRDNNNQWIVHYPVLSKKQVKEND 394

Query: 57  NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEV 116
           N T  E + +GDTI            SH I A V+  ++EVS YGN  + D ND WV+EV
Sbjct: 395 NSTVPEMMKDGDTIRLRHQHTGANLHSHRIQAHVSKQYYEVSCYGNAKVSDGNDEWVVEV 454

Query: 117 IDDL------YTKTNR--------IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEV 162
            + +      Y   N         +  ++TS R RH  +GCYL       P WGFKQ EV
Sbjct: 455 AEQIHSDDPKYAAANESDLKFQELLHPISTSFRLRHKRIGCYLATTGMAYPSWGFKQGEV 514

Query: 163 SCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPD 220
            C  +   RD  T WNIE H N KLP+   SY   +S F  DF  LN AM  +NNALVPD
Sbjct: 515 VCRPSWTSRDKSTWWNIEDHKNKKLPNA-TSYKAPKSYFWRDFVMLNYAMLASNNALVPD 573

Query: 221 PDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYL 280
           PDK D LAS   QWPI+ VGLRMC W+    +++L+ +P   W  TASL +F   +L  +
Sbjct: 574 PDKFDKLASQWWQWPIINVGLRMCGWSASQSRYFLMSSPFNTWLSTASLAVFCLIVLILV 633

Query: 281 IRRQRKYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAA 340
           ++ QR+  +LS  Q+   +  G V   GW LH+ PF +M RVTY+HHY PALYF+M +  
Sbjct: 634 LQWQRQRLNLSSRQYWELVIKGFVPFFGWALHFAPFIVMQRVTYVHHYVPALYFAMFLLG 693

Query: 341 FMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           F +D+ T       K +I+ ++Y+  +  F+YF  ++FG++ P       +W  +W +V
Sbjct: 694 FTVDYLTAKRNCYIKTLIYFVFYAGTIYSFYYFSPLSFGMDGPLKNYAYLQWFKSWTMV 752



>gi|259149797|emb|CAY86601.1| Pmt3p [Saccharomyces cerevisiae EC1118]
          Length = 753

 Score =  310 bits (794), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 154/409 (37%), Positives = 243/409 (59%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE- 60
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 61  -VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+++ 
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +    +  L+TS R ++S+LGCYL  +   LP+WGF+Q EV C K+ + RD  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N++LP G    Y ++ F  +F HLN AM  TNNALVP+P+K D +AS+  QWP +
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMHLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W++  +K++LLG+P   W  + ++   +  +++  ++ QR+   LS P + D
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+       + WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|349581471|dbj|GAA26629.1| K7_Pmt3p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 753

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 242/409 (59%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE- 60
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 61  -VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+++ 
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +    +  L+TS R ++S+LGCYL  +   LP+WGF+Q EV C K+ + RD  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N++LP G    Y ++ F  +F  LN AM  TNNALVP+P+K D +AS+  QWP +
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W++  +K++LLG+P   W  + ++   +  +++  ++ QR+   LS P + D
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+       + WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVEDYAYLAWLPTWQIVE 748



>gi|6324897|ref|NP_014966.1| Pmt3p [Saccharomyces cerevisiae S288c]
 gi|308153474|sp|P47190.2|PMT3_YEAST RecName: Full=Dolichyl-phosphate-mannose--protein
           mannosyltransferase 3
 gi|940852|emb|CAA62176.1| orf 06148 [Saccharomyces cerevisiae]
 gi|1420704|emb|CAA99641.1| PMT3 [Saccharomyces cerevisiae]
 gi|285815192|tpg|DAA11085.1| TPA: Pmt3p [Saccharomyces cerevisiae S288c]
 gi|392296650|gb|EIW07752.1| Pmt3p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 753

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 242/409 (59%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE- 60
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 61  -VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+++ 
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +    +  L+TS R ++S+LGCYL  +   LP+WGF+Q EV C K+ + RD  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N++LP G    Y ++ F  +F  LN AM  TNNALVP+P+K D +AS+  QWP +
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W++  +K++LLG+P   W  + ++   +  +++  ++ QR+   LS P + D
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+       + WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|256272582|gb|EEU07561.1| Pmt3p [Saccharomyces cerevisiae JAY291]
          Length = 753

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 242/409 (59%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE- 60
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 61  -VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+++ 
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +    +  L+TS R ++S+LGCYL  +   LP+WGF+Q EV C K+ + RD  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N++LP G    Y ++ F  +F  LN AM  TNNALVP+P+K D +AS+  QWP +
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W++  +K++LLG+P   W  + ++   +  +++  ++ QR+   LS P + D
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+       + WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|151945401|gb|EDN63644.1| dolichyl phosphate-D-mannose:protein O-D-mannosyltransferase
           [Saccharomyces cerevisiae YJM789]
 gi|323303015|gb|EGA56819.1| Pmt3p [Saccharomyces cerevisiae FostersB]
          Length = 753

 Score =  308 bits (788), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 242/409 (59%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE- 60
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 61  -VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+++ 
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +    +  L+TS R ++S+LGCYL  +   LP+WGF+Q EV C K+ + RD  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N++LP G    Y ++ F  +F  LN AM  TNNALVP+P+K D +AS+  QWP +
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W++  +K++LLG+P   W  + ++   +  +++  ++ QR+   LS P + D
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+       + WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|323346365|gb|EGA80654.1| Pmt3p [Saccharomyces cerevisiae Lalvin QA23]
 gi|365762978|gb|EHN04510.1| Pmt3p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 753

 Score =  307 bits (786), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 242/409 (59%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE- 60
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 61  -VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+++ 
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +    +  L+TS R ++S+LGCYL  +   LP+WGF+Q EV C K+ + RD  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N++LP G    Y ++ F  +F  LN AM  TNNALVP+P+K D +AS+  QWP +
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMXLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W++  +K++LLG+P   W  + ++   +  +++  ++ QR+   LS P + D
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+       + WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|156837076|ref|XP_001642573.1| hypothetical protein Kpol_316p8 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156113118|gb|EDO14715.1| hypothetical protein Kpol_316p8 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 388

 Score =  306 bits (784), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 160/384 (41%), Positives = 232/384 (60%), Gaps = 8/384 (2%)

Query: 23  YPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---NITEVEFVNNGDTIXXXXXXXXX 79
           YP GS QQQ++ Y + D NN+W   K R+   YN     +E+EFV +G T          
Sbjct: 1   YPEGSNQQQITGYGYQDDNNNWYFDKVREFPSYNFENPSSEIEFVEDGATYRLVHLLSGK 60

Query: 80  XXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDLYTK-TNRIRSLTTSMRFRH 138
              SH+I APVT + +EV+ YG    GD  DYWV+E+ + + ++   RI  LTTS R RH
Sbjct: 61  NLHSHQIPAPVTKLDYEVAGYGQLDQGDHFDYWVLEIAEQVGSENATRIHPLTTSFRLRH 120

Query: 139 SLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--R 196
             LGCYL  +   LP+WGF+Q+E++C KN + +D    WN+E H ND+LP   + +   R
Sbjct: 121 KELGCYLAQSGQHLPEWGFRQLEMTCMKNVSKKDKRILWNVESHSNDQLPPVPEDFKFPR 180

Query: 197 SKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLL 256
            +FL +F HLN+AM  TNNAL+PDP+K D ++S+  +WP +  GLR+  W+D+  K+YLL
Sbjct: 181 PRFLTNFIHLNLAMMATNNALIPDPEKHDHISSSWWEWPTLYTGLRLGGWSDEFAKYYLL 240

Query: 257 GNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWDHFLYVGKVCGIGWLLHYLP 315
           G PI  W+ T +++ F+ T +   IR QR+Y+DL      ++F+  G    +GW LHY P
Sbjct: 241 GTPITTWASTLAVLAFMLTFVILAIRWQRQYEDLQDKTSRNNFIIGGIYPMLGWGLHYTP 300

Query: 316 FCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCK-PKTKNIIFGIYYSLIVIVFWYFK 374
           F IMGRVTYLHHY PALYF++L+  + ++  T   K  K + I++ I  + ++  F  F 
Sbjct: 301 FIIMGRVTYLHHYLPALYFALLVLTYFIETGTSYIKNQKVRWILYIIMMASVIGCFALFS 360

Query: 375 DIAFGINYPASELKSRKWLSTWNI 398
            I+FG+  P+   K   WL TW +
Sbjct: 361 PISFGMVGPSENFKYLDWLPTWKV 384



>gi|633652|emb|CAA58728.1| PMT3 [Saccharomyces cerevisiae]
          Length = 753

 Score =  306 bits (783), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 152/409 (37%), Positives = 242/409 (59%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAHNK 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+++ 
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +    +  L+TS R ++S+LGCYL  +   LP+WGF+Q EV C K+ + RD  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N++LP G    Y ++ F  +F  LN AM  TNNALVP+P+K + +AS+  QWP +
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFNGIASSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W++  +K++LLG+P   W  + ++   +  +++  ++ QR+   LS P + D
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+       + WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748



>gi|367004348|ref|XP_003686907.1| hypothetical protein TPHA_0H02700 [Tetrapisispora phaffii CBS 4417]
 gi|357525209|emb|CCE64473.1| hypothetical protein TPHA_0H02700 [Tetrapisispora phaffii CBS 4417]
          Length = 760

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 157/408 (38%), Positives = 246/408 (60%), Gaps = 12/408 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S ++++N   GG LLHSH   YP GS+QQQ++ Y H D NN+++  + R++ +Y+ N T+
Sbjct: 348 STISIRNQALGGALLHSHQQLYPVGSKQQQITGYGHKDANNEFIFHRIREKPLYSTNETD 407

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           +E++ +G+T             +H++AAP++   +EVS YG+   GD  D W++E+++ L
Sbjct: 408 IEYIKDGETYRLIHRLTNKNLHTHQVAAPISKTEWEVSGYGDLEGGDSKDNWIVEIVNQL 467

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +   ++ +LTTS R ++++LGCYL   +   P+WGF Q E++C ++   RD  T WNI
Sbjct: 468 GDEDKTKLHTLTTSFRLKNAVLGCYLAQTSNRYPEWGFSQSEIACLRSPFKRDKRTWWNI 527

Query: 180 ERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N+KLP+  +++   R+ F  DF +LN+AM  TNNALV DPDK D LAS+  +WP +
Sbjct: 528 ETHVNEKLPNIDENFEFPRASFFKDFIYLNLAMMATNNALVTDPDKLDRLASSAWEWPTL 587

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
             GLR+  W D+ VK+YL+G P   W+ T ++  F+  ++   +R  R+Y D     + D
Sbjct: 588 HKGLRLNGWHDENVKYYLMGTPASTWASTLAVFSFMVLVIVLFLRWLRQYNDYKDEKKLD 647

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            FL  G     GW LH+ PF IM RVTY+HHY PALYF++++  +  +  T    PKTK+
Sbjct: 648 LFLMSGVYPMFGWGLHFCPFVIMARVTYVHHYLPALYFALVVLVYFFEAGT-QLLPKTKS 706

Query: 357 ------IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
                  I+ +Y  L++  F  F  I+FG+   +++ K   WL  WNI
Sbjct: 707 GQMLRIGIYTVYILLVIGCFCCFAPISFGMEGKSTDYKYLAWLPEWNI 754



>gi|323307268|gb|EGA60549.1| Pmt3p [Saccharomyces cerevisiae FostersO]
          Length = 753

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 152/409 (37%), Positives = 241/409 (58%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE- 60
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +    
Sbjct: 340 SIISIKNQALGGALLHSHVQSFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENK 399

Query: 61  -VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            +EFV  G+              +HE+ A ++   +EVSAYG+  LGD  D W+IE+++ 
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPASISKSEYEVSAYGDVDLGDYKDNWIIEIVEQ 459

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +    +  L+TS R ++S+LGCYL  +   LP+WGF+Q EV C K+ + RD  T WN
Sbjct: 460 VGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N++LP G    Y ++ F  +F  LN AM  TNNALVP+P+K D +AS+  QWP +
Sbjct: 520 IETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQWD 296
            VG+R+C W++  +K++LLG+P   W  + ++   +  +++  ++ QR+   LS P + D
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F+       + WLLHY+PF +M RV Y HHY P LYF++++ ++  D  T   + +   
Sbjct: 640 VFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRNTG 699

Query: 355 KNIIFG---IYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K +  G   +Y S+++  F+YF   +FG++ P  +     WL TW IV+
Sbjct: 700 KFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVEDYAYLAWLPTWQIVE 748



>gi|365758212|gb|EHN00065.1| Pmt3p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 753

 Score =  303 bits (777), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 154/409 (37%), Positives = 239/409 (58%), Gaps = 10/409 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GS QQQV+ Y ++D NN+W   + R  + + +   +
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSGQQQVTGYGYSDANNEWFFQRIRGVEPWTDAENS 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
             EFV  G+T             +HE+ APV+   +EVSAYG+  +GD  D W+IE+++ 
Sbjct: 400 TFEFVKGGETYRLMHRLTGKNLHTHEVPAPVSKSEYEVSAYGDVDVGDHKDNWIIEIVEQ 459

Query: 120 LYTKTNRI-RSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +  ++   L+TS R R+S+LGCYL  +   LP+WGF+Q E+ C K+ + RD  T WN
Sbjct: 460 VGKEDPKLLHPLSTSFRIRNSMLGCYLAQSGKRLPEWGFRQGEMICLKHASKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N+ LP      Y ++ FL +F  LN AM  TNNALVP+P+K D +AS+  QWP +
Sbjct: 520 IETHENEGLPEADDFVYPKASFLRNFIQLNSAMMATNNALVPNPEKVDGIASSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VG+R+C W++  VK++LLG+P   W  + ++   +  +++ +++ QR+   L  PA+ D
Sbjct: 580 NVGVRLCEWSEKSVKYFLLGSPASVWPSSIAVCALIIHVIFLILKWQRQCVVLPEPAERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV--SCKPKT 354
            F        + W+LHYLPF IM RV Y HHY P L+F++++ ++  D  T   + +   
Sbjct: 640 EFFMAAFYPLLAWVLHYLPFVIMSRVVYAHHYLPTLFFALMILSYYFDLITKRWASRNTG 699

Query: 355 KNIIFGIYY---SLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K + F  Y    SL++  F+YF   +FG+  P  +     WL TW I +
Sbjct: 700 KLLRFSAYIAYGSLVIAGFFYFSPFSFGMEGPIEDYSYLGWLPTWKIAE 748



>gi|403215726|emb|CCK70225.1| hypothetical protein KNAG_0D04860 [Kazachstania naganishii CBS
           8797]
          Length = 754

 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 243/408 (59%), Gaps = 12/408 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NITE 60
           S +T KN   GG LLHSH+  YP GS QQQV+ Y +ND NN W   + R+   ++ N TE
Sbjct: 346 SFVTFKNQALGGQLLHSHVQLYPEGSGQQQVTGYGYNDSNNVWYFDRVRESTPWSRNETE 405

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
           VE V  G+              SHE+ A V++  +EVS YG++T+GD  DYWV+E ++  
Sbjct: 406 VELVTVGEQYRIVHNLTHRNLHSHEVHAAVSSTEWEVSGYGDDTIGDFKDYWVLEFMNQP 465

Query: 121 YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
             K N+  +  LTTS R +++ + CYL   N   P+WGF+Q+E++C +N   +D  T WN
Sbjct: 466 -GKENKTVLHPLTTSFRIKNTYMNCYLAQTNEHYPEWGFRQMEIACLRNPFKKDKRTWWN 524

Query: 179 IERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           +E + +++LP    ++    + F  DF  LN+AM  +NNAL+P+ DK D+LAS+  QWP 
Sbjct: 525 VETNEDERLPDRPDNFRFPGTNFFKDFVRLNLAMMASNNALIPEEDKLDVLASSAWQWPT 584

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQW 295
           + +GLR+CSW D  +K++LLG P+  W+ + ++V     +   ++R QR+YK L S    
Sbjct: 585 LYLGLRICSWGDQYIKYFLLGTPVSTWASSLAVVGLCVAIAVLVLRWQRQYKSLKSERSL 644

Query: 296 DHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAF----MMDHFTVSCK 351
           + FL  G    + W LHY PF IM RVTY+HHY PALYF++++ A+     MD    S  
Sbjct: 645 NLFLMGGLYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYSLQVAMDRLNRSTL 704

Query: 352 PKT-KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            +T    +F +  + +V+ F +F  ++FG+  PA +    KW+STW+I
Sbjct: 705 GRTMAKALFLLASASVVLCFIHFSPMSFGMEGPARDYSYLKWVSTWDI 752



>gi|367014887|ref|XP_003681943.1| hypothetical protein TDEL_0E04890 [Torulaspora delbrueckii]
 gi|359749604|emb|CCE92732.1| hypothetical protein TDEL_0E04890 [Torulaspora delbrueckii]
          Length = 733

 Score =  301 bits (770), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 161/413 (38%), Positives = 232/413 (56%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM---YNN 57
           GS +T+++ G    LLHSH+  YPGGS Q+QV+ Y   D NN W I  PR       +NN
Sbjct: 320 GSDVTIRSHGLSPNLLHSHVQTYPGGSNQKQVTGYGFADGNNIWQIKFPRSSANQLDFNN 379

Query: 58  IT--EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
               ++  V +GD I            SHEIAA V+   +EVS YG+E +GD  D W+IE
Sbjct: 380 TLNGQILTVRDGDEIRLQHKETKTNLHSHEIAAHVSRGCYEVSGYGSEEIGDGKDDWIIE 439

Query: 116 VIDDLYTKT--------NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           +++   +            +  ++T  R RH  LGCYL +     P WGFKQ E+ C  +
Sbjct: 440 IVEQRKSSNPEFPTEDQTTLHPVSTFFRLRHKELGCYLTSTGLSYPPWGFKQAEIVCKYS 499

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDI 226
            +  D  T WN+E HWND L S       +SKF  DF  +N AM ++NNAL+PD DK D 
Sbjct: 500 WSKMDKSTWWNVEEHWNDHLESSPNYLPPKSKFWTDFVLINFAMASSNNALIPDEDKYDN 559

Query: 227 LASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRK 286
           LAS   +WP +  GLRMCSW+ D+ ++YLLG+P   W  TASLV+F+F L+  L + +R+
Sbjct: 560 LASKAWEWPTLHTGLRMCSWSRDLYRYYLLGSPFNTWLSTASLVLFIFILIKLLFQWRRQ 619

Query: 287 YKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
             +++  Q+ +    G    I WL HYLPF  MGRVTY+HHY PALYF+ML+  F++++ 
Sbjct: 620 SVNITEDQFWNLAIQGGFPFIAWLAHYLPFVTMGRVTYVHHYVPALYFAMLVCGFVLEYC 679

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
             + K   +  ++ + ++     + YF  +  G++ P       +WL  W+IV
Sbjct: 680 FKNTKSYVRYSVYALLFAGCTYTYIYFSPLCQGMHGPGVRYSKLQWLPGWDIV 732



>gi|344305369|gb|EGW35601.1| hypothetical protein SPAPADRAFT_131790 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 777

 Score =  300 bits (767), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 162/425 (38%), Positives = 228/425 (53%), Gaps = 27/425 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI----------LKPR 50
           GS +TL++ G    LLHSH + YP G ++QQV+ Y + D NN ++I           +  
Sbjct: 353 GSFVTLRSQGLSQNLLHSHPHNYPEGLQEQQVTTYAYKDENNVFLIEFDINAAISGKRAL 412

Query: 51  KEQMYNNITEVE-------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNE 103
            E   NN TE E        + NGD I            ++ I A V   HFEVS +G  
Sbjct: 413 PETSGNNGTETETTIESQQLLQNGDAIRLFHNSTGRYMHANAIPAAVAKTHFEVSCFGTI 472

Query: 104 TLGDDNDYWVIEVIDDLYTKTN--------RIRSLTTSMRFRHSLLGCYLRAANAILPQW 155
              +  D W++E+     + +          +  ++T+ R R+  LGCYL       P W
Sbjct: 473 DTTEIKDEWILEIQTQEESPSQFFANESGHELHPISTNFRLRNKELGCYLATTGYAYPSW 532

Query: 156 GFKQVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTT 213
           GF Q EV C  +   RD  T WN+E H NDKLP   ++Y   + KF  +F  LN AM T+
Sbjct: 533 GFSQGEVVCKYSYFNRDKSTWWNVEEHVNDKLPLPSETYVPPKPKFWREFVLLNFAMMTS 592

Query: 214 NNALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFV 273
           NNAL+PDPD+ D L+S   +WPI++ GLRMCSW  D +KF+L+GNP + W  + SL++F+
Sbjct: 593 NNALIPDPDRFDKLSSEWWEWPILKTGLRMCSWGADDIKFFLIGNPFVTWFSSLSLILFL 652

Query: 274 FTLLYYLIRRQRKYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALY 333
           F LL    + QR+        W+  L  G +  IGW LHY PF IMGRVTYLHHY PALY
Sbjct: 653 FYLLSVGFKYQRQTVRYEVDSWESLLSQGILPFIGWFLHYFPFIIMGRVTYLHHYVPALY 712

Query: 334 FSMLMAAFMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWL 393
           F++    F++D F      K   +I+G+ Y  ++  FWY + +AFG+   + + K  K L
Sbjct: 713 FAIFTMGFVVDRFATVVPKKISYVIYGLLYIAVIGSFWYLRVLAFGMEQSSKQYKHLKIL 772

Query: 394 STWNI 398
            +W I
Sbjct: 773 DSWMI 777



>gi|406606320|emb|CCH42311.1| dolichyl-phosphate-mannose-proteinmannosyltransferase
           [Wickerhamomyces ciferrii]
          Length = 755

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 160/411 (38%), Positives = 235/411 (57%), Gaps = 13/411 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK--EQMYNNI 58
           GS +T+++ G    LLHSH+  YP GS QQQ++ Y H+D NN+W+    R+  E +  N 
Sbjct: 346 GSEVTIRSQGSSPNLLHSHVQIYPDGSNQQQITGYGHSDGNNNWVFKYSRRSNETLDENS 405

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
            ++  V +GD +            SH I A V+  H+EV  YGNE +GD  D WV+E+++
Sbjct: 406 DDLVKVQDGDVVRLVHKWTGVNLHSHTIPAHVSKKHWEVGGYGNEKIGDSKDDWVVEIVE 465

Query: 119 DLYTKTNR---------IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNN 169
            L T  N+         +  L+T+ R RH+ LGCYL    A  P WGFKQ EV C  +  
Sbjct: 466 QL-TSANKSFPKEDKSILHPLSTNFRLRHADLGCYLSMTGAAYPAWGFKQSEVVCKDSWT 524

Query: 170 PRDSFTHWNIERHWNDKLP-SGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILA 228
            RD  T WN+E H + KL    G    +S F  DF  +N AM ++NNALVPD DK D LA
Sbjct: 525 WRDKSTWWNVEDHMHKKLEIDDGFIAPKSNFWSDFIQINFAMASSNNALVPDYDKFDHLA 584

Query: 229 STPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYK 288
           S   +WP + VGLRMC W  + V+++L+GNP   W  T SL IF++ +L Y+I+ QR+  
Sbjct: 585 SKAWEWPTLHVGLRMCGWGTNDVRYFLIGNPFNTWLSTISLPIFIYLVLLYVIKYQRQTL 644

Query: 289 DLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV 348
           + +   +  F+  G    IGWLLH+ PF IMGRVTY+HHY PALYF++ +  F+++H   
Sbjct: 645 EWNDEDYWKFIVGGVYPFIGWLLHFAPFAIMGRVTYVHHYVPALYFAIYVFGFLVEHAVG 704

Query: 349 SCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
             K   K  ++ + +  ++  +++F     G+  P ++ K  + L +W +V
Sbjct: 705 KTKLFVKIPVYSLLFGTLIFTYFHFAPFYDGMTGPHNDFKYLEILPSWKVV 755



>gi|384496594|gb|EIE87085.1| hypothetical protein RO3G_11796 [Rhizopus delemar RA 99-880]
          Length = 524

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 148/329 (44%), Positives = 212/329 (64%), Gaps = 15/329 (4%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK---EQMYN- 56
           GS +T+K+ G+ GGLLHSH + YP GS+QQQ++CY   D+NN W +  PR    E   N 
Sbjct: 173 GSNITIKSFGYSGGLLHSHPHYYPDGSKQQQITCYSFKDVNNIWQVRFPRSVGDEGQPNP 232

Query: 57  --NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
             N T +++V +GD I            SH I AP+++ ++EVS YG++ +GD  D W I
Sbjct: 233 KVNNTFIKYVKDGDIIRLFHLYTMRNLHSHPINAPISSKNWEVSGYGDDEIGDVQDNWRI 292

Query: 115 EVIDDLYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDS 173
           E++ D+  + T  +R+LTT  R RH  L C L + +  LP+WG+KQ EV C ++++  DS
Sbjct: 293 EIVKDVNERNTKHVRALTTLFRLRHVYLNCLLASRHETLPEWGYKQQEVYCSRDDDLEDS 352

Query: 174 FTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQ 233
            T W+IE H N+KLP    + Y+S F  +F HLN+ M+ +NNAL+PDPDK+DILAS P +
Sbjct: 353 STFWSIEEHHNEKLPPAPDNAYKSSFFQNFAHLNIVMWYSNNALIPDPDKDDILASKPTE 412

Query: 234 WPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA 293
           WP+V VGLRMCSW ++ +KFYL+GNP +WW   AS+V F   ++ Y IR +R+  D+SPA
Sbjct: 413 WPMVSVGLRMCSWDNENIKFYLMGNPSVWWPSFASIVTFSLLIIIYTIRLKRQVIDMSPA 472

Query: 294 QWDHFLYVGKVCGIGWL------LHYLPF 316
           +W +F  V  V GI ++      LH+ PF
Sbjct: 473 RWMYFTSV--VYGIIFIVMALNFLHFAPF 499



>gi|320582731|gb|EFW96948.1| Protein O-mannosyltransferase [Ogataea parapolymorpha DL-1]
          Length = 733

 Score =  295 bits (755), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 167/413 (40%), Positives = 234/413 (56%), Gaps = 22/413 (5%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S++T+++ G    LLHSH ++YP GSEQ QV+ Y   D NN++++   R ++ Y      
Sbjct: 327 SKITIRSQGKSPNLLHSHPSKYPAGSEQHQVTTYGFKDANNNFIVRPARTQRNYG----- 381

Query: 62  EFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDLY 121
            F+ NGD I            SH I A V+  ++EVS YG+ET+GD  D WV+E+++ L+
Sbjct: 382 PFIQNGDAIRLQHELTKANLHSHAIHAHVSERYWEVSGYGDETVGDAKDDWVVEIVEQLH 441

Query: 122 TKT-------------NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNN 168
           +               + +  LTT+ + RH +LGCYL       P WGFKQ EV C  + 
Sbjct: 442 SGNKSYAATENGPDFYSTVHPLTTTFKLRHKVLGCYLATTGESYPTWGFKQGEVVCRPDT 501

Query: 169 N-PRDSFTHWNIERHWNDKLPSGGKSYYRS-KFLHDFWHLNVAMYTTNNALVPDPDKEDI 226
             P D  T WN+E H ND L       Y S +FL DF+ +   M  +NNALVPD  K D 
Sbjct: 502 RLPFDRSTLWNVEMHENDDLAVESDYVYPSPRFLVDFFMVQHGMLASNNALVPDVHKHDE 561

Query: 227 LASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRK 286
           +AS   QWP   VGLRMCSW   V K+YLL +P   W  TA L +FV   +  L+  QR+
Sbjct: 562 IASFWWQWPFALVGLRMCSWGPHVTKYYLLSHPFTTWFSTACLGVFVLLAVRLLLLWQRQ 621

Query: 287 YKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
              +S  Q   F   G V  +GWLLHYLPF +MGRVTY+HHY PALYF+M +A F++++ 
Sbjct: 622 QLAVSADQLWKFTICGLVPFVGWLLHYLPFIVMGRVTYVHHYMPALYFAMYVAGFVVEYV 681

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           T S   + + +++G+ Y+L+  +FWYF  +  G++  AS+     WL  WNI 
Sbjct: 682 TGSS--RIRYVVYGVLYALVGYLFWYFSPLCLGMSGRASDYAYLNWLPGWNIA 732



>gi|401623527|gb|EJS41624.1| pmt3p [Saccharomyces arboricola H-6]
          Length = 753

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 151/408 (37%), Positives = 228/408 (55%), Gaps = 10/408 (2%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI--T 59
           S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + +      
Sbjct: 340 SIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGAEPWTEAENA 399

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
            +E+V  G               +HEI AP++   +EVSAYG+  LGD  D W+IE+ + 
Sbjct: 400 TLEYVKGGQMYRLMHRLTGKNLHTHEIPAPISKSEYEVSAYGDVKLGDIKDNWIIEITEQ 459

Query: 120 LYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           +  +    +  L+TS R R+S+LGCYL  +   LP WGF+Q EV+C K+ + RD  T WN
Sbjct: 460 VGNEDPTLLHPLSTSFRIRNSILGCYLAQSGKHLPDWGFRQGEVACLKHVSKRDKRTWWN 519

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           IE H N+ LP      Y +  F  +F  LN+AM  TNNALVP+P+K D + S+  QWP +
Sbjct: 520 IETHDNELLPQANDFVYPKLSFFRNFVQLNIAMMATNNALVPNPEKFDGITSSAWQWPTL 579

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL-SPAQWD 296
            VG+R+C W++  +K++LLG+P   W  + ++   +  +++ +++ QR+   L  P + D
Sbjct: 580 NVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVVFLILKWQRQCVILPDPVERD 639

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            F          W LH+LPF IM RV Y HHY P LYF++++  +  D  T     +   
Sbjct: 640 EFSMAACYPLFAWGLHFLPFLIMSRVVYAHHYLPTLYFALMILTYYFDIITKRWASRNAG 699

Query: 357 IIFGI-----YYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            +  I     Y SL++  F+YF   +FG++ P  +     WL TW IV
Sbjct: 700 KLLRISAYVAYGSLVIAGFFYFSPFSFGMDGPVEDYAYLAWLPTWQIV 747



>gi|255711158|ref|XP_002551862.1| KLTH0B01650p [Lachancea thermotolerans]
 gi|238933240|emb|CAR21424.1| KLTH0B01650p [Lachancea thermotolerans CBS 6340]
          Length = 754

 Score =  290 bits (743), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 161/416 (38%), Positives = 231/416 (55%), Gaps = 21/416 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQM-YNNIT 59
           GS LT+++ G    LLHSH+  YP GS Q QV+ Y H+D NN W++   R+  +  +N T
Sbjct: 342 GSELTIRSHGLSPNLLHSHVQLYPLGSGQHQVTGYGHSDDNNRWVVKFSRESGLSLDNST 401

Query: 60  EVE----FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
            ++     + +   I            SHEI A V+   +EVS YG+E +GD  D WV+E
Sbjct: 402 ILDSKHLLLRDNSEIRLVHKNTQANLHSHEIPAHVSKNSYEVSGYGDEVIGDTKDDWVVE 461

Query: 116 VIDDLYTKTNRI--------RSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           +++ L +  + +          ++TS R RH  LGCYL       P WGFKQ E+ C  +
Sbjct: 462 IVEQLDSSNSSLPQEDPSVLHPISTSFRLRHKELGCYLATTGLAYPAWGFKQAEIVCKHS 521

Query: 168 NNPRDSFTHWNIERHWNDKLP-SGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDI 226
              RD  T WN+E HWN  +  + G    +SKF  DF  +N AM ++NNALVPD DK D 
Sbjct: 522 WTKRDKSTWWNVEDHWNPAMEKTEGYIPPKSKFWADFVLINFAMASSNNALVPDEDKYDS 581

Query: 227 LASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRK 286
           LAS   +WPI+ VGLRMC W    VK++L+G+P   W  T SLV FVF +L    + +R+
Sbjct: 582 LASEAWEWPILHVGLRMCGWGHHTVKYFLMGSPFQTWLSTGSLVAFVFIILRLAYKWRRQ 641

Query: 287 YKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
              ++          G +  + WLLHYLPF  MGRVTY+HHY PALYF++L+  F+++  
Sbjct: 642 SVLVTSDFLSKVGMQGILPFLAWLLHYLPFVAMGRVTYVHHYVPALYFALLVLGFVLE-- 699

Query: 347 TVSCKPKT---KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
             +C PK      II+ + Y+  + ++  F  IA G+   A + +  +W +TWNI 
Sbjct: 700 --TCVPKRFYLNYIIYALLYAGCIYIYNLFSPIAQGMQGSAIDFRYLQWFNTWNIA 753



>gi|366996587|ref|XP_003678056.1| hypothetical protein NCAS_0I00420 [Naumovozyma castellii CBS 4309]
 gi|342303927|emb|CCC71710.1| hypothetical protein NCAS_0I00420 [Naumovozyma castellii CBS 4309]
          Length = 769

 Score =  290 bits (743), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 158/414 (38%), Positives = 237/414 (57%), Gaps = 17/414 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPR--KEQMYNNIT 59
           S +++KN   GG LLHSH+  +P GS QQQV+ Y +ND NN W   + R    Q ++N T
Sbjct: 355 SFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNET 414

Query: 60  E--VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYG-NETLGDDNDYWVIEV 116
           E  +E+V  G+              + +I APV+   +EV+ +G    +GDD D W+IEV
Sbjct: 415 ETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEV 474

Query: 117 IDDLYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFT 175
           I+    +  + I  LTT+   +H++LGCYL      LP+WGF+Q E++C    +  D  T
Sbjct: 475 IEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRT 534

Query: 176 HWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQ 233
            WN+E H N+KLP    S++  ++ F  DF  LN  M  TNNALVPD DK D LAS   Q
Sbjct: 535 WWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQ 594

Query: 234 WPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA 293
           WP + VGLR+C W DD VK++LLG+P   W  T S+++ +  ++    R QR+  + +  
Sbjct: 595 WPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFAND 654

Query: 294 QWDHFLYVGKVCG-IGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKP 352
           +  +   +G     + W LH++PF IM RVTY+HHY PALYF++L+ A+  +   +  +P
Sbjct: 655 KALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHYLPALYFALLVLAYFFE--AIIRRP 712

Query: 353 K------TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           K         I   +Y+++++  F+YF  I+FG++ P+   +   WLS W I D
Sbjct: 713 KGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKISD 766



>gi|255721445|ref|XP_002545657.1| hypothetical protein CTRG_00438 [Candida tropicalis MYA-3404]
 gi|240136146|gb|EER35699.1| hypothetical protein CTRG_00438 [Candida tropicalis MYA-3404]
          Length = 766

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 157/418 (37%), Positives = 228/418 (54%), Gaps = 28/418 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    LLHSH ++YPGGS++QQV+ Y   D NND++I     E + +    
Sbjct: 357 GSLVTMRSQGLSPNLLHSHDHKYPGGSQEQQVTTYGFKDENNDFLIEFDVSEGLKDKHAT 416

Query: 61  VEFVN----------NGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDND 110
           +E  N          NG TI            ++ I AP+T+ +FEVS  G     D  D
Sbjct: 417 LENENGVDYYSIPVPNGATIRINHKKTGCYLRANSITAPITSSNFEVSCSGEVESNDYAD 476

Query: 111 YWVIEVIDDLYTKTNRIRS--------LTTSMRFRHSLLGCYLRAANAILPQWGFKQVEV 162
            W++E+     + + +  S        ++T+ R +H  LGCYL       P WG+ Q EV
Sbjct: 477 EWILEIQTQEQSPSEKFHSEDANVLHPISTNFRLKHKQLGCYLATTGKSYPSWGYGQGEV 536

Query: 163 SCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPD 220
           +C  +   RD  T WN+E+H NDKLP+  + Y   + KF  +F  LN  M   N AL+PD
Sbjct: 537 ACKFSFFSRDKNTWWNVEKHVNDKLPTPNEKYVPPKPKFWKEFVLLNYGMMAANGALIPD 596

Query: 221 PDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYL 280
           PDK D L+S   +WP++  GLRMC W  D +K++LLGNP+I W  TA + +F+       
Sbjct: 597 PDKFDKLSSEWWEWPVLHTGLRMCGWGADDIKYFLLGNPLITWLSTAGVALFLVYTFVQG 656

Query: 281 IRRQRKYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAA 340
            R QR+    S A+       G +  +GWL HY+PF  MGRV YLHHY PA YF++ +  
Sbjct: 657 FRYQRQVTSNSLAE-------GGLLFLGWLFHYVPFIFMGRVKYLHHYLPAHYFAIFLFG 709

Query: 341 FMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           F++D  T+S     +  I+ ++Y  I+  FWYFKD++FG+  P+S  K  K L +W I
Sbjct: 710 FVVDK-TISKNIGVRWTIYSLFYIAILASFWYFKDLSFGMEGPSSNYKHLKLLGSWMI 766



>gi|50287155|ref|XP_446007.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525314|emb|CAG58931.1| unnamed protein product [Candida glabrata]
          Length = 734

 Score =  286 bits (733), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 157/408 (38%), Positives = 230/408 (56%), Gaps = 9/408 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN-NIT 59
           GS +TL+NM   G  LHSH   YP GS+Q+QV+CY++ D NNDW++ +P  + +++ N T
Sbjct: 327 GSTITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVNDT 386

Query: 60  EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVI-D 118
           E E + NGDTI            SH++ AP+  + +EVS YGN T+GD  D+WV+E+I D
Sbjct: 387 EHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIKD 446

Query: 119 DLYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
           D     N I  +TT +RFRH++L CYL  +N  LP+WGF Q EV C +     D  T W 
Sbjct: 447 DGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMWI 506

Query: 179 IERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           ++ H +  L +     Y R  F  DF+ LN  M  TNNAL    DK D L S   +WP +
Sbjct: 507 VDTHTHPNLEAPENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTL 566

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQWDH 297
              LR+ SW ++  ++ LLG+P   W  T +++  VF LLY +++  R+ +       + 
Sbjct: 567 YRSLRINSWNENDTRYLLLGSPASTWPSTVAVLFLVFALLYKVLKWNRQMQIFQNEHDEE 626

Query: 298 -FLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH-FTVSCKPKTK 355
            F+Y G    +GW LH+ PF IMGRV Y+HHY PALYF++ + A++ D       K KT+
Sbjct: 627 LFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKTKTQ 686

Query: 356 NI----IFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            I    I+  Y S+++  F  F   ++G+       K   W+  W++V
Sbjct: 687 RIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENYKHLNWMKNWDVV 734



>gi|365982845|ref|XP_003668256.1| hypothetical protein NDAI_0A08600 [Naumovozyma dairenensis CBS 421]
 gi|343767022|emb|CCD23013.1| hypothetical protein NDAI_0A08600 [Naumovozyma dairenensis CBS 421]
          Length = 788

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 161/414 (38%), Positives = 229/414 (55%), Gaps = 15/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-- 58
            S +++KN   GG LLHSH+  YP GS  QQV+CY ++D NNDW     R    YN    
Sbjct: 374 SSTVSIKNQALGGALLHSHVQTYPEGSNLQQVTCYSYSDSNNDWFFDNIRSRTPYNESDP 433

Query: 59  -TEVEFVN-NGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSA--YGNETLGDDNDYWVI 114
              +EF+  N                S  + A V+    EV+   YG E  GD+ D W+I
Sbjct: 434 NQPLEFIEPNKPYRLVHKQTRKNLHVSPNVHAHVSKNDLEVAGNGYGFEQ-GDNGDNWII 492

Query: 115 EVIDDLYTK---TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           E+ID   +K   T++I  LTT+ R ++ +  CYL      LP WG++Q EV+C K  +  
Sbjct: 493 EIIDQKSSKSENTSQIHPLTTTFRIKNIVSDCYLIQTEHNLPDWGYRQSEVTCSKKVSKT 552

Query: 172 DSFTHWNIERHWNDKLPSGGKS---YYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILA 228
           D   +WN+E H N  LP+  +    Y ++ FL DF +LN  M  TNNALVPD DK D LA
Sbjct: 553 DLRAYWNVETHENANLPTPTEDEFHYPKTNFLSDFIYLNKIMMRTNNALVPDYDKYDSLA 612

Query: 229 STPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYK 288
           S   QWP + VGLR+C W DD V+++LLG+P   W  T ++V+ +  ++ ++ R QR+  
Sbjct: 613 SDAWQWPTLNVGLRLCGWGDDQVRYFLLGSPFSTWPSTITVVMLMILIVIFIFRWQRQLH 672

Query: 289 DLS-PAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFT 347
           + +     D F+       +GW LHY+PF IM RVTY+HHY PALYF++++ A+  D   
Sbjct: 673 NFANETAMDTFMMGAFYPLLGWGLHYMPFVIMARVTYVHHYLPALYFALIILAYFFDAML 732

Query: 348 VSCKPK-TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              +       IF IY+  ++  F YF  I+FG+  P S+ K   WLSTW I++
Sbjct: 733 KRFRFNWLVMSIFTIYFVAMIAGFVYFSPISFGMTGPVSDYKYLNWLSTWKIIN 786



>gi|50312059|ref|XP_456061.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645197|emb|CAG98769.1| KLLA0F21978p [Kluyveromyces lactis]
          Length = 757

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 160/415 (38%), Positives = 232/415 (55%), Gaps = 18/415 (4%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPR-------KEQ 53
           GS ++L++ G   GLLHSH   YP GS Q+QV+ Y + D NN+W++   R       +E+
Sbjct: 342 GSCISLRSHGLSPGLLHSHPQTYPDGSNQRQVTGYSYRDGNNNWIVKYSRSSGKASAEER 401

Query: 54  MYNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWV 113
           +Y++   + F+ +GD +            +H+I + V+  H+EVS YGN+ +GD  D W+
Sbjct: 402 VYSD--NILFLKDGDLLRLVHEKTKNNLHTHQIPSHVSKGHYEVSGYGNDAVGDLKDDWI 459

Query: 114 IEVIDDLYTKTNR------IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           IEV++ L T  N       I  LTTS R R+  LGCYL A     P WG+ Q E+ C   
Sbjct: 460 IEVVEQLPTGNNTMENKALIHPLTTSFRLRNKELGCYLAATGLSYPGWGYNQAEIVCKYP 519

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGK-SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDI 226
            N RD  T WN+E H N  L      +   +KF  DF  +N AM  +NNAL+PD DK D 
Sbjct: 520 WNQRDKSTWWNVEDHINSNLHIDQTFTPPPTKFWTDFVVINFAMAASNNALIPDLDKYDR 579

Query: 227 LASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRK 286
           +AS P +WPI+  GLRMC+W D  VK+YLLG+P   W  TA+L I +  +   L R QR+
Sbjct: 580 IASEPWEWPILYKGLRMCNWNDKTVKYYLLGSPFNTWLSTAALPILLILVSMELFRYQRQ 639

Query: 287 YKDLSPAQ-WDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
              L+  + W+ F   G +  IGWLLHY PF IMGRVTY+HHY PAL+F+++  A+++D 
Sbjct: 640 SLQLNEKKAWNLFACAG-LSFIGWLLHYAPFFIMGRVTYIHHYVPALFFAIMTFAYVVDF 698

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
              +     K + +   Y+     +WYF     G+  P     + + L +W++ +
Sbjct: 699 ALANSNRYLKVVAYSSLYAGCTFTYWYFAPFCQGMPEPNLTYVNLELLPSWDVTN 753



>gi|365985898|ref|XP_003669781.1| hypothetical protein NDAI_0D02240 [Naumovozyma dairenensis CBS 421]
 gi|343768550|emb|CCD24538.1| hypothetical protein NDAI_0D02240 [Naumovozyma dairenensis CBS 421]
          Length = 748

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/410 (38%), Positives = 232/410 (56%), Gaps = 13/410 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    LLHSH+  YP GS+Q+QV+ Y H+D NN+W           N+ T 
Sbjct: 340 GSEVTIRSHGLSPNLLHSHVQLYPDGSKQRQVTGYAHSDANNNWEFHFADHNYSPND-TI 398

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNET-LGDDNDYWVIEVIDD 119
           +  V +G  I            SH+I + V+  +FEVS YGN+    D ND W IE++D 
Sbjct: 399 IRDVMDGMDIRLVHKNTRNNLHSHKIPSHVSRGNFEVSGYGNDDDFVDSNDIWTIELVDQ 458

Query: 120 L------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           L      Y K +   +  ++T  R RH  LGCYL +     PQWGF+Q E+ C  + + R
Sbjct: 459 LDSSNPNYPKEDPTILHPVSTFFRLRHKKLGCYLASTGLTYPQWGFQQAEIVCKNSWSKR 518

Query: 172 DSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILAS 229
           D  T WN+E HWN +L +  + Y   +SKF  DF  +N AM ++N+AL+PD DK D LAS
Sbjct: 519 DKATWWNVEDHWNSRL-TVAEEYLPPKSKFWTDFVLINFAMASSNSALIPDQDKFDPLAS 577

Query: 230 TPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKD 289
            P +WP +  GLRMCSW+ D  ++YL+G+P   W  T SL  FV  +L  + +  R+  +
Sbjct: 578 EPWEWPTLHKGLRMCSWSRDSYRYYLMGSPFNTWISTLSLFGFVLLMLRIIFKWGRQTIN 637

Query: 290 LSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS 349
           L+  Q    L  G      W++H+LPF +MGRVTY+HHY PALYF++L+  F+++   VS
Sbjct: 638 LTEDQIWKLLITGVFPFFSWIMHFLPFVMMGRVTYVHHYVPALYFAILVFGFVIEQLFVS 697

Query: 350 CKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
             P  K   F I  +  + V+  F  I  G++ P ++    +WL +W+I+
Sbjct: 698 AHPIIKYPAFIILATGCIWVYIIFAPICQGLHGPLTQYLRLQWLPSWDII 747



>gi|410083956|ref|XP_003959555.1| hypothetical protein KAFR_0K00650 [Kazachstania africana CBS 2517]
 gi|372466147|emb|CCF60420.1| hypothetical protein KAFR_0K00650 [Kazachstania africana CBS 2517]
          Length = 750

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 156/411 (37%), Positives = 232/411 (56%), Gaps = 18/411 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNI-TE 60
           S +T+KN   GG LLHSH   YP GS+QQQ++ Y   D NN+W   + R    +N   T+
Sbjct: 338 SIITIKNQKLGGALLHSHYQLYPTGSQQQQITAYGFKDNNNEWFFDRARGLVNWNETETD 397

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            EFV NG++             +H + A +T   +EV+ YG+  +GD  D WVIEVI+  
Sbjct: 398 DEFVKNGNSYRLVHRGTGRNLHTHPVLAAMTKSEWEVAGYGDHEIGDLKDNWVIEVIEQK 457

Query: 121 YTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWNI 179
             +  ++I  LTT  R R  ++ C+L   +  LP+WGF+Q E+ C +N +  D  T WNI
Sbjct: 458 NDEDPDKIHPLTTLFRIRSDVMDCHLAQTDKSLPEWGFRQGEIVCLRNAHKNDKRTWWNI 517

Query: 180 ERHWNDKLPSGGKSYYRSK--FLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIV 237
           E H N++LP   + +   K  FL  F HLN AM  +NNALV   DK D LAS+  +WP +
Sbjct: 518 ETHENERLPEAPEDFKFPKPGFLESFIHLNRAMMASNNALVTADDKYDPLASSAWEWPTL 577

Query: 238 EVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPA-QWD 296
             GLR+  W D+ VK+YLLG P+  W  + +++ F+  +   ++R QR+Y DL+ +   +
Sbjct: 578 HTGLRLNHWGDENVKYYLLGTPVSTWGSSIAVLGFMIYVAILILRWQRQYSDLTDSTDLN 637

Query: 297 HFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSCKPKTKN 356
            FL  G    +GW LH++PF IM RVTY+HHY PALYF++++  ++++    +C  +   
Sbjct: 638 LFLIGGFYPLLGWGLHFMPFVIMSRVTYVHHYLPALYFALIIFTYVLE----ACTKRLLK 693

Query: 357 IIFG------IYYSLIVIV---FWYFKDIAFGINYPASELKSRKWLSTWNI 398
             FG      I+ +L + V   F YF  I+FG++ P  +     W S W I
Sbjct: 694 TKFGRVSRLMIFTTLTLSVTACFAYFAPISFGMDGPKEQYAYLGWFSNWII 744



>gi|366987797|ref|XP_003673665.1| hypothetical protein NCAS_0A07260 [Naumovozyma castellii CBS 4309]
 gi|342299528|emb|CCC67284.1| hypothetical protein NCAS_0A07260 [Naumovozyma castellii CBS 4309]
          Length = 752

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 154/409 (37%), Positives = 225/409 (55%), Gaps = 11/409 (2%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    LLHSH+  YP GS Q+Q++ Y H+D NN W     R++        
Sbjct: 344 GSEVTIRSHGLSPNLLHSHVQLYPDGSRQRQITGYGHSDSNNVWEFQFAREDTRSLTDNL 403

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
              + +G  I            SHEI + V+  +FEVS Y  E  GD  D W++E++D +
Sbjct: 404 KTPITDGAEIRLVHNNTRANLHSHEILSHVSKGNFEVSGYSTEFNGDVYDDWILEIVDQM 463

Query: 121 YT--------KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRD 172
            +          N +  ++T  R RH +LGCYL +     P WGF+Q E+ C K+ + RD
Sbjct: 464 DSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGFQQAEIVCKKSWSHRD 523

Query: 173 SFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILAST 230
             T WN+E HWND+LP   + Y   +SKF  DF  +N AM ++N+ALVPD DK D LAS 
Sbjct: 524 KATWWNVEDHWNDQLPIE-EDYVPPKSKFWTDFILINFAMASSNSALVPDADKFDPLASK 582

Query: 231 PRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL 290
           P +WP +  GLR+CSW+ DV K+YLLG+P   W  T SL +FVF +     + +R++ +L
Sbjct: 583 PWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFIISKIAYQWRRQHLNL 642

Query: 291 SPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC 350
              Q       G    + W+ H+ PF +MGRVTY+HHY PALYF++L   F++D+     
Sbjct: 643 QEDQLWRLGIQGIFPFLAWITHFFPFVMMGRVTYVHHYLPALYFAILTFGFVLDYSIGRA 702

Query: 351 KPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
            P  K  I+   +     ++  F  I  G++   ++    +WL TWNIV
Sbjct: 703 NPFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAKYLRLEWLPTWNIV 751



>gi|294656631|ref|XP_458928.2| DEHA2D10648p [Debaryomyces hansenii CBS767]
 gi|199431620|emb|CAG87084.2| DEHA2D10648p [Debaryomyces hansenii CBS767]
          Length = 779

 Score =  278 bits (712), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 154/424 (36%), Positives = 234/424 (55%), Gaps = 26/424 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-----------LKP 49
           GS +TL++ G    LLHSH + YP GS QQQ++ Y   D NN++++              
Sbjct: 356 GSLITLRSQGLSPNLLHSHPHVYPEGSHQQQITTYGFKDENNEFLVEFDLEAGLRGEFAT 415

Query: 50  RKEQMYNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDN 109
            +++  ++ +  + + +GD +            SH+I + +++ H+EVS Y N    D  
Sbjct: 416 YEQEGNDSYSLDKIIKDGDVMRLVHKNSGCLLHSHQIMSSISSSHYEVSCYANLDESDLK 475

Query: 110 DYWVIEVIDDLYTKTN--------RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVE 161
           D WV+E+     + +          +  ++T+ R RH +LGCYL       P WGF+Q E
Sbjct: 476 DEWVVELQSQELSPSEDFQNEDPKELHPISTNFRLRHKVLGCYLATTGFSYPPWGFQQGE 535

Query: 162 VSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYYRS--KFLHDFWHLNVAMYTTNNALVP 219
           V C  +    +  T WNIE H NDKLP+    Y     KF  +F  LN  M  +NNALVP
Sbjct: 536 VVCKSSLFSTEKSTWWNIEDHINDKLPAPESLYVPPPPKFWKEFILLNYGMMASNNALVP 595

Query: 220 DPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYY 279
           D DK D L+S   +WPI++ GLRMC W  + VK++L+G+P I W  T +LV+FV  ++  
Sbjct: 596 DSDKFDRLSSEWWEWPILKSGLRMCGWTSNEVKYFLIGHPFITWFSTFNLVLFVIYIVIK 655

Query: 280 LIRRQRK----YKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFS 335
           L   QR+     K +   +W+  +  G    +GW+LHY+PF +MGRVTYLHHY PALYF+
Sbjct: 656 LWMWQRQKIHFRKGVFDLEWETLIIQGVTPFVGWVLHYVPFILMGRVTYLHHYVPALYFA 715

Query: 336 MLMAAFMMDHFTVSCKPK-TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLS 394
           + ++ +MM+        K    +++GI Y LI+ +FWY KD+A G+   +S+ K  + LS
Sbjct: 716 IFISGYMMESIIHRHTHKYISYLLYGISYLLIIGIFWYLKDLALGMEGSSSKFKHLRLLS 775

Query: 395 TWNI 398
           +W I
Sbjct: 776 SWMI 779



>gi|470308139|ref|XP_004363760.1| protein-O-mannosyltransferase 2 [Capsaspora owczarzaki ATCC 30864]
 gi|320168016|gb|EFW44915.1| protein-O-mannosyltransferase 2 [Capsaspora owczarzaki ATCC 30864]
          Length = 793

 Score =  276 bits (707), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 152/420 (36%), Positives = 227/420 (54%), Gaps = 33/420 (7%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPG--GSEQQQVSCYHHNDINNDWMILKPRKEQM---- 54
           GS ++LKN   GG LLHSH + YP   G +QQQV+CY H D NN W+I  P    +    
Sbjct: 382 GSIVSLKNHRSGGALLHSHTHTYPEAHGPQQQQVTCYSHKDSNNHWLIKHPGTPDLNAES 441

Query: 55  ------YNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDD 108
                   N+  +E++ +G  +            SH   AP+T  HF+VS YG + +GD 
Sbjct: 442 EKAMVEKTNVAPLEYIKHGSIVRLEHINTKRNIHSHREKAPLTTRHFQVSGYGADGVGDA 501

Query: 109 NDYWVIEVIDDLYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNN 168
           ND+W +EV+D    + NR+++L T  R  H  +GC L +    LP+WG++Q+EV+C+ N 
Sbjct: 502 NDHWRVEVLDG-GGEDNRVQTLITRFRLIHVSVGCALHSHGKNLPKWGWEQLEVTCNPNV 560

Query: 169 NPRDSFTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILA 228
           N  D+   WNIE H ND+LP      YR  F+ +   ++VAM   NN L P   KE+ + 
Sbjct: 561 NDADNM--WNIEMHQNDRLPKVEGVSYRPSFISNLIEIHVAMAQVNNGLKP---KENEIT 615

Query: 229 STPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIR---RQR 285
           S P QWPI   G R   W D+  + YLLGNP+I+W     LV+ V  +L+Y +     QR
Sbjct: 616 SRPWQWPINYRGQRFTGWGDNDTRIYLLGNPVIFW---GCLVMTVVFILFYAVDAGISQR 672

Query: 286 KYKDLSPAQWDHFLYVGKVCG---IGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFM 342
            Y++  P   +    +   C    IGW +HY PF +MGR+ Y HHYFPAL FS + +A +
Sbjct: 673 GYRE-PPWNRERKAKLLATCAWLLIGWAMHYFPFFVMGRILYFHHYFPALLFSCMYSALL 731

Query: 343 MDHFTVSCK-----PKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
           +D+F +  +     P+   I   I   ++   F +F  +++G+  P +   +R+W+ +W 
Sbjct: 732 LDYFIMRLRMWTMSPRVTIIGTSILLLIMFASFLFFAPVSYGMTGPVNSFFNRRWMESWE 791



>gi|308198020|ref|XP_001387014.2| protein mannosyltransferase [Scheffersomyces stipitis CBS 6054]
 gi|149388990|gb|EAZ62991.2| protein mannosyltransferase [Scheffersomyces stipitis CBS 6054]
          Length = 745

 Score =  276 bits (706), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 226/412 (54%), Gaps = 19/412 (4%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S +TL++ G    LLHSH + YP GS+ QQ++ Y   D NND++I   +  +  + + E 
Sbjct: 334 SLVTLRSQGLSPNLLHSHDHSYPEGSQLQQITTYGFKDDNNDFVIKADKFLERSSGVVET 393

Query: 62  E--FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
               + +GDTI            S  I+AP+++ H+EVS      + D  + W +EV   
Sbjct: 394 SDTLLKHGDTIRLMHNKTRCFLHSQPISAPISDNHYEVSCISELEVNDFRNSWTVEVQGQ 453

Query: 120 LYTKT--------NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
             +++        + +  ++T+ R +H  LGCYL       P WGF+Q EV C      R
Sbjct: 454 EKSESPFFQSESEDEVHPISTNFRLKHKQLGCYLATTGYSYPSWGFQQGEVVCKYAILSR 513

Query: 172 DSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILAS 229
           D  T WNIE H N+K  +  +SY   + KF  +F  LN  M  +NNAL+PDPDK D L+S
Sbjct: 514 DKTTWWNIEDHSNNKFETPSESYVPPKPKFWKEFVLLNYGMLASNNALIPDPDKFDRLSS 573

Query: 230 TPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKD 289
              +WP++  G+R+ SW  D VK++L+GNP I W  T SL+IF+  +    +  QR+   
Sbjct: 574 EWWEWPLLLSGIRLGSWGADDVKYFLMGNPFITWFSTFSLLIFILYVAACAVMHQRQILS 633

Query: 290 LS--PAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFT 347
            S     W+  L  G    + W LHY PF +MGRV YLHHY PALYF++L++AF+M+ F 
Sbjct: 634 YSVLGENWNELLIQGIFPFLAWFLHYFPFVVMGRVKYLHHYVPALYFAILVSAFVMETFI 693

Query: 348 VSCKPKTKNIIFGIY---YSLIVIVFWYFKDIAFGINYPASELKSRKWLSTW 396
              K   + I+  IY   Y +I+  FWY KD + G+  P S+ K  K+LS+W
Sbjct: 694 R--KRLNRVIVCTIYLIAYIMIIASFWYLKDFSLGMEGPPSKFKKLKFLSSW 743



>gi|366998505|ref|XP_003683989.1| hypothetical protein TPHA_0A04800 [Tetrapisispora phaffii CBS 4417]
 gi|357522284|emb|CCE61555.1| hypothetical protein TPHA_0A04800 [Tetrapisispora phaffii CBS 4417]
          Length = 760

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 158/413 (38%), Positives = 224/413 (54%), Gaps = 16/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NN 57
           GS +T+++ G    LLHSHI  YP GS Q Q++ Y  +D NN W     R++ ++   NN
Sbjct: 345 GSDVTIRSHGLSPNLLHSHIQTYPVGSLQNQITGYGFSDENNKWTFKFAREDGIFFDSNN 404

Query: 58  IT---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
            T   E+  V +GDT+            SH +A+ V+  +FEVS YG +  GD  D W+I
Sbjct: 405 KTVNGELIAVKDGDTVRLNHKSTMRNLHSHYVASHVSQGNFEVSGYGTDEGGDAKDNWII 464

Query: 115 EVIDDLYTK--------TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDK 166
           E++  L +         +  I  ++T  R RH  LGCYL +     P WGFKQ E+ C  
Sbjct: 465 EIVQQLKSNNPDFHQEDSENIHPVSTFFRLRHQELGCYLASTGFSYPGWGFKQSEIVCKN 524

Query: 167 NNNPRDSFTHWNIERHWNDKLP-SGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
           + + RD  T WN+E HWND L         +SKF  DF  +N AM  +NNAL+PD DK D
Sbjct: 525 SWSKRDKSTWWNVEDHWNDMLEIEDDYVPPKSKFWTDFILINFAMAASNNALIPDDDKYD 584

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            LAS P +WP + +GLRMC+WA DV ++YL+G+P   W  TASL + +  L Y L   +R
Sbjct: 585 NLASEPWEWPTLHIGLRMCTWAHDVYRYYLIGSPFNTWLSTASLFVCIIILAYTLYEWRR 644

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   L+               I W+ H++PF IMGRVTY+HHY PALYFSML+ A  +D+
Sbjct: 645 QKIHLNENNIWKLSIQFVFPFIAWVTHFVPFLIMGRVTYVHHYLPALYFSMLVFASTVDY 704

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGIN-YPASELKSRKWLSTWN 397
                K   K   + I +   + ++  F  +  G+  +   +LK   WLS+W+
Sbjct: 705 LLSGSKTYIKYPSYLILFGSCIYIYIIFAPLCQGMTGFNNEDLKKISWLSSWD 757



>gi|207340887|gb|EDZ69098.1| YOR321Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 344

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 133/337 (39%), Positives = 203/337 (60%), Gaps = 5/337 (1%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
            S +++KN   GG LLHSH+  +P GSEQQQV+ Y ++D NN+W   + R  + + +   
Sbjct: 5   SSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDAEN 64

Query: 61  --VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
             +EFV  G+              +HE+ AP++   +EVSAYG+  LGD  D W+IE+++
Sbjct: 65  KTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVE 124

Query: 119 DLYTK-TNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHW 177
            +  +    +  L+TS R ++S+LGCYL  +   LP+WGF+Q EV C K+ + RD  T W
Sbjct: 125 QVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWW 184

Query: 178 NIERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPI 236
           NIE H N++LP G    Y ++ F  +F  LN AM  TNNALVP+P+K D +AS+  QWP 
Sbjct: 185 NIETHENERLPQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWPT 244

Query: 237 VEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS-PAQW 295
           + VG+R+C W++  +K++LLG+P   W  + ++   +  +++  ++ QR+   LS P + 
Sbjct: 245 LNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVER 304

Query: 296 DHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPAL 332
           D F+       + WLLHY+PF +M RV Y HHY P L
Sbjct: 305 DVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTL 341



>gi|403216641|emb|CCK71137.1| hypothetical protein KNAG_0G00810 [Kazachstania naganishii CBS
           8797]
          Length = 749

 Score =  273 bits (699), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 153/414 (36%), Positives = 229/414 (55%), Gaps = 15/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NN 57
           GS +T+++ G    LLHSHI  YP GS Q QV+ Y H+D NN+W     R   ++   N 
Sbjct: 335 GSVVTIRSHGLSPNLLHSHIQSYPDGSRQGQVTGYGHSDSNNNWQFQFARTSGIHLDENG 394

Query: 58  IT---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
            T   E+  V +G T+            SHEI + V+  +FEVS YG+ET GD+ D WVI
Sbjct: 395 KTPNGELIPVVDGLTVRLVHNNTRSNLHSHEIPSHVSRGNFEVSRYGSETKGDEKDDWVI 454

Query: 115 EVIDDLYTKT--------NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDK 166
           E++D L +          + +  ++T  R RH  LGCYL +     PQWGF Q E+ C  
Sbjct: 455 EIVDQLRSSNYDFPEEDPSMLHPISTFFRLRHKELGCYLSSTGMAYPQWGFSQAEIVCKY 514

Query: 167 NNNPRDSFTHWNIERHWNDKLPSGGK-SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
           + + RD  T WN+E HWND+L +    S   SKF  DF  +N AM ++NNAL+PDPDK D
Sbjct: 515 SWSKRDKSTWWNVEDHWNDQLEADEDYSPPASKFWTDFILINFAMASSNNALIPDPDKYD 574

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            LAS   +WPI+  GLR+C W     ++YLLG+P   W+ T ++++    L     + +R
Sbjct: 575 NLASEAWEWPILYTGLRLCGWDLSNTRYYLLGSPFNTWASTLTIILLPLLLFSIFYQWRR 634

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   ++   W   +       +GWL HYLPF +MGRVTY+HHY PALYF++++  F M++
Sbjct: 635 QTIQITEPHWWTLIMQCGFPLVGWLSHYLPFVVMGRVTYVHHYVPALYFAIMVFGFAMNY 694

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           +     P     ++   +S  + +++YF  +  G++    +    +W  +W+IV
Sbjct: 695 WVYPKHPLISIPVYLAMFSGCIYIYYYFSPLCQGMDGAPMKYLYLEWFRSWDIV 748



>gi|296413150|ref|XP_002836279.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630092|emb|CAZ80470.1| unnamed protein product [Tuber melanosporum]
          Length = 594

 Score =  271 bits (693), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 168/251 (66%)

Query: 148 ANAILPQWGFKQVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYYRSKFLHDFWHLN 207
            N  LPQWGFKQ+EV+C K NNPRD FTHWN+E HWN+KLP+     +RS FL DF HLN
Sbjct: 344 GNVNLPQWGFKQIEVTCTKKNNPRDVFTHWNVESHWNEKLPNADVKAFRSPFLRDFIHLN 403

Query: 208 VAMYTTNNALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTA 267
           VAM T+NNALVPDPDK+D LAS   QWPI+ VGLRMCSW D +VK++LLGNP+++W  T 
Sbjct: 404 VAMMTSNNALVPDPDKQDDLASAYWQWPILHVGLRMCSWDDGIVKYFLLGNPMVYWGSTL 463

Query: 268 SLVIFVFTLLYYLIRRQRKYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHH 327
           +L +F   +L YLIR QR Y DL     DH    G    IGW+ HY+PF  M RVTY+HH
Sbjct: 464 ALPLFSLLVLLYLIRWQRGYNDLDGEGIDHIRAAGIYPLIGWVFHYVPFIAMARVTYVHH 523

Query: 328 YFPALYFSMLMAAFMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASEL 387
           Y+PALYF++L+  F+ +H T       K  ++G+ Y  I  VF  F  I+FG+   + + 
Sbjct: 524 YYPALYFAILVFGFLFNHLTNKLPKTAKLAVYGVAYVAITGVFVLFIPISFGMTGSSEQY 583

Query: 388 KSRKWLSTWNI 398
           K   WL TW I
Sbjct: 584 KYLNWLPTWRI 594



>gi|448088827|ref|XP_004196644.1| Piso0_003868 [Millerozyma farinosa CBS 7064]
 gi|448092994|ref|XP_004197675.1| Piso0_003868 [Millerozyma farinosa CBS 7064]
 gi|359378066|emb|CCE84325.1| Piso0_003868 [Millerozyma farinosa CBS 7064]
 gi|359379097|emb|CCE83294.1| Piso0_003868 [Millerozyma farinosa CBS 7064]
          Length = 784

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 151/423 (35%), Positives = 227/423 (53%), Gaps = 25/423 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-------LKPRKEQ 53
           GS +TL++ G    LLHSH + YP GS+QQQ++ Y + D NN+++I       L+     
Sbjct: 362 GSMVTLRSQGLSPNLLHSHPHLYPEGSQQQQITTYGYKDENNNFLIEFDLESGLRGEYAT 421

Query: 54  MYNN----ITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDN 109
             N+    +     V +GD +            SH I APV    +EVS Y +    D+ 
Sbjct: 422 YENDENSTVDHTRPVKDGDVVRLVHNDSGCLLHSHPIKAPVLKSAYEVSCYSDLEHSDEK 481

Query: 110 DYWVIEVIDDLYT--------KTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVE 161
           D W++E+     +          + +  ++T+ R +H +LGCYL      LP WG+KQ E
Sbjct: 482 DEWIVEISKQEVSPDPFFQSEAQDELHPISTNFRLKHKVLGCYLTTTGYALPSWGYKQGE 541

Query: 162 VSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVP 219
           V C      +D  T WN+E H N  LP   K Y   + +F  +F  LN AM  +NNAL+P
Sbjct: 542 VVCKYAVFSQDKSTWWNVEDHINSALPLPEKEYVPPKPRFWKEFILLNYAMMASNNALLP 601

Query: 220 DPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIF-VFTLLY 278
           D DK D L+S   +WPI+  GLRMC WA   VKF+L+GNP + W  T +LV+F +++L+ 
Sbjct: 602 DYDKFDRLSSEWWEWPILHSGLRMCGWAASEVKFFLIGNPPVTWFSTLALVVFAIYSLVL 661

Query: 279 YLIRRQRKY---KDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFS 335
            L  R++       +   +W+ F+  G    +GWLLH+LPF +MGRV YLHHY PA YF+
Sbjct: 662 LLCYRRQTLVFPGGVFDEEWNKFILQGIFPFLGWLLHFLPFVVMGRVKYLHHYVPAQYFA 721

Query: 336 MLMAAFMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLST 395
           + ++ F+M+           ++I+ + Y +I+ VFW  K + FG+N  +S     + L T
Sbjct: 722 IFVSGFIMEVSLRRINRHLSHLIYFVSYVMIIGVFWKLKPLCFGMNLHSSNYGHLRVLET 781

Query: 396 WNI 398
           W +
Sbjct: 782 WMV 784



>gi|190344842|gb|EDK36600.2| hypothetical protein PGUG_00698 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 767

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 157/430 (36%), Positives = 227/430 (52%), Gaps = 38/430 (8%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-------------- 46
           GS +TL++ G    LLHSH + YP GS+QQQ++ Y   D NN ++I              
Sbjct: 344 GSLVTLRSQGLSPNLLHSHPHVYPQGSQQQQITTYGFKDDNNQFIIEFDLEAGARGEFAS 403

Query: 47  LKPRKEQMYNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLG 106
           ++P   Q Y+  T    V NGDTI            SH I + ++    EVS Y +    
Sbjct: 404 MEPLDNQSYSFTT---LVKNGDTIRLLHKLSGCLLHSHMIPSFISTSQKEVSCYSDLEGS 460

Query: 107 DDNDYWVIEVIDD--------LYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFK 158
           D+ D WV+E+ +              + +  +TT+ R RH +LGCYL       P WG++
Sbjct: 461 DEKDEWVVEIQEQDQPLSPEHQNEAPDEVHPITTNFRLRHKVLGCYLATTGYSYPAWGYQ 520

Query: 159 QVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNA 216
           Q EV C      RD  T WN+E H ND LP     +   + KF  +F  +N  M  +N+A
Sbjct: 521 QGEVVCKHTLLSRDKSTWWNVEDHKNDALPQPEAEFIPPKPKFWKEFVLINYGMMASNSA 580

Query: 217 LVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTL 276
           LVPDPDK D L+S   +WPI   GLRMC W   V K++L+G+P+I W  T  L++   +L
Sbjct: 581 LVPDPDKFDKLSSEWWEWPITRSGLRMCGWGMSVTKYFLVGHPLINWFSTFCLLV---SL 637

Query: 277 LYYLIR-----RQRKY--KDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYF 329
           +Y+ ++     RQR Y    +   QWD  +  G +  +GW+LHYLPF  M RVTY+HHY 
Sbjct: 638 IYFSVKLWRWQRQRDYYPNGVFSVQWDSLIVQGILPILGWILHYLPFVAMSRVTYVHHYA 697

Query: 330 PALYFSMLMAAFMMDHFTVSCKPKT-KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELK 388
           PALYF++ +  F+++    +   +T     + I Y  I++ F Y KD+AFG+  P++  +
Sbjct: 698 PALYFAIFVTGFVVERVVYNHLNRTIARGFYIILYLAIILGFIYLKDLAFGMEGPSNAYR 757

Query: 389 SRKWLSTWNI 398
             K LSTW I
Sbjct: 758 HLKVLSTWMI 767



>gi|241954746|ref|XP_002420094.1| dolichyl-phosphate-mannose-protein mannosyltransferase, putative;
           protein mannosyltransferase, putative [Candida
           dubliniensis CD36]
 gi|223643435|emb|CAX42314.1| dolichyl-phosphate-mannose-protein mannosyltransferase, putative
           [Candida dubliniensis CD36]
          Length = 839

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 159/446 (35%), Positives = 233/446 (52%), Gaps = 48/446 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    L+HSH + YP GS++QQV+ Y   D NN+++        + N    
Sbjct: 394 GSLVTIRSQGLSPNLIHSHPHNYPQGSQEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHAT 453

Query: 61  VE-------------------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYG 101
           +E                    +++GDT+            ++ + APVT+  +EVS +G
Sbjct: 454 LENGNSTASGGEDDDDDYYHVIIHDGDTVRINHKNTGCYLRANAVGAPVTSSSYEVSCFG 513

Query: 102 NETLGDDNDYWVIEVI------DDLYTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILP 153
           +    D  D WVIE+       D ++   +R  I S++TS R +H  LGCYL       P
Sbjct: 514 DVESNDWADEWVIEIQTQDQSPDPIFQDEDRSEIHSVSTSFRLKHKQLGCYLATTGKSYP 573

Query: 154 QWGFKQVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMY 211
            WG++Q EV C  +   RD  T WNIE+H NDKLP     Y   + KF  +F  LN AM 
Sbjct: 574 AWGYQQGEVVCKYSVFSRDKNTWWNIEKHVNDKLPLPPTEYVPPKPKFWKEFILLNYAMM 633

Query: 212 TTNNALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVI 271
            +NNAL+PDPD+ D L+S   +WPI+  GLRM SW D  +K++LLGNP+I W  T +L+ 
Sbjct: 634 ASNNALIPDPDRFDKLSSEWWEWPILNTGLRMNSWGDADIKYFLLGNPLITWLSTMALIA 693

Query: 272 FVFTLLYYLIRRQRKYKDLSPAQWDHFLYVGKVCG-----------IGWLLHYLPFCIMG 320
               LL   I+ QR++  LS     +   V K               GW+LHY+PF +MG
Sbjct: 694 CPVYLLIVGIKYQRQWISLSATDASNTNSVNKQTLSLLSARALLPLAGWVLHYVPFILMG 753

Query: 321 RVTYLHHYFPALYFSMLMAAFMMD--------HFTVSCKPKTKNIIFGIYYSLIVIVFWY 372
           RV YLHHY PALYF++ +A F++D        +     +   K +I+   Y +I I FWY
Sbjct: 754 RVKYLHHYVPALYFAIFIAGFIVDAIVNLDFSYHNNKFQYIFKVVIYSTLYLVICISFWY 813

Query: 373 FKDIAFGINYPASELKSRKWLSTWNI 398
           FKD++FG+   +   +  + L +W I
Sbjct: 814 FKDLSFGMEGSSVAFRHLRLLGSWMI 839



>gi|146422773|ref|XP_001487321.1| hypothetical protein PGUG_00698 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 767

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 157/430 (36%), Positives = 226/430 (52%), Gaps = 38/430 (8%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-------------- 46
           GS +TL++ G    LLHSH + YP GS+QQQ++ Y   D NN ++I              
Sbjct: 344 GSLVTLRSQGLSPNLLHSHPHVYPQGSQQQQITTYGFKDDNNQFIIEFDLEAGARGEFAS 403

Query: 47  LKPRKEQMYNNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLG 106
           ++P   Q Y+  T    V NGDTI            SH I + +     EVS Y +    
Sbjct: 404 MEPLDNQSYSFTT---LVKNGDTIRLLHKLSGCLLHSHMIPSFILTSQKEVSCYSDLEGS 460

Query: 107 DDNDYWVIEVIDD--------LYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFK 158
           D+ D WV+E+ +              + +  +TT+ R RH +LGCYL       P WG++
Sbjct: 461 DEKDEWVVEIQEQDQPLSPEHQNEAPDEVHPITTNFRLRHKVLGCYLATTGYSYPAWGYQ 520

Query: 159 QVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNA 216
           Q EV C      RD  T WN+E H ND LP     +   + KF  +F  +N  M  +N+A
Sbjct: 521 QGEVVCKHTLLSRDKSTWWNVEDHKNDALPQPEAEFIPPKPKFWKEFVLINYGMMASNSA 580

Query: 217 LVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTL 276
           LVPDPDK D L+S   +WPI   GLRMC W   V K++L+G+P+I W  T  L++   +L
Sbjct: 581 LVPDPDKFDKLSSEWWEWPITRSGLRMCGWGMSVTKYFLVGHPLINWFSTFCLLV---SL 637

Query: 277 LYYLIR-----RQRKY--KDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYF 329
           +Y+ ++     RQR Y    +   QWD  +  G +  +GW+LHYLPF  M RVTY+HHY 
Sbjct: 638 IYFSVKLWRWQRQRDYYPNGVFSVQWDSLIVQGILPILGWILHYLPFVAMSRVTYVHHYA 697

Query: 330 PALYFSMLMAAFMMDHFTVSCKPKT-KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELK 388
           PALYF++ +  F+++    +   +T     + I Y  I++ F Y KD+AFG+  P++  +
Sbjct: 698 PALYFAIFVTGFVVERVVYNHLNRTIARGFYIILYLAIILGFIYLKDLAFGMEGPSNAYR 757

Query: 389 SRKWLSTWNI 398
             K LSTW I
Sbjct: 758 HLKVLSTWMI 767



>gi|365760510|gb|EHN02225.1| Pmt6p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 759

 Score =  267 bits (683), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 150/413 (36%), Positives = 223/413 (53%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNN- 57
           GS LT+++ G    LLHSH+  YP GS Q+QV+ Y   D NN W     R    Q++ N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHVQLYPDGSGQRQVTGYGFADSNNIWKFEFSRSSGLQLHQNG 405

Query: 58  --ITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
                +  + +G  +            SH++ + V+  +FEVS YG++++GD+ D W++E
Sbjct: 406 NLSDRIIPITDGVEVRLRHKNTESSLHSHDVPSHVSRGNFEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VIDDLYTKT--------NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  + +          + +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 466 IVKQVNSPNPVYANEDPDILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDI 226
            + RD  T WN+E HWN  L +       +S F  DF   N AM ++N+ALVPD DK D 
Sbjct: 526 WSHRDKSTWWNVEDHWNSYLETADDYIPPKSNFWTDFILTNFAMASSNSALVPDEDKYDS 585

Query: 227 LASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRK 286
           L+S   +WP +  GLRMCSWA    ++YL+G+P   W+ TASL+IF F +L  L R +R+
Sbjct: 586 LSSNAWEWPTLHKGLRMCSWAGYTTRYYLMGSPFNTWASTASLIIFPFIILSLLYRWRRQ 645

Query: 287 YKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
              LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF++L+  F++D  
Sbjct: 646 KLHLSEDQIWRVAIQGVFPFISWMSHYLPFVMMGRVTYVHHYVPALYFAILVFGFVVDFA 705

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                   K   +   +   + ++  F  I  G+N   +E    +WLSTW++ 
Sbjct: 706 LSRVHWIIKYPAYLSLFGSCIYIYNLFAPICQGMNGDKAEYLPLEWLSTWDMA 758



>gi|156848302|ref|XP_001647033.1| hypothetical protein Kpol_1050p32 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117716|gb|EDO19175.1| hypothetical protein Kpol_1050p32 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 750

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 148/412 (35%), Positives = 227/412 (55%), Gaps = 15/412 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMY---NN 57
           GS +++++ G    LLHSH+ +YP GS+Q Q++ Y ++D NN W+    R+  +    NN
Sbjct: 336 GSEVSIRSNGLSPNLLHSHVQKYPDGSKQNQITGYGYSDSNNGWIFKFTRESGIQFDSNN 395

Query: 58  ITEVEF---VNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
            T  E    + +GD +            SHE+ + V+  ++EVS YG++  GD  D WVI
Sbjct: 396 QTVNEDLIPIRDGDEVRLLHKNTGKNLHSHEVPSHVSRGNWEVSGYGSDHRGDQKDNWVI 455

Query: 115 EVIDDLYTKT--------NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDK 166
           E++D L +          + +  ++T  R +H +LGCYL +     P WGFKQ EV C  
Sbjct: 456 EIVDQLKSSNPDFHDEDNDSVHPVSTFFRLKHKVLGCYLTSTGFSYPAWGFKQSEVVCKY 515

Query: 167 NNNPRDSFTHWNIERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
           + + RD  T WN+E H ND L         +SKF  DF  +N AM  +NNALVPD DK D
Sbjct: 516 SWSTRDKSTWWNVEDHTNDMLEVEDDYIPPKSKFWTDFILINFAMAASNNALVPDGDKYD 575

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            LAS   +WP + VGLRMC+WA +  ++YL+G+P   W  + SL++ +  L     + +R
Sbjct: 576 NLASDAWEWPTLHVGLRMCNWAFNTYRYYLMGSPFNTWLSSLSLIVMLLILAKLSYQWRR 635

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +  +++  Q   F        I WL H+LPF IMGRVTY+HHY PALYF++L+ AF +D+
Sbjct: 636 QQINITEDQLWSFAIQAVFPFIAWLTHFLPFVIMGRVTYVHHYLPALYFAILVFAFTVDY 695

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
                 P T+++ + + ++  +  +  F  +  G+       +  KWL TW+
Sbjct: 696 TLNKVHPITRHLGYLVLFAGCIYTYILFAPLCQGMIRRDISYEKMKWLPTWD 747



>gi|238881391|gb|EEQ45029.1| dolichyl-phosphate-mannose-protein mannosyltransferase 6 [Candida
           albicans WO-1]
          Length = 832

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 155/444 (34%), Positives = 233/444 (52%), Gaps = 46/444 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    L+HSH + YP GS++QQV+ Y   D NN+++        + N    
Sbjct: 389 GSLVTIRSQGLSPNLIHSHPHNYPQGSQEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHAT 448

Query: 61  VE-----------------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNE 103
           +E                  +++GDT+            ++ + AP+T+  +EVS +G+ 
Sbjct: 449 LENENSTRNGGNDDDYYHVIIHDGDTVRINHKNTGSYLRANAVGAPITSSSYEVSCFGDV 508

Query: 104 TLGDDNDYWVIEVI------DDLYTKTN--RIRSLTTSMRFRHSLLGCYLRAANAILPQW 155
              D  D WVIE+       D ++   +   I S++TS R +H  LGCYL       P W
Sbjct: 509 ESNDWADEWVIEIQSQDQSPDPMFQDEDPSEIHSVSTSFRLKHKQLGCYLATTGKSYPAW 568

Query: 156 GFKQVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTT 213
           G++Q EV C  +   RD  T WNIE+H NDKLP     Y   + KF  +F  LN AM  +
Sbjct: 569 GYQQGEVVCKYSVFSRDKNTWWNIEKHVNDKLPLPATEYVPPKPKFWKEFILLNYAMMAS 628

Query: 214 NNALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFV 273
           NNAL+PDPD+ D L+S   +WPI+  GLRM SW D  +K++LLGNP+I W  T +L++  
Sbjct: 629 NNALIPDPDRFDKLSSEWWEWPILNTGLRMNSWGDADIKYFLLGNPLITWMSTIALIVCP 688

Query: 274 FTLLYYLIRRQRKYKDLSPAQWDH-----------FLYVGKVCGIGWLLHYLPFCIMGRV 322
             LL   I+ QR++  LS     +                 +   GW+LHY+PF +MGRV
Sbjct: 689 LYLLVVGIKYQRQWILLSATDTSNANPANSQSLSLLAARALLPLAGWVLHYVPFILMGRV 748

Query: 323 TYLHHYFPALYFSMLMAAFMMD--------HFTVSCKPKTKNIIFGIYYSLIVIVFWYFK 374
            YLHHY PALYF++ +A F++D        +     +   K +I+   Y +I I FWYFK
Sbjct: 749 KYLHHYVPALYFAIFVAGFIVDAILNLDFSYHNNKFQYIFKVVIYSTLYLVICISFWYFK 808

Query: 375 DIAFGINYPASELKSRKWLSTWNI 398
           D++FG+   + + +  + L +W I
Sbjct: 809 DLSFGMEGSSVDYRHLRLLGSWMI 832



>gi|410081413|ref|XP_003958286.1| hypothetical protein KAFR_0G01180 [Kazachstania africana CBS 2517]
 gi|372464874|emb|CCF59151.1| hypothetical protein KAFR_0G01180 [Kazachstania africana CBS 2517]
          Length = 756

 Score =  265 bits (678), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 155/411 (37%), Positives = 226/411 (54%), Gaps = 14/411 (3%)

Query: 2   SRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEV 61
           S +TL++ G    LLHSH   YP GS Q+Q++ Y  +D NN+W+I   R + +Y +  E 
Sbjct: 343 SEVTLRSHGLSPNLLHSHAQVYPDGSHQRQITGYGFSDTNNNWIIKFARTKMVYFD-PER 401

Query: 62  EF--VNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDD 119
           +F  V +GD I            SHE+ + V+  ++EVS YG++ +GD  D WV+E++  
Sbjct: 402 DFISVRDGDEIRLLHKNTNSNLHSHEVPSHVSRGNWEVSGYGSDDVGDQKDDWVVEIVKQ 461

Query: 120 LYTKTNR--------IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPR 171
           + +            +  ++T  R RH +LGCYL +     P WGF Q E+ C  + +  
Sbjct: 462 MDSANPNFPKEDPEILHPVSTFFRLRHKVLGCYLTSTGLSYPSWGFSQAEIVCKNSWSKH 521

Query: 172 DSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILAS 229
           D  T WNIE HWN+ L S  +SY   +S F  DF  +N AM ++NNALVPD DK D LAS
Sbjct: 522 DKSTWWNIEGHWNEHL-SIDESYVPPKSNFWTDFVLINFAMASSNNALVPDEDKYDPLAS 580

Query: 230 TPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKD 289
              +WPI+  GLRMC+W     K+YL+G+P   W  T SL IF   +   + + +R+   
Sbjct: 581 DFWEWPILYRGLRMCNWVTTSYKYYLMGSPFNTWISTLSLFIFCGIVSSIVYKYKRQSLV 640

Query: 290 LSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS 349
           +S   +      G    + W+ HYLPF +MGRVTY+HHY PALYF++L+  F+  +   +
Sbjct: 641 MSTDLFWKLSIQGGFPFVAWIAHYLPFVVMGRVTYVHHYVPALYFAILVFGFVTHYLLHT 700

Query: 350 CKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
                K  ++ + YS  V V+  F  I  GI    +   + KWL +WNIVD
Sbjct: 701 RHFLIKLPVYVLLYSGCVYVYILFSPICQGIVGRNANYTNLKWLPSWNIVD 751



>gi|68477313|ref|XP_717283.1| hypothetical protein CaO19.11283 [Candida albicans SC5314]
 gi|68477472|ref|XP_717207.1| hypothetical protein CaO19.3802 [Candida albicans SC5314]
 gi|46438909|gb|EAK98233.1| hypothetical protein CaO19.3802 [Candida albicans SC5314]
 gi|46438987|gb|EAK98310.1| hypothetical protein CaO19.11283 [Candida albicans SC5314]
          Length = 832

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 154/444 (34%), Positives = 233/444 (52%), Gaps = 46/444 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    L+HSH + YP GS++QQV+ Y   D NN+++        + N    
Sbjct: 389 GSLVTIRSQGLSPNLIHSHPHNYPQGSQEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHAT 448

Query: 61  VE-----------------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNE 103
           +E                  +++GDT+            ++ + AP+T+  +EVS +G+ 
Sbjct: 449 LENENSTRNGGNDDDYYHVIIHDGDTVRINHKNTGSYLRANAVGAPITSSSYEVSCFGDV 508

Query: 104 TLGDDNDYWVIEVI------DDLYTKTN--RIRSLTTSMRFRHSLLGCYLRAANAILPQW 155
              D  D WVIE+       D ++   +   I S++TS R +H  LGCYL       P W
Sbjct: 509 ESNDWADEWVIEIQSQDQSPDPMFQDEDPSEIHSVSTSFRLKHKQLGCYLATTGKSYPAW 568

Query: 156 GFKQVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTT 213
           G++Q EV C  +   RD  T WNIE+H N+KLP     Y   + KF  +F  LN AM  +
Sbjct: 569 GYQQGEVVCKYSVFSRDKNTWWNIEKHVNNKLPLPATEYVPPKPKFWKEFILLNYAMMAS 628

Query: 214 NNALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFV 273
           NNAL+PDPD+ D L+S   +WPI+  GLRM SW D  +K++LLGNP+I W  T +L++  
Sbjct: 629 NNALIPDPDRFDKLSSEWWEWPILNTGLRMNSWGDADIKYFLLGNPLITWISTIALIVCP 688

Query: 274 FTLLYYLIRRQRKYKDLSPAQWDH-----------FLYVGKVCGIGWLLHYLPFCIMGRV 322
             LL   I+ QR++  LS     +                 +   GW+LHY+PF +MGRV
Sbjct: 689 LYLLVVGIKYQRQWILLSATDTSNANPANSQSLSLLAARALLPLAGWVLHYVPFILMGRV 748

Query: 323 TYLHHYFPALYFSMLMAAFMMD--------HFTVSCKPKTKNIIFGIYYSLIVIVFWYFK 374
            YLHHY PALYF++ +A F++D        +     +   K +I+   Y +I I FWYFK
Sbjct: 749 KYLHHYVPALYFAIFVAGFIVDAILNLDFSYHNNKFQYIFKVVIYSTLYLVICISFWYFK 808

Query: 375 DIAFGINYPASELKSRKWLSTWNI 398
           D++FG+   + + +  + L +W I
Sbjct: 809 DLSFGMEGSSVDYRHLRLLGSWMI 832



>gi|354544485|emb|CCE41209.1| hypothetical protein CPAR2_301980 [Candida parapsilosis]
          Length = 766

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 144/411 (35%), Positives = 216/411 (52%), Gaps = 20/411 (4%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    LLHSH + YP GS  QQ++ Y   D NN++ +      ++ +    
Sbjct: 363 GSIVTIRSQGLSPNLLHSHPHSYPEGSGDQQITTYGFKDENNEFEV------ELASGSKL 416

Query: 61  VEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDL 120
            EF+    +I            +  IAAP+T  +FEVS      +      WV+++    
Sbjct: 417 GEFITQDSSIRIKHVKTGYYLGAQPIAAPITKKYFEVSCSPLSNVSFTAHDWVLDIQSQE 476

Query: 121 YTKTN--------RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRD 172
            +++          +  ++T+ R +H  LGC+L      LP WG++Q EV C      +D
Sbjct: 477 ISRSKHFQDENELELHPISTAFRLKHKELGCFLATTGNSLPSWGYQQGEVVCKYPFFSQD 536

Query: 173 SFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKEDILAST 230
             T WN+E H N+ LP+    Y     KF  +F  LN  M  +NNALVPDPDK D L+S 
Sbjct: 537 KTTWWNVEEHRNEHLPTPETEYVPPNPKFWKEFVLLNYGMMASNNALVPDPDKFDKLSSE 596

Query: 231 PRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDL 290
             +WPI+  GLRMC W DD  KF+L+GNP++ W     +V     +L+ L + QR+ ++ 
Sbjct: 597 WWEWPILNTGLRMCGWGDDDTKFFLMGNPVVTWLSNIGIVFGAIYMLFTLFKYQRQCENT 656

Query: 291 SPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVSC 350
                D  +    +  +GW+LHYLPF +MGRV YLHHY PALYF++    F MD      
Sbjct: 657 GILT-DTLIAQCILPILGWVLHYLPFIVMGRVKYLHHYVPALYFAIFSTGFFMDKLAGRN 715

Query: 351 K--PKT-KNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
           +  P+  K +I+ + Y+ IV  FWY KD+AFG+   +   +  K L++W I
Sbjct: 716 RYVPRVFKLVIYIVVYASIVFAFWYLKDLAFGMEGSSKHYRKLKLLNSWMI 766



>gi|344233863|gb|EGV65733.1| PMT-domain-containing protein [Candida tenuis ATCC 10573]
          Length = 784

 Score =  259 bits (663), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 153/427 (35%), Positives = 224/427 (52%), Gaps = 31/427 (7%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +TL++ G    LLHSH + YP GS+QQQV+ Y   D NN+++     +  + N+   
Sbjct: 360 GSLVTLRSQGLSPNLLHSHPHNYPEGSQQQQVTTYGFKDNNNEFVFEFDLQNGLNNHFAT 419

Query: 61  VE-----------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDN 109
           +E            V +G+T+            SH +AA +T  HFEVS Y N    D  
Sbjct: 420 LEADENTTVEYDRLVKDGNTVRLVHSNRGCLLHSHRVAAAITKSHFEVSCYANLANSDSK 479

Query: 110 DYWVIEVI--------DDLYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVE 161
           D WVIE+         D     T+ +  ++T+ R RH +LGCYL       P WGF+Q E
Sbjct: 480 DDWVIEIQGHEKSPSPDFQNEATDELHPISTNFRLRHKVLGCYLATTGKAYPAWGFQQGE 539

Query: 162 VSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVP 219
           V C      +D  T WNIE H N+ LP+    Y   + +F  +F  +N  M  +NNALVP
Sbjct: 540 VICKNTVLKQDKNTWWNIEDHVNEYLPNITTKYVPPKPRFWKEFILINYGMMASNNALVP 599

Query: 220 DPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYY 279
           DP+K D LAS   +WPI+  GLRM SW+ +  K++L+GNP +    T SL +     +  
Sbjct: 600 DPNKYDNLASEWWEWPILRAGLRMGSWSANQAKYFLIGNPAVTLFSTFSLGVLAIYYVVV 659

Query: 280 LIRRQRK---YKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSM 336
           L R QR+   Y+++     +  +    +   GW+LHYLPF +MGRVTYLHHY PA YF+ 
Sbjct: 660 LWRWQRQKLVYQNVFDTNLNQLIAQSILPVSGWILHYLPFILMGRVTYLHHYVPAQYFAT 719

Query: 337 LMAAFMMDHFTVSCKPKTKN-----IIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRK 391
            +A  +++  T+  KP   +     + FGI Y++ V +F Y   ++ G+   A +    K
Sbjct: 720 FVAGCILE--TLIYKPFKNHRVVVWVAFGISYTITVGLFLYLSPLSLGMTTSAKDYNHLK 777

Query: 392 WLSTWNI 398
           + S+W I
Sbjct: 778 FFSSWMI 784



>gi|260947120|ref|XP_002617857.1| hypothetical protein CLUG_01316 [Clavispora lusitaniae ATCC 42720]
 gi|238847729|gb|EEQ37193.1| hypothetical protein CLUG_01316 [Clavispora lusitaniae ATCC 42720]
          Length = 777

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 150/426 (35%), Positives = 226/426 (53%), Gaps = 28/426 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMI-------LKPRK-- 51
           GS +TL++ G    LLHSH ++YP GS+QQQV+ Y + D NN+++I       L  +K  
Sbjct: 351 GSLVTLRSQGLSPNLLHSHNHRYPEGSQQQQVTTYGYKDNNNEFLIEFDLQTSLTEKKFA 410

Query: 52  -----EQMYNNITEVE-FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETL 105
                E+  + +++ E  V +GDTI            SH I A ++  H+EVS YG   +
Sbjct: 411 TLEDEEKQSDFVSDFETLVKDGDTIRLRHAVTGCFLHSHSIPAHISTGHYEVSCYGGVDI 470

Query: 106 GDDNDYWVIEVIDDLYTKT--------NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGF 157
            DD D WV+E+     + +          +  ++++ R RH +LGCYL       P WGF
Sbjct: 471 PDDKDDWVVEIEAQYESPSPAFADEDPELLHPISSNFRLRHKVLGCYLATTGYAYPAWGF 530

Query: 158 KQVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNN 215
           +Q EV C      +D  + WNIE H NDKL      Y   + +F  +F  +N  M  +NN
Sbjct: 531 QQGEVICKNTFLAQDKSSWWNIEDHVNDKLEMPKDQYVAPKPRFWKEFILINYGMMASNN 590

Query: 216 ALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFT 275
           ALVPDPD  D L S   +WPI+  GLRM +W+    ++ L+GN  + +  T  + +    
Sbjct: 591 ALVPDPDHYDKLESQWWEWPILRKGLRMNAWSLSGYRYLLMGNIFVTYFTTVCIPLVCLL 650

Query: 276 LLYYLIRRQRKYKDL--SPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALY 333
           + +  I+ QR+  +L  +  +W+  L  G +  +GW+LHY PF  MGRVTYLHHY PALY
Sbjct: 651 IGFIFIQGQRQAINLNVTGPEWNFLLSAGILPLLGWVLHYWPFIAMGRVTYLHHYVPALY 710

Query: 334 FSMLMAAFMMDHFTVSCKPK-TKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKW 392
           F++ +A F M++       K  K +I+ + Y  I+  F Y+KD  +G+  P  + K    
Sbjct: 711 FAIFVAGFFMEYLVARRANKYLKYVIYLVTYVGIIGSFLYYKDFCWGMTGPLEQYKHLSL 770

Query: 393 LSTWNI 398
           L TW +
Sbjct: 771 LRTWQV 776



>gi|190406792|gb|EDV10059.1| dolichyl-phosphate-mannose-protein mannosyltransferase 6
           [Saccharomyces cerevisiae RM11-1a]
          Length = 759

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 228/414 (55%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIITITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 584

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 585 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 644

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 645 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 704

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 705 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758



>gi|259146701|emb|CAY79958.1| Pmt6p [Saccharomyces cerevisiae EC1118]
          Length = 759

 Score =  257 bits (656), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 228/414 (55%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRRNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 584

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 585 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 644

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 645 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 704

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 705 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758



>gi|323348459|gb|EGA82704.1| Pmt6p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 573

 Score =  257 bits (656), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 228/414 (55%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 160 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 219

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 220 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRXNYEVSGYGSQSVGDEKDDWIVE 279

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 280 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 339

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 340 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 398

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 399 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 458

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 459 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 518

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 519 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 572



>gi|50291669|ref|XP_448267.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527579|emb|CAG61228.1| unnamed protein product [Candida glabrata]
          Length = 730

 Score =  257 bits (656), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 147/418 (35%), Positives = 226/418 (54%), Gaps = 24/418 (5%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNIT- 59
           GS +T+++ G    LLHSH+  YP GS Q+QV+ Y H+D NN+WMI   R    Y +   
Sbjct: 317 GSEVTIRSHGLSPNLLHSHVQLYPDGSRQRQVTGYGHSDGNNNWMIKFGRTTGRYLDEDN 376

Query: 60  -----EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVI 114
                E+  V +GDTI            SH I++ V+  ++EVS YG+E +GD+ D W+I
Sbjct: 377 KRLNGELVPVRDGDTIRLFHVRMGCNLHSHTISSHVSKGNYEVSGYGSEEVGDEKDDWII 436

Query: 115 EVIDDLYTKTNR--------IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDK 166
           E+++ L +            +  ++T  R RH  LGCYL +     P WGF Q E+ C  
Sbjct: 437 EIMEQLDSANTNFGKEDNEVLHPISTMFRLRHKDLGCYLASTGLSYPTWGFHQAEIVCKY 496

Query: 167 NNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKE 224
           +   RD  T WN+E HWND+L    + Y   +SKF  DF  +N AM ++NNALVPD DK 
Sbjct: 497 SWGKRDKSTWWNVEDHWNDQLVVD-EEYVPPKSKFWTDFILINFAMASSNNALVPDEDKY 555

Query: 225 DILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQ 284
           D LAS   +WPI+  GLR+C W+   V++YLLG+P   W  + +L++ +   +   I+ +
Sbjct: 556 DYLASKAWEWPILHKGLRLCGWSSAGVRYYLLGSPFNTWLSSIALLVNILLGMVVAIKWR 615

Query: 285 RKYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMD 344
           R+   ++         +     + WL +++P+ +MGRVTY+HHY PALYF+++    + +
Sbjct: 616 RQSIVINEESCWKLFTLLLFPFLAWLANFMPYVMMGRVTYVHHYMPALYFAIIAFGSITE 675

Query: 345 HFTVS-CKPKTKNIIFGIYYSLI--VIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
           +     C  K     F  + S++    ++WYF  I  G++   S     +WL  W+I 
Sbjct: 676 YLLADYCTVKA----FLAFLSMVGCTYIYWYFAPICQGLHGIGSHYFYLQWLPGWDIA 729



>gi|6321638|ref|NP_011715.1| Pmt6p [Saccharomyces cerevisiae S288c]
 gi|1172543|sp|P42934.1|PMT6_YEAST RecName: Full=Dolichyl-phosphate-mannose--protein
           mannosyltransferase 6
 gi|790490|emb|CAA88992.1| unknown [Saccharomyces cerevisiae]
 gi|1323355|emb|CAA97226.1| PMT6 [Saccharomyces cerevisiae]
 gi|285812392|tpg|DAA08292.1| TPA: Pmt6p [Saccharomyces cerevisiae S288c]
 gi|392299452|gb|EIW10546.1| Pmt6p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 759

 Score =  257 bits (656), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 228/414 (55%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 584

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 585 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 644

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 645 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 704

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 705 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758



>gi|365765461|gb|EHN06969.1| Pmt6p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 632

 Score =  256 bits (655), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 228/414 (55%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 219 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 278

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 279 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRRNYEVSGYGSQSVGDEKDDWIVE 338

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 339 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 398

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 399 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 457

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 458 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 517

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 518 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 577

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 578 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 631



>gi|323354864|gb|EGA86697.1| Pmt6p [Saccharomyces cerevisiae VL3]
          Length = 632

 Score =  256 bits (655), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 228/414 (55%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 219 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 278

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 279 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 338

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 339 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 398

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 399 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 457

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 458 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 517

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 518 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 577

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 578 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 631



>gi|323308951|gb|EGA62182.1| Pmt6p [Saccharomyces cerevisiae FostersO]
          Length = 632

 Score =  256 bits (655), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 228/414 (55%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 219 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 278

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 279 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 338

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 339 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 398

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 399 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 457

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 458 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 517

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 518 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 577

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 578 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 631



>gi|207344990|gb|EDZ71953.1| YGR199Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 640

 Score =  256 bits (654), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 228/414 (55%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 227 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 286

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 287 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 346

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 347 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 406

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 407 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 465

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 466 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 525

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 526 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 585

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 586 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 639



>gi|254585857|ref|XP_002498496.1| ZYRO0G11682p [Zygosaccharomyces rouxii]
 gi|238941390|emb|CAR29563.1| ZYRO0G11682p [Zygosaccharomyces rouxii]
          Length = 719

 Score =  256 bits (654), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 142/413 (34%), Positives = 222/413 (53%), Gaps = 14/413 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRK-----EQMY 55
           GS +T+++ G    LLHSH   YP GS Q QV+ Y   D NN W +  PR      E+ Y
Sbjct: 306 GSLITIRSHGLSPNLLHSHFQTYPEGSNQNQVTGYGFADDNNVWQVRFPRSSELNWEEDY 365

Query: 56  NNITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
                  ++ +G  I            +H I + V+  ++EVS YG+E +GD  D W++E
Sbjct: 366 LPDEGSGYITDGSVIRLFHNQQKVNLHTHRIPSHVSRGNYEVSGYGSEEIGDLKDDWIVE 425

Query: 116 VI------DDLYTKTN--RIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++      D  Y K N   +  ++T  R R+  LGCYL +     P+WGF+Q E+ C  +
Sbjct: 426 IVRQTDSSDPDYPKENYDELHPVSTFFRLRNKELGCYLTSTGFSYPKWGFQQAEIVCKHS 485

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY-RSKFLHDFWHLNVAMYTTNNALVPDPDKEDI 226
            +  D  T WN+E HWN+ LP     +  +S+F  DF  +N AM ++N+ALV D DK D 
Sbjct: 486 WSKHDKSTWWNVEEHWNENLPIDTDWHPPKSRFWTDFVMINFAMASSNSALVEDHDKFDN 545

Query: 227 LASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRK 286
           LA+   +WP +  GLRMCSW+ D  +++L+G+P   W  T SL +F+      L + +R+
Sbjct: 546 LATDAWEWPTLHRGLRMCSWSKDSYRYFLMGSPFNTWLSTLSLFVFLAITAKLLYQWKRQ 605

Query: 287 YKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHF 346
            K ++ + +  F+  G +    W+ HYLPF +MGRVTY+HHY PALYF++L+  F++D  
Sbjct: 606 TKPMTESTFWEFIIQGVMPFTAWVTHYLPFVVMGRVTYVHHYLPALYFAILIFGFVVDRL 665

Query: 347 TVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
             S     K  ++   +   +  + YF  I  G+    ++    +WL +W++ 
Sbjct: 666 LRSSFNWIKYPVYIALFGGCIKTYTYFSPICQGMTGMWTDYIYLEWLKSWDMA 718



>gi|151943475|gb|EDN61786.1| dolichyl phosphate-D-mannose:protein O-D-mannosyltransferase
           [Saccharomyces cerevisiae YJM789]
          Length = 759

 Score =  256 bits (653), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 227/414 (54%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 584

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 585 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 644

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 645 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 704

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G+    +E    +WLSTW+I 
Sbjct: 705 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMYGDKAEYLPLQWLSTWDIA 758



>gi|6561139|gb|AAF16867.1|AF104916_1 protein mannosyltransferase [Candida albicans]
          Length = 826

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/423 (35%), Positives = 222/423 (52%), Gaps = 46/423 (10%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITE 60
           GS +T+++ G    L+HSH + YP GS++QQV+ Y   D NN+++        + N    
Sbjct: 389 GSLVTIRSQGLSPNLIHSHPHNYPQGSQEQQVTTYGFKDDNNEFLFEFGVDAGLRNQHAT 448

Query: 61  VE-----------------FVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNE 103
           +E                  +++GDT+            ++ + AP+T+  +EVS +G+ 
Sbjct: 449 LENENSTRNGGNDDDYYHVIIHDGDTVRINHKNTGSYLRANAVGAPITSSSYEVSCFGDV 508

Query: 104 TLGDDNDYWVIEVI------DDLYTKTN--RIRSLTTSMRFRHSLLGCYLRAANAILPQW 155
              D  D WVIE+       D ++   +   I S++TS R +H  LGCYL       P W
Sbjct: 509 ESNDWADEWVIEIQSQDQSPDPMFQDEDPSEIHSVSTSFRLKHKQLGCYLATTGKSYPAW 568

Query: 156 GFKQVEVSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTT 213
           G++Q EV C  +   RD  T WNIE+H NDKLP     Y   + KF  +F  LN AM  +
Sbjct: 569 GYQQGEVVCKYSVFSRDKNTWWNIEKHVNDKLPLPATEYVPPKPKFWKEFILLNYAMMAS 628

Query: 214 NNALVPDPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFV 273
           NNAL+PDPD+ D L+S   +WPI+  GLRM SW D  +K++LLGNP+I W  T +L++  
Sbjct: 629 NNALIPDPDRFDKLSSEWWEWPILNTGLRMNSWGDADIKYFLLGNPLITWMSTIALIVCP 688

Query: 274 FTLLYYLIRRQRKYKDLSPAQWDH-----------FLYVGKVCGIGWLLHYLPFCIMGRV 322
             LL   I+ QR++  LS     +                 +   GW+LHY+PF +MGRV
Sbjct: 689 LYLLVVGIKYQRQWILLSATDTSNANPANSQSLSLLAARALLPLAGWVLHYVPFILMGRV 748

Query: 323 TYLHHYFPALYFSMLMAAFMMD--------HFTVSCKPKTKNIIFGIYYSLIVIVFWYFK 374
            YLHHY PALYF++ +A F++D        +     +   K +I+   Y +I I FWYFK
Sbjct: 749 KYLHHYVPALYFAIFVAGFIVDAILNLDFSYHNNKFQYIFKVVIYSTLYLVICISFWYFK 808

Query: 375 DIA 377
           D++
Sbjct: 809 DLS 811



>gi|256271480|gb|EEU06529.1| Pmt6p [Saccharomyces cerevisiae JAY291]
          Length = 759

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 153/414 (36%), Positives = 228/414 (55%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++N+ALVPD DK D
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNSALVPDEDKYD 584

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 585 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 644

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 645 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 704

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I+   +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 705 TLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758



>gi|349578404|dbj|GAA23570.1| K7_Pmt6p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 759

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 154/414 (37%), Positives = 227/414 (54%), Gaps = 16/414 (3%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE--QMYNNI 58
           GS LT+++ G    LLHSHI  YP GS Q+Q++ Y   D NN W     R    ++  N 
Sbjct: 346 GSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNG 405

Query: 59  T---EVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIE 115
           T   ++  + +G  +            SH++ + V+  ++EVS YG++++GD+ D W++E
Sbjct: 406 TLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVE 465

Query: 116 VIDDL------YTKTNR--IRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKN 167
           ++  +      Y+  N   +  ++T  R RH +LGCYL +     P WGFKQ E+ C  +
Sbjct: 466 IVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDS 525

Query: 168 NNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVPDPDKED 225
            + RD  T WN+E HWN  L +  + Y   +S F  DF   N AM ++NNALVPD DK D
Sbjct: 526 WSRRDKSTWWNVEDHWNHNLETA-EDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYD 584

Query: 226 ILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQR 285
            L+S   +WP +  GLRMCSWA  + ++YL+G+P   W  T SL+IF F +L+ L R +R
Sbjct: 585 SLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRR 644

Query: 286 KYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDH 345
           +   LS  Q       G    I W+ HYLPF +MGRVTY+HHY PALYF+ML+  F++D 
Sbjct: 645 QTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDF 704

Query: 346 FTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIV 399
                    K  I    +   + ++  F  I  G++   +E    +WLSTW+I 
Sbjct: 705 TLTRVHWMVKYPIHLSLFGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758



>gi|385302605|gb|EIF46729.1| dolichyl-phosphate-mannose-protein mannosyltransferase 2 [Dekkera
           bruxellensis AWRI1499]
          Length = 778

 Score =  254 bits (649), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 149/419 (35%), Positives = 218/419 (52%), Gaps = 28/419 (6%)

Query: 4   LTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYNNITEVEF 63
           +T+++ G    LLHSH   YP GS Q QV+ Y + D NN W     R++  Y      ++
Sbjct: 334 VTIRSQGPSPNLLHSHPQLYPDGSNQHQVTTYGYKDTNNVWTFRPAREDWSYT-----DY 388

Query: 64  VNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVIDDLYTK 123
           + + D I            SHEI + V+   +EVS YG+E +GD+ D WV EV+D +++ 
Sbjct: 389 LKDSDIIRLKHTNTAANLHSHEIHSHVSPEFYEVSGYGDEAIGDEKDDWVFEVMDQIHSS 448

Query: 124 T--------------NRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNN 169
                          + I  ++TS R RH  LGCYL       P WGFKQ EV C K   
Sbjct: 449 NTTYVNVNEQDPEYFDYIHPVSTSFRLRHKYLGCYLATTGKAYPAWGFKQGEVIC-KPAA 507

Query: 170 PRDSF-------THWNIERHWNDKLPSGGK-SYYRSKFLHDFWHLNVAMYTTNNALVPDP 221
           P+DSF       T WNIE      +P   +  Y +S FL DF     AM  +NN L+PD 
Sbjct: 508 PKDSFRARFDKSTWWNIESVEKSNVPVDHEYKYPKSSFLDDFLMTQRAMMASNNGLIPDD 567

Query: 222 DKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLI 281
           DK+D+++S+  +WP++  G+RM SW+    ++Y+  +P + WS TA++++FV  +L   I
Sbjct: 568 DKDDVISSSWWEWPLLRGGIRMSSWSSYERRYYMFDSPFVMWSTTAAVLVFVLIMLRLAI 627

Query: 282 RRQRKYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAF 341
             QR+   L  +     L  G    + W +HYLPF IMGRVTY HHY PALYF++ +AAF
Sbjct: 628 LWQRQTLFLDESTTSRLLITGVAPFLAWFIHYLPFIIMGRVTYFHHYTPALYFAVFVAAF 687

Query: 342 MMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNIVD 400
           ++D+ T       K  I+   YS+++  F+ F   A G+       K   W   W + +
Sbjct: 688 VVDYLTHGFNKYLKASIYISLYSMLLYFFYLFGPTALGMTGRVDSYKYINWFXEWTMSE 746



>gi|157137169|ref|XP_001663919.1| mannosyltransferase 1, putative [Aedes aegypti]
 gi|108869779|gb|EAT34004.1| AAEL013732-PA, partial [Aedes aegypti]
          Length = 685

 Score =  254 bits (649), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 159/413 (38%), Positives = 213/413 (51%), Gaps = 31/413 (7%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGG--SEQQQVSCYHHNDINNDWMILKPRKEQMYNNI 58
           G+ +TLKN   GGG LHSH + YP G  ++QQQV+ Y H D NN W+I KP  +Q  +N+
Sbjct: 287 GAVVTLKNHKTGGGYLHSHNHLYPKGFGAKQQQVTTYSHKDENNKWLI-KPYNKQTVDNV 345

Query: 59  TEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDNDYWVIEVID 118
           T    V +GD I            SH   APVT  H +V+ YG E  GD ND W +++I 
Sbjct: 346 T---LVKHGDLIRFEHIQTKRNLHSHREQAPVTKKHMQVTCYGEEGQGDSNDVWQVQIIG 402

Query: 119 DLYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDSFTHWN 178
                 + + ++T+ + F H +  C L      LP+WGF+Q EV+C  N N RD    WN
Sbjct: 403 G--KDGDIVETVTSRLIFYHYIERCVLTTTAKQLPKWGFEQQEVTC--NPNIRDRSAVWN 458

Query: 179 IERHWNDKLPSGGKSYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTPRQWPIVE 238
           +E +  DKLPS     Y   F+  F+  +  M   N+ L P   KE  + S P QWPI  
Sbjct: 459 VEDNQFDKLPSVNFQVYAPGFISRFFESHAVMLQGNSGLKP---KEGEVTSRPWQWPINY 515

Query: 239 VGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLSPAQ---- 294
            G +  S +D  V  YLLGNPIIWWS    L +F+   L  +I+ QR        Q    
Sbjct: 516 RG-QFFSGSDHRV--YLLGNPIIWWSNLVFLGLFIIVFLVEVIKYQRNLGSQQSGQTNST 572

Query: 295 -----WDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTVS 349
                W        + G GWLLHYLPF  MGRV Y HHYFPAL F+ ++A  M+D+ TV 
Sbjct: 573 VEEFKWRSLRASAWLFG-GWLLHYLPFYAMGRVLYFHHYFPALVFNSMLAGVMLDYLTVK 631

Query: 350 CKPKTKNIIFGIYYSLIVIVFWYFKDIAFGIN-----YPASELKSRKWLSTWN 397
                ++ I G+  + +V  F  F  +A+G+N      P S L   KW+ TW 
Sbjct: 632 LPSWLRHTILGVALAALVYSFALFSPLAYGMNGPFSHEPNSTLSGLKWMDTWE 684



>gi|459366657|gb|EMG45940.1| hypothetical protein G210_3836 [Candida maltosa Xu316]
          Length = 758

 Score =  254 bits (648), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 153/419 (36%), Positives = 222/419 (52%), Gaps = 30/419 (7%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKEQMYN---- 56
           GS +TL++ G    LLHSH + YP GS++QQV+ Y   D NN+++I       + N    
Sbjct: 349 GSLITLRSQGLSPNLLHSHGHNYPEGSQEQQVTTYGFKDDNNEFLIEFDVTHGLANQHAT 408

Query: 57  -------NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHFEVSAYGNETLGDDN 109
                  +I  +E V +GDTI            ++ I APV+  ++EVS +G     D  
Sbjct: 409 LVDENSTDIYHIE-VKDGDTIRLNHRKTGSYLRANAINAPVSTNNYEVSCFGEIESNDYI 467

Query: 110 DYWVIEVI--------DDLYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVE 161
           D WVIEV         D        I  ++T+ R RH  LGCYL    +  P WG+ Q E
Sbjct: 468 DEWVIEVQVQEKSPSPDFQNEDETSIHPVSTNFRLRHKQLGCYLSTTGSAYPAWGYNQGE 527

Query: 162 VSCDKNNNPRDSFTHWNIERHWNDKLPSGGKSYY--RSKFLHDFWHLNVAMYTTNNALVP 219
           V C  +   RD  T WN+E+H NDKLP     Y   + KF  +F  LN  M   N AL+P
Sbjct: 528 VVCKYSIFNRDKNTWWNVEKHMNDKLPDPETEYVPPKPKFWKEFILLNYGMMAANGALLP 587

Query: 220 DPDKEDILASTPRQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYY 279
           DPD+ D L+S   +WPI+  GLRMC W +  +KF+LLGNP+I W  T  L +F    L  
Sbjct: 588 DPDRFDKLSSEWWEWPILHTGLRMCGWGESDIKFFLLGNPLITWLSTLGLGLFAVYCLVV 647

Query: 280 LIRRQRKYKDLSPAQWDHFLYVGKVCGIGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMA 339
             + QR+Y+       D F + G +  + WLL+Y+PF +MGRV Y+HHY PA YF++ + 
Sbjct: 648 GFKYQRQYE----VSGDKF-FQGLIIFMAWLLNYVPFILMGRVKYIHHYLPAQYFAIFLF 702

Query: 340 AFMMDHFTVSCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWNI 398
            F++D        + + +++G+ Y  ++  F YFKD++FG+   +      K L++W I
Sbjct: 703 GFILDRINFG---RLRWVVYGVLYVGVIATFIYFKDLSFGMEGSSKNYSYLKLLNSWMI 758



>gi|389744218|gb|EIM85401.1| glycosyltransferase family 39 protein [Stereum hirsutum FP-91666
           SS1]
          Length = 767

 Score =  253 bits (645), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 145/409 (35%), Positives = 219/409 (53%), Gaps = 27/409 (6%)

Query: 1   GSRLTLKNMGFGGGLLHSHINQYPGGSEQQQVSCYHHNDINNDWMILKPRKE----QMYN 56
           GS ++++++   GG LHSH + YPGGS QQQ++ Y H D NNDW IL   ++      + 
Sbjct: 361 GSTVSIRHVNTQGGYLHSHAHNYPGGSMQQQITLYPHGDENNDWRILNGTEQGNPLDDWE 420

Query: 57  NITEVEFVNNGDTIXXXXXXXXXXXXSHEIAAPVTNVHF--EVSAYGNET-LGDDNDYWV 113
           ++  + F+ NG  +            SH+   PV+ V F  EVSAYG    +GD ND W+
Sbjct: 421 SLNPLRFITNGQRLKFRHLTTEKNLHSHDFRPPVSEVEFQNEVSAYGMPGFVGDSNDDWI 480

Query: 114 IEVIDDLYTKTNRIRSLTTSMRFRHSLLGCYLRAANAILPQWGFKQVEVSCDKNNNPRDS 173
           IE+  D   KT  +++L T  R RH L GCYL +    LPQWG++Q EV+C+KN    +S
Sbjct: 481 IEL--DGGAKT--LKTLRTKFRLRHVLTGCYLFSHKVKLPQWGYEQQEVTCNKNAVKANS 536

Query: 174 FTHWNIERHWNDKLPSGGK--SYYRSKFLHDFWHLNVAMYTTNNALVPDPDKEDILASTP 231
              W IE   +  +P+  K  +Y +  FL  FW L   M+TTN  L     +     S P
Sbjct: 537 L--WMIETSDHPYMPTNAKKVNYRQMGFLAKFWELQQVMWTTNAGLT----ERHTFDSRP 590

Query: 232 RQWPIVEVGLRMCSWADDVVKFYLLGNPIIWWSGTASLVIFVFTLLYYLIRRQRKYKDLS 291
             WP +  G+    W  D  + YLLGNP++WW  TA+++ +     + ++R++R Y+D  
Sbjct: 591 DSWPTLRRGINF--WVKDHRQVYLLGNPMVWWLSTAAVLAYTSVRGFLILRQKRGYRDFE 648

Query: 292 PAQWDHFLYVGKVCG---IGWLLHYLPFCIMGRVTYLHHYFPALYFSMLMAAFMMDHFTV 348
             +    +    +CG   +GW LHYLPF +M R  +LHHYFPALYF++L+   + D  T 
Sbjct: 649 NTK---VVKYDSLCGFLFLGWALHYLPFYLMSRQLFLHHYFPALYFAILLLCSVFDFLTS 705

Query: 349 SCKPKTKNIIFGIYYSLIVIVFWYFKDIAFGINYPASELKSRKWLSTWN 397
           + +P+ +  I      L V  +W F  + +G  +   +    KW+ TW+
Sbjct: 706 TLRPRLRLQIAVFLVVLAVWNYWIFSPLVYGGQWTKGKCLEAKWVKTWD 754